2XLWA

Cytochrome c prime from alcaligenes xylosoxidans: ferrous r124q variant with bound no
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
125
structure length
125
Chain Sequence
b'EFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYQK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C'
publication title Distal-to-Proximal No Conversion in Hemoproteins: The Role of the Proximal Pocket.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Electron transport
total genus 51
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2010-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 2xlwA00
4U9EA 3M4BA 3C63A 3M79A 3DE8A 4EIYA 3ZQYA 2XLHA 4IB4A 1S05A 3FOOA 3NMKA 3NMJA 1E84A 1E83A 5JS5A 4WGZA 3QW0A 4D4XA 3QVYA 1APCA 1CPQA 2YKZA 5JP7A 4IARA 3ZTMA 2J8WA 2YL1A 3QW1A 4JEAA 4CDVA 3DE9A 4N4WA 2J9BA 1GQAA 2YLGA 2YL0A 3TOLA 4L6RA 3ZWIA 3FOPA 1LM3B 2XLOA 2XLWA 1M6TA 2YLDA 4WGYA 4CIPA 3QVZA 1EKYA 1MQVA 1NBBA 4CX9A 256BA 2XM0A 4ER9A 5JSLA 3M15A 1YYXA 1A7VA 3TOMA 3ZQVA 1QPUA 2XL6A 1CGOA 2XLMA 2XLVA 3HNKA 4CJOA 4JE9A 2XL8A 4D4NA 5B3IA 2YL7A 3C62A 4JEBA 5JVEA 4CDAA 3U8PA 3L1MA 1E85A 4N6HA 2BC5A 3IQ6A 1CPRA 4CJGA 1YZCA 5JT4A 1JAFA 1RCPA 3HNLA 1BBHA 4U9DA 2XLEA 3ZTZA 2CCYA 1E86A 1YZAA 5AGFA 2QLAA 3IQ5A 5JRAA 2XM4A 2YL3A 2XLDA 4CDYA 4IAQA 3NMIA 1YYJA 3HNJA 3HNIA 4NC3A 1CGNA 1QQ3A 5JLIA 5JUAA 4ULVA 2YLIA 3VRCA 3M4CA 4JKVA
chains in the Genus database with same CATH superfamily
1BR1A 1OW8A 3MYIA 1WN0A 3UGOA 4FESA 2NSGA 2IXMA 2MWQA 2R02A 3DE8A 3GEHA 4IB4A 4MQ9F 2WVOA 3BRJA 3EGXA 3NMJA 4MS2A 1FFHA 1LS1A 1MNDA 3DKAA 5A6KA 4NCQA 5L0IA 4PJJA 4PFPA 3Q7LA 3ATPA 1E83A 4YJWA 3C8GA 1BZ4A 2MYSA 1JRAA 1SF8A 5KYUA 4DRJB 1H7IA 1WGWA 3B71A 2BE5F 3N24A 2R03A 4QI0A 4WGZA 3QW0A 4OINF 3U9MA 3DI5A 4MVRA 4LLCA 1VLTA 2LFFA 1M56C 4EBKA 4XWJA 5CI8A 1U6HA 5T3TA 3SXZA 2R7VA 1TR2A 2YKZA 3EJNA 2OKUA 3ASOC 4PJMA 3U5SA 3PHF2 1UFBA 2LCHA 4G7ZF 3R2PA 1HMDA 4YN0B 3LLKA 2R7TA 2ETSA 2YL1A 4JEAA 1KNYA 4CDVA 1D1CA 3DE9A 4CS9C 2YLGA 5DS6A 4KBLA 3W8HA 1KTMA 3ZWIA 1DOVA 4XEVA 3FOPA 3T6BA 2W4BA 2TMVP 1FAPB 2L6GA 3EGDA 1A0BA 1M6TA 3LEOA 3UNGC 2A68F 3NYMA 1HE1A 2YLDA 4WGYA 5F28E 4HFKB 2KYHA 1SYQA 1ZU5A 3ABKC 3C8GD 5HSWA 2IXPA 1Z6AA 2QNLA 4R32A 3W2WA 1HW2A 4KI2A 4G0HA 4NTAA 4DRHB 1QKRA 1TWAA 2Y39A 2W9YA 4ER9A 4JW1A 4E7SA 3J06A 2X51A 3FVYA 2NG1A 3JRTA 4RD9A 3AG2C 2KJGA 2EILC 2PP4A 1Z3IX 1V4AA 1PV3A 4U5CE 2ICWG 4UDVA 1ZHZA 4DXWA 5AC5A 4DJ9A 1D0XA 1RKEA 5COMA 2FFHA 2XLMA 4CJOA 5KYWA 1HE9A 5L0JA 2M64A 3EH2A 5A69A 2IXNA 4O79A 4AE4A 1M2VA 2OCCC 3QTHA 1MMAA 1RJ9B 2EPKX 3K1HA 1XWJA 4IGGA 3AG1C 4CDAA 1Q0GA 1RKCA 2R7QA 1VYKA 2DB4A 1LKXA 4JCHA 1JR8A 1T01A 3B29A 2BC5A 3DD7A 1W2WA 3JSZA 4E0IA 4U5DE 4AK9A 2KQ9A 1OW6A 3US6A 5FCLA 2YHSA 3NYJA 3HNLA 1BBHA 3H2VA 4U9DA 3ZTZA 4NTFA 2CCYA 2HJMA 3SNHA 3GANA 4BEMJ 2A1DD 1U89A 1MMNA 3F47A 