2L9JA

Hrsv m2-1 core domain structure
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
119
structure length
119
Chain Sequence
EISGAAELDRTEEYALGVVGVLESYIGSINNITKQSACVAMSKLLTELNSDDIKKLRDNEEPNSPKIRVYNTVISYIESNRKNNKQTIHLLKRLPADVLKKTIKNTLDIHKSITINNPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and functional analysis of the RNA- and viral phosphoprotein-binding domain of respiratory syncytial virus M2-1 protein.
pubmed doi rcsb
source organism Human respiratory syncytial virus
molecule tags Viral protein, transcription
molecule keywords Matrix protein 2-1
total genus 28
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-02-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1350 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2l9jA00
4CS9C 4C3DA 4CS7A 4CSAC 4CSAA 4C3BA 4CS8A 2L9JA 4CS8C 4C3EA 4CS9A
chains in the Genus database with same CATH superfamily
1SR2A 2R7QA 4O7GA 4XPXA 2OJED 3EHMA 3I5PA 4NTBA 2AU5A 2DI3A 2R9RB 3HJCA 4PJJA 1G4WR 1CGOA 1OR3A 1XZQA 1ZHZA 3IQ5A 2Q9AA 4JTAB 1OKKA 5KYWA 2IYLD 3LNMB 4BPMA 3EZHA 4EBJA 4OINF 2NSGA 1R4TA 4ANJA 5A6JA 2XS8A 5B3SC 4IGGA 4E7SA 1FAPB 2CDQA 5D92A 3VRCA 3EFOB 4RBNA 2EIKC 5DLJA 1WATA 5F5FA 4JTCB 1G4US 3JSZA 1E85A 4JC7A 1W2WA 4BEMJ 2YWAA 1RJ9B 2EPLX 2LIGA 2KW3C 3ZSUA 5L0JA 1AUEA 3K6BA 5JP7A 4DJ9A 3ZWIA 1UFBA 4CBEA 4CS9C 2AP3A 3RIPA 4JE9A 2LFFA 3V7OA 2ZPAA 4MVUA 1HE9A 3I5QA 2LFDA 3ZTMA 4JTDB 3S9OA 2DGJA 3EH2A 3V5XA 4EBBA 4ER9A 1YZCA 2HJMA 3W2VA 2R7SA 1J8YF 2HUJA 2XLWA 5KYUA 1V4AA 1WGWA 2B0HA 3SXYA 4G7HF 2A68F 2IXMA 1AVOB 1DOVA 5CI9A 4U5HA 2IXPA 1Q0GA 2Q9BA 3QW0A 4EIYA 3FXHA 3SXKA 1TKNA 1TR2A 1WOLA 4XPYA 3FAJA 2HS5A 1IZMA 4MW3A 3C8GD 3GWLA 4HE8D 1Y4CA 1MMAA 4Z9IA 1K40A 1ZZPA 3GEHA 3MFNA 3GM2A 4RDAA 2ETSA 1M2VA 3LJBA 4ULVA 4XLNF 5A6AA 1DOWA 3NYMA 4E17A 4BJ6A 4ONSA 4ZLDA 3CSKA 3AQBA 4EKWA 1H9TA 1TWHA 3ASOC 1C03A 3B9QA 3JRTA 1M57C 2MHRA 1MNEA 1NFNA 1YYJA 1CPQA 1M6TA 1I4YA 4BG0A 3W8IA 3EFOA 4PFOA 4IJJA 1FFHA 1CGNA 2O9XA 4MNDA 4J7YA 2EPKX 1Z7Qc 4FESA 3RKOF 3DE8A 3Q6NA 2YQYA 1Z5ZA 2KJGA 3UMHA 4CX9A 1APCA 3JZ0A 1XZPA 2R25A 3AG2C 4IAQA 4CS8C 4EWCA 5CIVA 2ZD9A 2YLDA 5COFA 3EG9A 3GM1A 5EHHA 2J8WA 2A6HF 2X0CA 4MVZA 1QZXA 1G8XA 3HNKA 2FAPB 4H4KC 5FZTA 3CZ6A 2XLEA 3W8HA 5BQGA 4PJLA 1FTSA 4U9DA 4OIRF 4B6IA 3UGPA 5KYNA 3IQ6A 3B0UX 1OW6A 2R7VA 4PJMA 2JPUA 2GAQA 1YZAA 2L6FA 2WZFA 2CNWA 2G3KA 1EA8A 2XLDA 3PHF2 3T6JA 3U9JA 3DKAA 3DJNB 2OKUA 3H2UA 3SP1A 2EPOA 3FVYA 2JD3A 4IARA 3DWWA 3VM6A 256BA 3WAQA 2YHSA 1A7VA 3T4RA 1Z23A 3H65A 4JVSA 1D1BA 4JJGA 1E84A 3ZVRA 3NYLA 3GM3A 4FAPB 1V55C 3BRJA 3NYJA 3PMRA 3DD7A 4JKVA 1VMAA 3LAYA 1Z3IX 1I4ZA 4XPWA 3S29A 5DQZA 3RH3A 5JVEA 3AG3C 3JCUQ 1IW7F 1ZVZA 2V3CC 1ZHYA 1HW2A 1VLSA 2M4EA 1S7ZA 1WWPA 2GWWA 3C62A 3AJMA 3EGXB 1S05A 1JOGA 2ZXRA 3HLZA 2Y69C 3KH2A 4GQHA 3WHNA 1YVIA 4X0RA 5DS5A 3FAPB 1VYIA 2D4UA 2H7VC 1D1CA 4DRJB 1G5ZA 5E33A 1RKCA 2G62A 3UGOA 4LERA 4CSAA 1Z6AA 1BDJB 1A0BA 3DZAA 4MW8A 2AVKA 4U5FE 3B0PA 1QVXA 4DRHB 4E7ZA 3US6A 4Q5SF 2WVOA 2NUPB 4YL1A 3ZQVA 2Q4FA 1RCPA 3U9MA 2IXNA 4O6MA 4D4NA 4YT5A 1PD0A 2BC5A 4OIOF 3POVA 2YLIA 4U5BE 1VTMP 3L34A 1FMWA 4AE4A 3K33A 3HNJA 1M2OA 4MTGA 4U9EA 4N6CA 5EK0A 4CS8A 1GS9A 2R7TA 1YA7O 2NPUA 3J06A 1RMVA 1YARO 4PR9A 3LS1A 1Q0MA 1VK5A 2YKZA 1JMWA 2J46A 2Y3DA 4BEJA 3KYJA 3IQTA 1BZ4A 3C7JA 3F46A 5T1DB 4DRIB 2OU6A 4CS7A 3Q7LA 1KNYA 5TJ5E 5KYXA 1RXQA 1YA9A 2J45A 4M63A 5A6BD 4Q4ZF 1MMDA 1CPRA 1I5NA 2ASRA 3OA1A 4IB4A 3ZG1A 5BQIA 5L0CA 3IPMO 1XWJA 4BJTA 1AEPA 1VLTA 2J9WA 2L7AA 1ZU4A 2XL4A 