2L9JA

Hrsv m2-1 core domain structure
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
119
structure length
119
Chain Sequence
EISGAAELDRTEEYALGVVGVLESYIGSINNITKQSACVAMSKLLTELNSDDIKKLRDNEEPNSPKIRVYNTVISYIESNRKNNKQTIHLLKRLPADVLKKTIKNTLDIHKSITINNPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein, transcription
molecule keywords Matrix protein 2-1
publication title Structure and functional analysis of the RNA- and viral phosphoprotein-binding domain of respiratory syncytial virus M2-1 protein.
pubmed doi rcsb
source organism Human respiratory syncytial virus
total genus 28
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-02-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1350 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2l9jA00
4CS7A 2L9JA 4C3EA 4C3BA 4CS8A 4C3DA 4CS9C 4CSAC 4CSAA 4CS9A 4CS8C
chains in the Genus database with same CATH superfamily
2C03A 4IRUA 3ZTMA 2KC3A 4EWCA 4U5DE 4BJTA 2EIMC 2A0BA 4M63A 2G3VA 4N4WA 3MBGA 3FMSA 3SXYA 3IQ5A 1PD0A 1J8MF 1O5HA 1B68A 4IWBA 3POVA 3EH2A 2KJGA 4CSAC 2LQGA 4MVMA 1ZHTA 4JEAA 3VYWA 3DE8A 3JTLO 4OIOF 1QPUA 2LCHA 2LIGA 2R7VA 1SZIA 1IW7F 1JOGA 1L3PA 2XL6A 2NUTB 1WATA 4RBNA 1LIHA 4DBQA 1KNYA 1D1AA 2WVNA 3CAXA 5B1AC 1E86A 2VCAA 2E87A 4O7GA 4NTFA 4D4NA 4N6CA 5GPGB 1TFOB 3IPMO 4HE8D 3GWLA 3JCUQ 3QVYA 4AE4A 1S05A 3U2LA 3DJNB 1C17M 1YZCA 4CBEA 1MMGA 2QY9A 1EQ1A 3DKAA 3JZ0A 5K0IA 1S7ZA 3CSKA 2L7AA 3HNJA 5A6AA 5JRAA 5L0GA 5L0JA 3H2UA 1GQAA 2UUHA 3IHUA 4U5CE 4J7TA 2R7WA 4PJNA 1I4ZA 4YN0B 3U8VA 4IB4A 3RQGA 4E7SA 3DM9B 3U5SA 1J8YF 3DZAA 3S27A 4CS9C 2XXAA 4X0RA 3QW0A 4JTAB 2WVQA 3ZWIA 1CPRA 5JUAA 3HLZA 1Y6DA 2NSFA 4MVQA 1TQGA 3RQFA 2WVOA 3U0CA 4JC7A 2Q9AA 2NUPA 2WZGA 2D4UA 3ASNC 3ITFA 1W2WA 2VB6A 3SYNA 4MTOA 5F5FA 2JPUA 4LDKA 4XTKA 2EPMX 2MYSA 3UR3C 2CGEA 3F46A 5HV9A 3PHF2 1NU9C 3IQTA 2P61A 1Q0GA 3EHNA 3AGTA 3S84A 2GDCA 1EA8A 4KNWA 3TD7A 1HY5A 3F47A 2HZ8A 3U9JA 2LP4A 3EH1A 3UMKA 2V3CC 3FXHA 3LUTB 3C7JA 2PF4E 5A6KA 2J7PD 3WODF 1ZYRF 1VMAA 2W4MA 3LS0A 2YRFA 4E0IA 4OIPF 3V5ZA 4QI2A 1RKCA 1LI5A 2Y69C 2TMVP 4KI2A 2WZFA 4P9TA 3T6GB 3JT1A 3ZG1A 2CCYA 4LLCA 5DS4A 2PP4A 2EPLX 2DI3A 3LAYA 3DE9A 5DVWA 3ZDLA 3M4BA 1FMWA 2QUPA 3L8JA 1T01A 3RW0A 4FWVA 4YT8A 2IXPA 5AGFA 1Z7Qc 4PJMA 1KU2A 2RD9A 4I1OB 4JIOA 1VTMP 1TWCA 2C04A 1SMYF 3W8IA 5BQIA 2FAPB 3FAPB 4CJOA 5EGYA 4C7OA 2H7BA 1WGWA 3TULA 4HEAJ 1YA7O 3US6A 4U5HA 2VC9A 5DQZA 1K05A 3EFOB 5T1DB 2HFIA 3HNLA 2XRHA 4IJJA 4P9FA 3M15A 3FOOA 4WJ0A 3W2VA 4AK9A 4JEBA 3ZVRA 1CGNA 4MVRA 4LERA 3S0XA 4PACA 2ZXWC 3VAYA 4N06A 2BE5F 4IAOA 4YK5A 3N0TA 3EPVA 3S9OA 4AL1A 1NG1A 4CS8A 2OCCC 2LK4A 2KSFA 4PK4A 3BRJA 5KYWB 1C02A 3M79A 1ZW2A 4OIQF 4IGGA 2R05A 4BJ5A 4FX5A 3LEVA 3KYJA 2J45A 4NQFA 4EBJA 4K7BA 2HSQA 4PR9A 5TJ5E 3U9MA 1A7DA 3AG1C 4K1OA 1E85A 1M2VB 1H9GA 4PFPA 2OG2A 3FVYA 1Q0KA 1G4US 3TJ5A 1FR0A 5KYUA 5A6JA 1D1BA 3RQEA 1RJ9A 4MNDA 5D91A 4E0HA 3BEHA 2J8WA 1BR1A 3E70C 1L7CA 1K04A 4MVZA 5JP7A 5DS6A 3J06A 3KYIA 3IEEA 3MFNA 3SEOA 4EIYA 3EQLF 3GEEA 4U5FE 2AP3A 1QQ3A 4H4KC 1CGOA 4BJ6A 4LDRA 2Q7RA 1D1CA 5L0FA 2L6HA 3KL4A 1XWJA 4JKVA 3EHMA 1LI7A 2XLHA 4MVOA 2EPNA 1V55C 2W45A 4JRZA 3PDMP 1LVKA 2H7VC 1OXBA 3L0IA 4CX9A 4BPMA 3RH3A 2RSEB 1DOWA 1M57C 2P6VA 5T3TA 3G4ZA 2ASRA 1F1MA 1A7VA 1VK5A 3LS1A 5FCLA 3M1CB 1ORYA 5COGA 4MW3A 2OKUA 2DB4A 1V74B 1ZW3A 2ZXPA 5F28E 4DVYP 2EILC 1YAUO 1T9KA 3ZC4A 3NDBB 1OCCC 2WB7A 1ZHWA 3GM1A 1BBHA 4JE9A 5D92A 3JRMO 3AOUA 3DMDA 3U2MA 2YL0A 1VLTA 3T4RA 3U8PA 1Z5ZA 4ULVA 3S28A 3O55A 3ABMC 4C3EA 1QLEC 