2XLWA

Cytochrome c prime from alcaligenes xylosoxidans: ferrous r124q variant with bound no
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
125
structure length
125
Chain Sequence
EFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C'
publication title Distal-to-Proximal No Conversion in Hemoproteins: The Role of the Proximal Pocket.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Electron transport
total genus 51
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2010-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 2xlwA00
2YL3A 1NBBA 4U9EA 3ZTMA 4JKVA 1MQVA 1EKYA 1CPQA 3HNIA 3M15A 1E83A 2CCYA 1YZCA 4CJGA 256BA 4N6HA 4N4WA 2YL1A 1S05A 3ZQYA 3C62A 3NMJA 3QVYA 3ZTZA 3C63A 1QPUA 5JSLA 5B3IA 5JP7A 2XLWA 4JEAA 2YKZA 4WGZA 3QW1A 4JEBA 2BC5A 4CX9A 3NMIA 3TOLA 1E84A 2XLVA 1CGOA 4D4XA 1YZAA 3QVZA 1A7VA 2XLEA 3FOOA 3U8PA 4ULVA 1CPRA 4CDVA 1JAFA 2XL8A 2YL0A 3ZWIA 4ER9A 3TOMA 3QW0A 1BBHA 1QQ3A 1GQAA 5JUAA 4NC3A 3HNLA 3HNKA 5JVEA 1RCPA 3VRCA 2XLDA 2YLIA 4CJOA 2XLOA 2J8WA 4EIYA 4L6RA 4D4NA 3ZQVA 1E85A 1LM3B 4IAQA 4JE9A 3M4BA 2XLMA 3NMKA 4IARA 3IQ5A 2XLHA 2J9BA 5JRAA 4CDYA 2YLGA 3DE9A 3IQ6A 4CDAA 2XM0A 2YL7A 4CIPA 3L1MA 4U9DA 5JLIA 1E86A 1YYJA 3M79A 2QLAA 3HNJA 1CGNA 1M6TA 4IB4A 2XM4A 5AGFA 2XL6A 4WGYA 1YYXA 2YLDA 5JT4A 5JS5A 1APCA 3FOPA 3M4CA 3DE8A
chains in the Genus database with same CATH superfamily
1NBBA 4IJJA 2J45A 1MQVA 1LVKA 1O5HA 2WZLA 3R7CA 3SXYA 3NYLA 4EHPA 5KYNA 4YL1A 5DS5A 2QY9A 1ORSC 1Q0MA 4HE8D 2OOCA 4PJJA 1LE2A 2GDCA 3CSKA 3HTKC 2WVQA 3C8GB 2L9JA 1ORJA 5A6AA 3UMIA 4E7SA 1OXKA 3SXKA 4CJGA 256BA 4N6HA 2YL1A 4XPYA 1S05A 3PMRA 2C04A 2MYSA 1H9TA 3IPMO 1D1BA 4I1OB 1GS9A 1OW8A 1LS4A 3B71A 5COMA 3ABKC 3RFYA 3OWTA 3V5ZA 2NG1A 5E2QA 3S29A 3ZTZA 1PD1A 3B9QA 2NUTB 4PR9A 5K0IA 2NSFA 3DKAA 1OW6A 1T6QA 1YARO 2P1AA 3GANA 4JJFA 2E87A 3US6A 4AE4A 4A4AA 4UDVA 2ZD9A 3U8VA 2P0NA 2WL8A 2XLWA 3U5SA 2ASRA 1EA8A 4RD9A 2YKZA 2HJ3A 1VMAA 4WGZA 2X0CA 4I3MA 3JCUQ 3ZG1A 4AL0A 2EPOA 2HZ8A 3L8IA 1BR1A 1QZXA 2LD6A 4C3DA 3EJNA 4FX5A 4RBNA 5AC4A 3K6BA 4D4XA 2QUPA 1FMWA 2KQ9A 3FOOA 5BUOA 4YL3A 3AGTA 4ULVA 1NU9C 3MLGA 4U5EE 4FESA 4CSAC 1T6IA 3ZIBA 4IAOA 4CSAA 1JAFA 4J7TA 2XXAA 4M63A 1HW1A 3AQCA 1HE1A 2LP4A 2M4EA 3GEHA 2CDQA 1HY5A 4PJNA 3UNGC 4YT5A 1RJ9A 4CS7A 3LNRA 4C3BA 3AGUA 2D5RB 4EKWA 5JUAA 3GM2A 3DD7A 3ECSA 3HNLA 2XSEA 4LDQA 5FCLA 3HNKA 3W2VA 3AG4C 4AX2A 1ZW2A 5EK0A 1D1AA 5E3CA 5GPGB 1MNEA 3VRCA 3U0CA 2A69F 1RKEB 1ZZPA 2ZXPA 2AP3A 4DVYP 1SF8A 4GEHA 1T01A 3I5PA 1YDIA 3KPHA 3RIPA 3VAYA 2V3CC 4XPWA 3AOUA 2EIJC 3JYHA 3U3FA 1IZMA 3DMDA 3ZWIA 4IAQA 4BJ5C 4LLEA 3B0UX 2R03A 4BJ5A 3N0TA 4IARA 3RH3A 1NFNA 3IQ5A 5D92A 1WATA 2EPKX 4KNVA 5T3TA 5L3VA 1RKCA 1YA7O 5JRAA 1HMDA 1T9KA 2W45A 3DE9A 4I44A 2NPUA 3W4YA 1OW7A 4G7ZF 1Q0FA 4CIPA 1BR2A 1Z5ZA 2YZSA 3L1MA 2VCBA 2R02A 3UGOA 3FHDA 