2L9JA

Hrsv m2-1 core domain structure
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
119
structure length
119
Chain Sequence
EISGAAELDRTEEYALGVVGVLESYIGSINNITKQSACVAMSKLLTELNSDDIKKLRDNEEPNSPKIRVYNTVISYIESNRKNNKQTIHLLKRLPADVLKKTIKNTLDIHKSITINNPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Matrix protein 2-1
publication title Structure and functional analysis of the RNA- and viral phosphoprotein-binding domain of respiratory syncytial virus M2-1 protein.
pubmed doi rcsb
source organism Human respiratory syncytial virus
molecule tags Viral protein, transcription
total genus 28
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-02-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1350 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2l9jA00
4CS8C 4CSAC 4CS9C 4CS8A 4CS7A 4CS9A 2L9JA 4CSAA 4C3EA 4C3DA 4C3BA
chains in the Genus database with same CATH superfamily
4YT2A 2J9BA 1JAFA 2L81A 2YLGA 3MYIA 3T6GB 3LNRA 3PHF2 1AUEA 4P6IC 4FESA 3RVYA 5CIVA 5L0HA 4CIHA 1K05A 4O7GA 3SNHA 2LSEA 2MYSA 4ULWA 1D0XA 3KYJA 4CBEA 1PCXA 3ATPA 4IARA 2G62A 3OWTA 1TKNA 1B68A 2QE9A 3QMKA 1OKKD 3VAYA 2IBFA 1ZHXA 3SZRA 3AG4C 4CX9A 5B3SC 1QVXA 3FDQA 5K0IA 4CS8A 3EGXB 4QI0A 1ZHTA 1SYQA 1CGOA 2A0BA 2EPKX 2W4BA 5T3WA 3VRCA 4DRHB 2XLDA 4IAOA 3DXJF 4C7OB 1GS9A 2OQMA 2KK1A 1QLEC 5AGFA 1W2WA 2BC5A 3G4XA 4BJ1A 2PNOA 1BDJB 4BEJA 3VF0A 2WZLA 5JUAA 3VYWA 1SMYF 3DI5A 1VLSA 4AL1A 2L9JA 4FAPB 3NRHA 4HEAJ 2IM8A 1ORSC 2IOQA 1Z6AA 2KJGA 2XM0A 1NZEA 2W4MA 4J30B 2PX3A 3NKDA 4NQFA 5DQTA 2QTVA 3C63A 3L1MA 3DJUB 1U89A 1JOGA 3UGPA 1S7ZA 3W4YA 2XL8A 3JRMO 1LS4A 3H2VA 1Z3IX 5EHHA 2ASRA 3Q7LA 1YYXA 2KC3A 4MTOA 1R4TA 5A6KA 1LI5A 3EGDA 4RBNA 2P7VA 1ZW3A 2EIMC 1L7CA 1OCOC 2HV6A 3LESA 4EKWA 5KYYB 2OEXA 3FVYA 3NKEA 4XLPF 2YL3A 1GGQA 2GDCA 2EILC 3KPHA 4LDRA 1MMGA 3ZIBA 5CI8A 3LLKA 3NMIA 2G3VA 4WABA 1R5ID 3M4BA 3LAYA 5JLIA 2Y3BA 4NCQA 2WL8A 4U5CE 4CSAA 1WOLA 2BE5F 2P0NA 2L6GA 2LD6A 4NTAA 2Q7RA 4EHPA 1ORJA 3GM3A 3MYFA 2FGYA 3L34A 4JRZA 1YA9A 1OR2A 2Y3HA 2UUIA 3OA1A 4JIOA 4EUKB 5KYUB 4G78A 3S29A 5AC4A 1BBHA 4EBKA 5JT4A 3U0CA 1ZYRF 1K04A 2Y3DA 2YL7A 5KYXA 4O6YA 1VB5A 4E0IA 5L3QA 1CGME 2J9UA 4P9FA 2YL1A 4ZLCA 2EPOA 1JPJA 4YWQA 5DS5A 4H4KC 5EGYA 1MQVA 1IZMA 2Q4FA 2XLHA 4CS8C 2KNHA 5L3VA 1E83A 4N6CA 3K1HA 1D1AA 1RKEA 2RD9A 4YT8A 4KNWA 3CAXA 1A7VA 4W8PA 3V5YA 1L3PA 3O39A 4GQHA 2GAQA 2R02A 1PD1A 2FFHA 2BL2A 3G4ZA 3R2PA 4PJNA 2IXNA 1Q0FA 1RKCA 1ZHWA 5JSLA 3WAQA 3GEIA 1Q0DA 4MW8A 4KI2A 1OR3A 3SP1A 2Z15A 1YZCA 1OCCC 1O87A 3QW0A 4KNVA 3RQFA 3W2VA 2HFIA 1HW1A 2JD3A 2YVKA 4MVOA 4MVMA 5COMA 2WVNA 2JPUA 2WZGA 3BRJA 4DJ9A 2ICWG 1MMAA 1DOVA 3M4CA 1I4YA 4HFKB 1C03A 2YLDA 4XEVA 1WASA 2PFDA 2NUTB 4E17A 4U5GA 1CGNA 4IRUA 1AVOB 3DZAA 3W8IA 1D1CA 3EHNA 4PJJA 1OW6A 1YAUO 3K33A 4PFPA 3X1OA 3NDBB 3LNMB 3RW0A 1I4ZA 1Q0GA 4UDVA 1V54C 4OD4A 4FWVA 4KC9A 3S90A 3WHNA 4BPMA 5COFA 1FMVA 2CGEA 2H7OA 3I5PA 3K6BA 4XWJA 1M2OA 2HMQA 3RVZA 5AC5A 1OCZC 3ASNC 4LACB 1TWHA 2L6FA 2KSFA 1F1MA 3T9OA 4ANJA 4U9DA 5E2QA 2R03A 1RMVA 1YJGA 4EWCA 1Q0KA 4BEMJ 2PBEA 4Q4ZF 3UNGC 1NG1A 2D4UA 2NSGA 2OEVA 4CSAC 4PR9A 3ZG1A 1G8XA 1C17M 4ULVA 4GEHA 3ZTMA 2OG2A 4E7SA 1U0BB 2F22A 3FMSA 3B29A 4D4NA 2WZFA 1HE9A 1YYJA 4YT4A 3HNKA 2P6VA 1TWGA 4LLEA 2DI3A 3RF3A 3JZ0A 3SXZA 3T6BA 5BQGA 3ZSUA 2H7BA 2R7XA 4DRIB 1JR8A 4CS9C 3B0PA 2Q9AA 3NG1A 4A2NB 3C8GB 4X0RA 4MNDA 4EBJA 1RJ9A 3MBGA 3CQZA 1HE1A 2VCAA 2Q00A 1SR2A 4JJFA 3EG9B 1APCA 2EPLX 3JYYA 1U6HA 4YK5A 3ABLC 3AG1C 4YT5A 4OD5A 3ABKC 2KQ9A 1YDIA 1Q0MA 