3O10A 3SXMA 1V54C 2OU6A 3QW1A 3B29A 2P0NA 3RF3A 3FAJA 1OCZC 1RKEA 3DAGA 3ZQVA 4ZLCA 5HSWA 4G7HF 1TFKB 3B0VC 1H9TA 1FNTc 2UUIA 4YL3A 5BQHA 2PFDA 4A4AA 5L0IA 3O6XA 1WASA 2XM0A 4XQ1A 3DI5A 3N2ZB 3DJUB 3AG3C 4CDVA 5A6BA 3LNMB 1I5NA 1N1CA 4XPYA 4JTDB 1YJGA 5DLJA 4XLPF 3B0UX 1ZHZA 2PX3A 3V5XA 5A6BD 1WWPA 5E3CA 5B3IA 1OXKA 3FOPA 1ZU4A 1OCOC 4GEHA 3UMHA 2QNLA 3LEOA 2YKZA 4AE4B 1Y4CA 3AGUA 3LJBA 4U5EE 4A2NB 2ICWG 3DM5A 1NSGB 2G3KA 2L81A 3X1OA 2YWAA 1HE9A 3B0PA 1PCXA 3VRCA 1WTYA 2OJQA 4EHPA 5DS5A 3N24A 3HNKA 3LNRA 2DYSC 2R7XA 3K6BA 4BEMJ 1FFHA 1BR4A 2Y3GA 1ZU5A 1Q0DA 2J9UA 2XL8A 2YLGA 3JRTA 3NMIA 4MW8A 3W2WA 2XS8A 1VB5A 3GEIA 4DRHB 4EBBA 3LLKA 2OEXA 1GS9A 2YL3A 3EGDA 2QTVA 1R4TA 2PX0A 4XEFA 1RCPA 4U9EA 3S29A 3EGXA 3MYIA 3UGOA 2XXAB 1LS4A 4UDVA 3IQ6A 4BG0A 3V5YA 3DXJF 2M64A 2YVKA 4XEKA 4XEVA 2M4EA 3ECSA 4JVSA 5DQTA 5BUOA 4W8KA 1Z3IX 2NUPB 2DGJA 2J9BA 4OD4A 2W9YA 5L0DA 4D4XA 1GM5A 1OQCA 2FFHA 2EPOA 2ZXOA 3EZIA 3Q7LA 1KTMA 3C8GA 3PMRA 4CSAA 2J0XA 3KKBA 2KK1A 3ABLC 3KH2A 2KQ9A 2L6GA 3CZ6A 3C8GD 3JSZA 4J7YA 256BA 2A69F 5COFA 3JSEO 4JZAA 2AWYA 4WABA 2Q9CA 4E7ZA 2B0JA 2HJ3A 2GA0A 4YT4A 2EIKC 2L9JA 2OOCA 3I5QA 4G7OF 1APCA 1LE2A 4W8PA 3O39A 4WGZA 3WAQA 4YT2A 3TQOA 1NZEA 1ZZPA 2YLIA 1BR2A 1E84A 1K40A 1NU7D 2J46A 2BL2A 3DD7A 3QVZA 1ZHXA 2XLDA 2Y3BA 4RD9A 1G8XA 1BDJB 2HS5A 3L34A 2X51A 5AC5A 1VYIA 3C62A 4YL0A 1T6IA 2AVKA 4PJLA 5KYXA 1DOVA 3H2VA 1MMNA 2HMZA 4XPWA 4YL1A 2GWWA 5JS5A 3AG4C 3RYLA 2XLEA 1M6TA 3CQZA 2R7RA 2XLVA 4Z9HA 1U0BB 3IQCA 2MWQA 1WOLA 4O6MA 2J9VA 5L0CA 4C7OB 1OW8A 2VCBA 4CS9A 1HW2A 4ZLDA 4DJ9A 3NKDA 1JR8A 1D0ZA 2IXNA 3A9CA 1A0BA 3X2QC 1SF8A 2YEVA 5L3QA 4Z9JA 2IM8A 1QZXA 2FGYA 2Z15A 3TOLA 1H7IA 1OCRC 2HMQA 3PCVA 4MVUA 2WZLA 4DBRA 3NRHA 1A7EA 2A0UA 2D5RB 2HJMA 3DWWA 4J30B 1NFNA 4KNVA 3UNGC 4ER9A 3ASOC 4IARA 3NYLA 2Q9BA 2P1AA 1OW7A 3M4CA 5EK0A 4PFOA 3T6JA 1T6UA 2KYHA 4NC3A 4O6NA 4NCQA 4L6RA 1LS1A 5KYNA 1CPQA 2DYRC 2JX0A 3OWTA 1EKYA 4BJ1A 1JRAA 4LDQA 4PJJA 4CJGA 2LD6A 2F22A 3SP1A 5JVEA 3NYMA 4MVSA 2A6EF 4MTGA 1RXQA 1BZ4A 4ONSA 1C03A 3HKKA 4WGYA 2CDQA 4XLNF 2A1DD 5KYUB 1E2XA 4F4BA 3K1IC 1RJ9B 3HTKC 2Q4FA 3MLGA 3W8HA 1CGME 1YLMA 3VM6A 3L8IA 3VF0A 3A11A 2H7OA 3GODA 4IAQA 2NUTA 3RKOF 5F5HA 1ZHYA 2R03A 3K7DA 3U3BA 3FDQA 3H65A 1ORSC 2QE9A 2ZXRA 4CDAA 1PV3A 1TWAA 3R2PA 5CIVA 3FHDA 4MS2A 1YZAA 2XLWA 4U5GA 4NY3A 1UG7A 2CNWA 3C63A 4FESA 4GYTA 5CI8A 1TWHA 1QVXA 2CNWD 2MHRA 2I15A 2R7OA 3GWNA 3W4YA 3ZSUA 2YL7A 3JYYA 1SR2A 4J32B 4JJGA 5L3VA 4BEJA 4DXWA 4NTAA 3GM3A 4YT5A 1ST6A 2R7SA 5EHHA 3I4UA 4N6HA 2XSEA 1H6GA 2GAQA 1ZVZA 3Q6MA 1XZQA 5B1BC 1T5OA 3K66A 2XL4A 4EUKB 1G4WR 2VH3A 3LLIA 1JPNA 4MQ9F 3ABKC 2LFFA 3AQCA 4JCZA 1G5ZA 4P6IC 2JD3A 1VLSA 3HNIA 1EI7A 1U89A 3E9VA 1SYQA 3EG9A 3K33A 3LESA 1WN0A 4Z9IA 1R5ID 5JT4A 1QSPA 4EBKA 1HE1A 4OD5A 1D0YA 1T6QA 3AG2C 4LACB 1AEPA 1MMAA 2IXMA 3WG7C 3QTHA 2OQMA 1NLXA 1UFBA 1ORJA 2A6HF 2Q00A 1YA9A 3TOMA 3EJNA 1RKEB 2LSEA 4ULWA 4CS8C 1TKNA 4CS7A 4FAPB 4Q5SF 4DRIB 2XM4A 1OKKA 1GGQA 3TK0A 1AVOB 2Y39A 4BJ5C 1YVIA 1M56C 1OKKD 1YYXA 4JURI 4O79A 4QI0A 1LM3B 4NTBA 4Q4ZF 2CYDA 1IZMA 1Z6AA 2Y3DA 3CEXA 2HSBA 2AWCA 3B9QA 3EG9B 2XLMA 2R9RB 2GFHA 3NMJA 1FMVA 2IOQA 3MX3A 3Q7GA 4G0HA 3AJMA 4RDAA 2HUJA 3R7CA 3U3FA 4C3DA 1VYKA 4I44A 2YZSA 4YWQA 3RVYA 3ZTZA 1FAPB 2VASA 1MNEA 5IY5C 2R7QA 3K1IA 3NG1A 3B71A 3NYJA 4C3BA 2O9XA 3ATPA 5B3SC 4B6IA 4AL0A 3G4XA 4HFFB 2BC5A 1O3UA 3G50A 2X0CA 1VOMA 1YDIA 2J7PA 1HMOA 2EINC 4CDYA 2NPUA 2ZPAA 3EGDB 4E17A 3JYHA 4BJ6C 1NBBA 2EPKX 3EFOA 4KBLA 4JTCB 3C18A 3EGXB 3S90A 