2P61A 4U5EE 3DJUB 2ZXWC 1O3UA 3LEVA 4O6YA 1OR2A 2H7VC 3IQTA 4JVSA 2R7XA 1MNEA 2NUPB 2P7VA 3S9OA 1TQGA 2XM4A 2WB7A 2YL3A 3FDQA 3GORA 2XLDA 4NY3A 1IZMA 5A6JA 2QE9A 4U5BE 1TFKB 2HFIA 3DWWA 2XL4A 4GYTA 1YYJA 3FAJA 4C3BA 1XZQA 2VCBA 3QMKA 2J46A 3A11A 1MMDA 2V26A 2CDQA 3DM5A 2Q7RA 2DGJA 2J9UA 1QQ3A 5JUAA 3JRMO 4EUKB 3CEXA 4ULVA 3U3BA 4AX2A 3ABLC 2A0BA 4K1OA 3E70C 4H4KC 5DVWA 3VRCA 3S0XA 4JKVA 4U9EA 2KC3A 1K05A 1LE4A 2AP3A 4PK4A 3DXJF 1HW1A 3T6GB 3M79A 4BJ6A 4IAOA 4BG0A 1J8YF 4IRUA 4KNVA 3V7OA 3B0VC 3LJBA 4JTCB 2C03A 3FOOA 1VMAA 1BR4A 2VB6A 3E9VA 3NMKA 1Q0MA 3SXKA 1XZPA 3U3FA 3IHUA 1PD0A 1E84A 3HLZA 4YL0A 1YAUO 3B9QA 4EBJA 5L0GA 5L3QA 3AG3C 3LS0A 5DLJA 1YARO 3OWTA 3ECSA 4JRZA 4RBNA 4YT2A 5L0FA 4BJTA 3PDMP 2IXOA 3LLIA 5E3CA 3MLGA 3TULA 5L0DA 3DAGA 3SXMA 2JPUA 3WAQA 3RVYA 1O87A 2Z15A 1FFTC 2YEVA 3AGUA 1VLSA 2XXAA 3VM6A 3QW1A 1ORJA 4QDLA 4CBEA 3G4XA 3K33A 4PJNA 1LIHA 3O6XA 4P9FA 1D1BA 4OIRF 3TOLA 2PNOA 1E2XA 1LVKA 3GWLA 3Q7GA 4L6RA 1LM3B 1Q0FA 1VB5A 3WHNA 3SZRA 2QUPA 4O6NA 1T5OA 2H8AA 3MX3A 1A7DA 2HKVA 3RQEA 3QVZA 4ULWA 3EFOA 2W4MA 4JJFA 4LERA 3ZC4A 2O9XA 4BJ5A 1EKYA 3ZSUA 4PR9A 1A7EA 3A9CA 1NZEA 2XM0A 1Z23A 1OXBA 3C7JA 2W45A 5TJ5E 3EG9B 1YYXA 3JCUQ 4IJJA 2P0NA 2KSFA 3PMRA 1RJ9A 1T6IA 1WWPA 2CYDA 2HV6A 1G5ZA 1H9TA 4HE8D 5DS5A 1AEPA 4W8PA 3JZ0A 3KPHA 3C8ZA 4ZLCA 3OEOA 1KU2A 2VCAA 2WZFA 4Q7CA 3DAFA 2HSBA 4YL3A 4A2NB 2XLVA 3GM3A 3NYLA 2PX0A 4CS8A 1LE2A 1NU7D 1B68A 1QLEC 1Y6DA 4C3EA 4XLPF 1ST6A 1NU9C 1H6GA 2YL7A 4JEBA 5JVEA 3UMIA 1R5ID 2LK4A 2NUPA 4MVQA 3U8PA 1VK5A 2ASRA 4I1MA 3UMKA 3I4UA 3K7DA 1LI7A 4M63A 1E85A 4YT8A 3AJMA 1L7CA 3IQ6A 1Z63A 1FMWA 2NUTB 4H54A 3DZAA 1YZCA 2CGEA 5JT4A 4XPWA 1JAFA 3T6JA 1RCPA 2HZ8A 3GM2A 2EIKC 3GM1A 3F46A 4YK5A 1OCCC 5KYYB 4OIQF 3EZIA 2Q9AA 2HV7A 2R9RB 3HTKC 4LDRA 1K40A 1TWGA 2AU5A 2G3VA 1C17M 4MVZA 4HFFB 3GEEA 4DBRA 1T6UA 2Y3DA 3UGPA 3POVA 4G78A 2KW3C 3DM9B 1Q0DA 1HY5A 4BPMA 2M4EA 1IW7F 1FTSA 2GDCA 2R7RA 2J9WA 2OJQA 4O7GA 3KMIA 2D4UA 2HS5A 1G8XA 1C02A 2Y3GA 3NMIA 1BR2A 3KYIA 4DOZA 3AG4C 2ZD9A 3H65A 3RFYA 3O10A 3DJNB 3JTLO 4CSAA 4EHPA 5D92A 3S28A 2V3CC 1SZIA 3L8IA 2YLIA 2YQYA 3CSKA 4GEHA 4K0DA 4O6MA 4FWVA 3M4CA 2KGOA 3B0PA 2C04A 4X0RA 1S7ZA 1LPEA 3RYLA 1MMGA 1OR3A 3GEIA 4EIYA 3ZQYA 2XLHA 2YZSA 3VAYA 1S05A 3RH3A 4MVMA 4E0HA 3TQOA 2P1AA 4BJ6C 1H9GA 2NSFA 1TWCA 3K1IC 4K7BA 1NFOA 3X2QC 1UG7A 4MW8A 1ORYA 4I3MA 4GQHA 1I4ZA 1SMYF 2PFDA 5F5HA 1ORSC 2FGYA 1JOGA 3EH1A 2B0JA 2HJ3A 3FAPB 1I5NA 4AL0A 4E17A 3TK0A 3LAYA 1SR2A 3JSEO 3RF3A 1ZU4A 2VASA 2YVKA 2PX3A 4D4XA 1RXQA 2WL8A 1APCA 5B3SC 3IEEA 1YA7O 4MTOA 4P9TA 4XEFA 2UUHA 5JP7A 4CS7A 5KYNA 2QY9A 3EPVA 2IM8A 3NDBB 2EPOA 1ZVZA 2J8WA 1O5HA 3KKBA 4DRIB 4YT5A 1OQCA 4N4WA 5FZTA 3LS1A 2WZLA 5B1BC 4QI2A 1V74B 2Q3TA 2Q9BA 2HMZA 3EG9A 3C18A 4ONSA 3MYFA 1ZZPA 2CNWA 1YJGA 2Y3HA 3S27A 1OKKA 3NRHA 4U5FE 2HSQA 4B6IA 1FNTc 1JPNA 