3FOPA 5HSWA 1ST6A 2LP4A 4AE4A 1H9TA 2VH3A 3QW1A 3NYLA 1H7IA 4YL3A 2J9WA 1T9KA 4YJWA 4JCZA 3LJBA 3U3BA 5BUOA 1Y4CA 4M63A 1D0ZA 1O5HA 1ZZPA 2C04A 3U5SA 3PDMP 4U9EA 3EHMA 1M2VB 3NYJA 4XTKA 3JCUQ 3WODF 2M4EA 3VM6A 1FNTc 2FAPB 3FXHA 1NBBA 3K66A 2XXAB 3L8JA 3CSKA 3OEOA 1QQ3A 2LFFA 1TQGA 4MS2A 3DJNB 2DGJA 2ZPAA 4XLNF 4DXWA 2OOCA 4G7HF 4KBLA 3FAPB 3ABMC 3LEOA 2NUPA 3GEHA 1DOWA 3F46A 3DE8A 3R7CA 2R7VA 1H6GA 1ZHZA 4O6MA 3AG3C 2W45A 3I5QA 3C8ZA 3ECSA 4E0HA 1ORYA 2AVKA 4ZLDA 4I3MA 2R25A 4U5FE 2TMVP 1EI7A 2Y39A 3IPMO 2JX0A 2YHSA 2ZXRA 4Q7CA 2R7OA 2V3CC 3K1IA 1TR2A 3F47A 2L6HA 3QVYA 1OCRC 1ZW2A 2CDQA 2GWWA 4CIPA 2KGOA 2LK4A 2QY9A 4CDYA 4K0DA 3EFOA 4D4XA 3UGOA 3TJ6A 3UMIA 3ZQVA 2XM4A 4C7OA 3W8HA 1HMDA 1PD0A 3GODA 4LLCA 1EQ1A 1ZU4A 1BR4A 5A6AA 4H54A 2EIJC 4LERA 5L0IA 3DM9B 3S9OA 2HV7A 3ASOC 1YARO 4ONSA 2NSFA 4I44A 2XLMA 4MVUA 2J7PA 1NSGB 1FFTC 3ZC4A 1OXBA 4N06A 2VC9A 2GFHA 4OINF 4RD9A 3KKBA 1VK5A 2HS5A 4MVRA 3I4UA 3IEEA 1UFBA 2R9RB 2V26A 3AJMA 1Y6DA 4MW3A 3RIPA 2A69F 5DLJA 2X51A 5F5FA 1TWAA 3RQEA 1NFNA 4WGYA 2I8BA 3JSEO 2XLVA 3FOOA 1E85A 2DYRC 2XS8A 1T6UA 2A0UA 3ZDLA 2YL0A 2Q9BA 4E18A 3DKAA 5GPGB 4C3BA 4DBRA 1KTMA 3M1CB 3KMIA 4J7YA 4RDAA 2XXAA 3HKKA 3X2QC 4J32B 3KH2A 2VCCA 3GANA 4CS7A 256BA 5KYWA 4I1MA 2EIKC 5L0GA 3AGUA 5BQIA 1GQAA 1VYKA 1LVKA 2J7PD 2NG1A 3T4RA 5B1BC 1KU2A 2J8WA 1K40A 3U2LA 3C62A 3UMHA 4XPXA 1FFHA 1I5NA 3EGDB 4WJ0A 2YLIA 3DAGA 4MVQA 1MMDA 2X0CA 4NTBA 1HMOA 2QLAA 3TQOA 1D0YA 1YA7O 2ZD9A 4BJ5A 5COGA 1LI7A 1HY5A 3EGXA 5TJ5E 5JP7A 3SXMA 3H65A 4DRJB 2B0HA 2HJMA 3LS0A 3MX3A 4XEFA 3O55A 5IY5C 1E2XA 2D5RB 3K1IC 2NPUA 3Q7GA 4U5BE 5JVEA 1Z5ZA 4HE8D 1JRAA 1LE2A 3K7DA 1LPEA 5A6BA 1CPRA 5DQZA 1JMWA 2A1DD 1A7EA 1G5ZA 2YZSA 4GYTA 3U8VA 1ZU5A 5DVWA 2OCCC 1WATA 5FZTA 4F4BA 3AG2C 4Z9JA 1KNYA 3KYIA 3B71A 3NMKA 1ZVZA 4YN0B 3V5XA 4AK9A 4BG0A 2AWCA 4HFFB 1JPNA 2CW0F 1V55C 3A9CA 4JURI 5F28E 4N6HA 1G4WR 2AU5A 2WVQA 3M15A 1XZQA 5KYXB 3J06A 3GEEA 4B6IA 3O6XA 1OW8A 3ZTZA 1D1BA 3CZ6A 2WVOA 1VTMP 1FMWA 3QZCA 1TFOB 4XPYA 2VCBA 4XPWA 1VYIA 3HLZA 1RKEB 4IB4A 4MTFA 4O6NA 1QKRA 3HJCA 3HTKC 4Z9HA 5E33A 3S0XA 2OKUA 2VB6A 5KYYA 2XSEA 4JCHA 1LKXA 4G0HA 5E3AA 1BR2A 4PJLA 3RQGA 5A6BD 4JE9A 3FAJA 5KYNA 3C7JA 4BJTA 5BQHA 1E84A 2IXPA 5T1DB 2L7AA 2H7VC 5E3CA 1FTSA 1OQCA 1YLMA 2E87A 2EINC 3RYLA 4DVZA 1A0BA 1SF8A 1XZPA 2R05A 3GWNA 3QVZA 1IW7F 2LCHA 2A68F 2UUHA 4PJMA 4EIYA 5F5HA 3W2WA 3RFYA 2OJQA 4PK4A 2DYSC 2R7RA 4E7ZA 3U8PA 2B0JA 3RH3A 5KYUA 3Q6MA 5A69A 5FCLA 3E9VA 4MVZA 2HKVA 4AX2A 3EH1A 4N4WA 3SYNA 4MTGA 2P1AA 4JW1A 4O79A 4BJ5C 2XLOA 4IWBA 4C3DA 3NMJA 1SZIA 1NU7D 4MQ9F 5L0JA 4NY3A 1PV3A 3H2UA 2XRHA 2Q3TA 2KW3C 5HV9A 2CCYA 3B0UX 4OIOF 2I15A 4LDQA 1V74B 1Z7Qc 2MHRA 2R7UA 1N1CA 3MLGA 4Q5SF 1EKYA 1MNDA 4J7TA 4K1OA 1M6TA 3B9QA 3EPVA 4YL1A 5CI9A 3DAFA 2CYDA 3SXKA 5B1AC 3Q6NA 3HNJA 3IQCA 3IQ6A 1NLXA 1WN0A 1O3UA 2P61A 5A6JA 4JC7A 4FX5A 1TWCA 1NU9C 4XEKA 4U5DE 3U2MA 1E86A 1OW7A 4OIPF 4CDVA 5T3TA 3S84A 1T01A 2NUTA 2KYHA 3ITFA 4MVSA 4R32A 3AQBA 3U3FA 4NTFA 3EH2A 3GORA 4JKVA 2CNWA 1RJ9B 3T6JA 5JS5A 4Z9IA 1XWJA 2YEVA 3EZIA 3E70C 4G7ZF 2EPMX 3UMKA 3TOLA 2YKZA 1UG7A 2QNLA 2W9YA 1VMAA 3KL4A 1TFKB 5D91A 5B3IA 2R7WA 4CDAA 2HJ3A 1BR1A 2IXOA 3V7OA 1YVIA 3EJNA 3SXYA 1J8YF 4AE4B 3N0TA 4BJ6A 4IGGA 2Y69C 2PP4A 2YQYA 3V5ZA 2M64A 2J9VA 1T5OA 3L0IA 1GM5A 3EZHA 2HUJA 3S27A 2LIGA 2HMZA 2G3KA 2ZXPA 3IQTA 4PFOA 3S28A 2MWQA 3TULA 4JTDB 2AWYA 4JEBA 3DD7A 3PMRA 1LS1A 3GM1A 3DWWA 1T6IA 3G50A 3IHUA 4U5EE 4C3EA 1AEPA 3TOMA 4AL0A 4A4AA 4QI2A 2ZXOA 1S05A 3ZVRA 3LEVA 3NYMA 