5DVWA 4BJTA 1XWJA 2HUJA 5A69A 3SP1A 1YYJA 1SMYF 2CNWD 2WVNA 1GM5A 2W9YA 1QLEC 4Z9HA 1FTSA 5CI8A 3HNJA 2PF4E 4DBQA 3F47A 2R25A 3GORA 2OU6A 2KK1A 1MNDA 4QI0A 5AGFA 1B68A 2Q4FA 2FFHA 3TQOA 3ASOC 1C02A 2MHRA 2ICWG 3Q6NA 1OKKD 2WB7A 2YVKA 5JT4A 4YT2A 1ZU4A 3CZ6A 4B6IA 4U5DE 3FOPA 1BDJB 4AK9A 1ZYRF 3FDQA 4XEKA 2L6GA 1J8MF 2YL3A 5KYUA 2HV6A 4HFFB 4NCQA 4JVSA 1K05A 2HMQA 4U5BE 3HNIA 2XS1A 4BJ6A 2AWYA 1E83A 2Q9BA 3NYJA 4ONSA 3E9VA 3C18A 4XPXA 1NFOA 4F4BA 3MBGA 1TWHA 2XRHA 2C03A 3DZAA 3S28A 4E0IA 1C03A 3GODA 4LLCA 4MW3A 2FGYA 4IRUA 3RF3A 5A6KA 2GA0A 3SYNA 3ASNC 1L7CA 2CYDA 3QVYA 5AC5A 1SYQA 2PNOA 5KYYB 3PHF2 2LIGA 3B0PA 5A6JA 4LDRA 1OXBA 2OG2A 3C7JA 2I15A 1G5ZA 3C63A 1QPUA 3ATPA 2A6EF 4O7GA 1FR0A 2EINC 3FXHA 5L3QA 2OEVA 1NU7D 2LSEA 5L0GA 2XXAB 5B3IA 1V4AA 4Q5SF 4DJ9A 4JEAA 1EQ1A 3EZHA 2HMZA 3C8GD 3RYLA 1RJ9B 4JEBA 2WZGA 3U9JA 4PJMA 4A2NB 2EPNA 4KI2A 3L34A 2H7OA 3ABLC 2L6HA 3MX3A 2IYLD 2KW3C 3VM6A 4N6CA 1BZ4A 2DYSC 3V5XA 4JW1A 4MNDA 1A7VA 3U2LA 2MWQA 1OQCA 3SXZA 3W2WA 2TMVP 5FZTA 3AG2C 2XLEA 2A0UA 3U8PA 3B29A 1K40A 1R4TA 1FMVA 1MMDA 3SZRA 3HJCA 1DOVA 2AU5A 2UUHA 3U2MA 4JC7A 1VK5A 3LUTB 5KYWA 1VYKA 3HKKA 3T9OA 2J46A 2JPUA 2VCCA 3MFNA 2B0HA 3TOMA 2YQYA 4YK5A 1N1CA 3QMKA 1Y4CA 1O87A 3QW0A 1GQAA 1H9GA 1K04A 2AVKA 1JR8A 1I4YA 2HKVA 2Y3DA 4NC3A 1ORYA 3JT1A 1JMWA 3TJ6A 5L0DA 4C7OA 2OKUA 3NG1A 3NKEA 3H2VA 2R7OA 3O55A 4BPMA 2DGJA 2DYRC 1Y6DA 4JCZA 2J9WA 1RMVA 2F22A 1BR4A 2I8BA 3PCVA 2IXPA 3EGDA 2OJED 2KSFA 3IQCA 3DWWA 4EIYA 4L6RA 4O6NA 4G7OF 2JD3A 3LEVA 2L6FA 3EGXA 1M2OA 1VYIA 1MMGA 1YJGA 1ZW3A 3EFOA 3JTLO 1LM3B 1Z3IX 2GWWA 3Q6MA 4JCHA 3WG7C 1TWCA 4JE9A 3TULA 5E3AA 1A7EA 4G0HA 1VTMP 1PD0A 4PFOA 4E7ZA 2XLHA 3S90A 4YJWA 1SZIA 3HLZA 3UGPA 2LFFA 4CDYA 2YLGA 3DXJF 3S27A 4LERA 2LK4A 3V5YA 2VB6A 1G4WR 2J7PD 3ZC4A 4ULWA 4XEVA 4CS9C 4CS9A 4N06A 2YL7A 3A9CA 3RQGA 2A6HF 3GM1A 4JTAB 2WVOA 4OIOF 1J8YF 2PX3A 4U9DA 4Z9JA 3RVYA 1E86A 2B0JA 5F5FA 3EHNA 2ZXRA 2OQMA 3JRMO 1ZVZA 1GGQA 1FFHA 1YAUO 4LACB 3IQTA 4MVZA 4O6YA 4U5CE 2CGEA 1LE4A 2PBEA 2QLAA 3PDMP 2J0XA 5L0IA 3BEHA 4XWJA 4EWCA 5KYUB 4K1OA 3LLKA 2DB4A 1ZHYA 2JX0A 2Q00A 2XL4A 1T6UA 2XM4A 1G8XA 4JURI 4OIRF 2A68F 3M1CB 3RQFA 4FWVA 2P61A 3LS0A 4WGYA 4H4KC 1YYXA 4JZAA 4PK4A 2H7VC 2WZFA 2CW0F 1R5ID 3IEEA 3TK0A 4MVSA 4YN0B 3WHNA 5JS5A 2QTVA 1TKNA 3K7DA 2Q3TA 4XEFA 3DJUB 3NYMA 4P9FA 1IW7F 1EI7A 1D1CA 1HE9A 1I4ZA 2ZXWC 3EQLF 3JYYA 2DI3A 4JKVA 1OR2A 4CS8A 2Y3HA 3QZCA 4C3EA 3H2UA 3KL4A 1EKYA 1LI7A 1Q0KA 3EPVA 2HJMA 3CAXA 1XZQA 2AWCA 3N24A 3UMKA 1YZCA 4DRIB 2IM8A 4O79A 1FFTC 4N4WA 5EGYA 3UR3C 2LCHA 3ZQYA 3LEOA 2L7AA 3NMJA 2R7QA 3IHUA 2RD9A 4J32B 2VH3A 2EIMC 2R7RA 3EH2A 3K33A 1ZHWA 3TD7A 5T1DB 3CEXA 1NSGB 3G50A 1H7IA 4MTFA 1ZHZA 3SEOA 4K7BA 1QVXA 2OJQA 1Z63A 2R7UA 2G3KA 1F1MA 4K0DA 3S9OA 1VB5A 4E17A 3LAYA 4KC9A 3E70C 2YEVA 3QTHA 1MMNA 2D4UA 5EHHA 3NMIA 