1Z23A 3RIPA 3UGPA 3EZHA 1Q0FA 2I8BA 2Y3HA 4I1MA 4U5BE 2YHSA 1LPEA 1V4AA 2IXOA 3AQBA 4G7ZF 4GQHA 5FZTA 2OJED 1JAFA 1OW6A 2IBFA 2PBEA 4JCHA 4EKWA 1HW1A 2P7VA 1JPJA 2IYLD 3GANA 4LLEA 1XZPA 2J0WA 1YYJA 3C8GB 1D0XA 3NKEA 4H54A 4DRJB 4MTFA 5KYWA 3SXZA 3DAFA 5L0HA 2YLDA 4JW1A 4OINF 2ETSA 1PD1A 1JMWA 2VCCA 3QMKA 4XPXA 1MMDA 4DOZA 1O87A 2ZD9A 3QZCA 5E3AA 1FTSA 2J9WA 5KYYA 2KW3C 1M2VA 5E2QA 2B0HA 3KMIA 3T6BA 4AX2A 4CIPA 1YARO 2HKVA 4XWJA 1FFTC 3T9OA 2YQYA 4KC9A 3K1HA 1HMDA 2CW0F 3GM2A 1E83A 1TWGA 3L1MA 1AUEA 2W4BA 4CIHA 4R32A 5A69A 1LKXA 4E18A 3NMKA 2XS1A 4OIRF 3WHNA 1MQVA 1U6HA 3GORA 5KYXB 2H8AA 1M2OA 4HFKB 3MYFA 2HV7A 3C8ZA 3Q6NA 5AC4A 2KGOA 3SNHA 2EIJC 1MNDA 1Q0MA 5JLIA 5T3WA 2PNOA 5BQGA 2V26A 4K0DA 4Q7CA 2KNHA 3SXKA 5CI9A 1RMVA 2G62A 5KYYB 2WL8A 2A68F 2OEVA 3V7OA 4ANJA 2R7TA 5JSLA 2QLAA 1Z63A 2HV6A 3HJCA 1OR2A 3I5PA 3UMIA 2R7UA 4U9DA 3TJ6A 4O6YA 3SZRA 5E33A 2L6FA 2XLOA 3RFYA 1LE4A 4DVZA 3RVZA 1I4YA 2YL1A 3OA1A 2NG1A 4G78A 4I3MA 2AU5A 3ZIBA 3ZQYA 1OR3A 3KPHA 3GEHA 1A41A 1NFOA 4JJFA 4YJWA 1QKRA 2Q3TA 2R25A 2R02A 3OEOA 2NSGA 1TR2A 4QDLA 2LFDA 5COMA
chains in the Genus database with same CATH topology
2C03A 4IRUA 4EWCA 4U5DE 4BJTA 2EIMC 4M63A 2G3VA 1PD0A 1J8MF 1O5HA 4IWBA 3POVA 3EH2A 2KJGA 4CSAC 1ZHTA 3VYWA 4OIOF 2R7VA 1SZIA 1IW7F 2NUTB 4RBNA 4DBQA 2WVNA 1D1AA 5B1AC 2E87A 4O7GA 4HE8D 4AE4A 3JCUQ 3DJNB 4CBEA 1MMGA 2QY9A 1S7ZA 3CSKA 4U5CE 2R7WA 4PJNA 4YN0B 4E7SA 3DM9B 1J8YF 3DZAA 3S27A 4CS9C 2XXAA 4X0RA 2WVQA 3HLZA 2WVOA 2Q9AA 2NUPA 2WZGA 3ASNC 3ITFA 1W2WA 2VB6A 3SYNA 5F5FA 4XTKA 2MYSA 3UR3C 2CGEA 3F46A 3PHF2 1NU9C 3EHNA 4KNWA 3TD7A 3F47A 3EH1A 3UMKA 2V3CC 2PF4E 2J7PD 3WODF 1ZYRF 1VMAA 2W4MA 3LS0A 4QI2A 4OIPF 2Y69C 4KI2A 2WZFA 3JT1A 3ZG1A 4LLCA 5DS4A 2PP4A 3LAYA 5DVWA 1FMWA 4FWVA 4YT8A 2IXPA 4PJMA 1KU2A 4I1OB 1TWCA 2C04A 1SMYF 3W8IA 4C7OA 5EGYA 2H7BA 1WGWA 4HEAJ 4U5HA 5DQZA 3EFOB 5T1DB 2XRHA 4IJJA 4WJ0A 3W2VA 4AK9A 3ZVRA 4LERA 3S0XA 2ZXWC 3VAYA 4N06A 2BE5F 4IAOA 3N0TA 3EPVA 4CS8A 1NG1A 2OCCC 4PK4A 5KYWB 4OIQF 4BJ5A 4FX5A 3LEVA 2J45A 4K7BA 3AG1C 1M2VB 4PFPA 2OG2A 3FVYA 5KYUA 1D1BA 1RJ9A 4MNDA 5D91A 3E70C 1BR1A 5DS6A 3IEEA 3SEOA 3EQLF 4U5FE 4H4KC 1D1CA 3KL4A 3EHMA 1V55C 2W45A 1LVKA 2H7VC 3L0IA 3RH3A 1M57C 2P6VA 5T3TA 1VK5A 3LS1A 5FCLA 3M1CB 2ZXPA 4DVYP 2EILC 3ZC4A 3NDBB 1OCCC 2WB7A 1ZHWA 5D92A 3DMDA 3T4RA 1Z5ZA 3S28A 3ABMC 4C3EA 1QLEC 1V54C 3FAJA 1OCZC 3DAGA 4ZLCA 5HSWA 3B0VC 4G7HF 2PFDA 3O6XA 3N2ZB 3DJUB 3AG3C 5DLJA 1N1CA 4XLPF 3B0UX 1ZHZA 2PX3A 5E3CA 1ZU4A 1OCOC 4GEHA 3UMHA 4AE4B 4U5EE 3LJBA 4A2NB 3DM5A 2G3KA 2L81A 3X1OA 5DS5A 3B0PA 1PCXA 3N24A 3LNRA 2DYSC 2R7XA 3K6BA 1FFHA 1BR4A 2Y3GA 1ZU5A 2J9UA 3W2WA 3JRTA 4EBBA 3LLKA 3EGDA 2QTVA 2PX0A 2XXAB 3S29A 3UGOA 3EGXA 4BG0A 3DXJF 2M4EA 3ECSA 4JVSA 5DQTA 5BUOA 4W8KA 1Z3IX 2NUPB 2DGJA 4OD4A 2W9YA 2ZXOA 2FFHA 3EZIA 3Q7LA 3PMRA 4CSAA 2J0XA 3KKBA 3ABLC 3KH2A 2KQ9A 3CZ6A 3JSZA 2A69F 4JZAA 4E7ZA 2Q9CA 2B0JA 4YT4A 2EIKC 2L9JA 3I5QA 4G7OF 3O39A 4YT2A 1NZEA 1BR2A 1NU7D 2J46A 3DD7A 1ZHXA 2Y3BA 4RD9A 1G8XA 3L34A 2X51A 1VYIA 5KYXA 4PJLA 1MMNA 3AG4C 3RYLA 3CQZA 2R7RA 2MWQA 4O6MA 2J9VA 4C7OB 4CS9A 4ZLDA 3NKDA 5L3QA 1D0ZA 2IXNA 3X2QC 1SF8A 2YEVA 1QZXA 2FGYA 2Z15A 1OCRC 2WZLA 4DBRA 3NRHA 2D5RB 4J30B 4KNVA 3UNGC 3ASOC 3NYLA 2Q9BA 4PFOA 3T6JA 4O6NA 1LS1A 5KYNA 2DYRC 3OWTA 4BJ1A 4PJJA 3SP1A 3NYMA 2A6EF 4XLNF 5KYUB 2CDQA 2A1DD 4F4BA 3K1IC 1RJ9B 3HTKC 3W8HA 3MLGA 2H7OA 3GODA 2NUTA 3RKOF 5F5HA 1ZHYA 3K7DA 3FDQA 3H65A 2ZXRA 1TWAA 3FHDA 4U5GA 4NY3A 2CNWA 4FESA 4GYTA 5CI8A 1TWHA 2CNWD 