3UR3C 3LUTB 2CNWD 1M56C 4LDKA 3N24A 3TJ5A 4CS9A 3MFNA 3JSZA 2Q9CA 2NUPB 2XL6A 2J45A 3GWLA 3IQ5A 2VASA 1MMNA 3JRTA 2XL4A 2J0WA 4L6RA 5EK0A 3TD7A 4CJOA 2HZ8A 1Z63A 2AP3A 2H8AA 3C8GA 1EA8A 1RCPA 1QZXA 4K7BA 4IJJA 3BEHA 3LS1A 3O10A 4OIRF 3EG9A 2GA0A 1VLTA 2C03A 4JZAA 3DMDA 1J8MF 2DB4A 2EPNA 2Y3GA 2HSQA 2ETSA 3U9JA 3A11A 3CEXA 3DE9A 2J46A 3L8IA 4JTCB 2WB7A 2R7QA 5D92A 1H9GA 5L0CA 3SEOA 1A41A 3JYHA 2XS1A 1Z23A 2IYLD 1LM3B 3EFOB 4JJGA 4NC3A 3ZWIA 4DVYP 1CPQA 3HNIA 5DS6A 1M57C 1WGWA 4G7OF 4JTAB 1BZ4A 1YZAA 4P9TA 2YWAA 3WG7C 1G4US 5DS4A 1M2VA 4QDLA 2PF4E 3ZQYA 2XLWA 3C18A 4JVSA 4EBBA 1ZHYA 4DBQA 1FR0A 1NFOA 2LQGA 2O9XA 4ER9A 5L0DA 3JTLO 1WWPA 1RXQA 2J0XA 3DM5A 4U5HA 3RKOF 1MNEA 1VOMA 3C8GD 2R7SA 4YL0A 3GM2A 2A6HF 2OU6A 1T6QA 3LLIA 4PACA 2OJED 3M79A 1QPUA 1C02A 1OKKA 1LE4A 4JEAA 2YRFA 4WGZA 4DOZA 5L0FA 2HSBA 2RSEB 3US6A 3HNLA 5JRAA 3TK0A 1WTYA 2A6EF 4IAQA 4OIQF 4I1OB 4BJ6C 1OXKA 3PCVA 1HW2A 1QSPA 2ZXWC 3JT1A 1LIHA 3B0VC 3AQCA 3QTHA 4XQ1A 3U9MA 1A7DA 4W8KA 2XLEA 3POVA 2R7TA 2LFDA 3FHDA 3N2ZB 3AGTA 3EQLF 1V4AA 2PX0A 3AOUA 1FAPB 2IXMA 4CJGA 5KYWB 2QUPA
chains in the Genus database with same CATH topology
4YT2A 2L81A 3LNRA 3PHF2 4P6IC 4FESA 4CIHA 4O7GA 3SNHA 2LSEA 2MYSA 4ULWA 1D0XA 4CBEA 1PCXA 2G62A 3OWTA 1TKNA 3QMKA 1OKKD 3VAYA 1ZHXA 3SZRA 3AG4C 5B3SC 3FDQA 4CS8A 3EGXB 4QI0A 1ZHTA 5T3WA 2W4BA 4IAOA 3DXJF 4C7OB 1QLEC 1W2WA 4BJ1A 4BEJA 2WZLA 3VYWA 1SMYF 2L9JA 3NRHA 4HEAJ 2IOQA 2KJGA 1Z6AA 4J30B 1NZEA 2W4MA 2PX3A 3NKDA 5DQTA 2QTVA 3DJUB 3UGPA 1S7ZA 5EHHA 1Z3IX 3Q7LA 3EGDA 4RBNA 2P7VA 2EIMC 1OCOC 2HV6A 3LESA 5KYYB 3NKEA 3FVYA 4XLPF 2EILC 1MMGA 3ZIBA 5CI8A 3LLKA 2G3VA 3LAYA 2Y3BA 2WL8A 4U5CE 4CSAA 2BE5F 2FGYA 3L34A 2Y3HA 3OA1A 5KYUB 3S29A 1ZYRF 2Y3DA 5KYXA 5L3QA 4O6YA 2J9UA 4ZLCA 1JPJA 4YWQA 5DS5A 4H4KC 5EGYA 4CS8C 1IZMA 5L3VA 2KNHA 3K1HA 1D1AA 4YT8A 4KNWA 3O39A 1PD1A 2FFHA 4PJNA 2IXNA 1ZHWA 4KI2A 3SP1A 2Z15A 1OCCC 1O87A 4KNVA 3W2VA 2JD3A 2WVNA 2WZGA 1MMAA 4HFKB 2PFDA 2NUTB 4U5GA 4IRUA 3DZAA 3W8IA 1D1CA 3EHNA 4PJJA 4PFPA 3X1OA 3K33A 3NDBB 1V54C 4OD4A 4FWVA 4KC9A 1FMVA 2CGEA 2H7OA 3I5PA 3K6BA 4XWJA 1M2OA 1OCZC 3ASNC 4LACB 1TWHA 4ANJA 5E2QA 4EWCA 4Q4ZF 3UNGC 1NG1A 4CSAC 3ZG1A 1G8XA 4GEHA 2OG2A 4E7SA 2WZFA 4YT4A 2P6VA 1TWGA 4LLEA 3T6BA 3ZSUA 2R7XA 2H7BA 4CS9C 3B0PA 2Q9AA 3NG1A 4A2NB 4X0RA 4MNDA 1RJ9A 3CQZA 4JJFA 3EG9B 3ABLC 3AG1C 4YT5A 4OD5A 3ABKC 2KQ9A 5HSWA 1ST6A 4AE4A 2VH3A 3NYLA 5BUOA 2J9WA 4YJWA 3LJBA 4M63A 1D0ZA 1O5HA 2C04A 3EHMA 1M2VB 3NYJA 4XTKA 3JCUQ 3WODF 2M4EA 3K66A 3CSKA 3OEOA 4XLNF 3DJNB 2DGJA 2ZPAA 4G7HF 4KBLA 3ABMC 2NUPA 3F46A 2R7VA 1ZHZA 4O6MA 3AG3C 2W45A 3I5QA 3ECSA 4ZLDA 4I3MA 4U5FE 2Y39A 2YHSA 2ZXRA 4Q7CA 2R7OA 2V3CC 1TR2A 3F47A 1OCRC 2CDQA 2KGOA 2QY9A 3UGOA 4K0DA 3EFOA 3UMIA 3W8HA 1PD0A 3GODA 4LLCA 1ZU4A 1BR4A 2EIJC 4LERA 3DM9B 2HV7A 3ASOC 4I44A 2J7PA 1FFTC 3ZC4A 4N06A 4OINF 2GFHA 4RD9A 3KKBA 1VK5A 3I4UA 3IEEA 2V26A 3RIPA 5F5FA 2A69F 5DLJA 2X51A 1TWAA 2I8BA 2DYRC 2Q9BA 4C3BA 4DBRA 3M1CB 3KMIA 4RDAA 2XXAA 3X2QC 4J32B 3KH2A 4CS7A 3GANA 5KYWA 4I1MA 2EIKC 1VYKA 1LVKA 2J7PD 2NG1A 3T4RA 5B1BC 1KU2A 3UMHA 1FFHA 3EGDB 4WJ0A 3DAGA 1MMDA 1D0YA 4BJ5A 3EGXA 3H65A 3LS0A 3MX3A 5IY5C 2D5RB 3K1IC 4U5BE 3Q7GA 4C7OA 1Z5ZA 4HE8D 3K7DA 5DQZA 2A1DD 2YZSA 4GYTA 1ZU5A 5DVWA 2OCCC 4F4BA 3AG2C 4YN0B 4AK9A 4BG0A 4JURI 4HFFB 1JPNA 2CW0F 1V55C 2WVQA 5KYXB 4B6IA 3O6XA 1D1BA 3CZ6A 2WVOA 1FMWA 3QZCA 1VYIA 3HLZA 4O6NA 3HTKC 3HJCA 5E33A 3S0XA 2VB6A 5KYYA 2XSEA 4JCHA 1LKXA 4G0HA 5E3AA 1BR2A 4PJLA 3FAJA 5KYNA 4BJTA 2IXPA 