2XLWA

Cytochrome c prime from alcaligenes xylosoxidans: ferrous r124q variant with bound no
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
125
structure length
125
Chain Sequence
EFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Distal-to-Proximal No Conversion in Hemoproteins: The Role of the Proximal Pocket.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Electron transport
molecule keywords CYTOCHROME C'
total genus 51
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2010-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 2xlwA00
3IQ5A 256BA 2YLIA 2YLDA 3M79A 2XLMA 3QW1A 2YKZA 1JAFA 2XL6A 3IQ6A 4IARA 2YL7A 1NBBA 3M4CA 2QLAA 3ZQYA 4D4NA 4JKVA 1E86A 2XLHA 4IAQA 4IB4A 2J8WA 5JUAA 5JRAA 3HNLA 2YL3A 4D4XA 1YYJA 4CIPA 2XM0A 4U9DA 1EKYA 3M4BA 1S05A 4WGYA 4L6RA 4JE9A 1APCA 3DE8A 1E85A 1RCPA 3QVYA 1CGOA 3VRCA 1CPQA 4ULVA 3HNKA 3NMIA 1A7VA 2CCYA 3HNIA 3NMKA 3L1MA 4N4WA 2XLEA 1QPUA 4CDVA 5JT4A 2XL8A 2BC5A 4U9EA 4EIYA 4ER9A 4NC3A 2YL0A 1YYXA 1QQ3A 4CX9A 1MQVA 3C63A 2YL1A 5JP7A 5JVEA 3FOOA 2XLVA 2J9BA 4JEAA 1CGNA 4JEBA 3ZTMA 1GQAA 1LM3B 3M15A 2XLDA 3DE9A 3ZTZA 2YLGA 1BBHA 3ZQVA 5AGFA 1M6TA 3HNJA 2XLOA 3QW0A 1CPRA 4N6HA 3ZWIA 5JSLA 1E83A 5JLIA 3FOPA 3QVZA 3NMJA 1E84A 4WGZA 4CJOA 4CDYA 3C62A 2XLWA 4CDAA 5B3IA 5JS5A 1YZAA 4CJGA 2XM4A 3U8PA 3TOLA 3TOMA 1YZCA
chains in the Genus database with same CATH superfamily
4GYTA 256BA 3TJ6A 5KYWA 4DRHB 3MX3A 3O6XA 1ORSC 1VYIA 4HE8D 3GM1A 4GQHA 3ASOC 3QW1A 3IQCA 4JIOA 4C7OB 1JAFA 1J8MF 1T9KA 3IQ6A 1KTMA 1DOVA 1S7ZA 4LACB 5COGA 3RVZA 3M4CA 3CQZA 2OEVA 3MFNA 5FCLA 5CI8A 2YVKA 3RVYA 4JCZA 1M57C 3ECSA 3ZSUA 2J9WA 1XZPA 4DJ9A 1L3PA 3DJUB 2P0NA 1NU7D 3JSEO 3C8GA 3SP1A 3AG3C 3IEEA 3LS1A 2CGEA 2L6FA 3HNLA 3OWTA 1JPJA 4D4XA 4G7OF 1HW1A 1YA9A 1HE9A 1BR1A 3ZC4A 4CS8A 4CIPA 3Q6MA 2LP4A 1AVOB 2XM0A 4J30B 4U9DA 1TFKB 1EKYA 1NFOA 1TR2A 2AP3A 1RKEA 2I8BA 3NKDA 4WGYA 4JE9A 3JTLO 1RCPA 3UMKA 1CGOA 1QZXA 2DGJA 3FXHA 3GM3A 5DLJA 2WVQA 1CPQA 1OW7A 2L9JA 4XLNF 2V3CC 1RXQA 3EZHA 1OKKD 3ABMC 4OINF 4YK5A 3H2UA 4G0HA 1Q0GA 4OD4A 5KYYA 1GM5A 2R7WA 2Q7RA 4PR9A 1O87A 2QNLA 1QPUA 2XS1A 5DQZA 3UNGC 3UGPA 3NYLA 1I5NA 4U9EA 4BJ5A 