2R7OA 3ZSUA 4J32B 4JJGA 5L3VA 4BEJA 2R7SA 4YT5A 1ST6A 5EHHA 3I4UA 2XSEA 3Q6MA 5B1BC 3K66A 2XL4A 2VH3A 3LLIA 1JPNA 4MQ9F 3ABKC 3AQCA 4P6IC 2JD3A 3E9VA 3EG9A 3K33A 3LESA 4OD5A 1D0YA 3AG2C 4LACB 1MMAA 2IXMA 3WG7C 2A6HF 3EJNA 2LSEA 4ULWA 4CS8C 1TKNA 4CS7A 4Q5SF 1OKKA 2Y39A 4BJ5C 1M56C 1OKKD 4JURI 4O79A 4QI0A 4Q4ZF 2Y3DA 1IZMA 1Z6AA 3B9QA 3EG9B 2GFHA 1FMVA 2IOQA 3MX3A 3Q7GA 4G0HA 4RDAA 4C3DA 1VYKA 4I44A 2YZSA 4YWQA 2VASA 1MNEA 5IY5C 2R7QA 3NG1A 3NYJA 4C3BA 2O9XA 5B3SC 4B6IA 4HFFB 1VOMA 2J7PA 2EINC 2ZPAA 3EGDB 3JYHA 4BJ6C 3EFOA 4KBLA 3EGXB 1Z23A 3RIPA 3UGPA 3EZHA 2I8BA 2Y3HA 4I1MA 4U5BE 2YHSA 4G7ZF 3AQBA 2IXOA 4JCHA 2P7VA 1JPJA 2IYLD 3GANA 4LLEA 2J0WA 1D0XA 3NKEA 5KYWA 3DAFA 4JW1A 4OINF 3QMKA 1PD1A 4DOZA 1MMDA 1O87A 3QZCA 5E3AA 1FTSA 2J9WA 5KYYA 2KW3C 1M2VA 5E2QA 3KMIA 3T6BA 4AX2A 4XWJA 1FFTC 4KC9A 3K1HA 2CW0F 1TWGA 2W4BA 4CIHA 1LKXA 4OIRF 5KYXB 1M2OA 4HFKB 3Q6NA 2HV7A 2KGOA 3SNHA 2EIJC 1MNDA 5T3WA 2V26A 4K0DA 4Q7CA 2KNHA 5CI9A 2G62A 5KYYB 2WL8A 2A68F 3V7OA 4ANJA 2R7TA 1Z63A 2HV6A 3HJCA 3I5PA 3UMIA 2R7UA 4O6YA 3SZRA 5E33A 3RFYA 4DVZA 3OA1A 2NG1A 4I3MA 3ZIBA 4YJWA 4JJFA 2Q3TA 3OEOA 1TR2A 4QDLA 4BJ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CS7 A;  2L9J A;  4C3E A;  4C3B A;  4CS8 A;  4C3D A;  4CS9 C;  4CSA C;  4CSA A;  4CS9 A;  4CS8 C; 
#chains in the Genus database with same CATH topology
 2C03 A;  4IRU A;  3ZTM A;  2KC3 A;  4EWC A;  4U5D E;  4BJT A;  2EIM C;  2A0B A;  4M63 A;  2G3V A;  4N4W A;  3MBG A;  3FMS A;  3SXY A;  3IQ5 A;  1PD0 A;  1J8M F;  1O5H A;  1B68 A;  4IWB A;  3POV A;  3EH2 A;  2KJG A;  4CSA C;  2LQG A;  4MVM A;  1ZHT A;  4JEA A;  3VYW A;  3DE8 A;  3JTL O;  4OIO F;  1QPU A;  2LCH A;  2LIG A;  2R7V A;  1SZI A;  1IW7 F;  1JOG A;  1L3P A;  2XL6 A;  2NUT B;  1WAT A;  4RBN A;  1LIH A;  4DBQ A;  1KNY A;  1D1A A;  2WVN A;  3CAX A;  5B1A C;  1E86 A;  2VCA A;  2E87 A;  4O7G A;  4NTF A;  4D4N A;  4N6C A;  5GPG B;  1TFO B;  3IPM O;  4HE8 D;  3GWL A;  3JCU Q;  3QVY A;  4AE4 A;  1S05 A;  3U2L A;  3DJN B;  1C17 M;  1YZC A;  4CBE A;  1MMG A;  2QY9 A;  1EQ1 A;  3DKA A;  3JZ0 A;  5K0I A;  1S7Z A;  3CSK A;  2L7A A;  3HNJ A;  5A6A A;  5JRA A;  5L0G A;  5L0J A;  3H2U A;  1GQA A;  2UUH A;  3IHU A;  4U5C E;  4J7T A;  2R7W A;  4PJN A;  1I4Z A;  4YN0 B;  3U8V A;  4IB4 A;  3RQG A;  4E7S A;  3DM9 B;  3U5S A;  1J8Y F;  3DZA A;  3S27 A;  4CS9 C;  2XXA A;  4X0R A;  3QW0 A;  4JTA B;  2WVQ A;  3ZWI A;  1CPR A;  5JUA A;  3HLZ A;  1Y6D A;  2NSF A;  4MVQ A;  1TQG A;  3RQF A;  2WVO A;  3U0C A;  4JC7 A;  2Q9A A;  2NUP A;  2WZG A;  2D4U A;  3ASN C;  3ITF A;  1W2W A;  2VB6 A;  3SYN A;  4MTO A;  5F5F A;  2JPU A;  4LDK A;  4XTK A;  2EPM X;  2MYS A;  3UR3 C;  2CGE A;  3F46 A;  5HV9 A;  3PHF 2;  1NU9 C;  3IQT A;  2P61 A;  1Q0G A;  3EHN A;  3AGT A;  3S84 A;  2GDC A;  1EA8 A;  4KNW A;  3TD7 A;  1HY5 A;  3F47 A;  2HZ8 A;  3U9J A;  2LP4 A;  3EH1 A;  3UMK A;  2V3C C;  3FXH A;  3LUT B;  3C7J A;  2PF4 E;  5A6K A;  2J7P D;  3WOD F;  1ZYR F;  1VMA A;  2W4M A;  3LS0 A;  2YRF A;  4E0I A;  4OIP F;  3V5Z A;  4QI2 A;  1RKC A;  1LI5 A;  2Y69 C;  2TMV P;  4KI2 A;  2WZF A;  4P9T A;  3T6G B;  3JT1 A;  3ZG1 A;  2CCY A;  4LLC A;  5DS4 A;  2PP4 A;  2EPL X;  2DI3 A;  3LAY A;  3DE9 A;  5DVW A;  3ZDL A;  3M4B A;  1FMW A;  2QUP A;  3L8J A;  1T01 A;  3RW0 A;  4FWV A;  4YT8 A;  2IXP A;  5AGF A;  1Z7Q c;  4PJM A;  1KU2 A;  2RD9 A;  4I1O B;  4JIO A;  1VTM P;  1TWC A;  2C04 A;  1SMY F;  3W8I A;  5BQI A;  2FAP B;  3FAP B;  4CJO A;  5EGY A;  