3L0IA 2EPMX 2WVQA 3L8JA 4PJLA 1FR0A 4CIPA 3NKEA 4HEAJ 3RVZA 5L0HA 2OG2A 2PF4E 3ITFA 3EQLF 1M2OA 1BDJB 4JC7A 3I5PA 1MQVA 3WODF 3UMHA 5DQZA 2H7OA 5CI9A 4I44A 4CX9A 4EWCA 4WABA 2HMQA 3JYHA 3DMDA 4BJ5C 1GM5A 1V55C 2B0HA 3O39A 1LS4A 2ZXOA 3TOMA 5A6AA 3ZQVA 4F4BA 2R7WA 1QPUA 4NQFA 4AE4B 1WATA 3QZCA 1TWHA 4MVUA 5BQIA 2XL6A 3SEOA 2A6HF 4YWQA 3NKDA 3Q6NA 2Q00A 4WJ0A 1ZHXA 3ZIBA 3K6BA 4AL1A 5EHHA 2VC9A 3RQGA 4P6IC 3W2VA 1F1MA 2P6VA 3HNKA 1HMOA 5KYYA 2J7PA 2CNWD 2I8BA 2KK1A 1OKKD 2YRFA 2XL8A 5COFA 3EZHA 1NSGB 3Q6MA 3PCVA 3C62A 1ZYRF 4JZAA 4N06A 4CS8C 2R7UA 4PFOA 3MFNA 4Q5SF 2Y3BA 3AQCA 3VF0A 5A6BA 1R4TA 3MBGA 5E2QA 2Y69C 4N6HA 3U9JA 2A69F 2XSEA 4YT4A 4IWBA 1OCZC 1T6QA 1JMWA 4CJGA 3W4YA 1M57C 4JIOA 3U2MA 2LFDA 1L3PA 2XLEA 5KYXB 4MTGA 4N6CA 1ZHWA 4NTBA 4ANJA 1YZAA 3AQBA 5AGFA 4FX5A 3V5YA 5JRAA 3GWNA 2EIMC 1QVXA 3CAXA 3FXHA 4JCZA 1OCRC 3TJ6A 1DOWA 2L9JA 3G4ZA 1D0YA 2J7PD 4OIPF 4LDKA 4A4AA 4U5GA 4IAQA 1YA9A 2RD9A 4XEKA 4XPYA 1LI5A 2I15A 4XPXA 5EK0A 5L0CA 3L34A 2LIGA 3HNJA 3ZG1A 3HKKA 4FAPB 1ZHTA 2OU6A 2WZGA 3HNIA 2VH3A 2IOQA 1CGNA 1EI7A 5A6BD 4OD5A 1VTMP 2LP4A 4DVZA 5JLIA 5L3VA 2F22A 2GWWA 1PCXA 2MHRA 1OCOC 5T1DB 3UR3C 3V5ZA 4C7OA 3RIPA 3B0UX 2OEVA 3RW0A 3KH2A 3BEHA 2J45A 4MTFA 1QZXA 4J7YA 2J9VA 4CSAC 2BL2A 3G50A 3M4BA 3C63A 3RQFA 3W8IA 1Z5ZA 3HJCA 3R7CA 5DS4A 4LLEA 1D0ZA 2LD6A 1VYIA 4J32B 1YLMA 2GA0A 3U8VA 2JD3A 4DBQA 1QSPA 2Q4FA 4BJ1A 3VYWA 5JS5A 2AWCA 2L7AA 4XTKA 2OQMA 3ASNC 2XXAB 1NG1A 2R05A 2AVKA 3IPMO 2LSEA 5HV9A 3N2ZB 2QTVA 1A41A 2D5RB 3LNRA 4C3DA 1RMVA 4W8KA 3QVYA 2AWYA 4ZLDA 1CPQA 1ZW2A 1Z7Qc 1D1AA 3T9OA 1U0BB 3EGXB 4CS9A 4C7OB 2IBFA 5E3AA 4IARA 3ABMC 4EBBA 3ZTMA 1NFNA 2E87A 1EA8A 2DYRC 3LNMB 3GODA 4JURI 2J9BA 3C8GB 1GQAA 3EFOB 5K0IA 2RSEB 2YL0A 5KYUB 1N1CA 4RDAA 4J30B 2NPUA 4J7TA 4E18A 3SXYA 5CIVA 2XLOA 1Y4CA 1VOMA 2XLWA 2DI3A 2ZPAA 1OXKA 3O55A 4YL1A 1ZW3A 3S84A 4Z9JA 2XS8A 2A0UA 2Q9CA 4Z9IA 3ZDLA 4I1OB 3S29A 1NBBA 3X1OA 3OA1A 256BA 2L81A 3FMSA 4Q4ZF 5JSLA 3M15A 1JPJA 3RKOF 1EQ1A 1A7VA 3N0TA 2R7OA 2ZXRA 3EHNA 4LACB 2IYLD 2XRHA 4MNDA 3TD7A 1J8MF 3EGDB 2OJED 4JJGA 1AUEA 2UUIA 1CGOA 4G7HF 5AC4A 1WOLA 2EINC 2OOCA 5F5FA 4MVOA 1Q0KA 2GFHA 3EHMA 5DQTA 3LESA 4LDQA 2EIJC 4MVSA 3ZVRA 1GS9A 1OW7A 2KNHA 3LUTB 4JE9A 2YWAA 5KYXA 3S90A 1K04A 3K66A 4JTAB 2L6FA 4D4NA 5B3IA 2R25A 5BUOA 2LQGA 2L6HA 2CW0F 5EGYA 2R7SA 5COGA 1T9KA 2WVNA 1FMVA 4DVYP 3H2UA 3L1MA 5T3WA 1TFOB 4G7OF 5GPGB 1PD1A 1CPRA 1YVIA 5BQHA 1RKEB 2PBEA 4Z9HA 4OD4A 4BEJA 5KYWB 3KYJA 2DYSC 3SP1A 2G3KA 2H7BA 2JX0A 4KC9A 1C03A 4E7ZA 2J0WA 1M2VB 1E86A 2A6EF 3K1IA 1G4WR 2QLAA 2ZXPA 2FAPB 3IQ5A 2X0CA 3SYNA 2G62A 2XS1A 5E33A 5D91A 4OIOF 3T4RA 4XLNF 2NUTA 3U0CA 1TKNA 4CIHA 4PACA 3U2LA 5BQGA 4MW3A 4JTDB 1WASA 2VCCA 3AOUA 4U5HA 2OEXA 4CDYA 3JT1A 2EPLX 5B1AC 3WG7C 1NLXA 1V54C 4XQ1A 1WTYA 1ZHYA 3V5XA 1CGME 1GGQA 3I5QA 3CQZA 3CZ6A 3IQCA 3JYYA 1AVOB 3NG1A 3FHDA 3TJ5A 1YDIA 4NC3A 4EKWA 3KL4A 3M1CB 1I4YA 4KNWA 2GAQA 1G4US 2J0XA 5IY5C 2HUJA 3AGTA 2EPNA
