2XLWA

Cytochrome c prime from alcaligenes xylosoxidans: ferrous r124q variant with bound no
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
125
structure length
125
Chain Sequence
EFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords CYTOCHROME C'
publication title Distal-to-Proximal No Conversion in Hemoproteins: The Role of the Proximal Pocket.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
total genus 51
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2010-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 2xlwA00
4D4NA 4D4XA 1LM3B 3U8PA 1E85A 1QPUA 4N6HA 3M4CA 2XLOA 5JVEA 3NMJA 4ULVA 4WGZA 2QLAA 3TOLA 2XM0A 3NMIA 1A7VA 1CPQA 3QVYA 5AGFA 1RCPA 5JS5A 3ZTMA 4CIPA 3HNLA 4CJOA 1MQVA 4JEAA 2YLGA 5JP7A 4CDYA 5JLIA 256BA 1JAFA 4N4WA 4IB4A 4CDVA 5B3IA 2YKZA 4CJGA 1E83A 3IQ5A 2XLWA 4JKVA 1NBBA 3DE8A 4U9EA 2CCYA 2YL7A 3M79A 1M6TA 3C63A 3ZQYA 3ZTZA 3HNKA 3QVZA 2YLIA 1E86A 2XLMA 5JT4A 4IARA 2YL1A 1YZCA 4CDAA 4WGYA 3HNJA 3C62A 2XLEA 4ER9A 3VRCA 4L6RA 1CGNA 1APCA 2YLDA 4NC3A 5JRAA 1GQAA 2YL0A 1BBHA 3NMKA 1E84A 1EKYA 3TOMA 1YZAA 4EIYA 3HNIA 3ZQVA 4IAQA 3FOOA 5JUAA 2YL3A 2XLVA 3QW0A 3M4BA 1CPRA 2XM4A 3M15A 1CGOA 4JE9A 3L1MA 2XL6A 3QW1A 3IQ6A 3ZWIA 1YYXA 2BC5A 2XL8A 2J8WA 4U9DA 3FOPA 2XLHA 1QQ3A 1YYJA 5JSLA 3DE9A 2J9BA 4JEBA 2XLDA 4CX9A 1S05A
chains in the Genus database with same CATH superfamily
3C7JA 4OD4A 3T6GB 1HE1A 2A68F 3FXHA 4QI2A 1LM3B 4MS2A 1UG7A 3DM9B 2VCAA 1I4YA 5DS5A 3EHMA 2LIGA 1BR4A 1JR8A 2LP4A 1NU9C 3EHNA 4IAOA 3VM6A 3W8HA 5L0FA 1SYQA 5DLJA 1QPUA 1LS4A 2PBEA 3F46A 3FAPB 2Y3GA 1VOMA 4ZLCA 1Z3IX 1FFTC 2EIJC 3AG3C 2VC9A 4ULVA 4CS7A 3FHDA 3GODA 1O3UA 3EQLF 1OXBA 2QLAA 4CSAC 3WHNA 4PJLA 4N6CA 4O6NA 2TMVP 4XQ1A 3QVYA 5EGYA 3QZCA 2HV7A 2HSQA 5KYUB 3DXJF 3FVYA 4FWVA 4CBEA 2ZPAA 1QSPA 3C18A 2C04A 2IXOA 3JRMO 5F5HA 2PNOA 1RKEA 1A7EA 1MMAA 1MQVA 2YQYA 4LACB 5COGA 4E7SA 1S7ZA 5JP7A 5A69A 4CDYA 1FMWA 4Z9JA 256BA 1VLSA 2NUPA 3MLGA 3N2ZB 4BJ1A 2JX0A 3HLZA 3MYIA 4JC7A 5E3AA 3O6XA 3SXYA 3EZIA 4DJ9A 4C7OA 3U5SA 5F28E 1VMAA 1TQGA 2H7OA 1YARO 3TJ5A 3AOUA 5COFA 1A7DA 1NBBA 1Q0DA 1ZHTA 4KNWA 5E2QA 3JYHA 4W8KA 3ZSUA 3HKKA 3B9QA 2YL7A 4U9EA 1QVXA 4FX5A 4AX2A 3PMRA 4CS8A 2W4BA 4LLCA 1HW2A 2XXAA 3S29A 2X0CA 3ASOC 2P61A 4LDRA 3ZQYA 3WODF 2HKVA 3ZTZA 1ZW2A 1UFBA 1CGME 1O5HA 5COMA 4U5EE 3ZIBA 3QTHA 1SR2A 3RQFA 4Q4ZF 2VH3A 4XEKA 1VTMP 1E86A 1RJ9B 1OW6A 2PP4A 1G5ZA 3AJMA 3K1HA 3RYLA 3U3BA 1R4TA 4MW3A 1GS9A 4F4BA 2VCCA 5L3VA 1ORYA 1YJGA 2M64A 3UNGC 1ZHZA 2OJED 2PFDA 1VB5A 3JCUQ 4P9FA 2OOCA 2R03A 4NTFA 2AVKA 2JPUA 2KQ9A 3MYFA 4IJJA 5BQHA 1ZZPA 3N24A 5KYUA 4YK5A 3DD7A 4NQFA 1NU7D 2CDQA 3NMKA 5DQZA 3RFYA 2IBFA 2LCHA 4OINF 5L0GA 3B0VC 1EKYA 2V26A 2R02A 1YA7O 1T9KA 1YZAA 2R7OA 5EK0A 3N0TA 2CGEA 3FOOA 1PD0A 5BUOA 5JUAA 4UDVA 2XLVA 1QZXA 3CQZA 1RKCA 2Y3HA 2Q9CA 3GWNA 