3TOLA 1E84A 4BJ6C 3L8JA 5KYWB 4IWBA 4AE4B 3ZSUA 4QDLA 1ZHTA 1G4US 3KH2A 2HSQA 4OD5A 4XTKA 4C7OB 4X0RA 3QVZA 1VLTA 2Z15A 5BQHA 4PJLA 1V54C 4BEJA 4YT4A 1FNTc 2V26A 3S0XA 2XL8A 3LJBA 1TWAA 2W4BA 3EGDB 2GAQA 1NLXA 1JOGA 1ST6A 4E0HA 4EBKA 4ANJA 4FAPB 4YT8A 4YL0A 3EGXB 1D0YA 5BQIA 1RKEA 3MYFA 4JIOA 4WJ0A 2A0BA 1QQ3A 1WWPA 2A1DD 3K1IC 3J06A 3K1IA 3OA1A 1W2WA 1UG7A 3ITFA 5JVEA 1A7DA 1RCPA 1TFOB 3U9MA 4G7HF 2IBFA 3K1HA 1LIHA 4MQ9F 3RKOF 1PCXA 4OIQF 4JRZA 2Q7RA 4CJOA 3O6XA 5D91A 2XLOA 2UUIA 5F5HA 2PP4A 2BL2A 4Q4ZF 4NTBA 3ZQVA 1E85A 1M2VA 1XZPA 3AG1C 1H6GA 2XLMA 1NG1A 3AG3C 4RDAA 3N2ZB 2R9RB 4XLPF 1NZEA 2PX0A 3F46A 2J9BA 5A6BD 3JSZA 1VOMA 5KYXA 1DOWA 3SNHA 3DM5A 1TWGA 4IGGA 2NUPA 1E2XA 1RXQA 3W8IA 1WOLA 2J9VA 3GEEA 3GWNA 3K66A 4U5FE 3A11A 5B3SC 1QSPA 3O39A 1C17M 2CNWA 4E18A 3ZVRA 2Q9CA 3M79A 5CI9A 2GFHA 4NTFA 2EPLX 1CGNA 3T6GB 2LFDA 3GEIA 3JRTA 3FMSA 4PFPA 1TQGA 5DQZA 1M6TA 4MS2A 1YVIA 1Z23A 5F28E 2XL6A 4U5HA 1OCCC 1SR2A 3OEOA 2HFIA 1KNYA 4EBBA 3EH1A 1OKKA 3DAFA 1QKRA 3RQEA 2O9XA 2OCCC 3KYIA 5DS4A 1T5OA 2YLDA 2EPMX 4JTDB 2R05A 4BG0A 1LPEA 3M4CA 4PACA 3DE8A 1M57C 1AVOB 2KGOA 2KYHA 2G62A 3ZTMA 4U9EA 4DRHB 4DXWA 1CPQA 1Q0GA 3M15A 4DVZA 3UMHA 4MVOA 2M64A 3CQZA 2X51A 1VLSA 2Y69C 5KYYA 1LS1A 2CCYA 4G78A 3T6JA 2IOQA 3ZDLA 4P6IC 2NSGA 5BQGA 2HSBA 1I5NA 5DS6A 1OCOC 1OCRC 2KNHA 2RSEB 4HEAJ 3S84A 1Z6AA 2Y3GA 3C62A 3EG9A 4HFKB 4KBLA 3X1OA 3B0VC 2VC9A 4OIPF 1LKXA 2EILC 3POVA 4GQHA 1D0ZA 2IXOA 2XS8A 4BJ1A 4O6MA 5COGA 5JSLA 4R32A 1PV3A 1TR2A 3JSEO 4WABA 4GYTA 4YWQA 4Q7CA 1OCZC 3C8GA 5JP7A 3W8HA 2KC3A 4EBJA 1L3PA 2Q9AA 5IY5C 4CS8C 1YLMA 2LQGA 5L0FA 3QW1A 1TFKB 2BC5A 3RVZA 3ABMC 4CX9A 1A41A 4MVMA 1HW2A 2XLVA 4J30B 1WN0A 2KJGA 3I4UA 1CGOA 2IXMA 1YZAA 1UFBA 2G3VA 3FAPB 4XQ1A 2H8AA 2NUTA 5HSWA 2R7SA 1JRAA 4XLNF 1Z7Qc 5A6BA 3SXMA 2HS5A 1CPRA 1U89A 4CDVA 1WGWA 4MW8A 4OD4A 4DRJB 2PFDA 2YL0A 4NQFA 3TJ5A 1M56C 5COFA 3T6BA 4ER9A 3GM3A 1M2VB 3WODF 1BBHA 3Q7LA 5CIVA 3BRJA 1U0BB 3DM9B 4W8KA 4MVRA 3KKBA 1WTYA 3V7OA 2R7WA 5KYXB 4U5GA 5DLJA 3L0IA 3FVYA 3EZIA 1HMOA 1ZU5A 3Q7GA 5B1BC 1V55C 3C8ZA 2XLDA 3O10A 2R7TA 1FAPB 1Q0DA 1U6HA 1V74B 2NUPB 2YLIA 2ZXOA 2HV7A 4MVQA 3X2QC 2YRFA 2J8WA 4AL1A 3G4XA 3KYJA 3DI5A 3DJNB 3H65A 5T3WA 4H54A 3WAQA 5DQTA 1ZHXA 3LNMB 2J0WA 3LS1A 5TJ5E 3M4BA 4OINF 4DBRA 4QI2A 3NMKA 1MMAA 4NTAA 3U3BA 1OR3A 4I1MA 2R7XA 2Y3BA 3R2PA 4KNWA 3I5QA 2VCAA 3GWLA 2QE9A 1O3UA 3MYIA 4MTOA 2P7VA 3G4ZA 2J7PA 4EUKB 2VASA 4NY3A 4LDKA 1JPNA 2OEXA 3EFOB 2L81A 2W4MA 2YHSA 3IQ6A 2XM0A 4CDAA 2R7VA 3RW0A 1YA9A 3FAJA 5JLIA 1LI5A 4CBEA 3NDBB 2FAPB 2ETSA 2IXNA 1WASA 2ZPAA 4W8PA 4JJGA 3KMIA 3AJMA 4MTGA 4JTCB 4DOZA 3VF0A 5E33A 3DAGA 1AEPA 1JPJA 2EIKC 1D0XA 1KTMA 4IB4A 4P9TA 5HV9A 5L0JA 4J7YA 3LLIA 3JZ0A 5L0HA 5B1AC 2J9UA 4BEMJ 1CGME 4MVUA 2P6VA 4ZLDA 4Z9IA 4CIHA 3T4RA 1A0BA 2YWAA 1S7ZA 1AUEA 2BE5F 3LESA 3VYWA 4D4NA 5L0CA 1APCA 2QNLA 3EG9B 3NRHA 3NKDA 2H7BA 3AQBA 1KU2A 4ZLCA 3EHMA 2Y39A