4ER9A 2R7RA 4KNWA 2R9RB 4NC3A 5EGYA 2BE5F 2IOQA 4U5DE 3N0TA 5HSWA 5DS5A 5L0FA 4ANJA 3WHNA 4Z9IA 1YYXA 2D4UA 2PP4A 1QQ3A 2Q3TA 2XL4A 4CX9A 5KYUA 3ZVRA 4C3BA 4E0HA 2P7VA 2YEVA 4XPYA 1PD1A 2ZPAA 4Z9HA 3I5PA 3W8IA 3GEEA 2HV6A 2P6VA 5JP7A 5JVEA 3DJNB 3K1IA 2XLVA 3AG1C 2ZXPA 3RFYA 3RQEA 4MVUA 3SXYA 3US6A 2F22A 1OR2A 3ZTMA 1A0BA 3G4XA 5EK0A 2XLDA 4IGGA 1G4WR 1QSPA 1WWPA 4R32A 3ZQVA 5KYYB 1VTMP 1O3UA 2KW3C 3HNJA 2IM8A 4U5HA 4AX2A 5BQHA 4O6NA 1JRAA 3LS0A 2LQGA 5JSLA 2R05A 4IAOA 3MYIA 4CS8C 5AC5A 5A69A 4JJGA 3SXMA 4JJFA 3QVZA 5D91A 2R25A 1H9TA 3NMJA 2R03A 1W2WA 4Q7CA 3LLIA 1SR2A 3EZIA 2Y3DA 4YL1A 2LD6A 2LIGA 4EBBA 3OEOA 1G4US 4AK9A 2R7XA 1OQCA 2DB4A 3B29A 2WL8A 1SYQA 3JYHA 2MWQA 2I15A 3O55A 2FAPB 2YQYA 3T9OA 1H7IA 2Q9BA 1BDJB 3K66A 3U8PA 1T6QA 1I4YA 3NKEA 3TOLA 1PD0A 2LCHA 5KYXA 1BR2A 2ZXRA 3RH3A 1YZCA 2AWYA 3E70C 5FZTA 5L0GA 1OCZC 3C8GB 5COMA 3K1HA 3DZAA 1B68A 2IXMA 4JZAA 3W2VA 4OIPF 2PX0A 3B9QA 1MMAA 1R5ID 4U5EE 2XLMA 4F4BA 1OXBA 3NG1A 3F46A 1F1MA 2XL6A 4XPXA 4IARA 4MVQA 3WAQA 4JRZA 3W2WA 2OQMA 3U2LA 4B6IA 3C7JA 2HMQA 3N24A 5T1DB 1ZU5A 3J06A 4U5BE 3C8ZA 3EHNA 3K6BA 3BEHA 3S28A 3Q6NA 4MVSA 2WZFA 3W4YA 2NSFA 2MYSA 2RSEB 1K40A 4O6MA 4XQ1A 4CS9C 5K0IA 5DVWA 2LK4A 2VCCA 2J46A 4A4AA 1HY5A 1YVIA 4XLPF 1OCRC 2Y3HA 3ZIBA 3F47A 4G78A 2J7PA 4XEVA 2R7TA 2D5RB 5DS4A 5JUAA 3T6JA 2R7SA 4BEJA 3S9OA 4IJJA 1JOGA 4JVSA 4LDQA 5B1BC 2WZGA 1O5HA 1TWAA 2YL3A 2ETSA 2GDCA 2WZLA 1YYJA 4I3MA 4NTAA 4EHPA 2A6EF 2IXNA 4CSAC 2OJED 3RF3A 3V5XA 4DOZA 5KYNA 2G62A 1M2OA 5T3TA 4ZLDA 1QVXA 5DQTA 4N6CA 4XTKA 2CYDA 2EIJC 4L6RA 4MTFA 2GAQA 1APCA 3DMDA 4YT2A 3VRCA 3QVYA 2CNWD 2XS8A 5F28E 1JR8A 3AOUA 1WN0A 3LEVA 4DVZA 1YARO 4CBEA 4PFPA 2H7BA 3DWWA 2HFIA 3H65A 5E2QA 2OU6A 3FAPB 3NMIA 1NG1A 1ORJA 1MMGA 2CCYA 3I4UA 1ZYRF 3NMKA 3RW0A 4Q5SF 3AG2C 1VLTA 1EQ1A 4PJMA 4OIRF 4N4WA 3H2VA 5A6AA 1ZHYA 2HKVA 4CDVA 4EBKA 1SMYF 2XL8A 5L0HA 4U5CE 3U0CA 2EPLX 3TJ5A 2Z15A 3NYJA 1TWCA 3GANA 2YWAA 4NY3A 2W9YA 2YL0A 1TWHA 4I44A 4YL0A 4PJNA 2AU5A 1T6UA 1OCCC 2M64A 1VYKA 1MQVA 5E3AA 3JYYA 1AUEA 2XRHA 2YL1A 3UMIA 5T3WA 4NQFA 4O7GA 4I1MA 3FOOA 3LESA 4KI2A 1JPNA 2C04A 2Y3BA 3B0PA 4C3EA 3B0VC 4C3DA 1Q0DA 4JEBA 3WG7C 1OW8A 1T5OA 