5T1DB 2H7VC 5E3CA 1FTSA 2E87A 2EINC 3RYLA 4DVZA 1SF8A 1IW7F 2A68F 4PJMA 5F5HA 3W2WA 3RFYA 4PK4A 2DYSC 2R7RA 4E7ZA 2B0JA 3RH3A 5KYUA 3Q6MA 5FCLA 3E9VA 4AX2A 3EH1A 3SYNA 4JW1A 4O79A 4BJ5C 4IWBA 4C3DA 1SZIA 1NU7D 4MQ9F 4NY3A 2XRHA 2Q3TA 2KW3C 3B0UX 4OIOF 2R7UA 1N1CA 3MLGA 4Q5SF 1MNDA 3B9QA 3EPVA 5CI9A 3DAFA 5B1AC 3Q6NA 4FX5A 1TWCA 1NU9C 4U5DE 4OIPF 5T3TA 2NUTA 3ITFA 3AQBA 3EH2A 2CNWA 1RJ9B 3T6JA 2YEVA 3EZIA 3E70C 4G7ZF 3UMKA 2W9YA 1VMAA 3KL4A 5D91A 2R7WA 3V7OA 1BR1A 2IXOA 3EJNA 4AE4B 1J8YF 3N0TA 4BJ6A 2Y69C 2PP4A 2J9VA 3L0IA 3EZHA 4PFOA 2G3KA 2ZXPA 3S28A 2MWQA 3DD7A 3PMRA 1LS1A 4U5EE 4C3EA 4QI2A 2ZXOA 3ZVRA 3LEVA 3NYMA 3UR3C 2CNWD 1M56C 3N24A 4CS9A 3JSZA 2Q9CA 2NUPB 2J45A 2VASA 1MMNA 3JRTA 2XL4A 2J0WA 3TD7A 1Z63A 1QZXA 4K7BA 4IJJA 3LS1A 4OIRF 3EG9A 2C03A 4JZAA 3DMDA 1J8MF 2Y3GA 2J46A 2WB7A 2R7QA 5D92A 3SEOA 3JYHA 3EFOB 1Z23A 2IYLD 4JJGA 4DVYP 5DS6A 1M57C 1WGWA 4G7OF 3WG7C 5DS4A 1M2VA 4QDLA 2PF4E 4EBBA 4DBQA 4JVSA 1ZHYA 2O9XA 2J0XA 3DM5A 4U5HA 3RKOF 1MNEA 1VOMA 2R7SA 2A6HF 3LLIA 1OKKA 4DOZA 2A6EF 4OIQF 4I1OB 4BJ6C 2ZXWC 3JT1A 3B0VC 3AQCA 4W8KA 3POVA 2R7TA 3FHDA 3N2ZB 2XXAB 3EQLF 2PX0A 2IXMA 5KYWB 3S27A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CS8 C;  4CSA C;  4CS9 C;  4CS8 A;  4CS7 A;  4CS9 A;  2L9J A;  4CSA A;  4C3E A;  4C3D A;  4C3B A; 
#chains in the Genus database with same CATH topology
 4YT2 A;  2J9B A;  1JAF A;  2L81 A;  2YLG A;  3MYI A;  3T6G B;  3LNR A;  3PHF 2;  1AUE A;  4P6I C;  4FES A;  3RVY A;  5CIV A;  5L0H A;  4CIH A;  1K05 A;  4O7G A;  3SNH A;  2LSE A;  2MYS A;  4ULW A;  1D0X A;  3KYJ A;  4CBE A;  1PCX A;  3ATP A;  4IAR A;  2G62 A;  3OWT A;  1TKN A;  1B68 A;  2QE9 A;  3QMK A;  1OKK D;  3VAY A;  2IBF A;  1ZHX A;  3SZR A;  3AG4 C;  4CX9 A;  5B3S C;  1QVX A;  3FDQ A;  5K0I A;  4CS8 A;  3EGX B;  4QI0 A;  1ZHT A;  1SYQ A;  1CGO A;  2A0B A;  2EPK X;  2W4B A;  5T3W A;  3VRC A;  4DRH B;  2XLD A;  4IAO A;  3DXJ F;  4C7O B;  1GS9 A;  2OQM A;  2KK1 A;  1QLE C;  5AGF A;  1W2W A;  2BC5 A;  3G4X A;  4BJ1 A;  2PNO A;  1BDJ B;  4BEJ A;  3VF0 A;  2WZL A;  5JUA A;  3VYW A;  1SMY F;  3DI5 A;  1VLS A;  4AL1 A;  2L9J A;  4FAP B;  3NRH A;  4HEA J;  2IM8 A;  1ORS C;  2IOQ A;  1Z6A A;  2KJG A;  2XM0 A;  1NZE A;  2W4M A;  4J30 B;  2PX3 A;  3NKD A;  4NQF A;  5DQT A;  2QTV A;  3C63 A;  3L1M A;  3DJU B;  1U89 A;  1JOG A;  3UGP A;  1S7Z A;  3W4Y A;  2XL8 A;  3JRM O;  1LS4 A;  3H2V A;  1Z3I X;  5EHH A;  2ASR A;  3Q7L A;  1YYX A;  2KC3 A;  4MTO A;  1R4T A;  5A6K A;  1LI5 A;  3EGD A;  4RBN A;  2P7V A;  1ZW3 A;  2EIM C;  1L7C A;  1OCO C;  2HV6 A;  3LES A;  4EKW A;  5KYY B;  2OEX A;  3FVY A;  3NKE A;  4XLP F;  2YL3 A;  1GGQ A;  2GDC A;  2EIL C;  3KPH A;  4LDR A;  1MMG A;  3ZIB A;  5CI8 A;  3LLK A;  3NMI A;  2G3V A;  4WAB A;  1R5I D;  3M4B A;  3LAY A;  5JLI A;  2Y3B A;  4NCQ A;  2WL8 A;  4U5C E;  4CSA A;  1WOL A;  2BE5 F;  2P0N A;  2L6G A;  2LD6 A;  4NTA A;  2Q7R A;  4EHP A;  1ORJ A;  3GM3 A;  3MYF A;  2FGY A;  3L34 A;  4JRZ A;  1YA9 A;  1OR2 A;  2Y3H A;  2UUI A;  3OA1 A;  4JIO A;  4EUK B;  5KYU B;  4G78 A;  3S29 A;  5AC4 A;  1BBH A;  4EBK A;  5JT4 A;  3U0C A;  1ZYR F;  1K04 A;  2Y3D A;  2YL7 A;  5KYX A;  4O6Y A;  1VB5 A;  4E0I A;  5L3Q A;  1CGM E;  2J9U A;  4P9F A;  2YL1 A;  4ZLC A;  2EPO A;  1JPJ A;  4YWQ A;  5DS5 A;  4H4K C;  5EGY A;  1MQV A;  1IZM A;  2Q4F A;  2XLH A;  4CS8 C;  2KNH A;  5L3V A;  1E83 A;  4N6C A;  3K1H A;  1D1A A;  1RKE A;  2RD9 A;  4YT8 A;  4KNW A;  3CAX A;  1A7V A;  4W8P A;  3V5Y