2XLWA

Cytochrome c prime from alcaligenes xylosoxidans: ferrous r124q variant with bound no
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
125
structure length
125
Chain Sequence
EFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Distal-to-Proximal No Conversion in Hemoproteins: The Role of the Proximal Pocket.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Electron transport
molecule keywords CYTOCHROME C'
total genus 51
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2010-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 2xlwA00
3M4CA 2J9BA 4D4XA 4ER9A 1YZAA 4WGZA 2YL1A 4IB4A 4CIPA 3QVZA 2XLEA 3U8PA 4JEAA 1YZCA 3DE8A 3IQ6A 3VRCA 5JSLA 1S05A 1QQ3A 3ZTMA 1RCPA 1CGOA 2XLDA 3M15A 4CDYA 2XL8A 3QW0A 4L6RA 3L1MA 5JP7A 3TOMA 1CPQA 4WGYA 3NMKA 3QVYA 1APCA 2YLIA 3ZTZA 5B3IA 1LM3B 2XLMA 5AGFA 3HNIA 2YL3A 4CDVA 1CGNA 3ZWIA 2YLDA 1BBHA 4U9DA 3HNKA 1NBBA 4CX9A 1MQVA 3QW1A 2YLGA 1CPRA 1YYJA 4N6HA 2XLVA 3FOOA 1A7VA 1M6TA 3FOPA 3ZQYA 2XM4A 4CJGA 5JLIA 4NC3A 3M79A 1E85A 2XLWA 2J8WA 2BC5A 3C62A 3ZQVA 5JT4A 2YKZA 2CCYA 1JAFA 4N4WA 4CJOA 4ULVA 2XLHA 1E86A 1QPUA 3HNJA 256BA 4JEBA 4IAQA 1YYXA 4JKVA 2YL0A 4EIYA 3HNLA 3NMJA 3NMIA 2XL6A 3M4BA 2QLAA 1EKYA 4JE9A 4IARA 3DE9A 4CDAA 4U9EA 4D4NA 5JS5A 5JVEA 1E84A 2XM0A 3C63A 1E83A 3IQ5A 5JRAA 5JUAA 1GQAA 2XLOA 2YL7A 3TOLA
chains in the Genus database with same CATH superfamily
1TWHA 2GFHA 3EQLF 1SF8A 3DXJF 1A0BA 4FX5A 3RQEA 1Y4CA 1B68A 4P9TA 4D4XA 1U0BB 3FVYA 1RXQA 4ER9A 2D4UA 1M57C 3TK0A 1YZAA 1FMWA 5D91A 1OKKD 1VOMA 2R02A 1JOGA 4A2NB 4LERA 2YL1A 4FWVA 4JURI 3B71A 1EA8A 3U8VA 1TFOB 3EZHA 2Y3DA 5A6BA 2DYSC 4XEVA 2YVKA 5L0CA 4MVUA 1FFHA 3SP1A 1VLTA 2VC9A 4XTKA 2HSQA 3T9OA 5JSLA 3AJMA 4EBKA 3C8GB 1HMDA 1QQ3A 2MHRA 3CAXA 4PFPA 3RVZA 2XLDA 2OJQA 2QE9A 5F5FA 1J8YF 3BRJA 2DI3A 1LI5A 3FAJA 3KPHA 1ZW3A 3OEOA 4MTOA 3DAGA 3QW0A 2EPNA 1M2VA 3L1MA 5JP7A 2QNLA 3JSZA 3V5XA 4JTDB 3SXYA 2L81A 4YL0A 4E7ZA 1A7DA 2ASRA 2ZXRA 5EHHA 3POVA 4CS8A 4NY3A 1CPQA 1OCOC 3B0VC 1PV3A 4OD4A 4BJTA 3QVYA 4MW3A 2CYDA 3TULA 3TQOA 4DRHB 2R7TA 4EBJA 2CNWA 3AG2C 2V26A 1NSGB 1QSPA 1PD1A 5B3IA 5L3VA 5D92A 1NFOA 2ETSA 2H7BA 3DJNB 1LM3B 5CI9A 2LP4A 2OOCA 1T9KA 4JW1A 1H6GA 4CS8C 2JPUA 3F46A 2ICWG 1N1CA 3EPVA 4OIOF 4H54A 4MQ9F 3C18A 5TJ5E 5HSWA 3ZIBA 5KYXB 4N6CA 5DQZA 5BQIA 1SMYF 1BBHA 2AVKA 3PDMP 1RMVA 1SR2A 5AC5A 1NBBA 2IXPA 1HW1A 1R5ID 5KYXA 4I44A 1D1AA 4NQFA 1TQGA 2BL2A 3LS1A 4PJJA 2AWYA 2I8BA 3O55A 4K0DA 1MQVA 3RVYA 3Q6NA 1OCCC 4KNVA 2EIKC 4XPYA 1Q0GA 1YYJA 4RD9A 2FGYA 4MVOA 1OQCA 4U5CE 1AEPA 2D5RB 4F4BA 2XLVA 1ZU4A 3FOOA 3EJNA 1H9GA 4JCZA 3FOPA 1I4ZA 2XM4A 1D1CA 2GWWA 4HFKB 3G50A 5JLIA 3A9CA 2XS1A 3B0PA 1G8XA 4C7OB 1WOLA 4XLNF 5L0JA 2W4BA 5DS5A 2I15A 4O6NA 3Q7LA 3DM9B 1JAFA 1ZYRF 1RKCA 3AGTA 3EH1A 4BG0A 4ANJA 2XLHA 1LI7A 1RKEA 1FFTC 5EGYA 1R4TA 256BA 