2EIKC 3H2VA 3M4BA 1CPRA 5EHHA 4JJFA 3J06A 1GM5A 4ONSA 2KYHA 3V5YA 1FAPB 1Z23A 4E7ZA 3JYYA 1W2WA 3S28A 3T9OA 1PD1A 3GANA 4G7OF 4JE9A 5A6AA 3QW1A 2HS5A 3LJBA 4BJ6C 4HFFB 1TWCA 2ICWG 1T5OA 2J45A 1D1CA 2ETSA 3A9CA 2G3VA 3FOPA 3U2LA 3UMIA 2WVNA 3F47A 2I15A 5E33A 4E0HA 3B0UX 5JSLA 4YL3A 3IHUA 1RJ9A 1RXQA 1FR0A 3LS0A 4OIQF 4JEBA 4CX9A 5D92A 2PX3A 3AG4C 2OG2A 4JCHA 3DI5A 1TFOB 3UGOA 1B68A 1OXKA 5D91A 4XLPF 5DQTA 3TJ6A 1E85A 3OEOA 2HZ8A 4DBQA 5IY5C 4CSAA 1JRAA 2CNWD 3NRHA 3M4CA 2XLOA 3NKEA 3G50A 3NMJA 4IRUA 5JVEA 5HV9A 3H65A 3LLKA 2Q7RA 2IXMA 2ZXOA 2G3KA 2KW3C 2L81A 3NMIA 4OIPF 1Z5ZA 1A7VA 4EKWA 1DOVA 1ST6A 1FMVA 2EPMX 1WTYA 1LI7A 2M4EA 3R7CA 3RIPA 5AC5A 2QTVA 1MMGA 2EILC 2L6HA 2PX0A 1M57C 3ZTMA 3MBGA 5JS5A 2R7UA 2B0HA 3QMKA 4JVSA 3U0CA 3V5XA 1NZEA 4JTCB 4U5GA 4Z9IA 1OW8A 1JAFA 4RBNA 2J9WA 2R7WA 2R7TA 4I3MA 1OCOC 5CIVA 3EH2A 1YA9A 1JOGA 4IB4A 3EZHA 2L7AA 1Z6AA 5T3WA 3IQ5A 2XLWA 1I4ZA 1XZQA 2LQGA 2YEVA 3T6JA 2Y69C 3NG1A 2A1DD 2IM8A 2R25A 3I4UA 2Q4FA 4AE4A 4G0HA 5L0DA 4MVRA 2CCYA 2HUJA 4YL1A 3W2WA 4K0DA 1NSGB 1M6TA 4YJWA 3GEIA 1J8MF 3EGDB 4RD9A 1VK5A 3JT1A 3G4ZA 1BR2A 1YVIA 2AWCA 3KKBA 3LAYA 2MWQA 1RMVA 1AVOB 2XSEA 3LLIA 2AP3A 4M63A 1M2OA 1I5NA 4PACA 4QDLA 3ABMC 1OKKD 3SEOA 2IOQA 3A11A 5TJ5E 4YT8A 4XEVA 2XLMA 3S90A 2XS1A 3U8VA 1Q0GA 2MHRA 2BE5F 2NUTB 2R7XA 2GDCA 3NDBB 1YDIA 4JIOA 4MTOA 1TFKB 4WGYA 1FFHA 2UUIA 4YT5A 4H4KC 5KYNA 3HNJA 3RQEA 3HTKC 3IEEA 5BQGA 5DVWA 3UGPA 3SZRA 4ER9A 1OCZC 2KJGA 4LLEA 4U5HA 3IQCA 3LESA 1MNEA 2P1AA 2L9JA 1C17M 4EBJA 3U3FA 1N1CA 2YLDA 4CS9C 3POVA 4J7TA 2VB6A 2YL0A 2ZXRA 1A41A 1IW7F 3K1IC 3V5ZA 3Q6NA 5CI9A 2OU6A 3LNRA 1GGQA 3U9MA 4JTAB 3X2QC 2W45A 1E84A 4H54A 4G7HF 2E87A 3X1OA 1LI5A 1VYKA 3AG2C 3HNIA 1HMDA 1NFNA 4R32A 3ZQVA 4EBBA 4CIHA 2F22A 5KYYB 2L6FA 3R2PA 3PCVA 3KPHA 4LDKA 3NYLA 3LUTB 4JURI 4PK4A 4IWBA 3ABLC 3L8JA 3O39A 4EWCA 1H7IA 2J0WA 2DYSC 4O6MA 5DS6A 1K40A 2J7PD 4XTKA 3T6BA 4MVZA 4MVQA 2W4MA 3L1MA 1JPJA 2Q3TA 2CNWA 3IQ6A 2Q9AA 3K6BA 2MYSA 4MW8A 2BC5A 3EGDA 4MNDA 2GWWA 4RDAA 3L0IA 3GM3A 2AU5A 4C3BA 1R5ID 3KYIA 1YYJA 4P9TA 4HFKB 2ZXWC 3DE9A 4DBRA 2GA0A 1BR1A 2P6VA 3M1CB 3JRTA 1XZPA 4G78A 4N06A 2NUTA 4DRJB 5K0IA 3LEVA 1T01A 3EPVA 5T1DB 1OCRC 3S27A 2H8AA 1WATA 2G62A 3U8PA 2R7QA 2H7VC 2LFDA 2KSFA 3DZAA 5E3CA 4IGGA 3KMIA 1TWHA 3VAYA 2L6GA 2W9YA 4GEHA 1D1BA 3G4XA 1WOLA 3EGXB 4MQ9F 1LIHA 5BQIA 2KGOA 2YRFA 2GAQA 2EPNA 3LS1A 4WGZA 1JPNA 3TOLA 1H9GA 1Q0KA 2XM0A 1XWJA 4MTFA 3AQCA 4BJ5C 3RF3A 4DRIB 3UMHA 1M2VB 3ITFA 4YT2A 5B3SC 2LK4A 1Q0MA 3EH1A 5KYYA 3ECSA 4AE4B 2HFIA 3KH2A 4CS8C 3MFNA 4U5CE 3GM1A 2NSFA 4FAPB 2YHSA 4JW1A 4CIPA 3DJNB 4CJOA 2A0UA 2Y3DA 2HJ3A 1OKKA 2DYRC 2OKUA 1G4US 2YLGA 4WABA 3TK0A 1TR2A 3S0XA 4Q5SF 5JLIA 1D0YA 1O87A 2LD6A 3GORA 4N4WA 1Z7Qc 4PR9A 1F1MA 2ASRA 4MTGA 2RD9A 5B3IA 2YZSA 3DAGA 2YKZA 1ZVZA 3ZG1A 4QI0A 5A6BD 3FAJA 5L0IA 3B71A 