1GQAA 1YLMA 1LVKA 3DE9A 1FNTc 3R2PA 1YA7O 1ZHTA 3SEOA 4CIHA 3IHUA 3SYNA 3ZDLA 4JTDB 5BQGA 1PV3A 1M6TA 5B3SC 4QI2A 3QW0A 3PDMP 1Q0MA 1ZZPA 4N6HA 4BJ6C 1H6GA 1U6HA 3X2QC 4YT8A 1H9GA 3LNMB 3G4ZA 1WATA 2L81A 4O6YA 2KGOA 4E17A 2A68F 1RKCA 3PCVA 1VOMA 4YT4A 1WGWA 2Q00A 2ZXWC 2WVOA 3S27A 4CJOA 2AVKA 2DYSC 4GEHA 1YDIA 3PMRA 1HMDA 3C62A 2J7PD 3L8IA 2OJQA 3U5SA 5B3IA 3TQOA 1I4ZA 1YZAA 3TK0A 4CJGA 3ITFA 1K04A 2KJGA 2GFHA 1LKXA 2UUIA 3DAFA 3DM9B 3KMIA 2WVNA 1WTYA 3L0IA 4YL3A 3KL4A 4UDVA 3I5QA 3UGOA 1LPEA 4PJJA 5A6BA 3U3FA 1MMNA 3KH2A 3GWLA 1Z3IX 3IQ5A 2YLIA 3Q7GA 4XWJA 1FMWA 3JSZA 4JC7A 1TFOB 1L7CA 1MNEA 1VK5A 5BUOA 3UMHA 3TD7A 1TKNA 1JMWA 1K05A 4I1OB 1ZVZA 2J45A 5L3VA 2R7UA 3EGXA 4MTGA 2VCBA 1IW7F 2DI3A 5A6BD 2A1DD 3C8GD 1Q0FA 1Y6DA 2A69F 2XLHA 2HS5A 4IAQA 1A41A 4IB4A 3TULA 4OIOF 3L8JA 2HUJA 3AGTA 1ZU4A 3GEIA 3IQTA 4N06A 1T6IA 4C7OA 3LEOA 1MNDA 3LAYA 5E3CA 1YJGA 1V54C 1FFTC 4YJWA 4DVYP 1U89A 3JCUQ 5L3QA 2LFDA 5BQIA 5KYUB 4DBQA 1ORYA 4CSAA 3M4BA 2HSBA 2OCCC 2Y3GA 1M2VA 1S05A 1VMAA 2R7VA 3U9MA 3EFOA 1D0YA 3DE8A 4OIQF 5D92A 5EHHA 3M1CB 2IBFA 3BRJA 1RJ9B 3K33A 2V26A 2UUHA 4EKWA 2VASA 4LERA 1KU2A 3ZG1A 4MVRA 5AC4A 4ULVA 5F5FA 1FR0A 2IXOA 2QTVA 3MBGA 2ICWG 2PFDA 1EI7A 3VYWA 3VAYA 3V7OA 3L1MA 1D1CA 1Z63A 3SXZA 2GWWA 4BJ6A 3AJMA 3V5ZA 2J0WA 2FFHA 1C02A 3HLZA 2BC5A 3HTKC 4MW3A 2XSEA 2J0XA 1LS4A 1Z23A 4J7TA 2EIMC 2TMVP 4PK4A 1MMDA 3GM2A 4LLEA 1RKEB 5TJ5E 4E7ZA 1U0BB 3EG9A 3QMKA 4NCQA 4P6IC 2P61A 1G5ZA 1LE2A 4EBJA 4P9FA 4ULWA 3X1OA 1IZMA 1HE1A 4U5GA 2NSGA 2NUTB 3FMSA 4IWBA 2J9UA 1LIHA 3GODA 4LDKA 4MTOA 2OOCA 1CGME 1OKKA 4AE4B 3ASNC 3T6BA 3VF0A 1OCOC 2H8AA 1CGNA 4BEMJ 5E33A 1TWGA 1WOLA 3B71A 4M63A 4G7HF 3DAGA 3M15A 2EPOA 2JX0A 2QE9A 4HFFB 2L6HA 4NTBA 1BBHA 5IY5C 4E7SA 2WB7A 4CS9A 1LE4A 4BJ5C 1D0XA 5AGFA 4DRIB 4YWQA 2EPNA 4H54A 2XLOA 2X51A 3EJNA 3O39A 1YAUO 1CPRA 4LLCA 3SZRA 3C18A 4HFKB 3AQCA 3K1IC 4JCHA 4WABA 1BZ4A 3ATPA 3MYFA 3U3BA 3ZWIA 1E83A 4KNVA 5KYXB 4G7ZF 4K1OA 3RQFA 1E84A 3EH2A 4EWCA 4EUKB 1GS9A 2Q9AA 1KNYA 1NZEA 3JRMO 4MW8A 5CI9A 3NRHA 3RKOF 3CEXA 5L0IA 2XLWA 4CDAA 1GGQA 1M56C 1N1CA 4MNDA 2LSEA 2PX3A 4FAPB 3DXJF 3U9JA 4XEFA 2ASRA 1Z7Qc 1D1AA 3EGXB 2XM4A 2IXPA 