chains in the Genus database with same CATH topology
2YL3A 1NBBA 4U9EA 3ZTMA 4JKVA 1MQVA 1EKYA 1CPQA 3HNIA 3M15A 1E83A 2CCYA 1YZCA 4CJGA 256BA 4N6HA 4N4WA 2YL1A 1S05A 3ZQYA 3C62A 3NMJA 3QVYA 3ZTZA 3C63A 1QPUA 5JSLA 5B3IA 5JP7A 2XLWA 4JEAA 2YKZA 4WGZA 3QW1A 4JEBA 2BC5A 4CX9A 3NMIA 3TOLA 1E84A 2XLVA 1CGOA 4D4XA 1YZAA 3QVZA 1A7VA 2XLEA 3FOOA 3U8PA 4ULVA 1CPRA 4CDVA 1JAFA 2XL8A 2YL0A 3ZWIA 4ER9A 3TOMA 3QW0A 1BBHA 1QQ3A 1GQAA 5JUAA 4NC3A 3HNLA 3HNKA 5JVEA 1RCPA 3VRCA 2XLDA 2YLIA 4CJOA 2XLOA 2J8WA 4EIYA 4L6RA 4D4NA 3ZQVA 1E85A 1LM3B 4IAQA 4JE9A 3M4BA 2XLMA 3NMKA 4IARA 3IQ5A 2XLHA 2J9BA 5JRAA 4CDYA 2YLGA 3DE9A 3IQ6A 4CDAA 2XM0A 2YL7A 4CIPA 3L1MA 4U9DA 5JLIA 1E86A 1YYJA 3M79A 2QLAA 3HNJA 1CGNA 1M6TA 4IB4A 2XM4A 5AGFA 2XL6A 4WGYA 1YYXA 2YLDA 5JT4A 5JS5A 1APCA 3FOPA 3M4CA 3DE8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YL3 A;  1NBB A;  4U9E A;  3ZTM A;  4JKV A;  1MQV A;  1EKY A;  1CPQ A;  3HNI A;  3M15 A;  1E83 A;  2CCY A;  1YZC A;  4CJG A;  256B A;  4N6H A;  4N4W A;  2YL1 A;  1S05 A;  3ZQY A;  3C62 A;  3NMJ A;  3QVY A;  3ZTZ A;  3C63 A;  1QPU A;  5JSL A;  5B3I A;  5JP7 A;  2XLW A;  4JEA A;  2YKZ A;  4WGZ A;  3QW1 A;  4JEB A;  2BC5 A;  4CX9 A;  3NMI A;  3TOL A;  1E84 A;  2XLV A;  1CGO A;  4D4X A;  1YZA A;  3QVZ A;  1A7V A;  2XLE A;  3FOO A;  3U8P A;  4ULV A;  1CPR A;  4CDV A;  1JAF A;  2XL8 A;  2YL0 A;  3ZWI A;  4ER9 A;  3TOM A;  3QW0 A;  1BBH A;  1QQ3 A;  1GQA A;  5JUA A;  4NC3 A;  3HNL A;  3HNK A;  5JVE A;  1RCP A;  3VRC A;  2XLD A;  2YLI A;  4CJO A;  2XLO A;  2J8W A;  4EIY A;  4L6R A;  4D4N A;  3ZQV A;  1E85 A;  1LM3 B;  4IAQ A;  4JE9 A;  3M4B A;  2XLM A;  3NMK A;  4IAR A;  3IQ5 A;  2XLH A;  2J9B A;  5JRA A;  4CDY A;  2YLG A;  3DE9 A;  3IQ6 A;  4CDA A;  2XM0 A;  2YL7 A;  4CIP A;  3L1M A;  4U9D A;  5JLI A;  1E86 A;  1YYJ A;  3M79 A;  2QLA A;  3HNJ A;  1CGN A;  1M6T A;  4IB4 A;  2XM4 A;  5AGF A;  2XL6 A;  4WGY A;  1YYX A;  2YLD A;  5JT4 A;  5JS5 A;  1APC A;  3FOP A;  3M4C A;  3DE8 A; 
#chains in the Genus database with same CATH topology
 1NBB A;  4IJJ A;  2J45 A;  1MQV A;  1LVK A;  1O5H A;  2WZL A;  3R7C A;  3SXY A;  3NYL A;  4EHP A;  5KYN A;  4YL1 A;  5DS5 A;  2QY9 A;  1ORS C;  1Q0M A;  4HE8 D;  2OOC A;  4PJJ A;  1LE2 A;  2GDC A;  3CSK A;  3HTK C;  2WVQ A;  3C8G B;  2L9J A;  1ORJ A;  5A6A A;  3UMI A;  4E7S A;  1OXK A;  3SXK A;  4CJG A;  256B A;  4N6H A;  2YL1 A;  4XPY A;  1S05 A;  3PMR A;  2C04 A;  2MYS A;  1H9T A;  3IPM O;  1D1B A;  4I1O B;  1GS9 A;  1OW8 A;  1LS4 A;  3B71 A;  5COM A;  3ABK C;  3RFY A;  3OWT A;  3V5Z A;  2NG1 A;  5E2Q A;  3S29 A;  3ZTZ A;  1PD1 A;  3B9Q A;  2NUT B;  4PR9 A;  5K0I A;  2NSF A;  3DKA A;  1OW6 A;  1T6Q A;  1YAR O;  2P1A A;  3GAN A;  4JJF A;  2E87 A;  3US6 