4CJGA 5FCLA 1E83A 1TKNA 3ZVRA 1VLTA 4DOZA 5A6KA 2DGJA 1TWAA 3RQGA 3DE8A 1MMNA 1C03A 3IQTA 1OR2A 4ZLDA 4PJMA 4PFPA 3OWTA 3UR3C 4MVSA 3M79A 4BEMJ 3I5QA 3DKAA 1J8YF 1T6IA 4EHPA 4EUKB 3SP1A 1L7CA 1D0ZA 2A0BA 3SXMA 4YT4A 3QVZA 2O9XA 4XWJA 3H2UA 4B6IA 4JCZA 3DMDA 1LKXA 1SMYF 3EFOB 4U5DE 2QUPA 2ZXPA 2YL1A 3HJCA 3SXKA 1ZU4A 1K04A 2QE9A 4OIOF 1KTMA 3EGXA 4ULWA 3GEEA 1T6UA 2Y3BA 4O7GA 4JRZA 5L0CA 2XLEA 2QNLA 2VCBA 3VYWA 2Q00A 2J7PA 1AEPA 1SF8A 2EINC 3AQBA 3L34A 1M2VA 2WVOA 2KK1A 2PF4E 3ABKC 4KC9A 1V4AA 4ANJA 4C3DA 2AWYA 3BEHA 1APCA 1CGNA 3CSKA 1MNDA 4NC3A 4JTDB 5FZTA 2OCCC 4WJ0A 2IYLD 2P7VA 2R05A 4XEFA 3SXZA 1K05A 4I44A 1BDJB 1TWGA 4O79A 2Z15A 4BEJA 1NG1A 1WGWA 3JSEO 3TOMA 1KNYA 5HSWA 2XS8A 4IAQA 2FAPB 1OCCC 4JZAA 1C02A 3EJNA 1Y6DA 1OW7A 1PCXA 1WN0A 3DAFA 2XM4A 4NTBA 1FNTc 3AGTA 1V54C 3M15A 4EBKA 1CGOA 1U0BB 4W8PA 4K7BA 1EA8A 2CW0F 3RVZA 1HY5A 2P0NA 4KI2A 3GWLA 4Z9HA 2WB7A 4I1OB 3RVYA 2XL6A 3B29A 3WG7C 1KU2A 4BG0A 3ZWIA 3AG1C 2DI3A 3T4RA 2XL8A 1VYIA 1D1AA 1V74B 4KBLA 2NSGA 4U9DA 2V3CC 4GYTA 3L8IA 4YWQA 2EPKX 4BJTA 1EQ1A 3JZ0A 2D5RB 3WAQA 3C8GD 3EFOA 1A0BA 1ZU5A 4X0RA 4DXWA 3DJUB 2J9BA 3GEHA 4PJNA 4YL0A 4DRHB 2XLDA 4DVYP 1S05A 5DS4A 3RKOF 3E9VA 4DVZA 1PV3A 2A6HF 1ZHXA 1LVKA 2LSEA 1L3PA 2YVKA 2QY9A 4MVUA 4D4NA 4J32B 4D4XA 3PDMP 3SNHA 1OR3A 1T6QA 3NKDA 3FMSA 4J7YA 4BJ6A 3CZ6A 3NYJA 4N6HA 3VF0A 4K1OA 3U2MA 4XPYA 4HEAJ 3DWWA 3RW0A 3W8IA 4BJ5A 1E2XA 5A6BA 2B0JA 4I1MA 1LE4A 1Z63A 2IXNA 2VASA 3K33A 4AL1A 1NLXA 2OJQA 3W4YA 2KNHA 1SZIA 1WASA 2J9UA 2XRHA 3AGUA 3O10A 4PFOA 3US6A 1JMWA 1CPQA 1IZMA 1HMOA 3BRJA 3CEXA 4BPMA 5AC4A 2X51A 5AGFA 2ZD9A 1RCPA 3ATPA 1H9TA 5KYWB 2FFHA 5B1BC 3HNLA 4JEAA 1HE9A 4C3EA 2NPUA 2R7RA 1LPEA 3C8GB 1LS1A 3B0PA 4YN0B 3TQOA 3DM5A 3OA1A 4CDVA 4PJJA 3K7DA 4KNVA 3EG9B 1G8XA 1MMDA 4A4AA 2BL2A 1EI7A 2OQMA 4Q7CA 5KYXB 4J30B 4JKVA 3NYMA 2HJMA 2EIMC 1Q0FA 2J9VA 3U9JA 2EPOA 2XXAB 2DB4A 3TD7A 3RH3A 5A6JA 2R7VA 1Y4CA 3C63A 3S9OA 1G4WR 5L0JA 1DOWA 2CYDA 2WL8A 4AL0A 3HNKA 4HE8D 2UUHA 1ORJA 2YLIA 2Y39A 1V55C 2C03A 4E0IA 2R9RB 4IARA 5JT4A 1D0XA 2WZGA 4GQHA 4U5FE 3S84A 1YZCA 4CDAA 1U89A 2Q9BA 4G7ZF 3FDQA 1ZYRF 3MX3A 3K66A 4MVOA 2I8BA 3C62A 3UMKA 2GFHA 4XPWA 4MVMA 1ZW3A 2FGYA 2OEVA 2J46A 4OIRF 3V7OA 3VRCA 1ZHWA 2HMQA 4E18A 3Q7LA 4L6RA 3LNMB 3KL4A 4JJGA 4LDQA 2YWAA 3O55A 1M56C 5JRAA 1GQAA 2LFFA 3KYJA 1BBHA 1WWPA 5GPGB 3SYNA 2WZFA 5KYWA 5F5FA 1HW1A 5L0HA 2H7BA 2JD3A 1AUEA 2HSBA 1U6HA 2A69F 4EIYA 3C8GA 4OD5A 4NCQA 1LE2A 2WZLA 4E17A 4XPXA 2YL3A 3TULA 2D4UA 1H6GA 1YAUO 5CI8A 3E70C 2HMZA 3QW0A 3PHF2 3GM2A 3EG9A 3I5PA 1RKEB 3JTLO 5KYXA 1NFOA 2EPLX 2XL4A 1QKRA 2KC3A 3Q6MA 4CS9A 2NUPB 1OQCA 1QLEC 1ORSC 3JSZA 1YYXA 3K1IA 4O6YA 5L3QA 2NG1A 3ASNC 3CAXA 2IXPA 2J8WA 4AK9A 1BZ4A 4C7OB 5T3TA 4XLNF 2WVQA 2HV6A 2XLHA 3C8ZA 4P6IC 1QQ3A 1YLMA 3ZDLA 1FTSA 2OEXA 1ZHYA 4NTAA 5B1AC 2R7SA 4NY3A 3W2VA 3ZC4A 3LEOA 4U5BE 2J0XA 4LERA 2A6EF 2RSEB 3Q7GA 4FESA 4A2NB 3IPMO