3TOMA 1NFNA 2HV7A 1ST6A 1A7DA 3JZ0A 2NG1A 1TQGA 1AEPA 2HSQA 2PNOA 2ZD9A 2BL2A 4OD5A 1VLSA 5F5HA 3N2ZB 2L7AA 3CAXA 1FMVA 2PF4E 3KKBA 4DRJB 2C03A 2IYLD 2YLDA 2GA0A 3M79A 2EPMX 4K0DA 2R7QA 3L34A 4FX5A 2CDQA 2KQ9A 2H7OA 2YKZA 3DI5A 4YT5A 4NTFA 2A0UA 3EHMA 4J32B 2YL7A 5A6JA 1NBBA 3VM6A 2KSFA 4MQ9F 2KK1A 2QLAA 4O79A 4BPMA 1SZIA 3JT1A 3KYJA 3ZQYA 1DOWA 4JTCB 4D4NA 1ZHZA 3KYIA 3S0XA 4JKVA 5L0CA 1FTSA 1Y4CA 1D0ZA 2QUPA 3G50A 3V5YA 5L0DA 2A6HF 1RMVA 2NUPB 4ZLCA 1E86A 3DKAA 2FGYA 4FWVA 2VH3A 2J8WA 3Q7LA 1V4AA 2HMZA 1ZW3A 4DBRA 3FAJA 3RYLA 1SF8A 3EQLF 2KC3A 5JRAA 1QLEC 3T6GB 4PACA 4HEAJ 2X0CA 2JPUA 3AGUA 2OKUA 4E0IA 4Z9JA 2XXAA 5HV9A 1V55C 3OA1A 2LFFA 4U5FE 3FDQA 4QDLA 3JRTA 2YZSA 2QY9A 3FHDA 5KYWB 2J9VA 4YN0B 2EILC 4RDAA 1EA8A 3EGDB 1PCXA 1NSGB 1D1BA 2RD9A 4PJLA 1E85A 3EH1A 4WJ0A 1OW6A 3AG4C 1VB5A 4J7YA 5GPGB 1ZHXA 3SXKA 3HNKA 4RBNA 4Q4ZF 4XPWA 3S29A 1A7VA 3HNIA 3AQBA 1NLXA 1G8XA 4PFOA 2NUTA 1J8YF 3ABLC 4JTAB 3T4RA 4RD9A 2XLEA 5JT4A 2VCAA 4KBLA 3NYMA 2M4EA 4P9TA 1Z6AA 2E87A 3GWNA 4BJ1A 1A7EA 4EIYA 5A6KA 3K7DA 3R7CA 3SNHA 1UFBA 1LI7A 2G3KA 2KYHA 2VC9A 2ZXOA 3QTHA 3GEHA 2EIKC 1HMOA 1T01A 4E18A 4DXWA 4H4KC 3UR3C 3LJBA 1OXKA 2HJMA 2OG2A 3C63A 3IPMO 2R02A 4A2NB 2CNWA 2XXAB 1V74B 3DM5A 1XWJA 1HW2A 1BR4A 3EFOB 4JURI 2NPUA 2B0HA 3O10A 1R4TA 2VB6A 4FESA 1Q0KA 1ZW2A 1M2VB 4KC9A 4LDRA 1Z5ZA 2W4MA 5COFA 2J9BA 4JEAA 2Q9CA 1FAPB 1LI5A 3EGDA 3S90A 1QKRA 1WASA 3PHF2 2HZ8A 3GORA 4MVZA 1LM3B 1RJ9A 2P1AA 2HJ3A 4ONSA 4W8PA 4X0RA 4AL0A 3A9CA 2EINC 3ZTZA 2YLGA 3B0UX 2W4BA 2AWCA 3EG9B 3W8HA 3FVYA 4MVOA 2YRFA 1FFHA 3E9VA 2DYRC 3QZCA 2L6GA 3HKKA 3RQGA 3DD7A 4CS7A 1ZHWA 3S84A 2OEXA 1E2XA 2PBEA 5DS6A 5JLIA 1OR3A 2CW0F 3POVA 3FOPA 3WODF 2G3VA 5CIVA 2O9XA 2KNHA 5B1AC 4AE4A 3NDBB 2NUPA 4WGZA 4K7BA 4BJTA 2JD3A 3HJCA 2W45A 4JW1A 4MS2A 4W8KA 4CDYA 5L0JA 2MHRA 2A0BA 2EPKX 4QI0A 5JS5A 3ABKC 2Y39A 3LUTB 1UG7A 4MVMA 2Q4FA 3EPVA 2H7VC 1C03A 4XEKA 1C17M 1NU9C 2B0JA 2YHSA 3MLGA 2R7OA 3CZ6A 2Y69C 3KPHA 3LNRA 4IRUA 3U2MA 4BG0A 3RIPA 1XZQA 3U8VA 1LS1A 3LLKA 4AL1A 3CSKA 3A11A
chains in the Genus database with same CATH topology