chains in the Genus database with same CATH topology
4U9EA 3M4BA 3C63A 3M79A 3DE8A 4EIYA 3ZQYA 2XLHA 4IB4A 1S05A 3FOOA 3NMKA 3NMJA 1E84A 1E83A 5JS5A 4WGZA 3QW0A 4D4XA 3QVYA 1APCA 1CPQA 2YKZA 5JP7A 4IARA 3ZTMA 2J8WA 2YL1A 3QW1A 4JEAA 4CDVA 3DE9A 4N4WA 2J9BA 1GQAA 2YLGA 2YL0A 3TOLA 4L6RA 3ZWIA 3FOPA 1LM3B 2XLOA 2XLWA 1M6TA 2YLDA 4WGYA 4CIPA 3QVZA 1EKYA 1MQVA 1NBBA 4CX9A 256BA 2XM0A 4ER9A 5JSLA 3M15A 1YYXA 1A7VA 3TOMA 3ZQVA 1QPUA 2XL6A 1CGOA 2XLMA 2XLVA 3HNKA 4CJOA 4JE9A 2XL8A 4D4NA 5B3IA 2YL7A 3C62A 4JEBA 5JVEA 4CDAA 3U8PA 3L1MA 1E85A 4N6HA 2BC5A 3IQ6A 1CPRA 4CJGA 1YZCA 5JT4A 1JAFA 1RCPA 3HNLA 1BBHA 4U9DA 2XLEA 3ZTZA 2CCYA 1E86A 1YZAA 5AGFA 2QLAA 3IQ5A 5JRAA 2XM4A 2YL3A 2XLDA 4CDYA 4IAQA 3NMIA 1YYJA 3HNJA 3HNIA 4NC3A 1CGNA 1QQ3A 5JLIA 5JUAA 4ULVA 2YLIA 3VRCA 3M4CA 4JKVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U9E A;  3M4B A;  3C63 A;  3M79 A;  3DE8 A;  4EIY A;  3ZQY A;  2XLH A;  4IB4 A;  1S05 A;  3FOO A;  3NMK A;  3NMJ A;  1E84 A;  1E83 A;  5JS5 A;  4WGZ A;  3QW0 A;  4D4X A;  3QVY A;  1APC A;  1CPQ A;  2YKZ A;  5JP7 A;  4IAR A;  3ZTM A;  2J8W A;  2YL1 A;  3QW1 A;  4JEA A;  4CDV A;  3DE9 A;  4N4W A;  2J9B A;  1GQA A;  2YLG A;  2YL0 A;  3TOL A;  4L6R A;  3ZWI A;  3FOP A;  1LM3 B;  2XLO A;  2XLW A;  1M6T A;  2YLD A;  4WGY A;  4CIP A;  3QVZ A;  1EKY A;  1MQV A;  1NBB A;  4CX9 A;  256B A;  2XM0 A;  4ER9 A;  5JSL A;  3M15 A;  1YYX A;  1A7V A;  3TOM A;  3ZQV A;  1QPU A;  2XL6 A;  1CGO A;  2XLM A;  2XLV A;  3HNK A;  4CJO A;  4JE9 A;  2XL8 A;  4D4N A;  5B3I A;  2YL7 A;  3C62 A;  4JEB A;  5JVE A;  4CDA A;  3U8P A;  3L1M A;  1E85 A;  4N6H A;  2BC5 A;  3IQ6 A;  1CPR A;  4CJG A;  1YZC A;  5JT4 A;  1JAF A;  1RCP A;  3HNL A;  1BBH A;  4U9D A;  2XLE A;  3ZTZ A;  2CCY A;  1E86 A;  1YZA A;  5AGF A;  2QLA A;  3IQ5 A;  5JRA A;  2XM4 A;  2YL3 A;  2XLD A;  4CDY A;  4IAQ A;  3NMI A;  1YYJ A;  3HNJ A;  3HNI A;  4NC3 A;  1CGN A;  1QQ3 A;  5JLI A;  5JUA A;  4ULV A;  2YLI A;  3VRC A;  3M4C A;  4JKV A; 
#chains in the Genus database with same CATH topology
 1BR1 A;  1OW8 A;  3MYI A;  1WN0 A;  3UGO A;  4FES A;  2NSG A;  2IXM A;  2MWQ A;  2R02 A;  3DE8 A;  3GEH A;  4IB4 A;  4MQ9 F;  2WVO A;  3BRJ A;  3EGX A;  3NMJ A;  4MS2 A;  1FFH A;  1LS1 A;  1MND A;  3DKA A;  5A6K A;  4NCQ A;  5L0I A;  4PJJ A;  4PFP A;  3Q7L A;  3ATP A;  1E83 A;  4YJW A;  3C8G A;  1BZ4 A;  2MYS A;  1JRA A;  1SF8 A;  5KYU A;  4DRJ B;  1H7I A;  1WGW A;  3B71 A;  2BE5 F;  3N24 A;  2R03 A;  4QI0 A;  4WGZ A;  3QW0 A;  4OIN F;  3U9M A;  3DI5 A;  4MVR A;  4LLC A;  1VLT A;  2LFF A;  1M56 C;  4EBK A;  4XWJ A;  5CI8 A;  1U6H A;  5T3T A;  3SXZ A;  2R7V A;  1TR2 A;  2YKZ A;  3EJN A;  2OKU A;  3ASO C;  4PJM A;  3U5S A;  