A;  1L3P A;  3O39 A;  4GQH A;  2GAQ A;  2R02 A;  1PD1 A;  2FFH A;  2BL2 A;  3G4Z A;  3R2P A;  4PJN A;  2IXN A;  1Q0F A;  1RKC A;  1ZHW A;  5JSL A;  3WAQ A;  3GEI A;  1Q0D A;  4MW8 A;  4KI2 A;  1OR3 A;  3SP1 A;  2Z15 A;  1YZC A;  1OCC C;  1O87 A;  3QW0 A;  4KNV A;  3RQF A;  3W2V A;  2HFI A;  1HW1 A;  2JD3 A;  2YVK A;  4MVO A;  4MVM A;  5COM A;  2WVN A;  2JPU A;  2WZG A;  3BRJ A;  4DJ9 A;  2ICW G;  1MMA A;  1DOV A;  3M4C A;  1I4Y A;  4HFK B;  1C03 A;  2YLD A;  4XEV A;  1WAS A;  2PFD A;  2NUT B;  4E17 A;  4U5G A;  1CGN A;  4IRU A;  1AVO B;  3DZA A;  3W8I A;  1D1C A;  3EHN A;  4PJJ A;  1OW6 A;  1YAU O;  3K33 A;  4PFP A;  3X1O A;  3NDB B;  3LNM B;  3RW0 A;  1I4Z A;  1Q0G A;  4UDV A;  1V54 C;  4OD4 A;  4FWV A;  4KC9 A;  3S90 A;  3WHN A;  4BPM A;  5COF A;  1FMV A;  2CGE A;  2H7O A;  3I5P A;  3K6B A;  4XWJ A;  1M2O A;  2HMQ A;  3RVZ A;  5AC5 A;  1OCZ C;  3ASN C;  4LAC B;  1TWH A;  2L6F A;  2KSF A;  1F1M A;  3T9O A;  4ANJ A;  4U9D A;  5E2Q A;  2R03 A;  1RMV A;  1YJG A;  4EWC A;  1Q0K A;  4BEM J;  2PBE A;  4Q4Z F;  3UNG C;  1NG1 A;  2D4U A;  2NSG A;  2OEV A;  4CSA C;  4PR9 A;  3ZG1 A;  1G8X A;  1C17 M;  4ULV A;  4GEH A;  3ZTM A;  2OG2 A;  4E7S A;  1U0B B;  2F22 A;  3FMS A;  3B29 A;  4D4N A;  2WZF A;  1HE9 A;  1YYJ A;  4YT4 A;  3HNK A;  2P6V A;  1TWG A;  4LLE A;  2DI3 A;  3RF3 A;  3JZ0 A;  3SXZ A;  3T6B A;  5BQG A;  3ZSU A;  2H7B A;  2R7X A;  4DRI B;  1JR8 A;  4CS9 C;  3B0P A;  2Q9A A;  3NG1 A;  4A2N B;  3C8G B;  4X0R A;  4MND A;  4EBJ A;  1RJ9 A;  3MBG A;  3CQZ A;  1HE1 A;  2VCA A;  2Q00 A;  1SR2 A;  4JJF A;  3EG9 B;  1APC A;  2EPL X;  3JYY A;  1U6H A;  4YK5 A;  3ABL C;  3AG1 C;  4YT5 A;  4OD5 A;  3ABK C;  2KQ9 A;  1YDI A;  1Q0M A;  3FOP A;  5HSW A;  1ST6 A;  2LP4 A;  4AE4 A;  1H9T A;  2VH3 A;  3QW1 A;  3NYL A;  1H7I A;  4YL3 A;  2J9W A;  1T9K A;  4YJW A;  4JCZ A;  3LJB A;  3U3B A;  5BUO A;  1Y4C A;  4M63 A;  1D0Z A;  1O5H A;  1ZZP A;  2C04 A;  3U5S A;  3PDM P;  4U9E A;  3EHM A;  1M2V B;  3NYJ A;  4XTK A;  3JCU Q;  3WOD F;  2M4E A;  3VM6 A;  1FNT c;  2FAP B;  3FXH A;  1NBB A;  3K66 A;  2XXA B;  3L8J A;  3CSK A;  3OEO A;  1QQ3 A;  2LFF A;  1TQG A;  4MS2 A;  3DJN B;  2DGJ A;  2ZPA A;  4XLN F;  4DXW A;  2OOC A;  4G7H F;  4KBL A;  3FAP B;  3ABM C;  3LEO A;  2NUP A;  3GEH A;  1DOW A;  3F46 A;  3DE8 A;  3R7C A;  2R7V A;  1H6G A;  1ZHZ A;  4O6M A;  3AG3 C;  2W45 A;  3I5Q A;  3C8Z A;  3ECS A;  4E0H A;  1ORY A;  2AVK A;  4ZLD A;  4I3M A;  2R25 A;  4U5F E;  2TMV P;  1EI7 A;  2Y39 A;  3IPM O;  2JX0 A;  2YHS A;  2ZXR A;  4Q7C A;  2R7O A;  2V3C C;  3K1I A;  1TR2 A;  3F47 A;  2L6H A;  3QVY A;  1OCR C;  1ZW2 A;  2CDQ A;  2GWW A;  4CIP A;  2KGO A;  2LK4 A;  2QY9 A;  4CDY A;  4K0D A;  3EFO A;  4D4X A;  3UGO A;  3TJ6 A;  3UMI A;  3ZQV A;  2XM4 A;  4C7O A;  3W8H A;  1HMD A;  1PD0 A;  3GOD A;  4LLC A;  1EQ1 A;  1ZU4 A;  1BR4 A;  5A6A A;  4H54 A;  2EIJ C;  4LER A;  5L0I A;  3DM9 B;  3S9O A;  2HV7 A;  3ASO C;  1YAR O;  4ONS A;  2NSF A;  4I44 A;  2XLM A;  4MVU A;  2J7P A;  1NSG B;  1FFT C;  3ZC4 A;  1OXB A;  4N06 A;  2VC9 A;  2GFH A;  4OIN F;  4RD9 A;  3KKB A;  1VK5 A;  2HS5 A;  4MVR A;  3I4U A;  3IEE A;  1UFB A;  2R9R B;  2V26 A;  3AJM A;  1Y6D A;  4MW3 A;  3RIP A;  2A69 F;  5DLJ A;  2X51 A;  5F5F A;  1TWA A;  3RQE A;  1NFN A;  4WGY A;  2I8B A;  3JSE O;  2XLV A;  3FOO A;  1E85 A;  2DYR C;  2XS8 A;  1T6U A;  2A0U A;  3ZDL A;  2YL0 A;  2Q9B A;  4E18 A;  3DKA A;  5GPG B;  4C3B A;  4DBR A;  1KTM A;  3M1C B;  3KMI A;  4J7Y A;  