3IQ5A 256BA 2YLIA 2YLDA 3M79A 2XLMA 3QW1A 2YKZA 1JAFA 2XL6A 3IQ6A 4IARA 2YL7A 1NBBA 3M4CA 2QLAA 3ZQYA 4D4NA 4JKVA 1E86A 2XLHA 4IAQA 4IB4A 2J8WA 5JUAA 5JRAA 3HNLA 2YL3A 4D4XA 1YYJA 4CIPA 2XM0A 4U9DA 1EKYA 3M4BA 1S05A 4WGYA 4L6RA 4JE9A 1APCA 3DE8A 1E85A 1RCPA 3QVYA 1CGOA 3VRCA 1CPQA 4ULVA 3HNKA 3NMIA 1A7VA 2CCYA 3HNIA 3NMKA 3L1MA 4N4WA 2XLEA 1QPUA 4CDVA 5JT4A 2XL8A 2BC5A 4U9EA 4EIYA 4ER9A 4NC3A 2YL0A 1YYXA 1QQ3A 4CX9A 1MQVA 3C63A 2YL1A 5JP7A 5JVEA 3FOOA 2XLVA 2J9BA 4JEAA 1CGNA 4JEBA 3ZTMA 1GQAA 1LM3B 3M15A 2XLDA 3DE9A 3ZTZA 2YLGA 1BBHA 3ZQVA 5AGFA 1M6TA 3HNJA 2XLOA 3QW0A 1CPRA 4N6HA 3ZWIA 5JSLA 1E83A 5JLIA 3FOPA 3QVZA 3NMJA 1E84A 4WGZA 4CJOA 4CDYA 3C62A 2XLWA 4CDAA 5B3IA 5JS5A 1YZAA 4CJGA 2XM4A 3U8PA 3TOLA 3TOMA 1YZCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IQ5 A;  256B A;  2YLI A;  2YLD A;  3M79 A;  2XLM A;  3QW1 A;  2YKZ A;  1JAF A;  2XL6 A;  3IQ6 A;  4IAR A;  2YL7 A;  1NBB A;  3M4C A;  2QLA A;  3ZQY A;  4D4N A;  4JKV A;  1E86 A;  2XLH A;  4IAQ A;  4IB4 A;  2J8W A;  5JUA A;  5JRA A;  3HNL A;  2YL3 A;  4D4X A;  1YYJ A;  4CIP A;  2XM0 A;  4U9D A;  1EKY A;  3M4B A;  1S05 A;  4WGY A;  4L6R A;  4JE9 A;  1APC A;  3DE8 A;  1E85 A;  1RCP A;  3QVY A;  1CGO A;  3VRC A;  1CPQ A;  4ULV A;  3HNK A;  3NMI A;  1A7V A;  2CCY A;  3HNI A;  3NMK A;  3L1M A;  4N4W A;  2XLE A;  1QPU A;  4CDV A;  5JT4 A;  2XL8 A;  2BC5 A;  4U9E A;  4EIY A;  4ER9 A;  4NC3 A;  2YL0 A;  1YYX A;  1QQ3 A;  4CX9 A;  1MQV A;  3C63 A;  2YL1 A;  5JP7 A;  5JVE A;  3FOO A;  2XLV A;  2J9B A;  4JEA A;  1CGN A;  4JEB A;  3ZTM A;  1GQA A;  1LM3 B;  3M15 A;  2XLD A;  3DE9 A;  3ZTZ A;  2YLG A;  1BBH A;  3ZQV A;  5AGF A;  1M6T A;  3HNJ A;  2XLO A;  3QW0 A;  1CPR A;  4N6H A;  3ZWI A;  5JSL A;  1E83 A;  5JLI A;  3FOP A;  3QVZ A;  3NMJ A;  1E84 A;  4WGZ A;  4CJO A;  4CDY A;  3C62 A;  2XLW A;  4CDA A;  5B3I A;  5JS5 A;  1YZA A;  4CJG A;  2XM4 A;  3U8P A;  3TOL A;  3TOM A;  1YZC A; 
#chains in the Genus database with same CATH topology