3PHF 2;  1UFB A;  2LCH A;  4G7Z F;  3R2P A;  1HMD A;  4YN0 B;  3LLK A;  2R7T A;  2ETS A;  2YL1 A;  4JEA A;  1KNY A;  4CDV A;  1D1C A;  3DE9 A;  4CS9 C;  2YLG A;  5DS6 A;  4KBL A;  3W8H A;  1KTM A;  3ZWI A;  1DOV A;  4XEV A;  3FOP A;  3T6B A;  2W4B A;  2TMV P;  1FAP B;  2L6G A;  3EGD A;  1A0B A;  1M6T A;  3LEO A;  3UNG C;  2A68 F;  3NYM A;  1HE1 A;  2YLD A;  4WGY A;  5F28 E;  4HFK B;  2KYH A;  1SYQ A;  1ZU5 A;  3ABK C;  3C8G D;  5HSW A;  2IXP A;  1Z6A A;  2QNL A;  4R32 A;  3W2W A;  1HW2 A;  4KI2 A;  4G0H A;  4NTA A;  4DRH B;  1QKR A;  1TWA A;  2Y39 A;  2W9Y A;  4ER9 A;  4JW1 A;  4E7S A;  3J06 A;  2X51 A;  3FVY A;  2NG1 A;  3JRT A;  4RD9 A;  3AG2 C;  2KJG A;  2EIL C;  2PP4 A;  1Z3I X;  1V4A A;  1PV3 A;  4U5C E;  2ICW G;  4UDV A;  1ZHZ A;  4DXW A;  5AC5 A;  4DJ9 A;  1D0X A;  1RKE A;  5COM A;  2FFH A;  2XLM A;  4CJO A;  5KYW A;  1HE9 A;  5L0J A;  2M64 A;  3EH2 A;  5A69 A;  2IXN A;  4O79 A;  4AE4 A;  1M2V A;  2OCC C;  3QTH A;  1MMA A;  1RJ9 B;  2EPK X;  3K1H A;  1XWJ A;  4IGG A;  3AG1 C;  4CDA A;  1Q0G A;  1RKC A;  2R7Q A;  1VYK A;  2DB4 A;  1LKX A;  4JCH A;  1JR8 A;  1T01 A;  3B29 A;  2BC5 A;  3DD7 A;  1W2W A;  3JSZ A;  4E0I A;  4U5D E;  4AK9 A;  2KQ9 A;  1OW6 A;  3US6 A;  5FCL A;  2YHS A;  3NYJ A;  3HNL A;  1BBH A;  3H2V A;  4U9D A;  3ZTZ A;  4NTF A;  2CCY A;  2HJM A;  3SNH A;  3GAN A;  4BEM J;  2A1D D;  1U89 A;  1MMN A;  3F47 A;  2P61 A;  4U5E E;  3DJU B;  2ZXW C;  1O3U A;  3LEV A;  4O6Y A;  1OR2 A;  2H7V C;  3IQT A;  4JVS A;  2R7X A;  1MNE A;  2NUP B;  2P7V A;  3S9O A;  1TQG A;  2XM4 A;  2WB7 A;  2YL3 A;  3FDQ A;  3GOR A;  2XLD A;  4NY3 A;  1IZM A;  5A6J A;  2QE9 A;  4U5B E;  1TFK B;  2HFI A;  3DWW A;  2XL4 A;  4GYT A;  1YYJ A;  3FAJ A;  4C3B A;  1XZQ A;  2VCB A;  3QMK A;  2J46 A;  3A11 A;  1MMD A;  2V26 A;  2CDQ A;  3DM5 A;  2Q7R A;  2DGJ A;  2J9U A;  1QQ3 A;  5JUA A;  3JRM O;  4EUK B;  3CEX A;  4ULV A;  3U3B A;  4AX2 A;  3ABL C;  2A0B A;  4K1O A;  3E70 C;  4H4K C;  5DVW A;  3VRC A;  3S0X A;  4JKV A;  4U9E A;  2KC3 A;  1K05 A;  1LE4 A;  2AP3 A;  4PK4 A;  3DXJ F;  1HW1 A;  3T6G B;  3M79 A;  4BJ6 A;  4IAO A;  4BG0 A;  1J8Y F;  4IRU A;  4KNV A;  3V7O A;  3B0V C;  3LJB A;  4JTC B;  2C03 A;  3FOO A;  1VMA A;  1BR4 A;  2VB6 A;  3E9V A;  3NMK A;  1Q0M A;  3SXK A;  1XZP A;  3U3F A;  3IHU A;  1PD0 A;  1E84 A;  3HLZ A;  4YL0 A;  1YAU O;  3B9Q A;  4EBJ A;  5L0G A;  5L3Q A;  3AG3 C;  3LS0 A;  5DLJ A;  1YAR O;  3OWT A;  3ECS A;  4JRZ A;  4RBN A;  4YT2 A;  5L0F A;  4BJT A;  3PDM P;  2IXO A;  3LLI A;  5E3C A;  3MLG A;  3TUL A;  5L0D A;  3DAG A;  3SXM A;  2JPU A;  3WAQ A;  3RVY A;  1O87 A;  2Z15 A;  1FFT C;  2YEV A;  3AGU A;  1VLS A;  2XXA A;  3VM6 A;  3QW1 A;  1ORJ A;  4QDL A;  4CBE A;  3G4X A;  3K33 A;  4PJN A;  1LIH A;  3O6X A;  4P9F A;  1D1B A;  4OIR F;  3TOL A;  2PNO A;  1E2X