chains in the Genus database with same CATH topology
4D4NA 4D4XA 1LM3B 3U8PA 1E85A 1QPUA 4N6HA 3M4CA 2XLOA 5JVEA 3NMJA 4ULVA 4WGZA 2QLAA 3TOLA 2XM0A 3NMIA 1A7VA 1CPQA 3QVYA 5AGFA 1RCPA 5JS5A 3ZTMA 4CIPA 3HNLA 4CJOA 1MQVA 4JEAA 2YLGA 5JP7A 4CDYA 5JLIA 256BA 1JAFA 4N4WA 4IB4A 4CDVA 5B3IA 2YKZA 4CJGA 1E83A 3IQ5A 2XLWA 4JKVA 1NBBA 3DE8A 4U9EA 2CCYA 2YL7A 3M79A 1M6TA 3C63A 3ZQYA 3ZTZA 3HNKA 3QVZA 2YLIA 1E86A 2XLMA 5JT4A 4IARA 2YL1A 1YZCA 4CDAA 4WGYA 3HNJA 3C62A 2XLEA 4ER9A 3VRCA 4L6RA 1CGNA 1APCA 2YLDA 4NC3A 5JRAA 1GQAA 2YL0A 1BBHA 3NMKA 1E84A 1EKYA 3TOMA 1YZAA 4EIYA 3HNIA 3ZQVA 4IAQA 3FOOA 5JUAA 2YL3A 2XLVA 3QW0A 3M4BA 1CPRA 2XM4A 3M15A 1CGOA 4JE9A 3L1MA 2XL6A 3QW1A 3IQ6A 3ZWIA 1YYXA 2BC5A 2XL8A 2J8WA 4U9DA 3FOPA 2XLHA 1QQ3A 1YYJA 5JSLA 3DE9A 2J9BA 4JEBA 2XLDA 4CX9A 1S05A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4D4N A;  4D4X A;  1LM3 B;  3U8P A;  1E85 A;  1QPU A;  4N6H A;  3M4C A;  2XLO A;  5JVE A;  3NMJ A;  4ULV A;  4WGZ A;  2QLA A;  3TOL A;  2XM0 A;  3NMI A;  1A7V A;  1CPQ A;  3QVY A;  5AGF A;  1RCP A;  5JS5 A;  3ZTM A;  4CIP A;  3HNL A;  4CJO A;  1MQV A;  4JEA A;  2YLG A;  5JP7 A;  4CDY A;  5JLI A;  256B A;  1JAF A;  4N4W A;  4IB4 A;  4CDV A;  5B3I A;  2YKZ A;  4CJG A;  1E83 A;  3IQ5 A;  2XLW A;  4JKV A;  1NBB A;  3DE8 A;  4U9E A;  2CCY A;  2YL7 A;  3M79 A;  1M6T A;  3C63 A;  3ZQY A;  3ZTZ A;  3HNK A;  3QVZ A;  2YLI A;  1E86 A;  2XLM A;  5JT4 A;  4IAR A;  2YL1 A;  1YZC A;  4CDA A;  4WGY A;  3HNJ A;  3C62 A;  2XLE A;  4ER9 A;  3VRC A;  4L6R A;  1CGN A;  1APC A;  2YLD A;  4NC3 A;  5JRA A;  1GQA A;  2YL0 A;  1BBH A;  3NMK A;  1E84 A;  1EKY A;  3TOM A;  1YZA A;  4EIY A;  3HNI A;  3ZQV A;  4IAQ A;  3FOO A;  5JUA A;  2YL3 A;  2XLV A;  3QW0 A;  3M4B A;  1CPR A;  2XM4 A;  3M15 A;  1CGO A;  4JE9 A;  3L1M A;  2XL6 A;  3QW1 A;  3IQ6 A;  3ZWI A;  1YYX A;  2BC5 A;  2XL8 A;  2J8W A;  4U9D A;  3FOP A;  2XLH A;  1QQ3 A;  1YYJ A;  5JSL A;  3DE9 A;  2J9B A;  4JEB A;  2XLD A;  4CX9 A;  1S05 A; 
#chains in the Genus database with same CATH topology
 3C7J A;  4OD4 A;  3T6G B;  1HE1 A;  2A68 F;  3FXH A;  4QI2 A;  1LM3 B;  4MS2 A;  1UG7 A;  3DM9 B;  2VCA A;  1I4Y A;  5DS5 A;  3EHM A;  2LIG A;  1BR4 A;  1JR8 A;  2LP4 A;  1NU9 C;  3EHN A;  4IAO A;  3VM6 A;  3W8H A;  5L0F A;  1SYQ A;  5DLJ A;  1QPU A;  1LS4 A;  2PBE A;  3F46 A;  3FAP B;  2Y3G A;  1VOM A;  4ZLC A;  1Z3I X;  1FFT C;  2EIJ C;  3AG3 C;  2VC9 A;  4ULV A;  4CS7 A;  3FHD A;  3GOD A;  1O3U A;  3EQL F;  1OXB A;  2QLA A;  4CSA C;  3WHN A;  4PJL A;  4N6C A;  4O6N A;  2TMV P;  4XQ1 A;  3QVY A;  5EGY A;  3QZC A;  2HV7 A;  2HSQ A;  5KYU B;  3DXJ F;  3FVY A;  4FWV A;  4CBE A;  2ZPA A;  1QSP A;  3C18 A;  2C04 A;  2IXO A;  3JRM O;  5F5H A;  2PNO A;  1RKE