4RDA A;  2XXA A;  3HKK A;  3X2Q C;  4J32 B;  3KH2 A;  2VCC A;  3GAN A;  4CS7 A;  256B A;  5KYW A;  4I1M A;  2EIK C;  5L0G A;  3AGU A;  5BQI A;  1GQA A;  1VYK A;  1LVK A;  2J7P D;  2NG1 A;  3T4R A;  5B1B C;  1KU2 A;  2J8W A;  1K40 A;  3U2L A;  3C62 A;  3UMH A;  4XPX A;  1FFH A;  1I5N A;  3EGD B;  4WJ0 A;  2YLI A;  3DAG A;  4MVQ A;  1MMD A;  2X0C A;  4NTB A;  1HMO A;  2QLA A;  3TQO A;  1D0Y A;  1YA7 O;  2ZD9 A;  4BJ5 A;  5COG A;  1LI7 A;  1HY5 A;  3EGX A;  5TJ5 E;  5JP7 A;  3SXM A;  3H65 A;  4DRJ B;  2B0H A;  2HJM A;  3LS0 A;  3MX3 A;  4XEF A;  3O55 A;  5IY5 C;  1E2X A;  2D5R B;  3K1I C;  2NPU A;  3Q7G A;  4U5B E;  5JVE A;  1Z5Z A;  4HE8 D;  1JRA A;  1LE2 A;  3K7D A;  1LPE A;  5A6B A;  1CPR A;  5DQZ A;  1JMW A;  2A1D D;  1A7E A;  1G5Z A;  2YZS A;  4GYT A;  3U8V A;  1ZU5 A;  5DVW A;  2OCC C;  1WAT A;  5FZT A;  4F4B A;  3AG2 C;  4Z9J A;  1KNY A;  3KYI A;  3B71 A;  3NMK A;  1ZVZ A;  4YN0 B;  3V5X A;  4AK9 A;  4BG0 A;  2AWC A;  4HFF B;  1JPN A;  2CW0 F;  1V55 C;  3A9C A;  4JUR I;  5F28 E;  4N6H A;  1G4W R;  2AU5 A;  2WVQ A;  3M15 A;  1XZQ A;  5KYX B;  3J06 A;  3GEE A;  4B6I A;  3O6X A;  1OW8 A;  3ZTZ A;  1D1B A;  3CZ6 A;  2WVO A;  1VTM P;  1FMW A;  3QZC A;  1TFO B;  4XPY A;  2VCB A;  4XPW A;  1VYI A;  3HLZ A;  1RKE B;  4IB4 A;  4MTF A;  4O6N A;  1QKR A;  3HJC A;  3HTK C;  4Z9H A;  5E33 A;  3S0X A;  2OKU A;  2VB6 A;  5KYY A;  2XSE A;  4JCH A;  1LKX A;  4G0H A;  5E3A A;  1BR2 A;  4PJL A;  3RQG A;  5A6B D;  4JE9 A;  3FAJ A;  5KYN A;  3C7J A;  4BJT A;  5BQH A;  1E84 A;  2IXP A;  5T1D B;  2L7A A;  2H7V C;  5E3C A;  1FTS A;  1OQC A;  1YLM A;  2E87 A;  2EIN C;  3RYL A;  4DVZ A;  1A0B A;  1SF8 A;  1XZP A;  2R05 A;  3GWN A;  3QVZ A;  1IW7 F;  2LCH A;  2A68 F;  2UUH A;  4PJM A;  4EIY A;  5F5H A;  3W2W A;  3RFY A;  2OJQ A;  4PK4 A;  2DYS C;  2R7R A;  4E7Z A;  3U8P A;  2B0J A;  3RH3 A;  5KYU A;  3Q6M A;  5A69 A;  5FCL A;  3E9V A;  4MVZ A;  2HKV A;  4AX2 A;  3EH1 A;  4N4W A;  3SYN A;  4MTG A;  2P1A A;  4JW1 A;  4O79 A;  4BJ5 C;  2XLO A;  4IWB A;  4C3D A;  3NMJ A;  1SZI A;  1NU7 D;  4MQ9 F;  5L0J A;  4NY3 A;  1PV3 A;  3H2U A;  2XRH A;  2Q3T A;  2KW3 C;  5HV9 A;  2CCY A;  3B0U X;  4OIO F;  2I15 A;  4LDQ A;  1V74 B;  1Z7Q c;  2MHR A;  2R7U A;  1N1C A;  3MLG A;  4Q5S F;  1EKY A;  1MND A;  4J7T A;  4K1O A;  1M6T A;  3B9Q A;  3EPV A;  4YL1 A;  5CI9 A;  3DAF A;  2CYD A;  3SXK A;  5B1A C;  3Q6N A;  3HNJ A;  3IQC A;  3IQ6 A;  1NLX A;  1WN0 A;  1O3U A;  2P61 A;  5A6J A;  4JC7 A;  4FX5 A;  1TWC A;  1NU9 C;  4XEK A;  4U5D E;  3U2M A;  1E86 A;  1OW7 A;  4OIP F;  4CDV A;  5T3T A;  3S84 A;  1T01 A;  2NUT A;  2KYH A;  3ITF A;  4MVS A;  4R32 A;  3AQB A;  3U3F A;  4NTF A;  3EH2 A;  3GOR A;  4JKV A;  2CNW A;  1RJ9 B;  3T6J A;  5JS5 A;  4Z9I A;  1XWJ A;  2YEV A;  3EZI A;  3E70 C;  4G7Z F;  2EPM X;  3UMK A;  3TOL A;  2YKZ A;  1UG7 A;  2QNL A;  2W9Y A;  1VMA A;  3KL4 A;  1TFK B;  5D91 A;  5B3I A;  2R7W A;  4CDA A;  2HJ3 A;  1BR1 A;  2IXO A;  3V7O A;  1YVI A;  3EJN A;  3SXY A;  1J8Y F;  4AE4 B;  3N0T A;  4BJ6 A;  4IGG A;  2Y69 C;  2PP4 A;  2YQY A;  3V5Z A;  2M64 A;  2J9V A;  1T5O A;  3L0I A;  1GM5 A;  3EZH A;  2HUJ A;  3S27 A;  2LIG A;  2HMZ A;  2G3K A;  2ZXP A;  3IQT A;  4PFO A;  3S28 A;  2MWQ A;  3TUL A;  4JTD B;  2AWY A;  4JEB A;  3DD7 A;  3PMR A;  1LS1 A;  3GM1 A;  3DWW A;  1T6I A;  3G50 A;  3IHU A;  4U5E E;  4C3E A;  1AEP A;  3TOM A;  4AL0 A;  4A4A A;  4QI2 A;  2ZXO A;  1S05 A;  3ZVR A;  3LEV A;  3NYM A;  3UR3 C;  3LUT B;  2CNW