4C7O A;  2H7B A;  1WGW A;  3TUL A;  4HEA J;  1YA7 O;  3US6 A;  4U5H A;  2VC9 A;  5DQZ A;  1K05 A;  3EFO B;  5T1D B;  2HFI A;  3HNL A;  2XRH A;  4IJJ A;  4P9F A;  3M15 A;  3FOO A;  4WJ0 A;  3W2V A;  4AK9 A;  4JEB A;  3ZVR A;  1CGN A;  4MVR A;  4LER A;  3S0X A;  4PAC A;  2ZXW C;  3VAY A;  4N06 A;  2BE5 F;  4IAO A;  4YK5 A;  3N0T A;  3EPV A;  3S9O A;  4AL1 A;  1NG1 A;  4CS8 A;  2OCC C;  2LK4 A;  2KSF A;  4PK4 A;  3BRJ A;  5KYW B;  1C02 A;  3M79 A;  1ZW2 A;  4OIQ F;  4IGG A;  2R05 A;  4BJ5 A;  4FX5 A;  3LEV A;  3KYJ A;  2J45 A;  4NQF A;  4EBJ A;  4K7B A;  2HSQ A;  4PR9 A;  5TJ5 E;  3U9M A;  1A7D A;  3AG1 C;  4K1O A;  1E85 A;  1M2V B;  1H9G A;  4PFP A;  2OG2 A;  3FVY A;  1Q0K A;  1G4U S;  3TJ5 A;  1FR0 A;  5KYU A;  5A6J A;  1D1B A;  3RQE A;  1RJ9 A;  4MND A;  5D91 A;  4E0H A;  3BEH A;  2J8W A;  1BR1 A;  3E70 C;  1L7C A;  1K04 A;  4MVZ A;  5JP7 A;  5DS6 A;  3J06 A;  3KYI A;  3IEE A;  3MFN A;  3SEO A;  4EIY A;  3EQL F;  3GEE A;  4U5F E;  2AP3 A;  1QQ3 A;  4H4K C;  1CGO A;  4BJ6 A;  4LDR A;  2Q7R A;  1D1C A;  5L0F A;  2L6H A;  3KL4 A;  1XWJ A;  4JKV A;  3EHM A;  1LI7 A;  2XLH A;  4MVO A;  2EPN A;  1V55 C;  2W45 A;  4JRZ A;  3PDM P;  1LVK A;  2H7V C;  1OXB A;  3L0I A;  4CX9 A;  4BPM A;  3RH3 A;  2RSE B;  1DOW A;  1M57 C;  2P6V A;  5T3T A;  3G4Z A;  2ASR A;  1F1M A;  1A7V A;  1VK5 A;  3LS1 A;  5FCL A;  3M1C B;  1ORY A;  5COG A;  4MW3 A;  2OKU A;  2DB4 A;  1V74 B;  1ZW3 A;  2ZXP A;  5F28 E;  4DVY P;  2EIL C;  1YAU O;  1T9K A;  3ZC4 A;  3NDB B;  1OCC C;  2WB7 A;  1ZHW A;  3GM1 A;  1BBH A;  4JE9 A;  5D92 A;  3JRM O;  3AOU A;  3DMD A;  3U2M A;  2YL0 A;  1VLT A;  3T4R A;  3U8P A;  1Z5Z A;  4ULV A;  3S28 A;  3O55 A;  3ABM C;  4C3E A;  1QLE C;  3O10 A;  3SXM A;  1V54 C;  2OU6 A;  3QW1 A;  3B29 A;  2P0N A;  3RF3 A;  3FAJ A;  1OCZ C;  1RKE A;  3DAG A;  3ZQV A;  4ZLC A;  5HSW A;  4G7H F;  1TFK B;  3B0V C;  1H9T A;  1FNT c;  2UUI A;  4YL3 A;  5BQH A;  2PFD A;  4A4A A;  5L0I A;  3O6X A;  1WAS A;  2XM0 A;  4XQ1 A;  3DI5 A;  3N2Z B;  3DJU B;  3AG3 C;  4CDV A;  5A6B A;  3LNM B;  1I5N A;  1N1C A;  4XPY A;  4JTD B;  1YJG A;  5DLJ A;  4XLP F;  3B0U X;  1ZHZ A;  2PX3 A;  3V5X A;  5A6B D;  1WWP A;  5E3C A;  5B3I A;  1OXK A;  3FOP A;  1ZU4 A;  1OCO C;  4GEH A;  3UMH A;  2QNL A;  3LEO A;  2YKZ A;  4AE4 B;  1Y4C A;  3AGU A;  3LJB A;  4U5E E;  4A2N B;  2ICW G;  3DM5 A;  1NSG B;  2G3K A;  2L81 A;  3X1O A;  2YWA A;  1HE9 A;  3B0P A;  1PCX A;  3VRC A;  1WTY A;  2OJQ A;  4EHP A;  5DS5 A;  3N24 A;  3HNK A;  3LNR A;  2DYS C;  2R7X A;  3K6B A;  4BEM J;  1FFH A;  1BR4 A;  2Y3G A;  1ZU5 A;  1Q0D A;  2J9U A;  2XL8 A;  2YLG A;  3JRT A;  3NMI A;  4MW8 A;  3W2W A;  2XS8 A;  1VB5 A;  3GEI A;  4DRH B;  4EBB A;  3LLK A;  2OEX A;  1GS9 A;  2YL3 A;  3EGD A;  2QTV A;  1R4T A;  2PX0 A;  4XEF A;  1RCP A;  4U9E A;  3S29 A;  3EGX A;  3MYI A;  3UGO A;  2XXA B;  1LS4 A;  4UDV A;  3IQ6 A;  4BG0 A;  3V5Y A;  3DXJ F;  2M64 A;  2YVK A;  4XEK A;  4XEV A;  2M4E A;  3ECS A;  4JVS A;  5DQT A;  5BUO A;  4W8K A;  1Z3I X;  2NUP B;  2DGJ A;  2J9B A;  4OD4 A;  2W9Y A;  5L0D A;  4D4X A;  1GM5 A;  1OQC A;  2FFH A;  2EPO A;  2ZXO A;  3EZI A;  3Q7L A;  1KTM A;  3C8G A;  3PMR A;  4CSA A;  2J0X A;  3KKB A;  2KK1 A;  3ABL C;  3KH2 A;  2KQ9 A;  2L6G A;  3CZ6 A;  3C8G D;  3JSZ A;  4J7Y A;  256B A;  2A69 F;  5COF A;  3JSE O;  4JZA A;  2AWY A;  4WAB A;  2Q9C A;  4E7Z A;  2B0J A;  2HJ3 A;  2GA0 A;  4YT4 A;  2EIK C;  2L9J A;  2OOC A;  3I5Q A;  4G7O F;  1APC A;  1LE2 A;  