A;  4AE4 A;  4A4A A;  4UDV A;  2ZD9 A;  3U8V A;  2P0N A;  2WL8 A;  2XLW A;  3U5S A;  2ASR A;  1EA8 A;  4RD9 A;  2YKZ A;  2HJ3 A;  1VMA A;  4WGZ A;  2X0C A;  4I3M A;  3JCU Q;  3ZG1 A;  4AL0 A;  2EPO A;  2HZ8 A;  3L8I A;  1BR1 A;  1QZX A;  2LD6 A;  4C3D A;  3EJN A;  4FX5 A;  4RBN A;  5AC4 A;  3K6B A;  4D4X A;  2QUP A;  1FMW A;  2KQ9 A;  3FOO A;  5BUO A;  4YL3 A;  3AGT A;  4ULV A;  1NU9 C;  3MLG A;  4U5E E;  4FES A;  4CSA C;  1T6I A;  3ZIB A;  4IAO A;  4CSA A;  1JAF A;  4J7T A;  2XXA A;  4M63 A;  1HW1 A;  3AQC A;  1HE1 A;  2LP4 A;  2M4E A;  3GEH A;  2CDQ A;  1HY5 A;  4PJN A;  3UNG C;  4YT5 A;  1RJ9 A;  4CS7 A;  3LNR A;  4C3B A;  3AGU A;  2D5R B;  4EKW A;  5JUA A;  3GM2 A;  3DD7 A;  3ECS A;  3HNL A;  2XSE A;  4LDQ A;  5FCL A;  3HNK A;  3W2V A;  3AG4 C;  4AX2 A;  1ZW2 A;  5EK0 A;  1D1A A;  5E3C A;  5GPG B;  1MNE A;  3VRC A;  3U0C A;  2A69 F;  1RKE B;  1ZZP A;  2ZXP A;  2AP3 A;  4DVY P;  1SF8 A;  4GEH A;  1T01 A;  3I5P A;  1YDI A;  3KPH A;  3RIP A;  3VAY A;  2V3C C;  4XPW A;  3AOU A;  2EIJ C;  3JYH A;  3U3F A;  1IZM A;  3DMD A;  3ZWI A;  4IAQ A;  4BJ5 C;  4LLE A;  3B0U X;  2R03 A;  4BJ5 A;  3N0T A;  4IAR A;  3RH3 A;  1NFN A;  3IQ5 A;  5D92 A;  1WAT A;  2EPK X;  4KNV A;  5T3T A;  5L3V A;  1RKC A;  1YA7 O;  5JRA A;  1HMD A;  1T9K A;  2W45 A;  3DE9 A;  4I44 A;  2NPU A;  3W4Y A;  1OW7 A;  4G7Z F;  1Q0F A;  4CIP A;  1BR2 A;  1Z5Z A;  2YZS A;  3L1M A;  2VCB A;  2R02 A;  3UGO A;  3FHD A;  5DVW A;  4BJT A;  1XWJ A;  2HUJ A;  5A69 A;  3SP1 A;  1YYJ A;  1SMY F;  2CNW D;  2WVN A;  1GM5 A;  2W9Y A;  1QLE C;  4Z9H A;  1FTS A;  5CI8 A;  3HNJ A;  2PF4 E;  4DBQ A;  3F47 A;  2R25 A;  3GOR A;  2OU6 A;  2KK1 A;  1MND A;  4QI0 A;  5AGF A;  1B68 A;  2Q4F A;  2FFH A;  3TQO A;  3ASO C;  1C02 A;  2MHR A;  2ICW G;  3Q6N A;  1OKK D;  2WB7 A;  2YVK A;  5JT4 A;  4YT2 A;  1ZU4 A;  3CZ6 A;  4B6I A;  4U5D E;  3FOP A;  1BDJ B;  4AK9 A;  1ZYR F;  3FDQ A;  4XEK A;  2L6G A;  1J8M F;  2YL3 A;  5KYU A;  2HV6 A;  4HFF B;  4NCQ A;  4JVS A;  1K05 A;  2HMQ A;  4U5B E;  3HNI A;  2XS1 A;  4BJ6 A;  2AWY A;  1E83 A;  2Q9B A;  3NYJ A;  4ONS A;  3E9V A;  3C18 A;  4XPX A;  1NFO A;  4F4B A;  3MBG A;  1TWH A;  2XRH A;  2C03 A;  3DZA A;  3S28 A;  4E0I A;  1C03 A;  3GOD A;  4LLC A;  4MW3 A;  2FGY A;  4IRU A;  3RF3 A;  5A6K A;  2GA0 A;  3SYN A;  3ASN C;  1L7C A;  2CYD A;  3QVY A;  5AC5 A;  1SYQ A;  2PNO A;  5KYY B;  3PHF 2;  2LIG A;  3B0P A;  5A6J A;  4LDR A;  1OXB A;  2OG2 A;  3C7J A;  2I15 A;  1G5Z A;  3C63 A;  1QPU A;  3ATP A;  2A6E F;  4O7G A;  1FR0 A;  2EIN C;  3FXH A;  5L3Q A;  2OEV A;  1NU7 D;  2LSE A;  5L0G A;  2XXA B;  5B3I A;  1V4A A;  4Q5S F;  4DJ9 A;  4JEA A;  1EQ1 A;  3EZH A;  2HMZ A;  3C8G D;  3RYL A;  1RJ9 B;  4JEB A;  2WZG A;  3U9J A;  4PJM A;  4A2N B;  2EPN A;  4KI2 A;  3L34 A;  2H7O A;  3ABL C;  