D;  1M56 C;  4LDK A;  3N24 A;  3TJ5 A;  4CS9 A;  3MFN A;  3JSZ A;  2Q9C A;  2NUP B;  2XL6 A;  2J45 A;  3GWL A;  3IQ5 A;  2VAS A;  1MMN A;  3JRT A;  2XL4 A;  2J0W A;  4L6R A;  5EK0 A;  3TD7 A;  4CJO A;  2HZ8 A;  1Z63 A;  2AP3 A;  2H8A A;  3C8G A;  1EA8 A;  1RCP A;  1QZX A;  4K7B A;  4IJJ A;  3BEH A;  3LS1 A;  3O10 A;  4OIR F;  3EG9 A;  2GA0 A;  1VLT A;  2C03 A;  4JZA A;  3DMD A;  1J8M F;  2DB4 A;  2EPN A;  2Y3G A;  2HSQ A;  2ETS A;  3U9J A;  3A11 A;  3CEX A;  3DE9 A;  2J46 A;  3L8I A;  4JTC B;  2WB7 A;  2R7Q A;  5D92 A;  1H9G A;  5L0C A;  3SEO A;  1A41 A;  3JYH A;  2XS1 A;  1Z23 A;  2IYL D;  1LM3 B;  3EFO B;  4JJG A;  4NC3 A;  3ZWI A;  4DVY P;  1CPQ A;  3HNI A;  5DS6 A;  1M57 C;  1WGW A;  4G7O F;  4JTA B;  1BZ4 A;  1YZA A;  4P9T A;  2YWA A;  3WG7 C;  1G4U S;  5DS4 A;  1M2V A;  4QDL A;  2PF4 E;  3ZQY A;  2XLW A;  3C18 A;  4JVS A;  4EBB A;  1ZHY A;  4DBQ A;  1FR0 A;  1NFO A;  2LQG A;  2O9X A;  4ER9 A;  5L0D A;  3JTL O;  1WWP A;  1RXQ A;  2J0X A;  3DM5 A;  4U5H A;  3RKO F;  1MNE A;  1VOM A;  3C8G D;  2R7S A;  4YL0 A;  3GM2 A;  2A6H F;  2OU6 A;  1T6Q A;  3LLI A;  4PAC A;  2OJE D;  3M79 A;  1QPU A;  1C02 A;  1OKK A;  1LE4 A;  4JEA A;  2YRF A;  4WGZ A;  4DOZ A;  5L0F A;  2HSB A;  2RSE B;  3US6 A;  3HNL A;  5JRA A;  3TK0 A;  1WTY A;  2A6E F;  4IAQ A;  4OIQ F;  4I1O B;  4BJ6 C;  1OXK A;  3PCV A;  1HW2 A;  1QSP A;  2ZXW C;  3JT1 A;  1LIH A;  3B0V C;  3AQC A;  3QTH A;  4XQ1 A;  3U9M A;  1A7D A;  4W8K A;  2XLE A;  3POV A;  2R7T A;  2LFD A;  3FHD A;  3N2Z B;  3AGT A;  3EQL F;  1V4A A;  2PX0 A;  3AOU A;  1FAP B;  2IXM A;  4CJG A;  5KYW B;  2QUP A; 
#chains in the Genus database with same CATH homology
 4YT2 A;  2L81 A;  3LNR A;  3PHF 2;  4P6I C;  4FES A;  4CIH A;  4O7G A;  3SNH A;  2LSE A;  2MYS A;  4ULW A;  1D0X A;  4CBE A;  1PCX A;  2G62 A;  3OWT A;  1TKN A;  3QMK A;  1OKK D;  3VAY A;  1ZHX A;  3SZR A;  3AG4 C;  5B3S C;  3FDQ A;  4CS8 A;  3EGX B;  4QI0 A;  1ZHT A;  5T3W A;  2W4B A;  4IAO A;  3DXJ F;  4C7O B;  1QLE C;  1W2W A;  4BJ1 A;  4BEJ A;  2WZL A;  3VYW A;  1SMY F;  2L9J A;  3NRH A;  4HEA J;  2IOQ A;  2KJG A;  1Z6A A;  4J30 B;  1NZE A;  2W4M A;  2PX3 A;  3NKD A;  5DQT A;  2QTV A;  3DJU B;  3UGP A;  1S7Z A;  5EHH A;  1Z3I X;  3Q7L A;  3EGD A;  4RBN A;  2P7V A;  2EIM C;  1OCO C;  2HV6 A;  3LES A;  5KYY B;  3NKE A;  3FVY A;  4XLP F;  2EIL C;  1MMG A;  3ZIB A;  5CI8 A;  3LLK A;  2G3V A;  3LAY A;  2Y3B A;  2WL8 A;  4U5C E;  4CSA A;  2BE5 F;  2FGY A;  3L34 A;  2Y3H A;  3OA1 A;  5KYU B;  3S29 A;  1ZYR F;  2Y3D A;  5KYX A;  5L3Q A;  4O6Y A;  2J9U A;  4ZLC A;  1JPJ A;  4YWQ A;  5DS5 A;  4H4K C;  5EGY A;  4CS8 C;  1IZM A;  5L3V A;  2KNH A;  3K1H A;  1D1A A;  4YT8 A;  4KNW A;  3O39 A;  1PD1 A;  2FFH A;  4PJN A;  2IXN A;  1ZHW A;  4KI2 A;  3SP1 A;  2Z15 A;  1OCC C;  1O87 A;  4KNV A;  3W2V A;  2JD3 A;  2WVN A;  2WZG A;  1MMA A;  4HFK B;  2PFD A;  2NUT B;  4U5G A;  4IRU A;  3DZA A;  3W8I A;  1D1C A;  3EHN A;  4PJJ A;  4PFP A;  3X1O A;  3K33 A;  3NDB B;  1V54 C;  4OD4 A;  4FWV A;  4KC9 A;  1FMV A;  2CGE A;  2H7O A;  3I5P A;  3K6B A;  4XWJ A;  1M2O A;  1OCZ C;  3ASN C;  4LAC B;  1TWH A;  4ANJ A;  5E2Q A;  4EWC A;  4Q4Z F;  3UNG C;  1NG1 A;  4CSA C;  3ZG1 A;  1G8X A;  4GEH A;  2OG2 A;  4E7S A;  2WZF A;  4YT4 A;  2P6V A;  1TWG A;  4LLE A;  3T6B A;  3ZSU A;  2R7X A;  2H7B A;  4CS9 C;  3B0P A;  2Q9A A;  3NG1 A;  4A2N B;  4X0R A;  4MND A;  1RJ9 A;  3CQZ A;  4JJF A;  3EG9 B;  3ABL C;  3AG1 C;  4YT5 A;  4OD5 A;  3ABK