1C02A 2EIJC 2XSEA 5DS6A 3EZIA 3I4UA 5EGYA 1LE2A 4I44A 2KSFA 2XLVA 4EUKB 2R7OA 3AG1C 2OEVA 1K05A 3DMDA 2R7RA 4YWQA 2DYRC 1QPUA 3X2QC 3L0IA 2CCYA 3E9VA 3ZIBA 3S84A 4CJGA 1UG7A 3FMSA 2BL2A 5K0IA 4G78A 2P61A 2L9JA 3DXJF 3JRMO 4CS9A 2D5RB 3K7DA 2PF4E 3K1IA 4NY3A 5A6KA 4CDYA 5E3AA 4LDQA 3CQZA 1LVKA 5JT4A 3O55A 4AE4B 3C63A 2YLGA 4MTFA 5L3QA 2AWCA 2Y3GA 2YL3A 3GODA 4KNWA 5JUAA 4JZAA 2RSEB 3ASNC 2DB4A 3KMIA 4OD5A 1E83A 1U89A 4KI2A 4C7OB 1E2XA 4YJWA 5D91A 3TD7A 2IOQA 1MQVA 3ITFA 3M4BA 2XS1A 1Q0FA 2XM4A 2AWYA 4WGYA 4DVYP 2A0UA 3FOPA 1HE1A 1MMNA 2HKVA 1NFOA 2PP4A 3DJUB 3QZCA 3O10A 4WGZA 2XM0A 3QVYA 3AGUA 1OCOC 2W4MA 1NG1A 2Y3BA 1NU7D 2HZ8A 3UNGC 3N24A 1OCRC 2XLHA 2LSEA 2YZSA 1OW8A 3CAXA 3AQCA 1H6GA 1TFOB 2HJ3A 4CDAA 4MTOA 2OJQA 4P9FA 2PNOA 3ZDLA 5AC4A 1FFTC 2PX3A 5HV9A 1YDIA 4OIQF 2KQ9A 4E0IA 1Q0DA 3AGTA 4XWJA 1T5OA 3N0TA 4O6YA 3S0XA 1LI7A 4H54A 2EILC 4Q7CA 2CNWD 4MS2A 5B3IA 1ZW3A 3IHUA 4I3MA 4BJ5C 4GYTA 1Q0KA 2XL6A 1N1CA 3U8VA 4LLCA 3V5YA 2EINC 3MBGA 3HNLA 4P9TA 4DBQA 3GEEA 4XLPF 1KU2A 3JTLO 3S28A 1Z63A 2ICWG 1H7IA 1VYKA 3EGXA 1NBBA 2KK1A 3GORA 5T3TA 2VC9A 3HNIA 3JT1A 2A1DD 1OKKD 2HSBA 2OOCA 4RD9A 3SZRA 1PD1A 4C3BA 5L0GA 3SEOA 3VAYA 4Z9HA 1HW1A 3EPVA 3DAFA 2LQGA 3NMJA 3JSEO 3PCVA 4QI0A 3EQLF 4QDLA 2R7WA 4G7ZF 4C7OA 1LS4A 1L3PA 2IXOA 3ABKC 4E18A 2C03A 3AG4C 1C17M 1OCZC 4JURI 3DI5A 2YRFA 4WJ0A 5E3CA 4NCQA 2IM8A 1EKYA 2I8BA 4CJOA 2JX0A 3G50A 3ZQYA 3C8ZA 1ORSC 3LUTB 2XL8A 4JEBA 3SNHA 1WASA 4PFPA 4DVZA 3RQEA 3TJ6A 3L8IA 3C18A 4L6RA 2WZLA 4HFFB 5BUOA 2NSFA 2QY9A 3EH1A 5FCLA 2TMVP 2OEXA 4IWBA 4CIPA 1VB5A 1NU9C 3KPHA 1YYXA 3DM5A 1PV3A 3LLKA 2XXAB 1LE4A 4K1OA 3LEVA 4XEKA 2B0JA 1TWGA 1YLMA 5L0HA 4J7TA 2LD6A 1FNTc 4KC9A 4LDRA 1K04A 1LM3B 2NG1A 3A9CA 5DS4A 5CI8A 1SMYF 4I1OB 4N06A 4AX2A 2EPNA 3X1OA 3MYFA 2PFDA 2XXAA 5L3VA 4YT8A 1LIHA 1NZEA 4A4AA 2YEVA 4PK4A 5HSWA 3B0VC 4JEAA 3T6BA 3GWNA 3ZTZA 1HY5A 3RF3A 4A2NB 2P1AA 2Q00A 1T01A 4NC3A 5GPGB 4JCHA 4YT2A 2YVKA 3GEIA 5A69A 3DAGA 3EJNA 4XQ1A 4LDKA 1NLXA 3RQFA 3ABLC 2M64A 1FR0A 2UUHA 1O3UA 2I15A 3M15A 3EG9B 3OEOA 2Y3HA 3LESA 4DXWA 3QVZA 3C8GB 3RVZA 4NQFA 2HV6A 1QQ3A 1SF8A 2J7PA 3GANA 3V5ZA 1JRAA 2EPMX 3TJ5A 1NSGB 4QI2A 1ZU5A 1JAFA 1V74B 2C04A 2PX0A 3R7CA 5COGA 4OD4A 2EIMC 2DYSC 4AL0A 3EGDA 5F28E 3Q7GA 4FWVA 2HMZA 1QSPA 1J8MF 3K1IC 3C8GA 4W8PA 2L6HA 2WVQA 1U6HA 3VF0A 1D0ZA 2Z15A 2F22A 1HMOA 1SYQA 2CYDA 1OW7A 5KYYB 3TULA 1RJ9A 2XLMA 4N6HA 2LP4A 3CEXA 4BJ1A 2LCHA 3LS0A 3U8PA 2MWQA 3NG1A 3TK0A 3UMKA 1U0BB 2WZGA 3G4ZA 1WN0A 2G3VA 3AOUA 1T9KA 3ABMC 1SZIA 4HFKB 4IRUA 3FDQA 1FMVA 2VASA 3DM9B 4K7BA 1LS1A 4YN0B 4LACB 4ULWA 1OXBA 1ZW2A 2NUTB 3KL4A 4BJ6C 1MNDA 4XEVA 2R02A 3ECSA 3SXZA 5IY5C 5KYYA 3UR3C 3NDBB 4O6NA 4G0HA 1RKEA 4I1MA 3SXMA 2H7BA 2IBFA 3LNRA 4F4BA 4YL0A 1O87A 4ZLCA 3TOLA 4C3EA 5JLIA 2P7VA 2YL0A 1TQGA 1A7DA 3HKKA 4NTFA 3G4XA 4D4XA 1O5HA 4CDVA 3NKEA 1TWCA 2A69F 2CGEA 2QLAA 3NKDA 1M2VB 3U3BA 3RFYA 1T6QA 1RKEB 2X51A 3KKBA 5A6BA 3ATPA 3FOOA 3IEEA 3MLGA 5T3WA 3VYWA 3WODF 3QMKA 4EHPA 2J7PD 4MVRA 1V54C 3FHDA 4WABA 3S27A 3NMKA 3L1MA 5AGFA 5F5HA 3U2LA 4E0HA 5AC5A 1TWAA 2HV7A 4JJFA 3WG7C 2CW0F 3O39A 2R7UA 4DOZA 1YJGA 5B1BC 3QW1A 2A6EF 3BEHA 4EBKA 4PJNA 4J30B 2Q3TA 1LPEA 4IAOA 1F1MA 3QTHA 3RYLA 1R5ID 1GGQA 1T6IA 2WB7A 1OXKA 1YAUO 2VCAA 1BR4A 4HEAJ 4P6IC 2W4BA 3TQOA 4R32A 3W4YA 1T6UA 2QNLA 2ZXPA 4NTAA 3T9OA 2YL7A 1BBHA 1Y6DA 3S90A 1A7EA 1QKRA 1WTYA 2Q9CA 5JS5A 4CSAC 4AL1A 2ZXWC 1JPJA 3RVYA 5KYXB 1ST6A 2W45A 2XLOA 4GEHA 4U5DE 2R05A 2NUTA 3UMIA 2J0WA 3N2ZB 2YL1A 1EI7A 2J9UA 1H9GA 