A;  1A7E A;  1MMA A;  1MQV A;  2YQY A;  4LAC B;  5COG A;  4E7S A;  1S7Z A;  5JP7 A;  5A69 A;  4CDY A;  1FMW A;  4Z9J A;  256B A;  1VLS A;  2NUP A;  3MLG A;  3N2Z B;  4BJ1 A;  2JX0 A;  3HLZ A;  3MYI A;  4JC7 A;  5E3A A;  3O6X A;  3SXY A;  3EZI A;  4DJ9 A;  4C7O A;  3U5S A;  5F28 E;  1VMA A;  1TQG A;  2H7O A;  1YAR O;  3TJ5 A;  3AOU A;  5COF A;  1A7D A;  1NBB A;  1Q0D A;  1ZHT A;  4KNW A;  5E2Q A;  3JYH A;  4W8K A;  3ZSU A;  3HKK A;  3B9Q A;  2YL7 A;  4U9E A;  1QVX A;  4FX5 A;  4AX2 A;  3PMR A;  4CS8 A;  2W4B A;  4LLC A;  1HW2 A;  2XXA A;  3S29 A;  2X0C A;  3ASO C;  2P61 A;  4LDR A;  3ZQY A;  3WOD F;  2HKV A;  3ZTZ A;  1ZW2 A;  1UFB A;  1CGM E;  1O5H A;  5COM A;  4U5E E;  3ZIB A;  3QTH A;  1SR2 A;  3RQF A;  4Q4Z F;  2VH3 A;  4XEK A;  1VTM P;  1E86 A;  1RJ9 B;  1OW6 A;  2PP4 A;  1G5Z A;  3AJM A;  3K1H A;  3RYL A;  3U3B A;  1R4T A;  4MW3 A;  1GS9 A;  4F4B A;  2VCC A;  5L3V A;  1ORY A;  1YJG A;  2M64 A;  3UNG C;  1ZHZ A;  2OJE D;  2PFD A;  1VB5 A;  3JCU Q;  4P9F A;  2OOC A;  2R03 A;  4NTF A;  2AVK A;  2JPU A;  2KQ9 A;  3MYF A;  4IJJ A;  5BQH A;  1ZZP A;  3N24 A;  5KYU A;  4YK5 A;  3DD7 A;  4NQF A;  1NU7 D;  2CDQ A;  3NMK A;  5DQZ A;  3RFY A;  2IBF A;  2LCH A;  4OIN F;  5L0G A;  3B0V C;  1EKY A;  2V26 A;  2R02 A;  1YA7 O;  1T9K A;  1YZA A;  2R7O A;  5EK0 A;  3N0T A;  2CGE A;  3FOO A;  1PD0 A;  5BUO A;  5JUA A;  4UDV A;  2XLV A;  1QZX A;  3CQZ A;  1RKC A;  2Y3H A;  2Q9C A;  3GWN A;  2EIK C;  3H2V A;  3M4B A;  1CPR A;  5EHH A;  4JJF A;  3J06 A;  1GM5 A;  4ONS A;  2KYH A;  3V5Y A;  1FAP B;  1Z23 A;  4E7Z A;  3JYY A;  1W2W A;  3S28 A;  3T9O A;  1PD1 A;  3GAN A;  4G7O F;  4JE9 A;  5A6A A;  3QW1 A;  2HS5 A;  3LJB A;  4BJ6 C;  4HFF B;  1TWC A;  2ICW G;  1T5O A;  2J45 A;  1D1C A;  2ETS A;  3A9C A;  2G3V A;  3FOP A;  3U2L A;  3UMI A;  2WVN A;  3F47 A;  2I15 A;  5E33 A;  4E0H A;  3B0U X;  5JSL A;  4YL3 A;  3IHU A;  1RJ9 A;  1RXQ A;  1FR0 A;  3LS0 A;  4OIQ F;  4JEB A;  4CX9 A;  5D92 A;  2PX3 A;  3AG4 C;  2OG2 A;  4JCH A;  3DI5 A;  1TFO B;  3UGO A;  1B68 A;  1OXK A;  5D91 A;  4XLP F;  5DQT A;  3TJ6 A;  1E85 A;  3OEO A;  2HZ8 A;  4DBQ A;  5IY5 C;  4CSA A;  1JRA A;  2CNW D;  3NRH A;  3M4C A;  2XLO A;  3NKE A;  3G50 A;  3NMJ A;  4IRU A;  5JVE A;  5HV9 A;  3H65 A;  3LLK A;  2Q7R A;  2IXM A;  2ZXO A;  2G3K A;  2KW3 C;  2L81 A;  3NMI A;  4OIP F;  1Z5Z A;  1A7V A;  4EKW A;  1DOV A;  1ST6 A;  1FMV A;  2EPM X;  1WTY A;  1LI7 A;  2M4E A;  3R7C A;  3RIP A;  5AC5 A;  2QTV A;  1MMG A;  2EIL C;  2L6H A;  2PX0 A;  1M57 C;  3ZTM A;  3MBG A;  5JS5 A;  2R7U A;  2B0H A;  3QMK A;  4JVS A;  3U0C A;  3V5X A;  1NZE A;  4JTC B;  4U5G A;  4Z9I A;  1OW8 A;  1JAF A;  4RBN A;  2J9W A;  2R7W A;  2R7T A;  4I3M A;  1OCO C;  5CIV A;  3EH2 A;  1YA9 A;  1JOG A;  4IB4 A;  3EZH A;  2L7A A;  1Z6A A;  5T3W A;  