4W8P A;  3O39 A;  4WGZ A;  3WAQ A;  4YT2 A;  3TQO A;  1NZE A;  1ZZP A;  2YLI A;  1BR2 A;  1E84 A;  1K40 A;  1NU7 D;  2J46 A;  2BL2 A;  3DD7 A;  3QVZ A;  1ZHX A;  2XLD A;  2Y3B A;  4RD9 A;  1G8X A;  1BDJ B;  2HS5 A;  3L34 A;  2X51 A;  5AC5 A;  1VYI A;  3C62 A;  4YL0 A;  1T6I A;  2AVK A;  4PJL A;  5KYX A;  1DOV A;  3H2V A;  1MMN A;  2HMZ A;  4XPW A;  4YL1 A;  2GWW A;  5JS5 A;  3AG4 C;  3RYL A;  2XLE A;  1M6T A;  3CQZ A;  2R7R A;  2XLV A;  4Z9H A;  1U0B B;  3IQC A;  2MWQ A;  1WOL A;  4O6M A;  2J9V A;  5L0C A;  4C7O B;  1OW8 A;  2VCB A;  4CS9 A;  1HW2 A;  4ZLD A;  4DJ9 A;  3NKD A;  1JR8 A;  1D0Z A;  2IXN A;  3A9C A;  1A0B A;  3X2Q C;  1SF8 A;  2YEV A;  5L3Q A;  4Z9J A;  2IM8 A;  1QZX A;  2FGY A;  2Z15 A;  3TOL A;  1H7I A;  1OCR C;  2HMQ A;  3PCV A;  4MVU A;  2WZL A;  4DBR A;  3NRH A;  1A7E A;  2A0U A;  2D5R B;  2HJM A;  3DWW A;  4J30 B;  1NFN A;  4KNV A;  3UNG C;  4ER9 A;  3ASO C;  4IAR A;  3NYL A;  2Q9B A;  2P1A A;  1OW7 A;  3M4C A;  5EK0 A;  4PFO A;  3T6J A;  1T6U A;  2KYH A;  4NC3 A;  4O6N A;  4NCQ A;  4L6R A;  1LS1 A;  5KYN A;  1CPQ A;  2DYR C;  2JX0 A;  3OWT A;  1EKY A;  4BJ1 A;  1JRA A;  4LDQ A;  4PJJ A;  4CJG A;  2LD6 A;  2F22 A;  3SP1 A;  5JVE A;  3NYM A;  4MVS A;  2A6E F;  4MTG A;  1RXQ A;  1BZ4 A;  4ONS A;  1C03 A;  3HKK A;  4WGY A;  2CDQ A;  4XLN F;  2A1D D;  5KYU B;  1E2X A;  4F4B A;  3K1I C;  1RJ9 B;  3HTK C;  2Q4F A;  3MLG A;  3W8H A;  1CGM E;  1YLM A;  3VM6 A;  3L8I A;  3VF0 A;  3A11 A;  2H7O A;  3GOD A;  4IAQ A;  2NUT A;  3RKO F;  5F5H A;  1ZHY A;  2R03 A;  3K7D A;  3U3B A;  3FDQ A;  3H65 A;  1ORS C;  2QE9 A;  2ZXR A;  4CDA A;  1PV3 A;  1TWA A;  3R2P A;  5CIV A;  3FHD A;  4MS2 A;  1YZA A;  2XLW A;  4U5G A;  4NY3 A;  1UG7 A;  2CNW A;  3C63 A;  4FES A;  4GYT A;  5CI8 A;  1TWH A;  1QVX A;  2CNW D;  2MHR A;  2I15 A;  2R7O A;  3GWN A;  3W4Y A;  3ZSU A;  2YL7 A;  3JYY A;  1SR2 A;  4J32 B;  4JJG A;  5L3V A;  4BEJ A;  4DXW A;  4NTA A;  3GM3 A;  4YT5 A;  1ST6 A;  2R7S A;  5EHH A;  3I4U A;  4N6H A;  2XSE A;  1H6G A;  2GAQ A;  1ZVZ A;  3Q6M A;  1XZQ A;  5B1B C;  1T5O A;  3K66 A;  2XL4 A;  4EUK B;  1G4W R;  2VH3 A;  3LLI A;  1JPN A;  4MQ9 F;  3ABK C;  2LFF A;  3AQC A;  4JCZ A;  1G5Z A;  4P6I C;  2JD3 A;  1VLS A;  3HNI A;  1EI7 A;  1U89 A;  3E9V A;  1SYQ A;  3EG9 A;  3K33 A;  3LES A;  1WN0 A;  4Z9I A;  1R5I D;  5JT4 A;  1QSP A;  4EBK A;  1HE1 A;  4OD5 A;  1D0Y A;  1T6Q A;  3AG2 C;  4LAC B;  1AEP A;  1MMA A;  2IXM A;  3WG7 C;  3QTH A;  2OQM A;  1NLX A;  1UFB A;  1ORJ A;  2A6H F;  2Q00 A;  1YA9 A;  3TOM A;  3EJN A;  1RKE B;  2LSE A;  4ULW A;  4CS8 C;  1TKN A;  4CS7 A;  4FAP B;  4Q5S F;  4DRI B;  2XM4 A;  1OKK A;  1GGQ A;  3TK0 A;  1AVO B;  2Y39 A;  4BJ5 C;  1YVI A;  1M56 C;  1OKK D;  1YYX A;  4JUR I;  4O79 A;  4QI0 A;  1LM3 B;  4NTB A;  4Q4Z F;  2CYD A;  1IZM A;  1Z6A A;  2Y3D A;  3CEX A;  2HSB A;  2AWC A;  3B9Q A;  3EG9 B;  2XLM A;  2R9R B;  2GFH A;  3NMJ A;  1FMV A;  2IOQ A;  3MX3 A;  3Q7G A;  4G0H A;  3AJM A;  4RDA A;  2HUJ A;  3R7C A;  3U3F A;  4C3D A;  1VYK A;  4I44 A;  2YZS A;  4YWQ A;  3RVY A;  3ZTZ A;  1FAP B;  2VAS A;  1MNE A;  5IY5 C;  2R7Q A;  3K1I A;  3NG1 A;  3B71 A;  3NYJ A;  4C3B A;  2O9X A;  3ATP A;  5B3S C;  4B6I A;  4AL0 A;  3G4X A;  4HFF B;  2BC5 A;  1O3U A;  3G50 A;  2X0C A;  1VOM A;  1YDI A;  2J7P A;  1HMO A;  2EIN C;  4CDY A;  2NPU A;  2ZPA A;  3EGD B;  4E17 A;  3JYH A;  4BJ6 C;  1NBB A;  2EPK X;  3EFO A;  4KBL A;  4JTC B;  3C18 A;  3EGX B;  3S90 A;  1Z23 A;  3RIP A;  3UGP