 4GYT A;  256B A;  3TJ6 A;  5KYW A;  4DRH B;  3MX3 A;  3O6X A;  1ORS C;  1VYI A;  4HE8 D;  3GM1 A;  4GQH A;  3ASO C;  3QW1 A;  3IQC A;  4JIO A;  4C7O B;  1JAF A;  1J8M F;  1T9K A;  3IQ6 A;  1KTM A;  1DOV A;  1S7Z A;  4LAC B;  5COG A;  3RVZ A;  3M4C A;  3CQZ A;  2OEV A;  3MFN A;  5FCL A;  5CI8 A;  2YVK A;  3RVY A;  4JCZ A;  1M57 C;  3ECS A;  3ZSU A;  2J9W A;  1XZP A;  4DJ9 A;  1L3P A;  3DJU B;  2P0N A;  1NU7 D;  3JSE O;  3C8G A;  3SP1 A;  3AG3 C;  3IEE A;  3LS1 A;  2CGE A;  2L6F A;  3HNL A;  3OWT A;  1JPJ A;  4D4X A;  4G7O F;  1HW1 A;  1YA9 A;  1HE9 A;  1BR1 A;  3ZC4 A;  4CS8 A;  4CIP A;  3Q6M A;  2LP4 A;  1AVO B;  2XM0 A;  4J30 B;  4U9D A;  1TFK B;  1EKY A;  1NFO A;  1TR2 A;  2AP3 A;  1RKE A;  2I8B A;  3NKD A;  4WGY A;  4JE9 A;  3JTL O;  1RCP A;  3UMK A;  1CGO A;  1QZX A;  2DGJ A;  3FXH A;  3GM3 A;  5DLJ A;  2WVQ A;  1CPQ A;  1OW7 A;  2L9J A;  4XLN F;  2V3C C;  1RXQ A;  3EZH A;  1OKK D;  3ABM C;  4OIN F;  4YK5 A;  3H2U A;  4G0H A;  1Q0G A;  4OD4 A;  5KYY A;  1GM5 A;  2R7W A;  2Q7R A;  4PR9 A;  1O87 A;  2QNL A;  1QPU A;  2XS1 A;  5DQZ A;  3UNG C;  3UGP A;  3NYL A;  1I5N A;  4U9E A;  4BJ5 A;  4ER9 A;  2R7R A;  4KNW A;  2R9R B;  4NC3 A;  5EGY A;  2BE5 F;  2IOQ A;  4U5D E;  3N0T A;  5HSW A;  5DS5 A;  5L0F A;  4ANJ A;  3WHN A;  4Z9I A;  1YYX A;  2D4U A;  2PP4 A;  1QQ3 A;  2Q3T A;  2XL4 A;  4CX9 A;  5KYU A;  3ZVR A;  4C3B A;  4E0H A;  2P7V A;  2YEV A;  4XPY A;  1PD1 A;  2ZPA A;  4Z9H A;  3I5P A;  3W8I A;  3GEE A;  2HV6 A;  2P6V A;  5JP7 A;  5JVE A;  3DJN B;  3K1I A;  2XLV A;  3AG1 C;  2ZXP A;  3RFY A;  3RQE A;  4MVU A;  3SXY A;  3US6 A;  2F22 A;  1OR2 A;  3ZTM A;  1A0B A;  3G4X A;  5EK0 A;  2XLD A;  4IGG A;  1G4W R;  1QSP A;  1WWP A;  4R32 A;  3ZQV A;  5KYY B;  1VTM P;  1O3U A;  2KW3 C;  3HNJ A;  2IM8 A;  4U5H A;  4AX2 A;  5BQH A;  4O6N A;  1JRA A;  3LS0 A;  2LQG A;  5JSL A;  2R05 A;  4IAO A;  3MYI A;  4CS8 C;  5AC5 A;  5A69 A;  4JJG A;  3SXM A;  4JJF A;  3QVZ A;  5D91 A;  2R25 A;  1H9T A;  3NMJ A;  2R03 A;  1W2W A;  4Q7C A;  3LLI A;  1SR2 A;  3EZI A;  2Y3D A;  4YL1 A;  2LD6 A;  2LIG A;  4EBB A;  3OEO A;  1G4U S;  4AK9 A;  2R7X A;  1OQC A;  2DB4 A;  3B29 A;  2WL8 A;  1SYQ A;  3JYH A;  2MWQ A;  2I15 A;  3O55 A;  2FAP B;  2YQY A;  3T9O A;  1H7I A;  2Q9B A;  1BDJ B;  3K66 A;  3U8P A;  1T6Q A;  1I4Y A;  3NKE A;  3TOL A;  1PD0 A;  2LCH A;  5KYX A;  1BR2 A;  2ZXR A;  3RH3 A;  1YZC A;  2AWY A;  