4IGGA 1Q0KA 3GEIA 2KNHA 2EINC 4IJJA 2Q00A 3M1CB 4U5GA 2YL0A 4BJ6C 3RIPA 3SXMA 3V5YA 2OU6A 3HNLA 2IM8A 4J30B 3MLGA 3SEOA 3US6A 1U6HA 1Z3IX 3SXKA 3ABKC 4G7ZF 4ZLDA 3Q6MA 1VLSA 2P61A 1T5OA 3CQZA 3RYLA 1U89A 1QKRA 2W9YA 2XSEA 4K7BA 3C8ZA 3CSKA 3E70C 3F47A 3R7CA 1OW6A 2L6FA 3I5QA 3UMHA 4Z9HA 3U2MA 2DYRC 2PF4E 2PNOA 1OXBA 5L3QA 1H7IA 2H7VC 5KYUB 3WG7C 2CGEA 5IY5C 2EILC 4ULWA 1K05A 2O9XA 3IQ5A 4CS9A 4QI2A 2HV6A 1MMNA 1T6IA 1K04A 2LD6A 1YAUO 2OKUA 2R05A 2YL7A 2A1DD 3GODA 3K7DA 5E3CA 3NDBB 4PR9A 1TWCA 4JZAA 4DBRA 2J9WA 4LDKA 4DVZA 1WWPA 4XWJA 3DJUB 4HFFB 1HMOA 2Q7RA 1T6UA 3RQGA 2OCCC 2WVQA 4WGZA 5KYNA 2LFFA 1HY5A 4XPXA 1MMDA 3T6GB 3X2QC 4CIPA 5KYWB 3S0XA 2XLEA 3JT1A 1FAPB 2A6HF 3FAPB 2VH3A 3U3FA 3DE8A 2PX3A 4H4KC 4LLEA 1DOVA 2WL8A 3RF3A 3VRCA 2R7WA 4B6IA 1S05A 1JMWA 4LACB 3WODF 2GA0A 4K1OA 3M15A 4JTCB 2J0XA 1G4WR 3RFYA 1JPNA 5DLJA 2XL8A 2NUPB 4KNWA 1MMAA 1KU2A 3IQTA 2W45A 2Z15A 3GM1A 2WZFA 1JRAA 4KC9A 3TOMA 4OIPF 1W2WA 4LDQA 5B1AC 1BR2A 4O79A 5B3SC 3UR3C 3H2VA 3N2ZB 1Z63A 1XZPA 2EPLX 4G78A 1C02A 2OEXA 2VB6A 1I4YA 4CIHA 3NMKA 1G4US 2LIGA 3UMIA 1EI7A 4MVZA 3WHNA 2B0HA 4MVMA 2R9RB 1APCA 2YLIA 5F5HA 3B0UX 1F1MA 3ASOC 2XLMA 5AGFA 5AC4A 3FMSA 3HNIA 3ABLC 3DM5A 5DQTA 2J45A 2YL3A 3GWNA 2L6HA 3ZC4A 4CSAC 4J32B 5EK0A 2YLDA 3T6JA 3S84A 4MTGA 4U9DA 1ST6A 2HUJA 1YA7O 3HNKA 2MWQA 3RQFA 1DOWA 2GAQA 4J7TA 2HS5A 2Q9BA 3QW1A 1CPRA 4C3EA 5L0FA 5CI8A 3JYYA 3U3BA 2KYHA 2J7PD 4N6HA 3MYFA 3VM6A 3T6BA 4AE4A 3N0TA 4J7YA 1A7VA 2AU5A 3QTHA 2XRHA 3GORA 3EGDB 2CNWD 1E85A 2ZXPA 3PMRA 2NUTA 1VMAA 2BE5F 2GDCA 3NG1A 2NUPA 4PACA 4YT5A 2BC5A 3KKBA 2YKZA 2CCYA 4CS9C 4YT8A 5KYWA 4N4WA 4U5FE 4CJOA 1UFBA 1YA9A 3N24A 5A69A 1V54C 3AQBA 4BJ1A 1M2OA 2HFIA 1GM5A 4IAQA 1YYXA 1WN0A 4EBBA 1BR4A 5CIVA 1JR8A 3NKEA 2NG1A 3EGDA 4PFOA 3UGOA 3LEOA 3VAYA 3NMJA 2G3KA 1FTSA 3NMIA 2XL6A 3H65A 1MMGA 5COMA 3SXZA 3ECSA 4FESA 2FFHA 2OEVA 2HSBA 4U5BE 5KYYA 1EQ1A 2X0CA 1ZVZA 1EKYA 1MNEA 2A68F 4BJ6A 5L0IA 3B29A 3DE9A 3S9OA 3NYLA 4NTAA 2E87A 2R7SA 3K66A 2ZXOA 4D4NA 3S27A 1ORJA 2LCHA 4BJ5C 3U0CA 5JS5A 4NCQA 3HLZA 3JZ0A 2F22A 2OG2A 2XS8A 1Z7Qc 3ZDLA 1K40A 2HKVA 2LK4A 5JRAA 5E33A 2CDQA 3DKAA 2J0WA 2KQ9A 1RKEB 2KK1A 2P1AA 3V7OA 5T3TA 3WAQA 1FR0A 3ABMC 3TOLA 4YT2A 2HJ3A 1NFNA 5A6JA 1VYKA 3EFOA 3M4CA 1QZXA 2QY9A 4R32A 1GGQA 3C8GD 3AG3C 4G7HF 3TJ5A 3PHF2 2YZSA 1TWGA 3EH2A 2OJED 1T6QA 2P6VA 3EZIA 4N06A 4OIQF 2B0JA 1UG7A 2G62A 4A4AA 2DGJA 3LNRA 4C3DA 4Z9IA 2A6EF 2RSEB 5DS6A 2V3CC 4JEAA 4JJGA 3RW0A 2MYSA 2Q9CA 4EWCA 1ORYA 3KH2A 3LESA 3ZTMA 1RCPA 4YL3A 1I5NA 1TKNA 3W2VA 5FZTA 4C7OA 3E9VA 4L6RA 3TD7A 4AX2A 3IEEA 2Q3TA 2PFDA 2Y3GA 4LLCA 3V5ZA 4JC7A 3LAYA 3GM3A 3LNMB 4DRIB 1YARO 2Q4FA 4U5DE 5BQGA 3JTLO 1HW2A 2IXNA 4WGYA 2H8AA 2AWCA 4P9FA 2CW0F 4U5EE 4XEKA 3ZTZA 2EIMC 2C03A 4RDAA 3JSEO 1VYIA 3AG1C 4Q7CA 3W4YA 2HZ8A 4CDVA 2IOQA 4Q5SF 1ZHWA 3L0IA 3K1IC 