2L6H A;  3MX3 A;  2IYL D;  2KW3 C;  3VM6 A;  4N6C A;  1BZ4 A;  2DYS C;  3V5X A;  4JW1 A;  4MND A;  1A7V A;  3U2L A;  2MWQ A;  1OQC A;  3SXZ A;  3W2W A;  2TMV P;  5FZT A;  3AG2 C;  2XLE A;  2A0U A;  3U8P A;  3B29 A;  1K40 A;  1R4T A;  1FMV A;  1MMD A;  3SZR A;  3HJC A;  1DOV A;  2AU5 A;  2UUH A;  3U2M A;  4JC7 A;  1VK5 A;  3LUT B;  5KYW A;  1VYK A;  3HKK A;  3T9O A;  2J46 A;  2JPU A;  2VCC A;  3MFN A;  2B0H A;  3TOM A;  2YQY A;  4YK5 A;  1N1C A;  3QMK A;  1Y4C A;  1O87 A;  3QW0 A;  1GQA A;  1H9G A;  1K04 A;  2AVK A;  1JR8 A;  1I4Y A;  2HKV A;  2Y3D A;  4NC3 A;  1ORY A;  3JT1 A;  1JMW A;  3TJ6 A;  5L0D A;  4C7O A;  2OKU A;  3NG1 A;  3NKE A;  3H2V A;  2R7O A;  3O55 A;  4BPM A;  2DGJ A;  2DYR C;  1Y6D A;  4JCZ A;  2J9W A;  1RMV A;  2F22 A;  1BR4 A;  2I8B A;  3PCV A;  2IXP A;  3EGD A;  2OJE D;  2KSF A;  3IQC A;  3DWW A;  4EIY A;  4L6R A;  4O6N A;  4G7O F;  2JD3 A;  3LEV A;  2L6F A;  3EGX A;  1M2O A;  1VYI A;  1MMG A;  1YJG A;  1ZW3 A;  3EFO A;  3JTL O;  1LM3 B;  1Z3I X;  2GWW A;  3Q6M A;  4JCH A;  3WG7 C;  1TWC A;  4JE9 A;  3TUL A;  5E3A A;  1A7E A;  4G0H A;  1VTM P;  1PD0 A;  4PFO A;  4E7Z A;  2XLH A;  3S90 A;  4YJW A;  1SZI A;  3HLZ A;  3UGP A;  2LFF A;  4CDY A;  2YLG A;  3DXJ F;  3S27 A;  4LER A;  2LK4 A;  3V5Y A;  2VB6 A;  1G4W R;  2J7P D;  3ZC4 A;  4ULW A;  4XEV A;  4CS9 C;  4CS9 A;  4N06 A;  2YL7 A;  3A9C A;  3RQG A;  2A6H F;  3GM1 A;  4JTA B;  2WVO A;  4OIO F;  1J8Y F;  2PX3 A;  4U9D A;  4Z9J A;  3RVY A;  1E86 A;  2B0J A;  5F5F A;  3EHN A;  2ZXR A;  2OQM A;  3JRM O;  1ZVZ A;  1GGQ A;  1FFH A;  1YAU O;  4LAC B;  3IQT A;  4MVZ A;  4O6Y A;  4U5C E;  2CGE A;  1LE4 A;  2PBE A;  2QLA A;  3PDM P;  2J0X A;  5L0I A;  3BEH A;  4XWJ A;  4EWC A;  5KYU B;  4K1O A;  3LLK A;  2DB4 A;  1ZHY A;  2JX0 A;  2Q00 A;  2XL4 A;  1T6U A;  2XM4 A;  1G8X A;  4JUR I;  4OIR F;  2A68 F;  3M1C B;  3RQF A;  4FWV A;  2P61 A;  3LS0 A;  4WGY A;  4H4K C;  1YYX A;  4JZA A;  4PK4 A;  2H7V C;  2WZF A;  2CW0 F;  1R5I D;  3IEE A;  3TK0 A;  4MVS A;  4YN0 B;  3WHN A;  5JS5 A;  2QTV A;  1TKN A;  3K7D A;  2Q3T A;  4XEF A;  3DJU B;  3NYM A;  4P9F A;  1IW7 F;  1EI7 A;  1D1C A;  1HE9 A;  1I4Z A;  2ZXW C;  3EQL F;  3JYY A;  2DI3 A;  4JKV A;  1OR2 A;  4CS8 A;  2Y3H A;  3QZC A;  4C3E A;  3H2U A;  3KL4 A;  1EKY A;  1LI7 A;  1Q0K A;  3EPV A;  2HJM A;  3CAX A;  1XZQ A;  2AWC A;  3N24 A;  3UMK A;  1YZC A;  4DRI B;  2IM8 A;  4O79 A;  1FFT C;  4N4W A;  5EGY A;  3UR3 C;  2LCH A;  3ZQY A;  3LEO A;  2L7A A;  3NMJ A;  2R7Q A;  3IHU A;  2RD9 A;  4J32 B;  2VH3 A;  2EIM C;  2R7R A;  3EH2 A;  3K33 A;  1ZHW A;  3TD7 A;  5T1D B;  3CEX A;  1NSG B;  3G50 A;  1H7I A;  4MTF A;  1ZHZ A;  3SEO A;  4K7B A;  1QVX A;  2OJQ A;  1Z63 A;  2R7U A;  2G3K A;  1F1M A;  4K0D A;  3S9O A;  1VB5 A;  4E17 A;  3LAY A;  4KC9 A;  3E70 C;  2YEV A;  3QTH A;  1MMN A;  2D4U A;  5EHH A;  3NMI A;  3TOL A;  1E84 A;  4BJ6 C;  3L8J A;  5KYW B;  4IWB A;  4AE4 B;  3ZSU A;  4QDL A;  1ZHT A;  1G4U S;  3KH2 A;  2HSQ A;  4OD5 A;  4XTK A;  4C7O B;  4X0R A;  3QVZ A;  1VLT A;  2Z15 A;  5BQH A;  4PJL A;  1V54 C;  4BEJ A;  4YT4 A;  1FNT c;  2V26 A;  3S0X A;  2XL8 A;  3LJB A;  1TWA A;  2W4B A;  3EGD B;  2GAQ A;  1NLX A;  1JOG A;  1ST6 A;  4E0H A;  4EBK A;  4ANJ A;  4FAP B;  4YT8 A;  4YL0 A;  3EGX B;  1D0Y A;  5BQI A;  1RKE A;  3MYF A;  4JIO A;  4WJ0 A;  2A0B A;  1QQ3 A;  1WWP A;  2A1D D;  3K1I C;  3J06 A;  3K1I A;  3OA1 A;  1W2W A;  1UG7 A;  3ITF A;  5JVE A;  1A7D A;  1RCP A;  1TFO B;  3U9M A;  4G7H F;  2IBF A;  3K1H A;  1LIH A;  4MQ9 F;  3RKO F;  1PCX A;  4OIQ F;  4JRZ A;  2Q7R A;  4CJO A;  3O6X A;  5D91 A;  2XLO A;  2UUI A;  5F5H A;  2PP4 A;  2BL2 A;  4Q4Z F;  4NTB A;  3ZQV A;  1E85 A;  1M2V A;  1XZP A;  3AG1 C;  1H6G A;  2XLM A;  1NG1 A;  3AG3 C;  4RDA A;  3N2Z B;  2R9R B;  4XLP F;  1NZE A;  2PX0 A;  3F46 A;  2J9B A;  5A6B D;  3JSZ A;  1VOM A;  5KYX A;  1DOW A;  3SNH A;  3DM5 A;  1TWG A;  4IGG A;  2NUP A;  1E2X A;  1RXQ A;  3W8I A;  1WOL A;  2J9V A;  3GEE A;  3GWN A;  3K66 A;  4U5F E;  3A11 A;  5B3S C;  1QSP A;  3O39 A;  1C17 M;  2CNW A;  4E18 A;  3ZVR A;  2Q9C A;  3M79 A;  5CI9 A;  2GFH A;  4NTF A;  2EPL X;  1CGN A;  3T6G B;  2LFD A;  3GEI A;  3JRT A;  3FMS A;  4PFP A;  1TQG A;  5DQZ A;  1M6T A;  4MS2 A;  1YVI A;  1Z23 A;  5F28 E;  2XL6 A;  4U5H A;  1OCC C;  1SR2 A;  3OEO A;  2HFI A;  1KNY A;  4EBB A;  3EH1 A;  1OKK A;  3DAF A;  1QKR A;  3RQE A;  2O9X A;  2OCC C;  3KYI A;  5DS4 A;  1T5O A;  2YLD A;  2EPM X;  4JTD B;  2R05 A;  4BG0 A;  1LPE A;  3M4C A;  4PAC A;  3DE8 A;  1M57 C;  1AVO B;  2KGO A;  2KYH A;  2G62 A;  3ZTM A;  4U9E A;  4DRH B;  4DXW A;  1CPQ A;  1Q0G A;  3M15 A;  4DVZ A;  3UMH A;  4MVO A;  2M64 A;  3CQZ A;  2X51 A;  1VLS A;  2Y69 C;  5KYY A;  1LS1 A;  2CCY A;  4G78 A;  3T6J A;  2IOQ A;  3ZDL A;  4P6I C;  2NSG A;  5BQG A;  2HSB A;  1I5N A;  5DS6 A;  1OCO C;  1OCR C;  2KNH A;  2RSE B;  4HEA J;  3S84 A;  1Z6A A;  2Y3G A;  3C62 A;  3EG9 A;  4HFK B;  4KBL A;  3X1O A;  3B0V C;  2VC9 A;  4OIP F;  1LKX A;  2EIL C;  3POV A;  4GQH A;  1D0Z A;  2IXO A;  2XS8 A;  4BJ1 A;  4O6M A;  5COG A;  5JSL A;  4R32 A;  1PV3 A;  1TR2 A;  3JSE O;  4WAB A;  4GYT A;  4YWQ A;  4Q7C A;  1OCZ C;  3C8G A;  5JP7 A;  3W8H A;  2KC3 A;  4EBJ A;  1L3P A;  2Q9A A;  5IY5 C;  4CS8 C;  1YLM A;  2LQG A;  5L0F A;  3QW1 A;  1TFK B;  2BC5 A;  3RVZ A;  3ABM C;  4CX9 A;  1A41 A;  4MVM A;  1HW2 A;  2XLV A;  4J30 B;  1WN0 A;  2KJG A;  3I4U A;  1CGO A;  2IXM A;  1YZA A;  1UFB A;  2G3V A;  3FAP B;  4XQ1 A;  2H8A A;  2NUT A;  5HSW A;  2R7S A;  1JRA A;  4XLN F;  1Z7Q c;  5A6B A;  3SXM A;  2HS5 A;  1CPR A;  1U89 A;  4CDV A;  1WGW A;  4MW8 A;  4OD4 A;  4DRJ B;  