C;  2KQ9 A;  5HSW A;  1ST6 A;  4AE4 A;  2VH3 A;  3NYL A;  5BUO A;  2J9W A;  4YJW A;  3LJB A;  4M63 A;  1D0Z A;  1O5H A;  2C04 A;  3EHM A;  1M2V B;  3NYJ A;  4XTK A;  3JCU Q;  3WOD F;  2M4E A;  3K66 A;  3CSK A;  3OEO A;  4XLN F;  3DJN B;  2DGJ A;  2ZPA A;  4G7H F;  4KBL A;  3ABM C;  2NUP A;  3F46 A;  2R7V A;  1ZHZ A;  4O6M A;  3AG3 C;  2W45 A;  3I5Q A;  3ECS A;  4ZLD A;  4I3M A;  4U5F E;  2Y39 A;  2YHS A;  2ZXR A;  4Q7C A;  2R7O A;  2V3C C;  1TR2 A;  3F47 A;  1OCR C;  2CDQ A;  2KGO A;  2QY9 A;  3UGO A;  4K0D A;  3EFO A;  3UMI A;  3W8H A;  1PD0 A;  3GOD A;  4LLC A;  1ZU4 A;  1BR4 A;  2EIJ C;  4LER A;  3DM9 B;  2HV7 A;  3ASO C;  4I44 A;  2J7P A;  1FFT C;  3ZC4 A;  4N06 A;  4OIN F;  2GFH A;  4RD9 A;  3KKB A;  1VK5 A;  3I4U A;  3IEE A;  2V26 A;  3RIP A;  5F5F A;  2A69 F;  5DLJ A;  2X51 A;  1TWA A;  2I8B A;  2DYR C;  2Q9B A;  4C3B A;  4DBR A;  3M1C B;  3KMI A;  4RDA A;  2XXA A;  3X2Q C;  4J32 B;  3KH2 A;  4CS7 A;  3GAN A;  5KYW A;  4I1M A;  2EIK C;  1VYK A;  1LVK A;  2J7P D;  2NG1 A;  3T4R A;  5B1B C;  1KU2 A;  3UMH A;  1FFH A;  3EGD B;  4WJ0 A;  3DAG A;  1MMD A;  1D0Y A;  4BJ5 A;  3EGX A;  3H65 A;  3LS0 A;  3MX3 A;  5IY5 C;  2D5R B;  3K1I C;  4U5B E;  3Q7G A;  4C7O A;  1Z5Z A;  4HE8 D;  3K7D A;  5DQZ A;  2A1D D;  2YZS A;  4GYT A;  1ZU5 A;  5DVW A;  2OCC C;  4F4B A;  3AG2 C;  4YN0 B;  4AK9 A;  4BG0 A;  4JUR I;  4HFF B;  1JPN A;  2CW0 F;  1V55 C;  2WVQ A;  5KYX B;  4B6I A;  3O6X A;  1D1B A;  3CZ6 A;  2WVO A;  1FMW A;  3QZC A;  1VYI A;  3HLZ A;  4O6N A;  3HTK C;  3HJC A;  5E33 A;  3S0X A;  2VB6 A;  5KYY A;  2XSE A;  4JCH A;  1LKX A;  4G0H A;  5E3A A;  1BR2 A;  4PJL A;  3FAJ A;  5KYN A;  4BJT A;  2IXP A;  5T1D B;  2H7V C;  5E3C A;  1FTS A;  2E87 A;  2EIN C;  3RYL A;  4DVZ A;  1SF8 A;  1IW7 F;  2A68 F;  4PJM A;  5F5H A;  3W2W A;  3RFY A;  4PK4 A;  2DYS C;  2R7R A;  4E7Z A;  2B0J A;  3RH3 A;  5KYU A;  3Q6M A;  5FCL A;  3E9V A;  4AX2 A;  3EH1 A;  3SYN A;  4JW1 A;  4O79 A;  4BJ5 C;  4IWB A;  4C3D A;  1SZI A;  1NU7 D;  4MQ9 F;  4NY3 A;  2XRH A;  2Q3T A;  2KW3 C;  3B0U X;  4OIO F;  2R7U A;  1N1C A;  3MLG A;  4Q5S F;  1MND A;  3B9Q A;  3EPV A;  5CI9 A;  3DAF A;  5B1A C;  3Q6N A;  4FX5 A;  1TWC A;  1NU9 C;  4U5D E;  4OIP F;  5T3T A;  2NUT A;  3ITF A;  3AQB A;  3EH2 A;  2CNW A;  1RJ9 B;  3T6J A;  2YEV A;  3EZI A;  3E70 C;  4G7Z F;  3UMK A;  2W9Y A;  1VMA A;  3KL4 A;  5D91 A;  2R7W A;  3V7O A;  1BR1 A;  2IXO A;  3EJN A;  4AE4 B;  1J8Y F;  3N0T A;  4BJ6 A;  2Y69 C;  2PP4 A;  2J9V A;  3L0I A;  3EZH A;  4PFO A;  2G3K A;  2ZXP A;  3S28 A;  2MWQ A;  3DD7 A;  3PMR A;  1LS1 A;  4U5E E;  4C3E A;  4QI2 A;  2ZXO A;  3ZVR A;  3LEV A;  3NYM A;  3UR3 C;  2CNW D;  1M56 C;  3N24 A;  4CS9 A;  3JSZ A;  2Q9C A;  2NUP B;  2J45 A;  2VAS A;  1MMN A;  3JRT A;  2XL4 A;  2J0W A;  3TD7 A;  1Z63 A;  1QZX A;  4K7B A;  4IJJ A;  3LS1 A;  4OIR F;  3EG9 A;  2C03 A;  4JZA A;  3DMD A;  1J8M F;  2Y3G A;  2J46 A;  2WB7 A;  2R7Q A;  5D92 A;  3SEO A;  3JYH A;  3EFO B;  1Z23 A;  2IYL D;  4JJG A;  4DVY P;  5DS6 A;  1M57 C;  1WGW A;  4G7O F;  3WG7 C;  5DS4 A;  1M2V A;  4QDL A;  2PF4 E;  4EBB A;  4DBQ A;  4JVS A;  1ZHY A;  2O9X A;  2J0X A;  3DM5 A;  4U5H A;  3RKO F;  1MNE A;  1VOM A;  2R7S A;  2A6H F;  3LLI A;  1OKK A;  4DOZ A;  2A6E F;  4OIQ F;  4I1O B;  4BJ6 C;  2ZXW C;  3JT1 A;  3B0V C;  3AQC A;  4W8K A;  3POV A;  2R7T A;  3FHD A;  3N2Z B;  2XXA B;  3EQL F;  2PX0 A;  2IXM A;  5KYW B;  3S27 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...