3E70 C;  5FZT A;  5L0G A;  1OCZ C;  3C8G B;  5COM A;  3K1H A;  3DZA A;  1B68 A;  2IXM A;  4JZA A;  3W2V A;  4OIP F;  2PX0 A;  3B9Q A;  1MMA A;  1R5I D;  4U5E E;  2XLM A;  4F4B A;  1OXB A;  3NG1 A;  3F46 A;  1F1M A;  2XL6 A;  4XPX A;  4IAR A;  4MVQ A;  3WAQ A;  4JRZ A;  3W2W A;  2OQM A;  3U2L A;  4B6I A;  3C7J A;  2HMQ A;  3N24 A;  5T1D B;  1ZU5 A;  3J06 A;  4U5B E;  3C8Z A;  3EHN A;  3K6B A;  3BEH A;  3S28 A;  3Q6N A;  4MVS A;  2WZF A;  3W4Y A;  2NSF A;  2MYS A;  2RSE B;  1K40 A;  4O6M A;  4XQ1 A;  4CS9 C;  5K0I A;  5DVW A;  2LK4 A;  2VCC A;  2J46 A;  4A4A A;  1HY5 A;  1YVI A;  4XLP F;  1OCR C;  2Y3H A;  3ZIB A;  3F47 A;  4G78 A;  2J7P A;  4XEV A;  2R7T A;  2D5R B;  5DS4 A;  5JUA A;  3T6J A;  2R7S A;  4BEJ A;  3S9O A;  4IJJ A;  1JOG A;  4JVS A;  4LDQ A;  5B1B C;  2WZG A;  1O5H A;  1TWA A;  2YL3 A;  2ETS A;  2GDC A;  2WZL A;  1YYJ A;  4I3M A;  4NTA A;  4EHP A;  2A6E F;  2IXN A;  4CSA C;  2OJE D;  3RF3 A;  3V5X A;  4DOZ A;  5KYN A;  2G62 A;  1M2O A;  5T3T A;  4ZLD A;  1QVX A;  5DQT A;  4N6C A;  4XTK A;  2CYD A;  2EIJ C;  4L6R A;  4MTF A;  2GAQ A;  1APC A;  3DMD A;  4YT2 A;  3VRC A;  3QVY A;  2CNW D;  2XS8 A;  5F28 E;  1JR8 A;  3AOU A;  1WN0 A;  3LEV A;  4DVZ A;  1YAR O;  4CBE A;  4PFP A;  2H7B A;  3DWW A;  2HFI A;  3H65 A;  5E2Q A;  2OU6 A;  3FAP B;  3NMI A;  1NG1 A;  1ORJ A;  1MMG A;  2CCY A;  3I4U A;  1ZYR F;  3NMK A;  3RW0 A;  4Q5S F;  3AG2 C;  1VLT A;  1EQ1 A;  4PJM A;  4OIR F;  4N4W A;  3H2V A;  5A6A A;  1ZHY A;  2HKV A;  4CDV A;  4EBK A;  1SMY F;  2XL8 A;  5L0H A;  4U5C E;  3U0C A;  2EPL X;  3TJ5 A;  2Z15 A;  3NYJ A;  1TWC A;  3GAN A;  2YWA A;  4NY3 A;  2W9Y A;  2YL0 A;  1TWH A;  4I44 A;  4YL0 A;  4PJN A;  2AU5 A;  1T6U A;  1OCC C;  2M64 A;  1VYK A;  1MQV A;  5E3A A;  3JYY A;  1AUE A;  2XRH A;  2YL1 A;  3UMI A;  5T3W A;  4NQF A;  4O7G A;  4I1M A;  3FOO A;  3LES A;  4KI2 A;  1JPN A;  2C04 A;  2Y3B A;  3B0P A;  4C3E A;  3B0V C;  4C3D A;  1Q0D A;  4JEB A;  3WG7 C;  1OW8 A;  1T5O A;  1GQA A;  1YLM A;  1LVK A;  3DE9 A;  1FNT c;  3R2P A;  1YA7 O;  1ZHT A;  3SEO A;  4CIH A;  3IHU A;  3SYN A;  3ZDL A;  4JTD B;  5BQG A;  1PV3 A;  1M6T A;  5B3S C;  4QI2 A;  