A;  1LVK A;  3GWL A;  3Q7G A;  4L6R A;  1LM3 B;  1Q0F A;  1VB5 A;  3WHN A;  3SZR A;  2QUP A;  4O6N A;  1T5O A;  2H8A A;  3MX3 A;  1A7D A;  2HKV A;  3RQE A;  3QVZ A;  4ULW A;  3EFO A;  2W4M A;  4JJF A;  4LER A;  3ZC4 A;  2O9X A;  4BJ5 A;  1EKY A;  3ZSU A;  4PR9 A;  1A7E A;  3A9C A;  1NZE A;  2XM0 A;  1Z23 A;  1OXB A;  3C7J A;  2W45 A;  5TJ5 E;  3EG9 B;  1YYX A;  3JCU Q;  4IJJ A;  2P0N A;  2KSF A;  3PMR A;  1RJ9 A;  1T6I A;  1WWP A;  2CYD A;  2HV6 A;  1G5Z A;  1H9T A;  4HE8 D;  5DS5 A;  1AEP A;  4W8P A;  3JZ0 A;  3KPH A;  3C8Z A;  4ZLC A;  3OEO A;  1KU2 A;  2VCA A;  2WZF A;  4Q7C A;  3DAF A;  2HSB A;  4YL3 A;  4A2N B;  2XLV A;  3GM3 A;  3NYL A;  2PX0 A;  4CS8 A;  1LE2 A;  1NU7 D;  1B68 A;  1QLE C;  1Y6D A;  4C3E A;  4XLP F;  1ST6 A;  1NU9 C;  1H6G A;  2YL7 A;  4JEB A;  5JVE A;  3UMI A;  1R5I D;  2LK4 A;  2NUP A;  4MVQ A;  3U8P A;  1VK5 A;  2ASR A;  4I1M A;  3UMK A;  3I4U A;  3K7D A;  1LI7 A;  4M63 A;  1E85 A;  4YT8 A;  3AJM A;  1L7C A;  3IQ6 A;  1Z63 A;  1FMW A;  2NUT B;  4H54 A;  3DZA A;  1YZC A;  2CGE A;  5JT4 A;  4XPW A;  1JAF A;  3T6J A;  1RCP A;  2HZ8 A;  3GM2 A;  2EIK C;  3GM1 A;  3F46 A;  4YK5 A;  1OCC C;  5KYY B;  4OIQ F;  3EZI A;  2Q9A A;  2HV7 A;  2R9R B;  3HTK C;  4LDR A;  1K40 A;  1TWG A;  2AU5 A;  2G3V A;  1C17 M;  4MVZ A;  4HFF B;  3GEE A;  4DBR A;  1T6U A;  2Y3D A;  3UGP A;  3POV A;  4G78 A;  2KW3 C;  3DM9 B;  1Q0D A;  1HY5 A;  4BPM A;  2M4E A;  1IW7 F;  1FTS A;  2GDC A;  2R7R A;  2J9W A;  2OJQ A;  4O7G A;  3KMI A;  2D4U A;  2HS5 A;  1G8X A;  1C02 A;  2Y3G A;  3NMI A;  1BR2 A;  3KYI A;  4DOZ A;  3AG4 C;  2ZD9 A;  3H65 A;  3RFY A;  3O10 A;  3DJN B;  3JTL O;  4CSA A;  4EHP A;  5D92 A;  3S28 A;  2V3C C;  1SZI A;  3L8I A;  2YLI A;  2YQY A;  3CSK A;  4GEH A;  4K0D A;  4O6M A;  4FWV A;  3M4C A;  2KGO A;  3B0P A;  2C04 A;  4X0R A;  1S7Z A;  1LPE A;  3RYL A;  1MMG A;  1OR3 A;  3GEI A;  4EIY A;  3ZQY A;  2XLH A;  2YZS A;  3VAY A;  1S05 A;  3RH3 A;  4MVM A;  4E0H A;  3TQO A;  2P1A A;  4BJ6 C;  1H9G A;  2NSF A;  1TWC A;  3K1I C;  4K7B A;  1NFO A;  3X2Q C;  1UG7 A;  4MW8 A;  1ORY A;  4I3M A;  4GQH A;  1I4Z A;  1SMY F;  2PFD A;  5F5H A;  1ORS C;  2FGY A;  1JOG A;  3EH1 A;  2B0J A;  2HJ3 A;  3FAP B;  1I5N A;  4AL0 A;  4E17 A;  3TK0 A;  3LAY A;  1SR2 A;  3JSE O;  3RF3 A;  1ZU4 A;  2VAS A;  2YVK A;  2PX3 A;  4D4X A;  1RXQ A;  2WL8 A;  1APC A;  5B3S C;  3IEE A;  1YA7 O;  4MTO A;  4P9T A;  4XEF A;  2UUH A;  5JP7 A;  4CS7 A;  5KYN A;  2QY9 A;  3EPV A;  2IM8 A;  3NDB B;  2EPO A;  1ZVZ A;  2J8W A;  1O5H A;  3KKB A;  4DRI B;  4YT5 A;  1OQC A;  4N4W A;  5FZT A;  3LS1 A;  2WZL A;  5B1B C;  4QI2 A;  1V74 B;  2Q3T A;  2Q9B A;  2HMZ A;  3EG9 A;  3C18 A;  4ONS A;  3MYF A;  1ZZP A;  2CNW A;  1YJG A;  2Y3H A;  3S27 A;  1OKK A;  3NRH A;  4U5F E;  2HSQ A;  4B6I A;  1FNT c;  1JPN A;  3L0I