4EHPA 1ZZPA 2UUIA 3T4RA 3CZ6A 3UMKA 3K1HA 2J46A 2L7AA 2ZXWC 3LS0A 4X0RA 2L9JA 5A6BD 4MNDA 2R03A 1NG1A 4DOZA 2FAPB 1VK5A 3FXHA 4DJ9A 3J06A 4CX9A 2HMZA 2QUPA 1MNDA 1BDJB 2Q9AA 4WJ0A 2P7VA 2VCAA 1PD0A 3KMIA 3KYJA 2J9VA 2R7OA 3JRTA 3L34A 3B9QA 4BEJA 5KYYB 1LS4A 3C7JA 2X51A 3AOUA 4DVYP 1YVIA 4E18A 1WATA 1M6TA 4LDRA 3ZQYA 4CJGA 1IW7F 2HV7A 4NC3A 3UGPA 2EPOA 4EUKB 1YLMA 3JYHA 4KBLA 1OCZC 3FHDA 3ZQVA 4AL0A 2NSFA 3DD7A 3LJBA 4M63A 4AE4B 5K0IA 1AUEA 5HV9A 3S90A 3RKOF 2R7RA 2R7UA 1LKXA 2C04A 2UUHA 2KSFA 4OIRF 1E86A 1QPUA 4P6IC 3EHNA 4JEBA 3PCVA 3TJ6A 1ORSC 2Y3HA 2ZD9A 3G4XA 3VF0A 2JX0A 4YN0B 1ZHXA 3A11A 4JKVA 3EG9A 1ZU5A 2YEVA 3HTKC 2EPMX 5E3AA 3ZVRA 1IZMA 2A69F 3QZCA 4O6MA 4ONSA 1QLEC 2WB7A 4EIYA 4Q4ZF 4YT4A 1D0XA 4ZLCA 2EPKX 3M4BA 3SYNA 2XL4A 3RH3A 4EKWA 4MVRA 3LUTB 2LSEA 1LE4A 3IQCA 3R2PA 3GWLA 4I1OB 2IXOA 4JVSA 1LS1A 4PJNA 1V4AA 4AL1A 2KC3A 3NYMA 3L8IA 3NKDA 3ZG1A 4U9EA 4JIOA 2NUTB 2YHSA 3KYIA 1Z6AA 4OINF 3S28A 5JVEA 1E84A 4W8KA 4O7GA 5B1BC 2XM0A 3C63A 2WVOA 4GYTA 5JUAA 4GEHA 4NTBA 3DI5A 4I1MA 2LFDA 4PK4A 1CGME 1GQAA 4FAPB 1Q0DA 4MS2A 2XLOA 3MFNA 4IAOA 1O87A 4NTFA 4PJLA 1V55C 2OQMA 4QI0A 2KW3C 5T1DB 4QDLA 2TMVP 3IHUA 4CSAA 2JD3A 5GPGB 2H7OA 3GM2A 1WGWA 4XQ1A 2J9UA 3OWTA 2J9BA 3K33A 3UNGC 1Q0MA 2WVNA 1XWJA 5BQHA 2IBFA 4PJMA 2PBEA 3W8IA 5L0GA 4IB4A 5F28E 3QVZA 4OD5A 3U8PA 2EIJC 3U9MA 1M2VB 1OCRC 1YZCA 1SZIA 3IQ6A 2KJGA 3ASNC 3K1IA 3QMKA 3U2LA 1VTMP 1D0YA 2XXAA 1BR1A 5T3WA 1HE1A 1H9TA 2NSGA 4XPWA 1CGOA 2KGOA 2YRFA 4G0HA 4CBEA 1GS9A 2AP3A 1OR3A 3I4UA 3O6XA 4YL1A 3W2WA 4CDYA 3EHMA 2L6GA 4HEAJ 4BJ5A 2PX0A 1AVOB 3GEHA 3O39A 3ATPA 1Z23A 4E0HA 1ZHTA 3EGXA 1OXKA 4JRZA 1BZ4A 2WZGA 1S7ZA 3GEEA 3DWWA 4WABA 1Y6DA 3I5PA 2A0BA 4DXWA 1C03A 1YJGA 1TFKB 3LLKA 1E2XA 2IXMA 4I3MA 1RJ9B 3LEVA 1PCXA 1OW8A 2R7VA 2WZLA 2Y69C 4BEMJ 1LE2A 1QVXA 4CS7A 2Y3BA 1FNTc 1YDIA 3LLIA 3NYJA 4YJWA 2R25A 5DS4A 3Q7GA 3EGXB 4UDVA 1A41A 4G7OF 5A6AA 1CGNA 1OKKA 4C3BA 4E7SA 1L7CA 2A0UA 4YK5A 2YQYA 3ZWIA 3ITFA 5KYUA 1LIHA 4XEFA 1WTYA 2QTVA 1Q0FA 4MVQA 3SNHA 3K6BA 4KI2A 1O3UA 1RJ9A 1D0ZA 4YWQA 2W4MA 3AG4C 1V74B 2YWAA 3GANA 1A7EA 1ZHYA 3H2UA 3ZSUA 1JPJA 1WASA 4JJFA 2YLGA 1TR2A 2XXAB 2VCCA 5COFA 1XZQA 4W8PA 5COGA 2DB4A 4E0IA 4AK9A 1ZHZA 1J8MF 3JRMO 3S29A 4MTFA 2IYLD 1KNYA 3AGUA 3M79A 3SZRA 2XLWA 3HKKA 3KL4A 1HE9A 2J8WA 1LPEA 1NLXA 1T01A 3C62A 4HE8D 5JT4A 3DMDA 3VYWA 4BPMA 4IWBA 2HJMA 3DZAA 4ULVA 4RBNA 2NPUA 3CEXA 3DAFA 3U5SA 3W8HA 4E17A 4JTAB 2RD9A 5A6KA 2R7XA 3MBGA 1NU7D 3MYIA 3OA1A 3HNJA 4MVSA 2G3VA 3NRHA 3X1OA 5L0HA 2M4EA 3G4ZA 1L3PA 3O10A 5FCLA 1NU9C 4GQHA 4U5HA 4XLPF 4JCHA 1M56C 2Y39A 4Z9JA 1ZW2A 1TWAA 3EG9B 4MW8A 2QLAA 1D1BA 1Z5ZA 2M64A 4IARA 4JE9A 2P0NA 4O6YA 4DRJB 4CDAA 1VB5A 1KTMA 4IRUA 2J7PA 3AQCA 5DVWA 1OR2A 3EFOB 2PP4A 1FMVA 3IPMO 3HJCA 1G5ZA 3MX3A 3L8JA 2VCBA 4DBQA 1E83A 2HMQA 3C8GA 5BUOA 5L0DA 3JCUQ 1OW7A 1LVKA 2VASA 2LQGA 1NZEA 1C17M 1O5HA 5E2QA 2R7QA 1SYQA 2ZPAA 3U9JA 3BEHA 3FDQA