3IQ5 A;  2XLW A;  1I4Z A;  1XZQ A;  2LQG A;  2YEV A;  3T6J A;  2Y69 C;  3NG1 A;  2A1D D;  2IM8 A;  2R25 A;  3I4U A;  2Q4F A;  4AE4 A;  4G0H A;  5L0D A;  4MVR A;  2CCY A;  2HUJ A;  4YL1 A;  3W2W A;  4K0D A;  1NSG B;  1M6T A;  4YJW A;  3GEI A;  1J8M F;  3EGD B;  4RD9 A;  1VK5 A;  3JT1 A;  3G4Z A;  1BR2 A;  1YVI A;  2AWC A;  3KKB A;  3LAY A;  2MWQ A;  1RMV A;  1AVO B;  2XSE A;  3LLI A;  2AP3 A;  4M63 A;  1M2O A;  1I5N A;  4PAC A;  4QDL A;  3ABM C;  1OKK D;  3SEO A;  2IOQ A;  3A11 A;  5TJ5 E;  4YT8 A;  4XEV A;  2XLM A;  3S90 A;  2XS1 A;  3U8V A;  1Q0G A;  2MHR A;  2BE5 F;  2NUT B;  2R7X A;  2GDC A;  3NDB B;  1YDI A;  4JIO A;  4MTO A;  1TFK B;  4WGY A;  1FFH A;  2UUI A;  4YT5 A;  4H4K C;  5KYN A;  3HNJ A;  3RQE A;  3HTK C;  3IEE A;  5BQG A;  5DVW A;  3UGP A;  3SZR A;  4ER9 A;  1OCZ C;  2KJG A;  4LLE A;  4U5H A;  3IQC A;  3LES A;  1MNE A;  2P1A A;  2L9J A;  1C17 M;  4EBJ A;  3U3F A;  1N1C A;  2YLD A;  4CS9 C;  3POV A;  4J7T A;  2VB6 A;  2YL0 A;  2ZXR A;  1A41 A;  1IW7 F;  3K1I C;  3V5Z A;  3Q6N A;  5CI9 A;  2OU6 A;  3LNR A;  1GGQ A;  3U9M A;  4JTA B;  3X2Q C;  2W45 A;  1E84 A;  4H54 A;  4G7H F;  2E87 A;  3X1O A;  1LI5 A;  1VYK A;  3AG2 C;  3HNI A;  1HMD A;  1NFN A;  4R32 A;  3ZQV A;  4EBB A;  4CIH A;  2F22 A;  5KYY B;  2L6F A;  3R2P A;  3PCV A;  3KPH A;  4LDK A;  3NYL A;  3LUT B;  4JUR I;  4PK4 A;  4IWB A;  3ABL C;  3L8J A;  3O39 A;  4EWC A;  1H7I A;  2J0W A;  2DYS C;  4O6M A;  5DS6 A;  1K40 A;  2J7P D;  4XTK A;  3T6B A;  4MVZ A;  4MVQ A;  2W4M A;  3L1M A;  1JPJ A;  2Q3T A;  2CNW A;  3IQ6 A;  2Q9A A;  3K6B A;  2MYS A;  4MW8 A;  2BC5 A;  3EGD A;  4MND A;  2GWW A;  4RDA A;  3L0I A;  3GM3 A;  2AU5 A;  4C3B A;  1R5I D;  3KYI A;  1YYJ A;  4P9T A;  4HFK B;  2ZXW C;  3DE9 A;  4DBR A;  2GA0 A;  1BR1 A;  2P6V A;  3M1C B;  3JRT A;  1XZP A;  4G78 A;  4N06 A;  2NUT A;  4DRJ B;  5K0I A;  3LEV A;  1T01 A;  3EPV A;  5T1D B;  1OCR C;  3S27 A;  2H8A A;  1WAT A;  2G62 A;  3U8P A;  2R7Q A;  2H7V C;  2LFD A;  2KSF A;  3DZA A;  5E3C A;  4IGG A;  3KMI A;  1TWH A;  3VAY A;  2L6G A;  2W9Y A;  4GEH A;  1D1B A;  3G4X A;  1WOL A;  3EGX B;  4MQ9 F;  1LIH A;  5BQI A;  2KGO A;  2YRF A;  2GAQ A;  2EPN A;  3LS1 A;  4WGZ A;  1JPN A;  3TOL A;  1H9G A;  1Q0K A;  2XM0 A;  1XWJ A;  4MTF A;  3AQC A;  4BJ5 C;  3RF3 A;  4DRI B;  3UMH A;  1M2V B;  3ITF A;  4YT2 A;  5B3S C;  2LK4 A;  1Q0M A;  3EH1 A;  5KYY A;  3ECS A;  4AE4 B;  2HFI A;  3KH2 A;  4CS8 C;  3MFN A;  4U5C E;  3GM1 A;  2NSF A;  4FAP B;  2YHS A;  4JW1 A;  4CIP A;  3DJN B;  4CJO A;  2A0U A;  2Y3D A;  2HJ3 A;  1OKK A;  2DYR C;  2OKU A;  1G4U S;  2YLG A;  4WAB A;  3TK0 A;  1TR2 A;  3S0X A;  4Q5S F;  5JLI A;  1D0Y A;  1O87 A;  2LD6 A;  3GOR A;  4N4W A;  1Z7Q c;  4PR9 A;  1F1M A;  2ASR A;  4MTG A;  2RD9 A;  5B3I A;  2YZS A;  3DAG A;  2YKZ A;  1ZVZ A;  3ZG1 A;  4QI0 A;  5A6B D;  3FAJ A;  5L0I A;  3B71 A;  4CJG A;  5FCL A;  1E83 A;  1TKN A;  3ZVR A;  1VLT A;  4DOZ A;  5A6K A;  2DGJ A;  1TWA A;  3RQG A;  3DE8 A;  1MMN A;  1C03 A;  3IQT A;  1OR2 A;  4ZLD A;  4PJM A;  4PFP A;  3OWT A;  3UR3 C;  4MVS A;  3M79 A;  4BEM J;  3I5Q A;  3DKA A;  1J8Y F;  1T6I A;  4EHP A;  4EUK B;  3SP1 A;  1L7C A;  1D0Z A;  2A0B A;  3SXM A;  4YT4 A;  3QVZ A;  2O9X A;  4XWJ A;  3H2U A;  4B6I A;  4JCZ A;  3DMD A;  1LKX A;  1SMY F;  3EFO B;  4U5D E;  2QUP A;  2ZXP A;  2YL1 A;  3HJC A;  3SXK A;  1ZU4 A;  1K04 A;  2QE9 A;  4OIO F;  1KTM A;  3EGX A;  4ULW A;  3GEE A;  1T6U A;  2Y3B A;  4O7G A;  4JRZ A;  5L0C A;  2XLE A;  2QNL A;  2VCB A;  3VYW A;  2Q00 A;  2J7P A;  1AEP A;  1SF8 A;  2EIN C;  3AQB A;  3L34 A;  1M2V A;  2WVO A;  2KK1 A;  2PF4 E;  3ABK C;  4KC9 A;  1V4A A;  4ANJ A;  4C3D A;  2AWY A;  3BEH A;  1APC A;  1CGN A;  3CSK A;  1MND A;  4NC3 A;  4JTD B;  5FZT A;  2OCC C;  4WJ0 A;  2IYL D;  2P7V A;  2R05 A;  4XEF A;  3SXZ A;  1K05 A;  4I44 A;  1BDJ B;  1TWG A;  4O79 A;  2Z15 A;  4BEJ A;  1NG1 A;  1WGW A;  3JSE O;  3TOM A;  1KNY A;  5HSW A;  2XS8 A;  4IAQ A;  2FAP B;  1OCC C;  4JZA A;  1C02 A;  3EJN A;  1Y6D A;  1OW7 A;  1PCX A;  1WN0 A;  3DAF A;  2XM4 A;  4NTB A;  1FNT c;  3AGT A;  1V54 C;  3M15 A;  4EBK A;  1CGO A;  1U0B B;  4W8P A;  4K7B A;  1EA8 A;  2CW0 F;  3RVZ A;  1HY5 A;  2P0N A;  4KI2 A;  3GWL A;  4Z9H A;  2WB7 A;  4I1O B;  3RVY A;  2XL6 A;  3B29 A;  3WG7 C;  1KU2 A;  4BG0 A;  3ZWI A;  3AG1 C;  2DI3 A;  3T4R A;  2XL8 A;  1VYI A;  1D1A A;  1V74 B;  4KBL A;  2NSG A;  4U9D A;  2V3C C;  4GYT A;  3L8I A;  4YWQ A;  2EPK X;  4BJT A;  1EQ1 A;  3JZ0 A;  2D5R B;  3WAQ A;  3C8G D;  3EFO A;  1A0B A;  1ZU5 A;  4X0R A;  4DXW A;  3DJU B;  2J9B A;  3GEH A;  4PJN A;  4YL0 A;  4DRH B;  2XLD A;  4DVY P;  1S05 A;  5DS4 A;  3RKO F;  3E9V A;  4DVZ A;  1PV3 A;  2A6H F;  1ZHX A;  1LVK A;  2LSE A;  1L3P A;  2YVK A;  2QY9 A;  4MVU A;  4D4N A;  4J32 B;  4D4X A;  3PDM P;  3SNH A;  1OR3 A;  1T6Q A;  3NKD A;  3FMS A;  4J7Y A;  4BJ6 A;  3CZ6 A;  3NYJ A;  4N6H A;  3VF0 A;  4K1O A;  3U2M A;  4XPY A;  4HEA J;  3DWW A;  3RW0 A;  3W8I A;  4BJ5 A;  1E2X A;  5A6B A;  2B0J A;  4I1M A;  1LE4 A;  1Z63 A;  2IXN A;  2VAS A;  3K33 A;  4AL1 A;  1NLX A;  2OJQ A;  3W4Y A;  2KNH A;  1SZI A;  1WAS A;  2J9U A;  2XRH A;  3AGU A;  3O10 A;  4PFO A;  3US6 A;  1JMW A;  1CPQ A;  1IZM A;  1HMO A;  3BRJ A;  3CEX A;  4BPM A;  5AC4 A;  2X51 A;  5AGF A;  2ZD9 A;  1RCP A;  3ATP A;  1H9T A;  5KYW B;  2FFH A;  5B1B C;  3HNL A;  4JEA A;  1HE9 A;  4C3E A;  2NPU A;  2R7R A;  1LPE A;  3C8G B;  1LS1 A;  3B0P A;  4YN0 B;  3TQO A;  3DM5 A;  3OA1 A;  4CDV A;  4PJJ A;  3K7D A;  4KNV A;  3EG9 B;  1G8X A;  1MMD A;  4A4A A;  2BL2 A;  1EI7 A;  2OQM A;  4Q7C A;  5KYX B;  4J30 B;  4JKV A;  3NYM A;  2HJM A;  