2KC3A 2HSQA 1L7CA 4MQ9F 4G7OF 2GA0A 3LLIA 5COMA 3K1HA 4JW1A 2E87A 5L0DA 1BR1A 4CIHA 4JRZA 4KBLA 1MMGA 1A41A 2KNHA 3B71A 3F47A 1TFKB 3DE9A 3RW0A 4J32B 2NUPA 1D0XA 2VB6A 2GDCA 3NMIA 2R03A 1ZHXA 2BE5F 2FGYA 3O6XA 2L6GA 1HMDA 1JPNA 2Y39A 3EGDB 1ZHWA 4MVSA 4MVOA 4DBRA 5KYUB 3M79A 3E70C 3U5SA 4U5GA 2FFHA 2V26A 3U2MA 1OCCC 3K66A 1KTMA 1LKXA 5DVWA 2VCCA 2WL8A 5JRAA 2OG2A 2MYSA 1PCXA 4OIPF 1GM5A 2P0NA 1LI5A 1QLEC 4MVMA 2ZXOA 1E86A 3B29A 2HFIA 4YK5A 4U5CE 3R2PA 4Z9JA 5KYWB 4U5EE 3M4CA 3KYIA 3IQCA 4JIOA 4XEFA 3HTKC 2KYHA 2OCCC 3TOMA 2OQMA 4AK9A 1ZYRF 2H8AA 3T6GB 1D1AA 2QTVA 2RD9A 5L0IA 2QUPA 4W8KA 1ORYA 2KGOA 2J9VA 4K0DA 2VH3A 2HMQA 4YT4A 2R7XA 3JYYA 3MYIA 4UDVA 2GFHA 3JYHA 5E2QA 3U3FA 4YL3A 5B1AC 4XTKA 2J0XA 2QE9A 2UUIA 2L81A 2A0BA 4JCZA 1EQ1A 1OQCA 4C3DA 4PACA 3L8JA 2W9YA 1GQAA 2VCBA 1VOMA 2H7OA 2J9BA 1JR8A 5DQTA 5BQHA 3Q6MA 3RQGA 5L0FA 2Q7RA 3U0CA 5JSLA 1BR2A 4KNVA 4LLEA 4MVQA 3ZC4A 2PBEA 3M1CB 3A11A 3SYNA 1ZHTA 3W2WA 1CGME 1ORJA 3MX3A 1OR2A 4O79A 2WVNA 3NRHA 1D0YA 3PDMP 1B68A 1M56C 2XRHA 3OWTA 2P6VA 3LEOA 4N4WA 2LK4A 3H2VA 4BJ5A 4FX5A 3EHNA
chains in the Genus database with same CATH topology
2R7QA 4O7GA 3EHMA 3I5PA 3HJCA 4PJJA 1ZHZA 2Q9AA 1OKKA 5KYWA 2IYLD 3EZHA 4OINF 4ANJA 5B3SC 4E7SA 2CDQA 5D92A 3EFOB 4RBNA 2EIKC 5DLJA 5F5FA 3JSZA 1W2WA 1RJ9B 2KW3C 3ZSUA 3K6BA 4CBEA 4CS9C 3RIPA 3V7OA 2ZPAA 3I5QA 2DGJA 3EH2A 4EBBA 2R7SA 3W2VA 1J8YF 5KYUA 4G7HF 1WGWA 2A68F 2IXMA 5CI9A 4U5HA 2IXPA 2Q9BA 1TKNA 1TR2A 3FAJA 1IZMA 4HE8D 1MMAA 4RDAA 1M2VA 3LJBA 4XLNF 3NYMA 4BJ6A 3CSKA 3AQBA 1TWHA 3ASOC 3B9QA 3JRTA 1M57C 1MNEA 4BG0A 3W8IA 3EFOA 4PFOA 4IJJA 1FFHA 2O9XA 4MNDA 4FESA 3RKOF 3Q6NA 1Z5ZA 2KJGA 3UMHA 4CS8C 3AG2C 4EWCA 3EG9A 5EHHA 2A6HF 1QZXA 1G8XA 4H4KC 3CZ6A 3W8HA 4PJLA 1FTSA 3UGPA 4OIRF 5KYNA 3B0UX 2R7VA 4PJMA 3PHF2 2WZFA 2CNWA 2G3KA 3T6JA 3DJNB 3SP1A 3FVYA 2JD3A 2YHSA 3T4RA 1Z23A 3H65A 4JVSA 1D1BA 4JJGA 3ZVRA 3NYLA 1V55C 3NYJA 3PMRA 3DD7A 1VMAA 3LAYA 1Z3IX 3S29A 5DQZA 3RH3A 3AG3C 3JCUQ 1IW7F 2V3CC 1ZHYA 2M4EA 1S7ZA 3HLZA 3KH2A 3EGXB 2ZXRA 2Y69C 4X0RA 5DS5A 1VYIA 2H7VC 1D1CA 5E33A 3UGOA 2G62A 4CSAA 4LERA 1Z6AA 3DZAA 4U5FE 3B0PA 4E7ZA 4Q5SF 2WVOA 2NUPB 2IXNA 4O6MA 4YT5A 1PD0A 4OIOF 3POVA 4U5BE 3L34A 1FMWA 4AE4A 3K33A 1M2OA 4CS8A 2R7TA 3LS1A 1VK5A 2J46A 2Y3DA 4BEJA 3F46A 5T1DB 4CS7A 3Q7LA 5KYXA 2J45A 4M63A 4Q4ZF 1MMDA 3OA1A 3ZG1A 4BJTA 2J9WA 1ZU4A 2XL4A 2EIJC 2XSEA 5DS6A 3EZIA 5EGYA 4I44A 2R7OA 3AG1C 3DMDA 2R7RA 4YWQA 2DYRC 3X2QC 3L0IA 3E9VA 3ZIBA 2L9JA 3DXJF 4CS9A 2D5RB 3K7DA 2PF4E 4NY3A 5E3AA 3CQZA 1LVKA 4AE4B 5L3QA 2Y3GA 3GODA 4KNWA 4JZAA 4C7OB 3ASNC 3KMIA 4OD5A 4KI2A 4YJWA 5D91A 3TD7A 2IOQA 3ITFA 4DVYP 1MMNA 2PP4A 3QZCA 3DJUB 1OCOC 2W4MA 1NG1A 2Y3BA 1NU7D 3UNGC 3N24A 1OCRC 3I4UA 2LSEA 2YZSA 3AQCA 1FFTC 2PX3A 4OIQF 2KQ9A 4XWJA 3N0TA 4O6YA 3S0XA 2EILC 4Q7CA 2CNWD 4I3MA 4BJ5C 4GYTA 1N1CA 4LLCA 2EINC 4XLPF 1KU2A 3S28A 1Z63A 3EGXA 1VYKA 5T3TA 3JT1A 2A1DD 1OKKD 4RD9A 4C3BA 3SZRA 1PD1A 3SEOA 3VAYA 3EPVA 3DAFA 4QI0A 4QDLA 2R7WA 3EQLF 4G7ZF 4C7OA 2IXOA 3ABKC 2C03A 3AG4C 1OCZC 4JURI 4WJ0A 5E3CA 2I8BA 3SNHA 4DVZA 4PFPA 2WZLA 4HFFB 5BUOA 2QY9A 5FCLA 3EH1A 4IWBA 1NU9C 3DM5A 3LLKA 2XXAB 3LEVA 2B0JA 1TWGA 4KC9A 2NG1A 5DS4A 5CI8A 1SMYF 4I1OB 4N06A 4AX2A 3X1OA 2PFDA 2XXAA 5L3VA 4YT8A 1NZEA 5HSWA 2YEVA 4PK4A 3B0VC 3T6BA 4A2NB 4JCHA 4YT2A 3DAGA 3EJNA 3ABLC 3EG9B 3OEOA 2Y3HA 3LESA 2HV6A 1SF8A 2J7PA 3GANA 4QI2A 1ZU5A 2C04A 2PX0A 4OD4A 2EIMC 2DYSC 3EGDA 3Q7GA 4FWVA 1J8MF 3K1IC 2WVQA 1D0ZA 2Z15A 5KYYB 1RJ9A 4BJ1A 3LS0A 2MWQA 