A;  3EZH A;  1Q0F A;  2I8B A;  2Y3H A;  4I1M A;  4U5B E;  2YHS A;  1LPE A;  1V4A A;  2IXO A;  3AQB A;  4G7Z F;  4GQH A;  5FZT A;  2OJE D;  1JAF A;  1OW6 A;  2IBF A;  2PBE A;  4JCH A;  4EKW A;  1HW1 A;  2P7V A;  1JPJ A;  2IYL D;  3GAN A;  4LLE A;  1XZP A;  2J0W A;  1YYJ A;  3C8G B;  1D0X A;  3NKE A;  4H54 A;  4DRJ B;  4MTF A;  5KYW A;  3SXZ A;  3DAF A;  5L0H A;  2YLD A;  4JW1 A;  4OIN F;  2ETS A;  1PD1 A;  1JMW A;  2VCC A;  3QMK A;  4XPX A;  1MMD A;  4DOZ A;  1O87 A;  2ZD9 A;  3QZC A;  5E3A A;  1FTS A;  2J9W A;  5KYY A;  2KW3 C;  1M2V A;  5E2Q A;  2B0H A;  3KMI A;  3T6B A;  4AX2 A;  4CIP A;  1YAR O;  2HKV A;  4XWJ A;  1FFT C;  3T9O A;  2YQY A;  4KC9 A;  3K1H A;  1HMD A;  2CW0 F;  3GM2 A;  1E83 A;  1TWG A;  3L1M A;  1AUE A;  2W4B A;  4CIH A;  4R32 A;  5A69 A;  1LKX A;  4E18 A;  3NMK A;  2XS1 A;  4OIR F;  3WHN A;  1MQV A;  1U6H A;  3GOR A;  5KYX B;  2H8A A;  1M2O A;  4HFK B;  3MYF A;  2HV7 A;  3C8Z A;  3Q6N A;  5AC4 A;  2KGO A;  3SNH A;  2EIJ C;  1MND A;  1Q0M A;  5JLI A;  5T3W A;  2PNO A;  5BQG A;  2V26 A;  4K0D A;  4Q7C A;  2KNH A;  3SXK A;  5CI9 A;  1RMV A;  2G62 A;  5KYY B;  2WL8 A;  2A68 F;  2OEV A;  3V7O A;  4ANJ A;  2R7T A;  5JSL A;  2QLA A;  1Z63 A;  2HV6 A;  3HJC A;  1OR2 A;  3I5P A;  3UMI A;  2R7U A;  4U9D A;  3TJ6 A;  4O6Y A;  3SZR A;  5E33 A;  2L6F A;  2XLO A;  3RFY A;  1LE4 A;  4DVZ A;  3RVZ A;  1I4Y A;  2YL1 A;  3OA1 A;  2NG1 A;  4G78 A;  4I3M A;  2AU5 A;  3ZIB A;  3ZQY A;  1OR3 A;  3KPH A;  3GEH A;  1A41 A;  1NFO A;  4JJF A;  4YJW A;  1QKR A;  2Q3T A;  2R25 A;  2R02 A;  3OEO A;  2NSG A;  1TR2 A;  4QDL A;  2LFD A;  5COM A; 
#chains in the Genus database with same CATH homology
 2C03 A;  4IRU A;  4EWC A;  4U5D E;  4BJT A;  2EIM C;  4M63 A;  2G3V A;  1PD0 A;  1J8M F;  1O5H A;  4IWB A;  3POV A;  3EH2 A;  2KJG A;  4CSA C;  1ZHT A;  3VYW A;  4OIO F;  2R7V A;  1SZI A;  1IW7 F;  2NUT B;  4RBN A;  4DBQ A;  2WVN A;  1D1A A;  5B1A C;  2E87 A;  4O7G A;  4HE8 D;  4AE4 A;  3JCU Q;  3DJN B;  4CBE A;  1MMG A;  2QY9 A;  1S7Z A;  3CSK A;  4U5C E;  2R7W A;  4PJN A;  4YN0 B;  4E7S A;  3DM9 B;  1J8Y F;  3DZA A;  3S27 A;  4CS9 C;  2XXA A;  4X0R A;  2WVQ A;  3HLZ A;  2WVO A;  2Q9A A;  2NUP A;  2WZG A;  3ASN C;  3ITF A;  1W2W A;  2VB6 A;  3SYN A;  5F5F A;  4XTK A;  2MYS A;  3UR3 C;  2CGE A;  3F46 A;  3PHF 2;  1NU9 C;  3EHN A;  4KNW A;  3TD7 A;  3F47 A;  3EH1 A;  3UMK A;  2V3C C;  2PF4 E;  2J7P D;  3WOD F;  1ZYR F;  1VMA A;  2W4M A;  3LS0 A;  4QI2 A;  4OIP F;  2Y69 C;  4KI2 A;  2WZF A;  3JT1 A;  3ZG1 A;  4LLC A;  5DS4 A;  2PP4 A;  3LAY A;  5DVW A;  1FMW A;  4FWV A;  4YT8 A;  2IXP A;  4PJM A;  1KU2 A;  4I1O B;  1TWC A;  2C04 A;  1SMY F;  3W8I A;  4C7O A;  5EGY A;  2H7B A;  1WGW A;  4HEA J;  4U5H A;  5DQZ A;  3EFO B;  5T1D B;  2XRH A;  4IJJ A;  4WJ0 A;  3W2V A;  4AK9 A;  3ZVR A;  4LER A;  3S0X A;  2ZXW C;  3VAY A;  4N06 A;  2BE5 F;  4IAO A;  3N0T A;  3EPV A;  4CS8 A;  1NG1 A;  2OCC C;  4PK4 A;  5KYW B;  4OIQ F;  4BJ5 A;  4FX5 A;  3LEV A;  2J45 A;  4K7B A;  3AG1 C;  1M2V B;  4PFP A;  2OG2 A;  3FVY A;  5KYU A;  1D1B A;  1RJ9 A;  4MND A;  5D91 A;  3E70 C;  1BR1 A;  5DS6 A;  3IEE A;  3SEO A;  3EQL F;  4U5F E;  4H4K C;  1D1C A;  3KL4 A;  3EHM A;  1V55 C;  2W45 A;  1LVK A;  2H7V C;  3L0I A;  3RH3 A;  1M57 C;  2P6V A;  5T3T A;  1VK5 A;  3LS1 A;  5FCL A;  3M1C B;  2ZXP A;  4DVY P;  2EIL C;  3ZC4 A;  3NDB B;  1OCC C;  2WB7 A;  1ZHW A;  5D92 A;  3DMD A;  3T4R A;  1Z5Z A;  3S28 A;  3ABM C;  4C3E A;  1QLE C;  1V54 