chains in the Genus database with same CATH topology
3M4CA 2J9BA 4D4XA 4ER9A 1YZAA 4WGZA 2YL1A 4IB4A 4CIPA 3QVZA 2XLEA 3U8PA 4JEAA 1YZCA 3DE8A 3IQ6A 3VRCA 5JSLA 1S05A 1QQ3A 3ZTMA 1RCPA 1CGOA 2XLDA 3M15A 4CDYA 2XL8A 3QW0A 4L6RA 3L1MA 5JP7A 3TOMA 1CPQA 4WGYA 3NMKA 3QVYA 1APCA 2YLIA 3ZTZA 5B3IA 1LM3B 2XLMA 5AGFA 3HNIA 2YL3A 4CDVA 1CGNA 3ZWIA 2YLDA 1BBHA 4U9DA 3HNKA 1NBBA 4CX9A 1MQVA 3QW1A 2YLGA 1CPRA 1YYJA 4N6HA 2XLVA 3FOOA 1A7VA 1M6TA 3FOPA 3ZQYA 2XM4A 4CJGA 5JLIA 4NC3A 3M79A 1E85A 2XLWA 2J8WA 2BC5A 3C62A 3ZQVA 5JT4A 2YKZA 2CCYA 1JAFA 4N4WA 4CJOA 4ULVA 2XLHA 1E86A 1QPUA 3HNJA 256BA 4JEBA 4IAQA 1YYXA 4JKVA 2YL0A 4EIYA 3HNLA 3NMJA 3NMIA 2XL6A 3M4BA 2QLAA 1EKYA 4JE9A 4IARA 3DE9A 4CDAA 4U9EA 4D4NA 5JS5A 5JVEA 1E84A 2XM0A 3C63A 1E83A 3IQ5A 5JRAA 5JUAA 1GQAA 2XLOA 2YL7A 3TOLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M4C A;  2J9B A;  4D4X A;  4ER9 A;  1YZA A;  4WGZ A;  2YL1 A;  4IB4 A;  4CIP A;  3QVZ A;  2XLE A;  3U8P A;  4JEA A;  1YZC A;  3DE8 A;  3IQ6 A;  3VRC A;  5JSL A;  1S05 A;  1QQ3 A;  3ZTM A;  1RCP A;  1CGO A;  2XLD A;  3M15 A;  4CDY A;  2XL8 A;  3QW0 A;  4L6R A;  3L1M A;  5JP7 A;  3TOM A;  1CPQ A;  4WGY A;  3NMK A;  3QVY A;  1APC A;  2YLI A;  3ZTZ A;  5B3I A;  1LM3 B;  2XLM A;  5AGF A;  3HNI A;  2YL3 A;  4CDV A;  1CGN A;  3ZWI A;  2YLD A;  1BBH A;  4U9D A;  3HNK A;  1NBB A;  4CX9 A;  1MQV A;  3QW1 A;  2YLG A;  1CPR A;  1YYJ A;  4N6H A;  2XLV A;  3FOO A;  1A7V A;  1M6T A;  3FOP A;  3ZQY A;  2XM4 A;  4CJG A;  5JLI A;  4NC3 A;  3M79 A;  1E85 A;  2XLW A;  2J8W A;  2BC5 A;  3C62 A;  3ZQV A;  5JT4 A;  2YKZ A;  2CCY A;  1JAF A;  4N4W A;  4CJO A;  4ULV A;  2XLH A;  1E86 A;  1QPU A;  3HNJ A;  256B A;  4JEB A;  4IAQ A;  1YYX A;  4JKV A;  2YL0 A;  4EIY A;  3HNL A;  3NMJ A;  3NMI A;  2XL6 A;  3M4B A;  2QLA A;  1EKY A;  4JE9 A;  4IAR A;  3DE9 A;  4CDA A;  4U9E A;  4D4N A;  5JS5 A;  5JVE A;  1E84 A;  2XM0 A;  3C63 A;  1E83 A;  3IQ5 A;  5JRA A;  5JUA A;  1GQA A;  2XLO A;  2YL7 A;  3TOL A; 
#chains in the Genus database with same CATH topology
 1TWH A;  2GFH A;  3EQL F;  1SF8 A;  3DXJ F;  1A0B A;  4FX5 A;  3RQE A;  1Y4C A;  1B68 A;  4P9T A;  4D4X A;  1U0B B;  3FVY A;  1RXQ A;  4ER9 A;  2D4U A;  1M57 C;  3TK0 A;  1YZA A;  1FMW A;  5D91 A;  1OKK D;  1VOM A;  2R02 A;  1JOG A;  4A2N B;  4LER A;  2YL1 A;  4FWV A;  4JUR I;  3B71 A;  1EA8 A;  3U8V A;  1TFO B;  3EZH A;  2Y3D A;  5A6B A;  2DYS C;  4XEV A;  2YVK A;  5L0C A;  4MVU A;  1FFH A;  3SP1 A;  1VLT A;  2VC9 A;  4XTK A;  2HSQ A;  3T9O A;  5JSL A;  3AJM A;  4EBK A;  3C8G B;  1HMD A;  1QQ3 A;  2MHR A;  3CAX A;  4PFP A;  3RVZ A;  2XLD A;  2OJQ A;  2QE9 A;  5F5F A;  1J8Y F;  3BRJ A;  2DI3 A;  1LI5 A;  3FAJ A;  3KPH A;  1ZW3 A;  3OEO A;  4MTO