3NG1A 3UMKA 2WZGA 2G3VA 3ABMC 4IRUA 1SZIA 4HFKB 3FDQA 1FMVA 2VASA 3DM9B 4K7BA 1LS1A 4YN0B 4LACB 4ULWA 2NUTB 3KL4A 4BJ6C 5KYYA 1MNDA 3ECSA 5IY5C 3UR3C 3NDBB 4O6NA 4G0HA 4I1MA 2H7BA 3LNRA 4F4BA 1O87A 4ZLCA 4C3EA 2P7VA 1O5HA 3NKEA 1TWCA 2A69F 2CGEA 3NKDA 1M2VB 3RFYA 2X51A 3KKBA 3IEEA 3MLGA 5T3WA 3VYWA 3WODF 3QMKA 2J7PD 1V54C 3FHDA 3S27A 5F5HA 1TWAA 2HV7A 4JJFA 3WG7C 2CW0F 3O39A 2R7UA 4DOZA 5B1BC 2A6EF 4PJNA 4J30B 2Q3TA 4IAOA 3RYLA 4DBQA 2WB7A 1BR4A 4HEAJ 4P6IC 2W4BA 2ZXPA 2Q9CA 4CSAC 2ZXWC 1JPJA 5KYXB 1ST6A 2W45A 4GEHA 4U5DE 2NUTA 3UMIA 2J0WA 3N2ZB 2J9UA 4MQ9F 4G7OF 3LLIA 3K1HA 4JW1A 2E87A 1BR1A 4CIHA 4KBLA 1MMGA 2KNHA 3F47A 4J32B 2NUPA 1D0XA 2VB6A 1ZHXA 2BE5F 2FGYA 3O6XA 1JPNA 2Y39A 3EGDB 1ZHWA 4DBRA 5KYUB 3E70C 4U5GA 2FFHA 2V26A 1OCCC 3K66A 1LKXA 5DVWA 2WL8A 2OG2A 2MYSA 1PCXA 4OIPF 1QLEC 2ZXOA 4U5CE 5KYWB 4U5EE 3HTKC 2OCCC 4AK9A 1ZYRF 1D1AA 2QTVA 4W8KA 2KGOA 2J9VA 4K0DA 2VH3A 4YT4A 2R7XA 2GFHA 3JYHA 5E2QA 5B1AC 4XTKA 2J0XA 2L81A 4C3DA 2W9YA 4ZLDA 1VOMA 2H7OA 5DQTA 3Q6MA 3ZC4A 1BR2A 4KNVA 4LLEA 4B6IA 3M1CB 3SYNA 1ZHTA 3W2WA 3MX3A 4O79A 2WVNA 3NRHA 1D0YA 1M56C 2XRHA 3OWTA 2P6VA 4BJ5A 4FX5A 3EHNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CS9 C;  4C3D A;  4CS7 A;  4CSA C;  4CSA A;  4C3B A;  4CS8 A;  2L9J A;  4CS8 C;  4C3E A;  4CS9 A; 
#chains in the Genus database with same CATH topology
 1SR2 A;  2R7Q A;  4O7G A;  4XPX A;  2OJE D;  3EHM A;  3I5P A;  4NTB A;  2AU5 A;  2DI3 A;  2R9R B;  3HJC A;  4PJJ A;  1G4W R;  1CGO A;  1OR3 A;  1XZQ A;  1ZHZ A;  3IQ5 A;  2Q9A A;  4JTA B;  1OKK A;  5KYW A;  2IYL D;  3LNM B;  4BPM A;  3EZH A;  4EBJ A;  4OIN F;  2NSG A;  1R4T A;  4ANJ A;  5A6J A;  2XS8 A;  5B3S C;  4IGG A;  4E7S A;  1FAP B;  2CDQ A;  5D92 A;  3VRC A;  3EFO B;  4RBN A;  2EIK C;  5DLJ A;  1WAT A;  5F5F A;  4JTC B;  1G4U S;  3JSZ A;  1E85 A;  4JC7 A;  1W2W A;  4BEM J;  2YWA A;  1RJ9 B;  2EPL X;  2LIG A;  2KW3 C;  3ZSU A;  5L0J A;  1AUE A;  3K6B A;  5JP7 A;  4DJ9 A;  3ZWI A;  1UFB A;  4CBE A;  4CS9 C;  2AP3 A;  3RIP A;  4JE9 A;  2LFF A;  3V7O A;  2ZPA A;  4MVU A;  1HE9 A;  3I5Q A;  2LFD A;  3ZTM A;  4JTD B;  3S9O A;  2DGJ A;  3EH2 A;  3V5X A;  4EBB A;  4ER9 A;  1YZC A;  2HJM A;  3W2V A;  2R7S A;  1J8Y F;  2HUJ A;  2XLW A;  5KYU A;  1V4A A;  1WGW A;  2B0H A;  3SXY A;  4G7H F;  2A68 F;  2IXM A;  1AVO B;  1DOV A;  5CI9 A;  4U5H A;  2IXP A;  1Q0G A;  2Q9B A;  3QW0 A;  4EIY A;  3FXH A;  3SXK A;  1TKN A;  1TR2 A;  1WOL A;  4XPY A;  3FAJ A;  2HS5 A;  1IZM A;  4MW3 A;  3C8G D;  3GWL A;  4HE8 D;  1Y4C A;  1MMA A;  4Z9I A;  1K40 A;  1ZZP A;  3GEH A;  3MFN A;  3GM2 A;  4RDA A;  2ETS A;  1M2V A;  3LJB A;  4ULV A;  4XLN F;  5A6A A;  1DOW A;  3NYM A;  4E17 A;  4BJ6 A;  4ONS A;  4ZLD A;  3CSK A;  3AQB A;  4EKW A;  1H9T A;  1TWH A;  3ASO C;  1C03 A;  3B9Q A;  3JRT A;  1M57 C;  2MHR A;  1MNE A;  1NFN A;  1YYJ A;  1CPQ A;  1M6T A;  1I4Y A;  4BG0 A;  3W8I A;  3EFO A;  4PFO A;  4IJJ A;  1FFH A;  1CGN A;  2O9X A;  4MND A;  4J7Y A;  2EPK X;  1Z7Q c;  4FES A;  3RKO F;  3DE8 A;  3Q6N A;  2YQY A;  1Z5Z A;  2KJG A;  3UMH A;  4CX9 A;  1APC A;  3JZ0 A;  1XZP A;  2R25 A;  3AG2 C;  4IAQ A;  4CS8 C;  4EWC A;  5CIV A;  2ZD9 A;  2YLD A;  5COF A;  3EG9 A;  3GM1 A;  5EHH A;  2J8W A;  2A6H F;  2X0C A;  4MVZ A;  1QZX A;  1G8X A;  3HNK A;  2FAP B;  4H4K C;  5FZT A;  3CZ6 A;  2XLE A;  3W8H A;  5BQG A;  4PJL A;  1FTS A;  4U9D A;  4OIR F;  4B6I A;  3UGP A;  5KYN A;  3IQ6 A;  3B0U X;  1OW6 A;  2R7V A;  4PJM A;  2JPU A;  2GAQ A;  1YZA