A;  2EPM X;  2WVQ A;  3L8J A;  4PJL A;  1FR0 A;  4CIP A;  3NKE A;  4HEA J;  3RVZ A;  5L0H A;  2OG2 A;  2PF4 E;  3ITF A;  3EQL F;  1M2O A;  1BDJ B;  4JC7 A;  3I5P A;  1MQV A;  3WOD F;  3UMH A;  5DQZ A;  2H7O A;  5CI9 A;  4I44 A;  4CX9 A;  4EWC A;  4WAB A;  2HMQ A;  3JYH A;  3DMD A;  4BJ5 C;  1GM5 A;  1V55 C;  2B0H A;  3O39 A;  1LS4 A;  2ZXO A;  3TOM A;  5A6A A;  3ZQV A;  4F4B A;  2R7W A;  1QPU A;  4NQF A;  4AE4 B;  1WAT A;  3QZC A;  1TWH A;  4MVU A;  5BQI A;  2XL6 A;  3SEO A;  2A6H F;  4YWQ A;  3NKD A;  3Q6N A;  2Q00 A;  4WJ0 A;  1ZHX A;  3ZIB A;  3K6B A;  4AL1 A;  5EHH A;  2VC9 A;  3RQG A;  4P6I C;  3W2V A;  1F1M A;  2P6V A;  3HNK A;  1HMO A;  5KYY A;  2J7P A;  2CNW D;  2I8B A;  2KK1 A;  1OKK D;  2YRF A;  2XL8 A;  5COF A;  3EZH A;  1NSG B;  3Q6M A;  3PCV A;  3C62 A;  1ZYR F;  4JZA A;  4N06 A;  4CS8 C;  2R7U A;  4PFO A;  3MFN A;  4Q5S F;  2Y3B A;  3AQC A;  3VF0 A;  5A6B A;  1R4T A;  3MBG A;  5E2Q A;  2Y69 C;  4N6H A;  3U9J A;  2A69 F;  2XSE A;  4YT4 A;  4IWB A;  1OCZ C;  1T6Q A;  1JMW A;  4CJG A;  3W4Y A;  1M57 C;  4JIO A;  3U2M A;  2LFD A;  1L3P A;  2XLE A;  5KYX B;  4MTG A;  4N6C A;  1ZHW A;  4NTB A;  4ANJ A;  1YZA A;  3AQB A;  5AGF A;  4FX5 A;  3V5Y A;  5JRA A;  3GWN A;  2EIM C;  1QVX A;  3CAX A;  3FXH A;  4JCZ A;  1OCR C;  3TJ6 A;  1DOW A;  2L9J A;  3G4Z A;  1D0Y A;  2J7P D;  4OIP F;  4LDK A;  4A4A A;  4U5G A;  4IAQ A;  1YA9 A;  2RD9 A;  4XEK A;  4XPY A;  1LI5 A;  2I15 A;  4XPX A;  5EK0 A;  5L0C A;  3L34 A;  2LIG A;  3HNJ A;  3ZG1 A;  3HKK A;  4FAP B;  1ZHT A;  2OU6 A;  2WZG A;  3HNI A;  2VH3 A;  2IOQ A;  1CGN A;  1EI7 A;  5A6B D;  4OD5 A;  1VTM P;  2LP4 A;  4DVZ A;  5JLI A;  5L3V A;  2F22 A;  2GWW A;  1PCX A;  2MHR A;  1OCO C;  5T1D B;  3UR3 C;  3V5Z A;  4C7O A;  3RIP A;  3B0U X;  2OEV A;  3RW0 A;  3KH2 A;  3BEH A;  2J45 A;  4MTF A;  1QZX A;  4J7Y A;  2J9V A;  4CSA C;  2BL2 A;  3G50 A;  3M4B A;  3C63 A;  3RQF A;  3W8I A;  1Z5Z A;  3HJC A;  3R7C A;  5DS4 A;  4LLE A;  1D0Z A;  2LD6 A;  1VYI A;  4J32 B;  1YLM A;  2GA0 A;  3U8V A;  2JD3 A;  4DBQ A;  1QSP A;  2Q4F A;  4BJ1 A;  3VYW A;  5JS5 A;  2AWC A;  2L7A A;  4XTK A;  2OQM A;  3ASN C;  2XXA B;  1NG1 A;  2R05 A;  2AVK A;  3IPM O;  2LSE A;  5HV9 A;  3N2Z B;  2QTV A;  1A41 A;  2D5R B;  3LNR A;  4C3D A;  1RMV A;  4W8K A;  3QVY A;  2AWY A;  4ZLD A;  1CPQ A;  1ZW2 A;  1Z7Q c;  1D1A A;  3T9O A;  1U0B B;  3EGX B;  4CS9 A;  4C7O B;  2IBF A;  5E3A A;  4IAR A;  3ABM C;  4EBB A;  3ZTM A;  1NFN A;  2E87 A;  1EA8 A;  2DYR C;  3LNM B;  3GOD A;  4JUR I;  2J9B A;  3C8G B;  1GQA A;  3EFO B;  5K0I A;  2RSE B;  2YL0 A;  5KYU B;  1N1C A;  4RDA A;  4J30 B;  2NPU A;  4J7T A;  4E18 A;  3SXY A;  5CIV A;  2XLO A;  1Y4C A;  1VOM A;  2XLW A;  2DI3 A;  2ZPA A;  1OXK A;  3O55 A;  4YL1 A;  1ZW3 A;  3S84 A;  4Z9J A;  2XS8 A;  2A0U A;  2Q9C A;  