A;  3DAG A;  3QW0 A;  2EPN A;  1M2V A;  3L1M A;  5JP7 A;  2QNL A;  3JSZ A;  3V5X A;  4JTD B;  3SXY A;  2L81 A;  4YL0 A;  4E7Z A;  1A7D A;  2ASR A;  2ZXR A;  5EHH A;  3POV A;  4CS8 A;  4NY3 A;  1CPQ A;  1OCO C;  3B0V C;  1PV3 A;  4OD4 A;  4BJT A;  3QVY A;  4MW3 A;  2CYD A;  3TUL A;  3TQO A;  4DRH B;  2R7T A;  4EBJ A;  2CNW A;  3AG2 C;  2V26 A;  1NSG B;  1QSP A;  1PD1 A;  5B3I A;  5L3V A;  5D92 A;  1NFO A;  2ETS A;  2H7B A;  3DJN B;  1LM3 B;  5CI9 A;  2LP4 A;  2OOC A;  1T9K A;  4JW1 A;  1H6G A;  4CS8 C;  2JPU A;  3F46 A;  2ICW G;  1N1C A;  3EPV A;  4OIO F;  4H54 A;  4MQ9 F;  3C18 A;  5TJ5 E;  5HSW A;  3ZIB A;  5KYX B;  4N6C A;  5DQZ A;  5BQI A;  1SMY F;  1BBH A;  2AVK A;  3PDM P;  1RMV A;  1SR2 A;  5AC5 A;  1NBB A;  2IXP A;  1HW1 A;  1R5I D;  5KYX A;  4I44 A;  1D1A A;  4NQF A;  1TQG A;  2BL2 A;  3LS1 A;  4PJJ A;  2AWY A;  2I8B A;  3O55 A;  4K0D A;  1MQV A;  3RVY A;  3Q6N A;  1OCC C;  4KNV A;  2EIK C;  4XPY A;  1Q0G A;  1YYJ A;  4RD9 A;  2FGY A;  4MVO A;  1OQC A;  4U5C E;  1AEP A;  2D5R B;  4F4B A;  2XLV A;  1ZU4 A;  3FOO A;  3EJN A;  1H9G A;  4JCZ A;  3FOP A;  1I4Z A;  2XM4 A;  1D1C A;  2GWW A;  4HFK B;  3G50 A;  5JLI A;  3A9C A;  2XS1 A;  3B0P A;  1G8X A;  4C7O B;  1WOL A;  4XLN F;  5L0J A;  2W4B A;  5DS5 A;  2I15 A;  4O6N A;  3Q7L A;  3DM9 B;  1JAF A;  1ZYR F;  1RKC A;  3AGT A;  3EH1 A;  4BG0 A;  4ANJ A;  2XLH A;  1LI7 A;  1RKE A;  1FFT C;  5EGY A;  1R4T A;  256B A;  4IGG A;  1Q0K A;  3GEI A;  2KNH A;  2EIN C;  4IJJ A;  2Q00 A;  3M1C B;  4U5G A;  2YL0 A;  4BJ6 C;  3RIP A;  3SXM A;  3V5Y A;  2OU6 A;  3HNL A;  2IM8 A;  4J30 B;  3MLG A;  3SEO A;  3US6 A;  1U6H A;  1Z3I X;  3SXK A;  3ABK C;  4G7Z F;  4ZLD A;  3Q6M A;  1VLS A;  2P61 A;  1T5O A;  3CQZ A;  3RYL A;  1U89 A;  1QKR A;  2W9Y A;  2XSE A;  4K7B A;  3C8Z A;  3CSK A;  3E70 C;  3F47 A;  3R7C A;  1OW6 A;  2L6F A;  3I5Q A;  3UMH A;  4Z9H A;  3U2M A;  2DYR C;  2PF4 E;  2PNO A;  1OXB A;  5L3Q A;  1H7I A;  2H7V C;  5KYU B;  3WG7 C;  2CGE A;  5IY5 C;  2EIL C;  4ULW A;  1K05 A;  2O9X A;  3IQ5 A;  4CS9 A;  4QI2 A;  2HV6 A;  1MMN A;  1T6I A;  1K04 A;  2LD6 A;  1YAU O;  2OKU A;  2R05 A;  2YL7 A;  2A1D D;  3GOD A;  3K7D A;  5E3C A;  3NDB B;  4PR9 A;  1TWC A;  4JZA A;  4DBR A;  2J9W A;  4LDK A;  4DVZ A;  1WWP A;  4XWJ A;  3DJU B;  4HFF B;  1HMO A;  2Q7R A;  1T6U A;  3RQG A;  2OCC C;  2WVQ A;  4WGZ A;  5KYN A;  2LFF A;  1HY5 A;  4XPX A;  1MMD A;  3T6G B;  3X2Q C;  4CIP A;  5KYW B;  3S0X A;  2XLE A;  3JT1 A;  1FAP B;  2A6H F;  3FAP B;  2VH3 A;  3U3F A;  3DE8 A;  2PX3 A;  4H4K C;  4LLE A;  1DOV A;  2WL8 A;  3RF3 A;  3VRC A;  2R7W A;  4B6I A;  1S05 A;  1JMW A;  4LAC B;  3WOD F;  2GA0 A;  4K1O A;  3M15 A;  4JTC B;  2J0X A;  1G4W R;  3RFY A;  1JPN A;  5DLJ A;  2XL8 A;  2NUP B;  4KNW A;  1MMA A;  1KU2 A;  3IQT A;  2W45 A;  2Z15 