A;  2L6F A;  2WZF A;  2CNW A;  2G3K A;  1EA8 A;  2XLD A;  3PHF 2;  3T6J A;  3U9J A;  3DKA A;  3DJN B;  2OKU A;  3H2U A;  3SP1 A;  2EPO A;  3FVY A;  2JD3 A;  4IAR A;  3DWW A;  3VM6 A;  256B A;  3WAQ A;  2YHS A;  1A7V A;  3T4R A;  1Z23 A;  3H65 A;  4JVS A;  1D1B A;  4JJG A;  1E84 A;  3ZVR A;  3NYL A;  3GM3 A;  4FAP B;  1V55 C;  3BRJ A;  3NYJ A;  3PMR A;  3DD7 A;  4JKV A;  1VMA A;  3LAY A;  1Z3I X;  1I4Z A;  4XPW A;  3S29 A;  5DQZ A;  3RH3 A;  5JVE A;  3AG3 C;  3JCU Q;  1IW7 F;  1ZVZ A;  2V3C C;  1ZHY A;  1HW2 A;  1VLS A;  2M4E A;  1S7Z A;  1WWP A;  2GWW A;  3C62 A;  3AJM A;  3EGX B;  1S05 A;  1JOG A;  2ZXR A;  3HLZ A;  2Y69 C;  3KH2 A;  4GQH A;  3WHN A;  1YVI A;  4X0R A;  5DS5 A;  3FAP B;  1VYI A;  2D4U A;  2H7V C;  1D1C A;  4DRJ B;  1G5Z A;  5E33 A;  1RKC A;  2G62 A;  3UGO A;  4LER A;  4CSA A;  1Z6A A;  1BDJ B;  1A0B A;  3DZA A;  4MW8 A;  2AVK A;  4U5F E;  3B0P A;  1QVX A;  4DRH B;  4E7Z A;  3US6 A;  4Q5S F;  2WVO A;  2NUP B;  4YL1 A;  3ZQV A;  2Q4F A;  1RCP A;  3U9M A;  2IXN A;  4O6M A;  4D4N A;  4YT5 A;  1PD0 A;  2BC5 A;  4OIO F;  3POV A;  2YLI A;  4U5B E;  1VTM P;  3L34 A;  1FMW A;  4AE4 A;  3K33 A;  3HNJ A;  1M2O A;  4MTG A;  4U9E A;  4N6C A;  5EK0 A;  4CS8 A;  1GS9 A;  2R7T A;  1YA7 O;  2NPU A;  3J06 A;  1RMV A;  1YAR O;  4PR9 A;  3LS1 A;  1Q0M A;  1VK5 A;  2YKZ A;  1JMW A;  2J46 A;  2Y3D A;  4BEJ A;  3KYJ A;  3IQT A;  1BZ4 A;  3C7J A;  3F46 A;  5T1D B;  4DRI B;  2OU6 A;  4CS7 A;  3Q7L A;  1KNY A;  5TJ5 E;  5KYX A;  1RXQ A;  1YA9 A;  2J45 A;  4M63 A;  5A6B D;  4Q4Z F;  1MMD A;  1CPR A;  1I5N A;  2ASR A;  3OA1 A;  4IB4 A;  3ZG1 A;  5BQI A;  5L0C A;  3IPM O;  1XWJ A;  4BJT A;  1AEP A;  1VLT A;  2J9W A;  2L7A A;  1ZU4 A;  2XL4 A;  1C02 A;  2EIJ C;  2XSE A;  5DS6 A;  3EZI A;  3I4U A;  5EGY A;  1LE2 A;  4I44 A;  2KSF A;  2XLV A;  4EUK B;  2R7O A;  3AG1 C;  2OEV A;  1K05 A;  3DMD A;  2R7R A;  4YWQ A;  2DYR C;  1QPU A;  3X2Q C;  3L0I A;  2CCY A;  3E9V A;  3ZIB A;  3S84 A;  4CJG A;  1UG7 A;  3FMS A;  2BL2 A;  5K0I A;  4G78 A;  2P61 A;  2L9J A;  3DXJ F;  3JRM O;  4CS9 A;  2D5R B;  3K7D A;  2PF4 E;  3K1I A;  4NY3 A;  5A6K A;  4CDY A;  5E3A A;  4LDQ A;  3CQZ A;  1LVK A;  5JT4 A;  3O55 A;  4AE4 B;  3C63 A;  2YLG A;  4MTF A;  5L3Q A;  2AWC A;  2Y3G A;  2YL3 A;  3GOD A;  4KNW A;  5JUA A;  4JZA A;  2RSE B;  3ASN C;  2DB4 A;  3KMI A;  4OD5 A;  1E83 A;  1U89 A;  4KI2 A;  4C7O B;  1E2X A;  4YJW A;  5D91 A;  3TD7 A;  2IOQ A;  1MQV A;  3ITF A;  3M4B A;  2XS1 A;  1Q0F A;  2XM4 A;  2AWY A;  4WGY A;  4DVY P;  2A0U A;  3FOP A;  1HE1 A;  1MMN A;  2HKV A;  1NFO A;  2PP4 A;  3DJU B;  3QZC A;  3O10 A;  4WGZ A;  2XM0 A;  3QVY A;  3AGU A;  1OCO C;  2W4M A;  1NG1 A;  2Y3B A;  1NU7 D;  2HZ8 A;  3UNG C;  3N24 A;  1OCR C;  2XLH A;  2LSE A;  2YZS A;  1OW8 A;  3CAX A;  3AQC A;  1H6G A;  1TFO B;  2HJ3 A;  4CDA A;  4MTO A;  2OJQ A;  4P9F A;  2PNO A;  3ZDL A;  5AC4 A;  1FFT C;  2PX3 A;  5HV9 A;  1YDI A;  4OIQ F;  2KQ9 A;  4E0I A;  1Q0D A;  3AGT A;  4XWJ A;  1T5O A;  3N0T A;  4O6Y A;  3S0X A;  1LI7 A;  4H54 A;  2EIL C;  4Q7C A;  2CNW D;  4MS2 A;  5B3I A;  1ZW3 A;  3IHU A;  4I3M A;  4BJ5 C;  4GYT A;  1Q0K A;  2XL6 A;  1N1C A;  3U8V A;  4LLC A;  3V5Y A;  2EIN C;  3MBG A;  3HNL A;  4P9T A;  4DBQ A;  3GEE A;  4XLP F;  1KU2 A;  3JTL O;  3S28 A;  1Z63 A;  2ICW G;  1H7I A;  1VYK A;  3EGX A;  1NBB A;  2KK1 A;  3GOR A;  5T3T A;  2VC9 A;  3HNI A;  3JT1 A;  2A1D D;  1OKK D;  2HSB A;  2OOC A;  4RD9 A;  3SZR A;  1PD1 A;  4C3B A;  5L0G