C;  3FAJ A;  1OCZ C;  3DAG A;  4ZLC A;  5HSW A;  3B0V C;  4G7H F;  2PFD A;  3O6X A;  3N2Z B;  3DJU B;  3AG3 C;  5DLJ A;  1N1C A;  4XLP F;  3B0U X;  1ZHZ A;  2PX3 A;  5E3C A;  1ZU4 A;  1OCO C;  4GEH A;  3UMH A;  4AE4 B;  4U5E E;  3LJB A;  4A2N B;  3DM5 A;  2G3K A;  2L81 A;  3X1O A;  5DS5 A;  3B0P A;  1PCX A;  3N24 A;  3LNR A;  2DYS C;  2R7X A;  3K6B A;  1FFH A;  1BR4 A;  2Y3G A;  1ZU5 A;  2J9U A;  3W2W A;  3JRT A;  4EBB A;  3LLK A;  3EGD A;  2QTV A;  2PX0 A;  2XXA B;  3S29 A;  3UGO A;  3EGX A;  4BG0 A;  3DXJ F;  2M4E A;  3ECS A;  4JVS A;  5DQT A;  5BUO A;  4W8K A;  1Z3I X;  2NUP B;  2DGJ A;  4OD4 A;  2W9Y A;  2ZXO A;  2FFH A;  3EZI A;  3Q7L A;  3PMR A;  4CSA A;  2J0X A;  3KKB A;  3ABL C;  3KH2 A;  2KQ9 A;  3CZ6 A;  3JSZ A;  2A69 F;  4JZA A;  4E7Z A;  2Q9C A;  2B0J A;  4YT4 A;  2EIK C;  2L9J A;  3I5Q A;  4G7O F;  3O39 A;  4YT2 A;  1NZE A;  1BR2 A;  1NU7 D;  2J46 A;  3DD7 A;  1ZHX A;  2Y3B A;  4RD9 A;  1G8X A;  3L34 A;  2X51 A;  1VYI A;  5KYX A;  4PJL A;  1MMN A;  3AG4 C;  3RYL A;  3CQZ A;  2R7R A;  2MWQ A;  4O6M A;  2J9V A;  4C7O B;  4CS9 A;  4ZLD A;  3NKD A;  5L3Q A;  1D0Z A;  2IXN A;  3X2Q C;  1SF8 A;  2YEV A;  1QZX A;  2FGY A;  2Z15 A;  1OCR C;  2WZL A;  4DBR A;  3NRH A;  2D5R B;  4J30 B;  4KNV A;  3UNG C;  3ASO C;  3NYL A;  2Q9B A;  4PFO A;  3T6J A;  4O6N A;  1LS1 A;  5KYN A;  2DYR C;  3OWT A;  4BJ1 A;  4PJJ A;  3SP1 A;  3NYM A;  2A6E F;  4XLN F;  5KYU B;  2CDQ A;  2A1D D;  4F4B A;  3K1I C;  1RJ9 B;  3HTK C;  3W8H A;  3MLG A;  2H7O A;  3GOD A;  2NUT A;  3RKO F;  5F5H A;  1ZHY A;  3K7D A;  3FDQ A;  3H65 A;  2ZXR A;  1TWA A;  3FHD A;  4U5G A;  4NY3 A;  2CNW A;  4FES A;  4GYT A;  5CI8 A;  1TWH A;  2CNW D;  2R7O A;  3ZSU A;  4J32 B;  4JJG A;  5L3V A;  4BEJ A;  2R7S A;  4YT5 A;  1ST6 A;  5EHH A;  3I4U A;  2XSE A;  3Q6M A;  5B1B C;  3K66 A;  2XL4 A;  2VH3 A;  3LLI A;  1JPN A;  4MQ9 F;  3ABK C;  3AQC A;  4P6I C;  2JD3 A;  3E9V A;  3EG9 A;  3K33 A;  3LES A;  4OD5 A;  1D0Y A;  3AG2 C;  4LAC B;  1MMA A;  2IXM A;  3WG7 C;  2A6H F;  3EJN A;  2LSE A;  4ULW A;  4CS8 C;  1TKN A;  4CS7 A;  4Q5S F;  1OKK A;  2Y39 A;  4BJ5 C;  1M56 C;  1OKK D;  4JUR I;  4O79 A;  4QI0 A;  4Q4Z F;  2Y3D A;  1IZM A;  1Z6A A;  3B9Q A;  3EG9 B;  2GFH A;  1FMV A;  2IOQ A;  3MX3 A;  3Q7G A;  4G0H A;  4RDA A;  4C3D A;  1VYK A;  4I44 A;  2YZS A;  4YWQ A;  2VAS A;  1MNE A;  5IY5 C;  2R7Q A;  3NG1 A;  3NYJ A;  4C3B A;  2O9X A;  5B3S C;  4B6I A;  4HFF B;  1VOM A;  2J7P A;  2EIN C;  2ZPA A;  3EGD B;  3JYH A;  4BJ6 C;  3EFO A;  4KBL A;  3EGX B;  1Z23 A;  3RIP A;  3UGP A;  3EZH A;  2I8B A;  2Y3H A;  4I1M A;  4U5B E;  2YHS A;  4G7Z F;  3AQB A;  2IXO A;  4JCH A;  2P7V A;  1JPJ A;  2IYL D;  3GAN A;  4LLE A;  2J0W A;  1D0X A;  3NKE A;  5KYW A;  3DAF A;  4JW1 A;  4OIN F;  3QMK A;  1PD1 A;  4DOZ A;  1MMD A;  1O87 A;  3QZC A;  5E3A A;  1FTS A;  2J9W A;  5KYY A;  2KW3 C;  1M2V A;  5E2Q A;  3KMI A;  3T6B A;  4AX2 A;  4XWJ A;  1FFT C;  4KC9 A;  3K1H A;  2CW0 F;  1TWG A;  2W4B A;  4CIH A;  1LKX A;  4OIR F;  5KYX B;  1M2O A;  4HFK B;  3Q6N A;  2HV7 A;  2KGO A;  3SNH A;  2EIJ C;  1MND A;  5T3W A;  2V26 A;  4K0D A;  4Q7C A;  2KNH A;  5CI9 A;  2G62 A;  5KYY B;  2WL8 A;  2A68 F;  3V7O A;  4ANJ A;  2R7T A;  1Z63 A;  2HV6 A;  3HJC A;  3I5P A;  3UMI A;  2R7U A;  4O6Y A;  3SZR A;  5E33 A;  3RFY A;  4DVZ A;  3OA1 A;  2NG1 A;  4I3M A;  3ZIB A;  4YJW A;  4JJF A;  2Q3T A;  3OEO A;  1TR2 A;  4QDL A;  4BJ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...