A;  3GM1 A;  2WZF A;  1JRA A;  4KC9 A;  3TOM A;  4OIP F;  1W2W A;  4LDQ A;  5B1A C;  1BR2 A;  4O79 A;  5B3S C;  3UR3 C;  3H2V A;  3N2Z B;  1Z63 A;  1XZP A;  2EPL X;  4G78 A;  1C02 A;  2OEX A;  2VB6 A;  1I4Y A;  4CIH A;  3NMK A;  1G4U S;  2LIG A;  3UMI A;  1EI7 A;  4MVZ A;  3WHN A;  2B0H A;  4MVM A;  2R9R B;  1APC A;  2YLI A;  5F5H A;  3B0U X;  1F1M A;  3ASO C;  2XLM A;  5AGF A;  5AC4 A;  3FMS A;  3HNI A;  3ABL C;  3DM5 A;  5DQT A;  2J45 A;  2YL3 A;  3GWN A;  2L6H A;  3ZC4 A;  4CSA C;  4J32 B;  5EK0 A;  2YLD A;  3T6J A;  3S84 A;  4MTG A;  4U9D A;  1ST6 A;  2HUJ A;  1YA7 O;  3HNK A;  2MWQ A;  3RQF A;  1DOW A;  2GAQ A;  4J7T A;  2HS5 A;  2Q9B A;  3QW1 A;  1CPR A;  4C3E A;  5L0F A;  5CI8 A;  3JYY A;  3U3B A;  2KYH A;  2J7P D;  4N6H A;  3MYF A;  3VM6 A;  3T6B A;  4AE4 A;  3N0T A;  4J7Y A;  1A7V A;  2AU5 A;  3QTH A;  2XRH A;  3GOR A;  3EGD B;  2CNW D;  1E85 A;  2ZXP A;  3PMR A;  2NUT A;  1VMA A;  2BE5 F;  2GDC A;  3NG1 A;  2NUP A;  4PAC A;  4YT5 A;  2BC5 A;  3KKB A;  2YKZ A;  2CCY A;  4CS9 C;  4YT8 A;  5KYW A;  4N4W A;  4U5F E;  4CJO A;  1UFB A;  1YA9 A;  3N24 A;  5A69 A;  1V54 C;  3AQB A;  4BJ1 A;  1M2O A;  2HFI A;  1GM5 A;  4IAQ A;  1YYX A;  1WN0 A;  4EBB A;  1BR4 A;  5CIV A;  1JR8 A;  3NKE A;  2NG1 A;  3EGD A;  4PFO A;  3UGO A;  3LEO A;  3VAY A;  3NMJ A;  2G3K A;  1FTS A;  3NMI A;  2XL6 A;  3H65 A;  1MMG A;  5COM A;  3SXZ A;  3ECS A;  4FES A;  2FFH A;  2OEV A;  2HSB A;  4U5B E;  5KYY A;  1EQ1 A;  2X0C A;  1ZVZ A;  1EKY A;  1MNE A;  2A68 F;  4BJ6 A;  5L0I A;  3B29 A;  3DE9 A;  3S9O A;  3NYL A;  4NTA A;  2E87 A;  2R7S A;  3K66 A;  2ZXO A;  4D4N A;  3S27 A;  1ORJ A;  2LCH A;  4BJ5 C;  3U0C A;  5JS5 A;  4NCQ A;  3HLZ A;  3JZ0 A;  2F22 A;  2OG2 A;  2XS8 A;  1Z7Q c;  3ZDL A;  1K40 A;  2HKV A;  2LK4 A;  5JRA A;  5E33 A;  2CDQ A;  3DKA A;  2J0W A;  2KQ9 A;  1RKE B;  2KK1 A;  2P1A A;  3V7O A;  5T3T A;  3WAQ A;  1FR0 A;  3ABM C;  3TOL A;  4YT2 A;  2HJ3 A;  1NFN A;  5A6J A;  1VYK A;  3EFO A;  3M4C A;  1QZX A;  2QY9 A;  4R32 A;  1GGQ A;  3C8G D;  3AG3 C;  4G7H F;  3TJ5 A;  3PHF 2;  2YZS A;  1TWG A;  3EH2 A;  2OJE D;  1T6Q A;  2P6V A;  3EZI A;  4N06 A;  4OIQ F;  2B0J A;  1UG7 A;  2G62 A;  4A4A A;  2DGJ A;  3LNR A;  4C3D A;  4Z9I A;  2A6E F;  2RSE B;  5DS6 A;  2V3C C;  4JEA A;  4JJG A;  3RW0 A;  2MYS A;  2Q9C A;  4EWC A;  1ORY A;  3KH2 A;  3LES A;  3ZTM A;  1RCP A;  4YL3 A;  1I5N A;  1TKN A;  3W2V A;  5FZT A;  4C7O A;  3E9V A;  4L6R A;  3TD7 A;  4AX2 A;  3IEE A;  2Q3T A;  2PFD A;  2Y3G A;  4LLC A;  3V5Z A;  4JC7 A;  3LAY A;  3GM3 A;  3LNM B;  4DRI B;  1YAR O;  2Q4F A;  4U5D E;  5BQG A;  3JTL O;  1HW2 A;  2IXN A;  4WGY A;  2H8A A;  2AWC A;  4P9F A;  2CW0 F;  4U5E E;  4XEK A;  3ZTZ A;  2EIM C;  2C03 A;  4RDA A;  3JSE O;  1VYI A;  3AG1 C;  4Q7C A;  3W4Y A;  2HZ8 A;  4CDV A;  2IOQ A;  4Q5S F;  1ZHW A;  3L0I A;  3K1I C;  4EHP A;  1ZZP A;  2UUI A;  3T4R A;  3CZ6 A;  3UMK A;  3K1H A;  2J46 A;  2L7A A;  2ZXW C;  3LS0 A;  4X0R A;  2L9J A;  5A6B D;  4MND A;  2R03 A;  1NG1 A;  4DOZ A;  2FAP B;  1VK5 A;  3FXH A;  4DJ9 A;  3J06 A;  4CX9 A;  2HMZ A;  2QUP A;  1MND A;  1BDJ B;  2Q9A A;  4WJ0 A;  2P7V A;  2VCA A;  1PD0 A;  3KMI A;  3KYJ A;  2J9V A;  2R7O A;  3JRT A;  3L34 A;  3B9Q A;  4BEJ A;  5KYY B;  1LS4 A;  3C7J A;  2X51 A;  3AOU A;  4DVY P;  1YVI A;  4E18 A;  1WAT A;  1M6T A;  4LDR A;  3ZQY A;  4CJG A;  1IW7 F;  2HV7 A;  4NC3 A;  3UGP A;  2EPO A;  4EUK B;  1YLM A;  3JYH A;  4KBL A;  1OCZ C;  3FHD A;  3ZQV A;  4AL0 A;  2NSF A;  3DD7 A;  3LJB A;  4M63 A;  4AE4 B;  5K0I A;  1AUE A;  5HV9 A;  3S90 A;  3RKO F;  2R7R A;  2R7U A;  1LKX A;  2C04 A;  2UUH A;  2KSF A;  4OIR F;  1E86 A;  1QPU A;  4P6I C;  3EHN A;  4JEB A;  3PCV A;  3TJ6 A;  1ORS C;  2Y3H A;  2ZD9 A;  3G4X A;  3VF0 A;  2JX0 A;  4YN0 B;  1ZHX A;  3A11 A;  4JKV A;  3EG9 A;  1ZU5 A;  2YEV A;  3HTK C;  2EPM X;  5E3A A;  3ZVR A;  1IZM A;  2A69 F;  3QZC A;  4O6M A;  4ONS A;  1QLE C;  2WB7 A;  4EIY A;  4Q4Z F;  4YT4 A;  1D0X A;  4ZLC A;  2EPK X;  3M4B A;  3SYN A;  2XL4 A;  3RH3 A;  4EKW A;  4MVR A;  3LUT B;  2LSE A;  1LE4 A;  3IQC A;  3R2P A;  3GWL A;  4I1O B;  2IXO A;  4JVS A;  1LS1 A;  4PJN A;  1V4A A;  4AL1 A;  2KC3 A;  3NYM A;  3L8I A;  3NKD A;  3ZG1 A;  4U9E A;  4JIO A;  2NUT B;  2YHS A;  3KYI A;  1Z6A A;  4OIN F;  3S28 A;  5JVE A;  1E84 A;  4W8K A;  4O7G A;  5B1B C;  2XM0 A;  3C63 A;  2WVO A;  4GYT A;  5JUA A;  4GEH A;  4NTB A;  3DI5 A;  4I1M A;  2LFD A;  4PK4 A;  1CGM E;  1GQA A;  4FAP B;  1Q0D A;  4MS2 A;  2XLO A;  3MFN A;  4IAO A;  1O87 A;  4NTF A;  4PJL A;  1V55 C;  2OQM A;  4QI0 A;  2KW3 C;  5T1D B;  4QDL A;  2TMV P;  3IHU A;  4CSA A;  2JD3 A;  5GPG B;  2H7O A;  3GM2 A;  1WGW A;  4XQ1 A;  2J9U A;  3OWT A;  2J9B A;  3K33 A;  3UNG C;  1Q0M A;  2WVN A;  1XWJ A;  5BQH A;  2IBF A;  4PJM A;  2PBE A;  3W8I A;  5L0G A;  4IB4 A;  5F28 E;  3QVZ A;  4OD5 A;  3U8P A;  2EIJ C;  3U9M A;  1M2V B;  1OCR C;  1YZC A;  1SZI A;  3IQ6 A;  2KJG A;  3ASN C;  3K1I A;  3QMK A;  3U2L A;  1VTM P;  1D0Y A;  2XXA A;  1BR1 A;  5T3W A;  1HE1 A;  1H9T A;  2NSG A;  4XPW A;  1CGO A;  2KGO A;  2YRF A;  4G0H A;  4CBE A;  1GS9 A;  2AP3 A;  1OR3 A;  3I4U A;  3O6X A;  4YL1 A;  3W2W A;  4CDY A;  3EHM A;  2L6G A;  4HEA J;  4BJ5 A;  2PX0 A;  1AVO B;  3GEH A;  3O39 A;  3ATP A;  1Z23 A;  4E0H A;  1ZHT A;  3EGX A;  1OXK A;  4JRZ A;  1BZ4 A;  2WZG A;  1S7Z A;  3GEE A;  3DWW A;  4WAB A;  1Y6D A;  3I5P A;  2A0B A;  4DXW A;  1C03 A;  1YJG A;  1TFK B;  3LLK A;  1E2X A;  2IXM A;  4I3M A;  1RJ9 B;  3LEV A;  1PCX A;  1OW8 A;  2R7V A;  2WZL A;  2Y69 C;  4BEM J;  1LE2 A;  1QVX A;  4CS7 A;  2Y3B A;  1FNT c;  1YDI A;  3LLI A;  3NYJ A;  4YJW