4Z9I A;  3ZDL A;  4I1O B;  3S29 A;  1NBB A;  3X1O A;  3OA1 A;  256B A;  2L81 A;  3FMS A;  4Q4Z F;  5JSL A;  3M15 A;  1JPJ A;  3RKO F;  1EQ1 A;  1A7V A;  3N0T A;  2R7O A;  2ZXR A;  3EHN A;  4LAC B;  2IYL D;  2XRH A;  4MND A;  3TD7 A;  1J8M F;  3EGD B;  2OJE D;  4JJG A;  1AUE A;  2UUI A;  1CGO A;  4G7H F;  5AC4 A;  1WOL A;  2EIN C;  2OOC A;  5F5F A;  4MVO A;  1Q0K A;  2GFH A;  3EHM A;  5DQT A;  3LES A;  4LDQ A;  2EIJ C;  4MVS A;  3ZVR A;  1GS9 A;  1OW7 A;  2KNH A;  3LUT B;  4JE9 A;  2YWA A;  5KYX A;  3S90 A;  1K04 A;  3K66 A;  4JTA B;  2L6F A;  4D4N A;  5B3I A;  2R25 A;  5BUO A;  2LQG A;  2L6H A;  2CW0 F;  5EGY A;  2R7S A;  5COG A;  1T9K A;  2WVN A;  1FMV A;  4DVY P;  3H2U A;  3L1M A;  5T3W A;  1TFO B;  4G7O F;  5GPG B;  1PD1 A;  1CPR A;  1YVI A;  5BQH A;  1RKE B;  2PBE A;  4Z9H A;  4OD4 A;  4BEJ A;  5KYW B;  3KYJ A;  2DYS C;  3SP1 A;  2G3K A;  2H7B A;  2JX0 A;  4KC9 A;  1C03 A;  4E7Z A;  2J0W A;  1M2V B;  1E86 A;  2A6E F;  3K1I A;  1G4W R;  2QLA A;  2ZXP A;  2FAP B;  3IQ5 A;  2X0C A;  3SYN A;  2G62 A;  2XS1 A;  5E33 A;  5D91 A;  4OIO F;  3T4R A;  4XLN F;  2NUT A;  3U0C A;  1TKN A;  4CIH A;  4PAC A;  3U2L A;  5BQG A;  4MW3 A;  4JTD B;  1WAS A;  2VCC A;  3AOU A;  4U5H A;  2OEX A;  4CDY A;  3JT1 A;  2EPL X;  5B1A C;  3WG7 C;  1NLX A;  1V54 C;  4XQ1 A;  1WTY A;  1ZHY A;  3V5X A;  1CGM E;  1GGQ A;  3I5Q A;  3CQZ A;  3CZ6 A;  3IQC A;  3JYY A;  1AVO B;  3NG1 A;  3FHD A;  3TJ5 A;  1YDI A;  4NC3 A;  4EKW A;  3KL4 A;  3M1C B;  1I4Y A;  4KNW A;  2GAQ A;  1G4U S;  2J0X A;  5IY5 C;  2HUJ A;  3AGT A;  2EPN A; 
#chains in the Genus database with same CATH homology
 4U9E A;  3M4B A;  3C63 A;  3M79 A;  3DE8 A;  4EIY A;  3ZQY A;  2XLH A;  4IB4 A;  1S05 A;  3FOO A;  3NMK A;  3NMJ A;  1E84 A;  1E83 A;  5JS5 A;  4WGZ A;  3QW0 A;  4D4X A;  3QVY A;  1APC A;  1CPQ A;  2YKZ A;  5JP7 A;  4IAR A;  3ZTM A;  2J8W A;  2YL1 A;  3QW1 A;  4JEA A;  4CDV A;  3DE9 A;  4N4W A;  2J9B A;  1GQA A;  2YLG A;  2YL0 A;  3TOL A;  4L6R A;  3ZWI A;  3FOP A;  1LM3 B;  2XLO A;  2XLW A;  1M6T A;  2YLD A;  4WGY A;  4CIP A;  3QVZ A;  1EKY A;  1MQV A;  1NBB A;  4CX9 A;  256B A;  2XM0 A;  4ER9 A;  5JSL A;  3M15 A;  1YYX A;  1A7V A;  3TOM A;  3ZQV A;  1QPU A;  2XL6 A;  1CGO A;  2XLM A;  2XLV A;  3HNK A;  4CJO A;  4JE9 A;  2XL8 A;  4D4N A;  5B3I A;  2YL7 A;  3C62 A;  4JEB A;  5JVE A;  4CDA A;  3U8P A;  3L1M A;  1E85 A;  4N6H A;  2BC5 A;  3IQ6 A;  1CPR A;  4CJG A;  1YZC A;  5JT4 A;  1JAF A;  1RCP A;  3HNL A;  1BBH A;  4U9D A;  2XLE A;  3ZTZ A;  2CCY A;  1E86 A;  1YZA A;  5AGF A;  2QLA A;  3IQ5 A;  5JRA A;  2XM4 A;  2YL3 A;  2XLD A;  4CDY A;  4IAQ A;  3NMI A;  1YYJ A;  3HNJ A;  3HNI A;  4NC3 A;  1CGN A;  1QQ3 A;  5JLI A;  5JUA A;  4ULV A;  2YLI A;  3VRC A;  3M4C A;  4JKV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...