A;  3SEO A;  3VAY A;  4Z9H A;  1HW1 A;  3EPV A;  3DAF A;  2LQG A;  3NMJ A;  3JSE O;  3PCV A;  4QI0 A;  3EQL F;  4QDL A;  2R7W A;  4G7Z F;  4C7O A;  1LS4 A;  1L3P A;  2IXO A;  3ABK C;  4E18 A;  2C03 A;  3AG4 C;  1C17 M;  1OCZ C;  4JUR I;  3DI5 A;  2YRF A;  4WJ0 A;  5E3C A;  4NCQ A;  2IM8 A;  1EKY A;  2I8B A;  4CJO A;  2JX0 A;  3G50 A;  3ZQY A;  3C8Z A;  1ORS C;  3LUT B;  2XL8 A;  4JEB A;  3SNH A;  1WAS A;  4PFP A;  4DVZ A;  3RQE A;  3TJ6 A;  3L8I A;  3C18 A;  4L6R A;  2WZL A;  4HFF B;  5BUO A;  2NSF A;  2QY9 A;  3EH1 A;  5FCL A;  2TMV P;  2OEX A;  4IWB A;  4CIP A;  1VB5 A;  1NU9 C;  3KPH A;  1YYX A;  3DM5 A;  1PV3 A;  3LLK A;  2XXA B;  1LE4 A;  4K1O A;  3LEV A;  4XEK A;  2B0J A;  1TWG A;  1YLM A;  5L0H A;  4J7T A;  2LD6 A;  1FNT c;  4KC9 A;  4LDR A;  1K04 A;  1LM3 B;  2NG1 A;  3A9C A;  5DS4 A;  5CI8 A;  1SMY F;  4I1O B;  4N06 A;  4AX2 A;  2EPN A;  3X1O A;  3MYF A;  2PFD A;  2XXA A;  5L3V A;  4YT8 A;  1LIH A;  1NZE A;  4A4A A;  2YEV A;  4PK4 A;  5HSW A;  3B0V C;  4JEA A;  3T6B A;  3GWN A;  3ZTZ A;  1HY5 A;  3RF3 A;  4A2N B;  2P1A A;  2Q00 A;  1T01 A;  4NC3 A;  5GPG B;  4JCH A;  4YT2 A;  2YVK A;  3GEI A;  5A69 A;  3DAG A;  3EJN A;  4XQ1 A;  4LDK A;  1NLX A;  3RQF A;  3ABL C;  2M64 A;  1FR0 A;  2UUH A;  1O3U A;  2I15 A;  3M15 A;  3EG9 B;  3OEO A;  2Y3H A;  3LES A;  4DXW A;  3QVZ A;  3C8G B;  3RVZ A;  4NQF A;  2HV6 A;  1QQ3 A;  1SF8 A;  2J7P A;  3GAN A;  3V5Z A;  1JRA A;  2EPM X;  3TJ5 A;  1NSG B;  4QI2 A;  1ZU5 A;  1JAF A;  1V74 B;  2C04 A;  2PX0 A;  3R7C A;  5COG A;  4OD4 A;  2EIM C;  2DYS C;  4AL0 A;  3EGD A;  5F28 E;  3Q7G A;  4FWV A;  2HMZ A;  1QSP A;  1J8M F;  3K1I C;  3C8G A;  4W8P A;  2L6H A;  2WVQ A;  1U6H A;  3VF0 A;  1D0Z A;  2Z15 A;  2F22 A;  1HMO A;  1SYQ A;  2CYD A;  1OW7 A;  5KYY B;  3TUL A;  1RJ9 A;  2XLM A;  4N6H A;  2LP4 A;  3CEX A;  4BJ1 A;  2LCH A;  3LS0 A;  3U8P A;  2MWQ A;  3NG1 A;  3TK0 A;  3UMK A;  1U0B B;  2WZG A;  3G4Z A;  1WN0 A;  2G3V A;  3AOU A;  1T9K A;  3ABM C;  1SZI A;  4HFK B;  4IRU A;  3FDQ A;  1FMV A;  2VAS A;  3DM9 B;  4K7B A;  1LS1 A;  4YN0 B;  4LAC B;  4ULW A;  1OXB A;  1ZW2 A;  2NUT B;  3KL4 A;  4BJ6 C;  1MND A;  4XEV A;  2R02 A;  3ECS A;  3SXZ A;  5IY5 C;  5KYY A;  3UR3 C;  3NDB B;  4O6N A;  4G0H A;  1RKE A;  4I1M A;  3SXM A;  2H7B A;  2IBF A;  3LNR A;  4F4B A;  4YL0 A;  1O87 A;  4ZLC A;  3TOL A;  4C3E A;  5JLI A;  2P7V A;  2YL0 A;  1TQG A;  1A7D A;  3HKK A;  4NTF A;  3G4X A;  4D4X A;  1O5H A;  4CDV A;  3NKE A;  1TWC A;  2A69 F;  2CGE A;  2QLA A;  3NKD A;  1M2V B;  3U3B A;  3RFY A;  1T6Q A;  1RKE B;  2X51 A;  3KKB A;  5A6B A;  3ATP A;  3FOO A;  3IEE A;  3MLG A;  5T3W A;  3VYW A;  3WOD F;  3QMK A;  4EHP A;  2J7P D;  4MVR A;  1V54 C;  3FHD A;  4WAB A;  3S27 A;  3NMK A;  3L1M A;  5AGF A;  5F5H A;  3U2L A;  4E0H A;  5AC5 A;  1TWA A;  2HV7 A;  4JJF A;  3WG7 C;  2CW0 F;  3O39 A;  2R7U A;  4DOZ A;  1YJG A;  5B1B C;  3QW1 A;  2A6E F;  3BEH A;  4EBK A;  4PJN A;  4J30 B;  2Q3T A;  1LPE A;  4IAO A;  1F1M A;  3QTH A;  3RYL A;  1R5I D;  1GGQ A;  1T6I A;  2WB7 A;  1OXK A;  1YAU O;  2VCA A;  1BR4 A;  4HEA J;  4P6I C;  2W4B A;  3TQO A;  4R32 A;  3W4Y A;  1T6U A;  2QNL A;  2ZXP A;  4NTA A;  3T9O A;  2YL7 A;  1BBH A;  1Y6D A;  3S90 A;  1A7E A;  1QKR A;  1WTY A;  2Q9C A;  5JS5 A;  4CSA C;  4AL1 A;  2ZXW C;  1JPJ A;  3RVY A;  5KYX B;  1ST6 A;  2W45 A;  2XLO A;  4GEH A;  4U5D E;  2R05 A;  2NUT A;  3UMI A;  2J0W A;  3N2Z B;  2YL1 A;  1EI7 A;  2J9U A;  1H9G A;  2KC3 A;  2HSQ A;  1L7C A;  4MQ9 F;  4G7O F;  2GA0 A;  3LLI A;  5COM A;  3K1H A;  4JW1 A;  2E87 A;  5L0D A;  1BR1 A;  4CIH A;  4JRZ A;  4KBL A;  1MMG A;  1A41 A;  2KNH A;  3B71 A;  3F47 A;  1TFK B;  3DE9 A;  3RW0 A;  4J32 B;  2NUP A;  1D0X A;  2VB6 A;  2GDC A;  3NMI A;  2R03 A;  1ZHX A;  2BE5 F;  2FGY A;  3O6X A;  2L6G A;  1HMD A;  1JPN A;  2Y39 A;  3EGD B;  1ZHW A;  4MVS A;  4MVO A;  4DBR A;  5KYU B;  3M79 A;  3E70 C;  3U5S A;  4U5G A;  2FFH A;  2V26 A;  3U2M A;  1OCC C;  3K66 A;  1KTM A;  1LKX A;  5DVW A;  2VCC A;  2WL8 A;  5JRA A;  2OG2 A;  2MYS A;  1PCX A;  4OIP F;  1GM5 A;  2P0N A;  1LI5 A;  1QLE C;  4MVM A;  2ZXO A;  1E86 A;  3B29 A;  2HFI A;  4YK5 A;  4U5C E;  3R2P A;  4Z9J A;  5KYW B;  4U5E E;  3M4C A;  3KYI A;  3IQC A;  4JIO A;  4XEF A;  3HTK C;  2KYH A;  2OCC C;  3TOM A;  2OQM A;  4AK9 A;  1ZYR F;  2H8A A;  3T6G B;  1D1A A;  2QTV A;  2RD9 A;  5L0I A;  2QUP A;  4W8K A;  1ORY A;  2KGO A;  2J9V A;  4K0D A;  2VH3 A;  2HMQ A;  4YT4 A;  2R7X A;  3JYY A;  3MYI A;  4UDV A;  2GFH A;  3JYH A;  5E2Q A;  3U3F A;  4YL3 A;  5B1A C;  4XTK A;  2J0X A;  2QE9 A;  2UUI A;  2L81 A;  2A0B A;  4JCZ A;  1EQ1 A;  1OQC A;  4C3D A;  4PAC A;  3L8J A;  2W9Y A;  1GQA A;  2VCB A;  1VOM A;  2H7O A;  2J9B A;  1JR8 A;  5DQT A;  5BQH A;  3Q6M A;  3RQG A;  5L0F A;  2Q7R A;  3U0C A;  5JSL A;  1BR2 A;  4KNV A;  4LLE A;  4MVQ A;  3ZC4 A;  2PBE A;  3M1C B;  3A11 A;  3SYN A;  1ZHT A;  3W2W A;  1CGM E;  1ORJ A;  3MX3 A;  1OR2 A;  4O79 A;  2WVN A;  3NRH A;  1D0Y A;  3PDM P;  1B68 A;  1M56 C;  2XRH A;  3OWT A;  2P6V A;  3LEO A;  4N4W A;  2LK4 A;  3H2V A;  4BJ5 A;  4FX5 A;  3EHN A; 
#chains in the Genus database with same CATH homology
 2R7Q A;  4O7G A;  3EHM A;  3I5P A;  3HJC A;  4PJJ A;  1ZHZ A;  2Q9A A;  1OKK A;  5KYW A;  2IYL D;  3EZH A;  4OIN F;  4ANJ A;  5B3S C;  4E7S A;  2CDQ A;  5D92 A;  3EFO B;  4RBN A;  2EIK C;  5DLJ A;  5F5F A;  3JSZ A;  1W2W A;  1RJ9 B;  2KW3 C;  3ZSU A;  3K6B A;  4CBE A;  4CS9 C;  3RIP A;  3V7O A;  2ZPA A;  3I5Q A;  2DGJ A;  3EH2 A;  4EBB A;  2R7S A;  3W2V A;  1J8Y F;  5KYU A;  4G7H F;  1WGW A;  2A68 F;  2IXM A;  5CI9 A;  4U5H A;  2IXP A;  2Q9B A;  1TKN A;  1TR2 A;  3FAJ A;  1IZM A;  4HE8 D;  1MMA A;  4RDA A;  1M2V A;  3LJB A;  4XLN F;  3NYM A;  4BJ6 A;  3CSK A;  3AQB A;  1TWH A;  3ASO C;  3B9Q A;  3JRT A;  1M57 C;  1MNE A;  4BG0 A;  3W8I A;  3EFO A;  4PFO A;  4IJJ A;  1FFH A;  2O9X A;  4MND A;  4FES A;  3RKO F;  3Q6N A;  1Z5Z A;  2KJG A;  3UMH A;  4CS8 C;  3AG2 C;  4EWC A;  3EG9 A;  5EHH A;  2A6H F;  1QZX A;  1G8X A;  4H4K C;  3CZ6 A;  3W8H A;  4PJL A;  1FTS A;  3UGP A;  4OIR F;  5KYN A;  3B0U X;  2R7V A;  4PJM A;  3PHF 2;  2WZF A;  2CNW A;  2G3K A;  3T6J A;  3DJN B;  3SP1 A;  3FVY A;  2JD3 A;  2YHS A;  3T4R A;  1Z23 A;  3H65 A;  4JVS A;  1D1B A;  4JJG A;  3ZVR A;  3NYL A;  1V55 C;  3NYJ A;  3PMR A;  3DD7 A;  1VMA A;  3LAY A;  1Z3I X;  3S29 A;  5DQZ A;  3RH3 A;  3AG3 C;  3JCU Q;  1IW7 F;  2V3C C;  1ZHY A;  2M4E A;  1S7Z A;  3HLZ A;  3KH2 A;  3EGX B;  2ZXR A;  2Y69 C;  4X0R A;  5DS5 A;  1VYI A;  2H7V C;  1D1C A;  5E33 A;  3UGO A;  2G62 A;  4CSA A;  4LER A;  1Z6A A;  3DZA A;  4U5F E;  3B0P A;  4E7Z A;  4Q5S F;  2WVO A;  2NUP B;  2IXN A;  4O6M A;  4YT5 A;  1PD0 A;  4OIO F;  3POV A;  4U5B E;  3L34 A;  1FMW A;  4AE4 A;  3K33 A;  1M2O A;  4CS8 A;  2R7T A;  3LS1 A;  1VK5 A;  2J46 A;  2Y3D A;  4BEJ A;  3F46 A;  5T1D B;  4CS7 A;  3Q7L A;  5KYX A;  2J45 A;  4M63 A;  4Q4Z F;  1MMD A;  3OA1 A;  3ZG1 A;  4BJT A;  2J9W