2PFD A;  2YL0 A;  4NQF A;  3TJ5 A;  1M56 C;  5COF A;  3T6B A;  4ER9 A;  3GM3 A;  1M2V B;  3WOD F;  1BBH A;  3Q7L A;  5CIV A;  3BRJ A;  1U0B B;  3DM9 B;  4W8K A;  4MVR A;  3KKB A;  1WTY A;  3V7O A;  2R7W A;  5KYX B;  4U5G A;  5DLJ A;  3L0I A;  3FVY A;  3EZI A;  1HMO A;  1ZU5 A;  3Q7G A;  5B1B C;  1V55 C;  3C8Z A;  2XLD A;  3O10 A;  2R7T A;  1FAP B;  1Q0D A;  1U6H A;  1V74 B;  2NUP B;  2YLI A;  2ZXO A;  2HV7 A;  4MVQ A;  3X2Q C;  2YRF A;  2J8W A;  4AL1 A;  3G4X A;  3KYJ A;  3DI5 A;  3DJN B;  3H65 A;  5T3W A;  4H54 A;  3WAQ A;  5DQT A;  1ZHX A;  3LNM B;  2J0W A;  3LS1 A;  5TJ5 E;  3M4B A;  4OIN F;  4DBR A;  4QI2 A;  3NMK A;  1MMA A;  4NTA A;  3U3B A;  1OR3 A;  4I1M A;  2R7X A;  2Y3B A;  3R2P A;  4KNW A;  3I5Q A;  2VCA A;  3GWL A;  2QE9 A;  1O3U A;  3MYI A;  4MTO A;  2P7V A;  3G4Z A;  2J7P A;  4EUK B;  2VAS A;  4NY3 A;  4LDK A;  1JPN A;  2OEX A;  3EFO B;  2L81 A;  2W4M A;  2YHS A;  3IQ6 A;  2XM0 A;  4CDA A;  2R7V A;  3RW0 A;  1YA9 A;  3FAJ A;  5JLI A;  1LI5 A;  4CBE A;  3NDB B;  2FAP B;  2ETS A;  2IXN A;  1WAS A;  2ZPA A;  4W8P A;  4JJG A;  3KMI A;  3AJM A;  4MTG A;  4JTC B;  4DOZ A;  3VF0 A;  5E33 A;  3DAG A;  1AEP A;  1JPJ A;  2EIK C;  1D0X A;  1KTM A;  4IB4 A;  4P9T A;  5HV9 A;  5L0J A;  4J7Y A;  3LLI A;  3JZ0 A;  5L0H A;  5B1A C;  2J9U A;  4BEM J;  1CGM E;  4MVU A;  2P6V A;  4ZLD A;  4Z9I A;  4CIH A;  3T4R A;  1A0B A;  2YWA A;  1S7Z A;  1AUE A;  2BE5 F;  3LES A;  3VYW A;  4D4N A;  5L0C A;  1APC A;  2QNL A;  3EG9 B;  3NRH A;  3NKD A;  2H7B A;  3AQB A;  1KU2 A;  4ZLC A;  3EHM A;  2Y39 A; 
#chains in the Genus database with same CATH homology
 2YL3 A;  1NBB A;  4U9E A;  3ZTM A;  4JKV A;  1MQV A;  1EKY A;  1CPQ A;  3HNI A;  3M15 A;  1E83 A;  2CCY A;  1YZC A;  4CJG A;  256B A;  4N6H A;  4N4W A;  2YL1 A;  1S05 A;  3ZQY A;  3C62 A;  3NMJ A;  3QVY A;  3ZTZ A;  3C63 A;  1QPU A;  5JSL A;  5B3I A;  5JP7 A;  2XLW A;  4JEA A;  2YKZ A;  4WGZ A;  3QW1 A;  4JEB A;  2BC5 A;  4CX9 A;  3NMI A;  3TOL A;  1E84 A;  2XLV A;  1CGO A;  4D4X A;  1YZA A;  3QVZ A;  1A7V A;  2XLE A;  3FOO A;  3U8P A;  4ULV A;  1CPR A;  4CDV A;  1JAF A;  2XL8 A;  2YL0 A;  3ZWI A;  4ER9 A;  3TOM A;  3QW0 A;  1BBH A;  1QQ3 A;  1GQA A;  5JUA A;  4NC3 A;  3HNL A;  3HNK A;  5JVE A;  1RCP A;  3VRC A;  2XLD A;  2YLI A;  4CJO A;  2XLO A;  2J8W A;  4EIY A;  4L6R A;  4D4N A;  3ZQV A;  1E85 A;  1LM3 B;  4IAQ A;  4JE9 A;  3M4B A;  2XLM A;  3NMK A;  4IAR A;  3IQ5 A;  2XLH A;  2J9B A;  5JRA A;  4CDY A;  2YLG A;  3DE9 A;  3IQ6 A;  4CDA A;  2XM0 A;  2YL7 A;  4CIP A;  3L1M A;  4U9D A;  5JLI A;  1E86 A;  1YYJ A;  3M79 A;  2QLA A;  3HNJ A;  1CGN A;  1M6T A;  4IB4 A;  2XM4 A;  5AGF A;  2XL6 A;  4WGY A;  1YYX A;  2YLD A;  5JT4 A;  5JS5 A;  1APC A;  3FOP A;  3M4C A;  3DE8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...