2EIM C;  1Q0F A;  2J9V A;  3U9J A;  2EPO A;  2XXA B;  2DB4 A;  3TD7 A;  3RH3 A;  5A6J A;  2R7V A;  1Y4C A;  3C63 A;  3S9O A;  1G4W R;  5L0J A;  1DOW A;  2CYD A;  2WL8 A;  4AL0 A;  3HNK A;  4HE8 D;  2UUH A;  1ORJ A;  2YLI A;  2Y39 A;  1V55 C;  2C03 A;  4E0I A;  2R9R B;  4IAR A;  5JT4 A;  1D0X A;  2WZG A;  4GQH A;  4U5F E;  3S84 A;  1YZC A;  4CDA A;  1U89 A;  2Q9B A;  4G7Z F;  3FDQ A;  1ZYR F;  3MX3 A;  3K66 A;  4MVO A;  2I8B A;  3C62 A;  3UMK A;  2GFH A;  4XPW A;  4MVM A;  1ZW3 A;  2FGY A;  2OEV A;  2J46 A;  4OIR F;  3V7O A;  3VRC A;  1ZHW A;  2HMQ A;  4E18 A;  3Q7L A;  4L6R A;  3LNM B;  3KL4 A;  4JJG A;  4LDQ A;  2YWA A;  3O55 A;  1M56 C;  5JRA A;  1GQA A;  2LFF A;  3KYJ A;  1BBH A;  1WWP A;  5GPG B;  3SYN A;  2WZF A;  5KYW A;  5F5F A;  1HW1 A;  5L0H A;  2H7B A;  2JD3 A;  1AUE A;  2HSB A;  1U6H A;  2A69 F;  4EIY A;  3C8G A;  4OD5 A;  4NCQ A;  1LE2 A;  2WZL A;  4E17 A;  4XPX A;  2YL3 A;  3TUL A;  2D4U A;  1H6G A;  1YAU O;  5CI8 A;  3E70 C;  2HMZ A;  3QW0 A;  3PHF 2;  3GM2 A;  3EG9 A;  3I5P A;  1RKE B;  3JTL O;  5KYX A;  1NFO A;  2EPL X;  2XL4 A;  1QKR A;  2KC3 A;  3Q6M A;  4CS9 A;  2NUP B;  1OQC A;  1QLE C;  1ORS C;  3JSZ A;  1YYX A;  3K1I A;  4O6Y A;  5L3Q A;  2NG1 A;  3ASN C;  3CAX A;  2IXP A;  2J8W A;  4AK9 A;  1BZ4 A;  4C7O B;  5T3T A;  4XLN F;  2WVQ A;  2HV6 A;  2XLH A;  3C8Z A;  4P6I C;  1QQ3 A;  1YLM A;  3ZDL A;  1FTS A;  2OEX A;  1ZHY A;  4NTA A;  5B1A C;  2R7S A;  4NY3 A;  3W2V A;  3ZC4 A;  3LEO A;  4U5B E;  2J0X A;  4LER A;  2A6E F;  2RSE B;  3Q7G A;  4FES A;  4A2N B;  3IPM O; 
#chains in the Genus database with same CATH homology
 4D4N A;  4D4X A;  1LM3 B;  3U8P A;  1E85 A;  1QPU A;  4N6H A;  3M4C A;  2XLO A;  5JVE A;  3NMJ A;  4ULV A;  4WGZ A;  2QLA A;  3TOL A;  2XM0 A;  3NMI A;  1A7V A;  1CPQ A;  3QVY A;  5AGF A;  1RCP A;  5JS5 A;  3ZTM A;  4CIP A;  3HNL A;  4CJO A;  1MQV A;  4JEA A;  2YLG A;  5JP7 A;  4CDY A;  5JLI A;  256B A;  1JAF A;  4N4W A;  4IB4 A;  4CDV A;  5B3I A;  2YKZ A;  4CJG A;  1E83 A;  3IQ5 A;  2XLW A;  4JKV A;  1NBB A;  3DE8 A;  4U9E A;  2CCY A;  2YL7 A;  3M79 A;  1M6T A;  3C63 A;  3ZQY A;  3ZTZ A;  3HNK A;  3QVZ A;  2YLI A;  1E86 A;  2XLM A;  5JT4 A;  4IAR A;  2YL1 A;  1YZC A;  4CDA A;  4WGY A;  3HNJ A;  3C62 A;  2XLE A;  4ER9 A;  3VRC A;  4L6R A;  1CGN A;  1APC A;  2YLD A;  4NC3 A;  5JRA A;  1GQA A;  2YL0 A;  1BBH A;  3NMK A;  1E84 A;  1EKY A;  3TOM A;  1YZA A;  4EIY A;  3HNI A;  3ZQV A;  4IAQ A;  3FOO A;  5JUA A;  2YL3 A;  2XLV A;  3QW0 A;  3M4B A;  1CPR A;  2XM4 A;  3M15 A;  1CGO A;  4JE9 A;  3L1M A;  2XL6 A;  3QW1 A;  3IQ6 A;  3ZWI A;  1YYX A;  2BC5 A;  2XL8 A;  2J8W A;  4U9D A;  3FOP A;  2XLH A;  1QQ3 A;  1YYJ A;  5JSL A;  3DE9 A;  2J9B A;  4JEB A;  2XLD A;  4CX9 A;  1S05 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...