A;  1ZU4 A;  2XL4 A;  2EIJ C;  2XSE A;  5DS6 A;  3EZI A;  5EGY A;  4I44 A;  2R7O A;  3AG1 C;  3DMD A;  2R7R A;  4YWQ A;  2DYR C;  3X2Q C;  3L0I A;  3E9V A;  3ZIB A;  2L9J A;  3DXJ F;  4CS9 A;  2D5R B;  3K7D A;  2PF4 E;  4NY3 A;  5E3A A;  3CQZ A;  1LVK A;  4AE4 B;  5L3Q A;  2Y3G A;  3GOD A;  4KNW A;  4JZA A;  4C7O B;  3ASN C;  3KMI A;  4OD5 A;  4KI2 A;  4YJW A;  5D91 A;  3TD7 A;  2IOQ A;  3ITF A;  4DVY P;  1MMN A;  2PP4 A;  3QZC A;  3DJU B;  1OCO C;  2W4M A;  1NG1 A;  2Y3B A;  1NU7 D;  3UNG C;  3N24 A;  1OCR C;  3I4U A;  2LSE A;  2YZS A;  3AQC A;  1FFT C;  2PX3 A;  4OIQ F;  2KQ9 A;  4XWJ A;  3N0T A;  4O6Y A;  3S0X A;  2EIL C;  4Q7C A;  2CNW D;  4I3M A;  4BJ5 C;  4GYT A;  1N1C A;  4LLC A;  2EIN C;  4XLP F;  1KU2 A;  3S28 A;  1Z63 A;  3EGX A;  1VYK A;  5T3T A;  3JT1 A;  2A1D D;  1OKK D;  4RD9 A;  4C3B A;  3SZR A;  1PD1 A;  3SEO A;  3VAY A;  3EPV A;  3DAF A;  4QI0 A;  4QDL A;  2R7W A;  3EQL F;  4G7Z F;  4C7O A;  2IXO A;  3ABK C;  2C03 A;  3AG4 C;  1OCZ C;  4JUR I;  4WJ0 A;  5E3C A;  2I8B A;  3SNH A;  4DVZ A;  4PFP A;  2WZL A;  4HFF B;  5BUO A;  2QY9 A;  5FCL A;  3EH1 A;  4IWB A;  1NU9 C;  3DM5 A;  3LLK A;  2XXA B;  3LEV A;  2B0J A;  1TWG A;  4KC9 A;  2NG1 A;  5DS4 A;  5CI8 A;  1SMY F;  4I1O B;  4N06 A;  4AX2 A;  3X1O A;  2PFD A;  2XXA A;  5L3V A;  4YT8 A;  1NZE A;  5HSW A;  2YEV A;  4PK4 A;  3B0V C;  3T6B A;  4A2N B;  4JCH A;  4YT2 A;  3DAG A;  3EJN A;  3ABL C;  3EG9 B;  3OEO A;  2Y3H A;  3LES A;  2HV6 A;  1SF8 A;  2J7P A;  3GAN A;  4QI2 A;  1ZU5 A;  2C04 A;  2PX0 A;  4OD4 A;  2EIM C;  2DYS C;  3EGD A;  3Q7G A;  4FWV A;  1J8M F;  3K1I C;  2WVQ A;  1D0Z A;  2Z15 A;  5KYY B;  1RJ9 A;  4BJ1 A;  3LS0 A;  2MWQ A;  3NG1 A;  3UMK A;  2WZG A;  2G3V A;  3ABM C;  4IRU A;  1SZI A;  4HFK B;  3FDQ A;  1FMV A;  2VAS A;  3DM9 B;  4K7B A;  1LS1 A;  4YN0 B;  4LAC B;  4ULW A;  2NUT B;  3KL4 A;  4BJ6 C;  5KYY A;  1MND A;  3ECS A;  5IY5 C;  3UR3 C;  3NDB B;  4O6N A;  4G0H A;  4I1M A;  2H7B A;  3LNR A;  4F4B A;  1O87 A;  4ZLC A;  4C3E A;  2P7V A;  1O5H A;  3NKE A;  1TWC A;  2A69 F;  2CGE A;  3NKD A;  1M2V B;  3RFY A;  2X51 A;  3KKB A;  3IEE A;  3MLG A;  5T3W A;  3VYW A;  3WOD F;  3QMK A;  2J7P D;  1V54 C;  3FHD A;  3S27 A;  5F5H A;  1TWA A;  2HV7 A;  4JJF A;  3WG7 C;  2CW0 F;  3O39 A;  2R7U A;  4DOZ A;  5B1B C;  2A6E F;  4PJN A;  4J30 B;  2Q3T A;  4IAO A;  3RYL A;  4DBQ A;  2WB7 A;  1BR4 A;  4HEA J;  4P6I C;  2W4B A;  2ZXP A;  2Q9C A;  4CSA C;  2ZXW C;  1JPJ A;  5KYX B;  1ST6 A;  2W45 A;  4GEH A;  4U5D E;  2NUT A;  3UMI A;  2J0W A;  3N2Z B;  2J9U A;  4MQ9 F;  4G7O F;  3LLI A;  3K1H A;  4JW1 A;  2E87 A;  1BR1 A;  4CIH A;  4KBL A;  1MMG A;  2KNH A;  3F47 A;  4J32 B;  2NUP A;  1D0X A;  2VB6 A;  1ZHX A;  2BE5 F;  2FGY A;  3O6X A;  1JPN A;  2Y39 A;  3EGD B;  1ZHW A;  4DBR A;  5KYU B;  3E70 C;  4U5G A;  2FFH A;  2V26 A;  1OCC C;  3K66 A;  1LKX A;  5DVW A;  2WL8 A;  2OG2 A;  2MYS A;  1PCX A;  4OIP F;  1QLE C;  2ZXO A;  4U5C E;  5KYW B;  4U5E E;  3HTK C;  2OCC C;  4AK9 A;  1ZYR F;  1D1A A;  2QTV A;  4W8K A;  2KGO A;  2J9V A;  4K0D A;  2VH3 A;  4YT4 A;  2R7X A;  2GFH A;  3JYH A;  5E2Q A;  5B1A C;  4XTK A;  2J0X A;  2L81 A;  4C3D A;  2W9Y A;  4ZLD A;  1VOM A;  2H7O A;  5DQT A;  3Q6M A;  3ZC4 A;  1BR2 A;  4KNV A;  4LLE A;  4B6I A;  3M1C B;  3SYN A;  1ZHT A;  3W2W A;  3MX3 A;  4O79 A;  2WVN A;  3NRH A;  1D0Y A;  1M56 C;  2XRH A;  3OWT A;  2P6V A;  4BJ5 A;  4FX5 A;  3EHN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...