A;  2R25 A;  5DS4 A;  3Q7G A;  3EGX B;  4UDV A;  1A41 A;  4G7O F;  5A6A A;  1CGN A;  1OKK A;  4C3B A;  4E7S A;  1L7C A;  2A0U A;  4YK5 A;  2YQY A;  3ZWI A;  3ITF A;  5KYU A;  1LIH A;  4XEF A;  1WTY A;  2QTV A;  1Q0F A;  4MVQ A;  3SNH A;  3K6B A;  4KI2 A;  1O3U A;  1RJ9 A;  1D0Z A;  4YWQ A;  2W4M A;  3AG4 C;  1V74 B;  2YWA A;  3GAN A;  1A7E A;  1ZHY A;  3H2U A;  3ZSU A;  1JPJ A;  1WAS A;  4JJF A;  2YLG A;  1TR2 A;  2XXA B;  2VCC A;  5COF A;  1XZQ A;  4W8P A;  5COG A;  2DB4 A;  4E0I A;  4AK9 A;  1ZHZ A;  1J8M F;  3JRM O;  3S29 A;  4MTF A;  2IYL D;  1KNY A;  3AGU A;  3M79 A;  3SZR A;  2XLW A;  3HKK A;  3KL4 A;  1HE9 A;  2J8W A;  1LPE A;  1NLX A;  1T01 A;  3C62 A;  4HE8 D;  5JT4 A;  3DMD A;  3VYW A;  4BPM A;  4IWB A;  2HJM A;  3DZA A;  4ULV A;  4RBN A;  2NPU A;  3CEX A;  3DAF A;  3U5S A;  3W8H A;  4E17 A;  4JTA B;  2RD9 A;  5A6K A;  2R7X A;  3MBG A;  1NU7 D;  3MYI A;  3OA1 A;  3HNJ A;  4MVS A;  2G3V A;  3NRH A;  3X1O A;  5L0H A;  2M4E A;  3G4Z A;  1L3P A;  3O10 A;  5FCL A;  1NU9 C;  4GQH A;  4U5H A;  4XLP F;  4JCH A;  1M56 C;  2Y39 A;  4Z9J A;  1ZW2 A;  1TWA A;  3EG9 B;  4MW8 A;  2QLA A;  1D1B A;  1Z5Z A;  2M64 A;  4IAR A;  4JE9 A;  2P0N A;  4O6Y A;  4DRJ B;  4CDA A;  1VB5 A;  1KTM A;  4IRU A;  2J7P A;  3AQC A;  5DVW A;  1OR2 A;  3EFO B;  2PP4 A;  1FMV A;  3IPM O;  3HJC A;  1G5Z A;  3MX3 A;  3L8J A;  2VCB A;  4DBQ A;  1E83 A;  2HMQ A;  3C8G A;  5BUO A;  5L0D A;  3JCU Q;  1OW7 A;  1LVK A;  2VAS A;  2LQG A;  1NZE A;  1C17 M;  1O5H A;  5E2Q A;  2R7Q A;  1SYQ A;  2ZPA A;  3U9J A;  3BEH A;  3FDQ A; 
#chains in the Genus database with same CATH homology
 3M4C A;  2J9B A;  4D4X A;  4ER9 A;  1YZA A;  4WGZ A;  2YL1 A;  4IB4 A;  4CIP A;  3QVZ A;  2XLE A;  3U8P A;  4JEA A;  1YZC A;  3DE8 A;  3IQ6 A;  3VRC A;  5JSL A;  1S05 A;  1QQ3 A;  3ZTM A;  1RCP A;  1CGO A;  2XLD A;  3M15 A;  4CDY A;  2XL8 A;  3QW0 A;  4L6R A;  3L1M A;  5JP7 A;  3TOM A;  1CPQ A;  4WGY A;  3NMK A;  3QVY A;  1APC A;  2YLI A;  3ZTZ A;  5B3I A;  1LM3 B;  2XLM A;  5AGF A;  3HNI A;  2YL3 A;  4CDV A;  1CGN A;  3ZWI A;  2YLD A;  1BBH A;  4U9D A;  3HNK A;  1NBB A;  4CX9 A;  1MQV A;  3QW1 A;  2YLG A;  1CPR A;  1YYJ A;  4N6H A;  2XLV A;  3FOO A;  1A7V A;  1M6T A;  3FOP A;  3ZQY A;  2XM4 A;  4CJG A;  5JLI A;  4NC3 A;  3M79 A;  1E85 A;  2XLW A;  2J8W A;  2BC5 A;  3C62 A;  3ZQV A;  5JT4 A;  2YKZ A;  2CCY A;  1JAF A;  4N4W A;  4CJO A;  4ULV A;  2XLH A;  1E86 A;  1QPU A;  3HNJ A;  256B A;  4JEB A;  4IAQ A;  1YYX A;  4JKV A;  2YL0 A;  4EIY A;  3HNL A;  3NMJ A;  3NMI A;  2XL6 A;  3M4B A;  2QLA A;  1EKY A;  4JE9 A;  4IAR A;  3DE9 A;  4CDA A;  4U9E A;  4D4N A;  5JS5 A;  5JVE A;  1E84 A;  2XM0 A;  3C63 A;  1E83 A;  3IQ5 A;  5JRA A;  5JUA A;  1GQA A;  2XLO A;  2YL7 A;  3TOL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...