3QW0 A;  3PDM P;  1Q0M A;  1ZZP A;  4N6H A;  4BJ6 C;  1H6G A;  1U6H A;  3X2Q C;  4YT8 A;  1H9G A;  3LNM B;  3G4Z A;  1WAT A;  2L81 A;  4O6Y A;  2KGO A;  4E17 A;  2A68 F;  1RKC A;  3PCV A;  1VOM A;  4YT4 A;  1WGW A;  2Q00 A;  2ZXW C;  2WVO A;  3S27 A;  4CJO A;  2AVK A;  2DYS C;  4GEH A;  1YDI A;  3PMR A;  1HMD A;  3C62 A;  2J7P D;  3L8I A;  2OJQ A;  3U5S A;  5B3I A;  3TQO A;  1I4Z A;  1YZA A;  3TK0 A;  4CJG A;  3ITF A;  1K04 A;  2KJG A;  2GFH A;  1LKX A;  2UUI A;  3DAF A;  3DM9 B;  3KMI A;  2WVN A;  1WTY A;  3L0I A;  4YL3 A;  3KL4 A;  4UDV A;  3I5Q A;  3UGO A;  1LPE A;  4PJJ A;  5A6B A;  3U3F A;  1MMN A;  3KH2 A;  3GWL A;  1Z3I X;  3IQ5 A;  2YLI A;  3Q7G A;  4XWJ A;  1FMW A;  3JSZ A;  4JC7 A;  1TFO B;  1L7C A;  1MNE A;  1VK5 A;  5BUO A;  3UMH A;  3TD7 A;  1TKN A;  1JMW A;  1K05 A;  4I1O B;  1ZVZ A;  2J45 A;  5L3V A;  2R7U A;  3EGX A;  4MTG A;  2VCB A;  1IW7 F;  2DI3 A;  5A6B D;  2A1D D;  3C8G D;  1Q0F A;  1Y6D A;  2A69 F;  2XLH A;  2HS5 A;  4IAQ A;  1A41 A;  4IB4 A;  3TUL A;  4OIO F;  3L8J A;  2HUJ A;  3AGT A;  1ZU4 A;  3GEI A;  3IQT A;  4N06 A;  1T6I A;  4C7O A;  3LEO A;  1MND A;  3LAY A;  5E3C A;  1YJG A;  1V54 C;  1FFT C;  4YJW A;  4DVY P;  1U89 A;  3JCU Q;  5L3Q A;  2LFD A;  5BQI A;  5KYU B;  4DBQ A;  1ORY A;  4CSA A;  3M4B A;  2HSB A;  2OCC C;  2Y3G A;  1M2V A;  1S05 A;  1VMA A;  2R7V A;  3U9M A;  3EFO A;  1D0Y A;  3DE8 A;  4OIQ F;  5D92 A;  5EHH A;  3M1C B;  2IBF A;  3BRJ A;  1RJ9 B;  3K33 A;  2V26 A;  2UUH A;  4EKW A;  2VAS A;  4LER A;  1KU2 A;  3ZG1 A;  4MVR A;  5AC4 A;  4ULV A;  5F5F A;  1FR0 A;  2IXO A;  2QTV A;  3MBG A;  2ICW G;  2PFD A;  1EI7 A;  3VYW A;  3VAY A;  3V7O A;  3L1M A;  1D1C A;  1Z63 A;  3SXZ A;  2GWW A;  4BJ6 A;  3AJM A;  3V5Z A;  2J0W A;  2FFH A;  1C02 A;  3HLZ A;  2BC5 A;  3HTK C;  4MW3 A;  2XSE A;  2J0X A;  1LS4 A;  1Z23 A;  4J7T A;  2EIM C;  2TMV P;  4PK4 A;  1MMD A;  3GM2 A;  4LLE A;  1RKE B;  5TJ5 E;  4E7Z A;  1U0B B;  3EG9 A;  3QMK A;  4NCQ A;  4P6I C;  2P61 A;  1G5Z A;  1LE2 A;  4EBJ A;  4P9F A;  4ULW A;  3X1O A;  1IZM A;  1HE1 A;  4U5G A;  2NSG A;  2NUT B;  3FMS A;  4IWB A;  2J9U A;  1LIH A;  3GOD A;  4LDK A;  4MTO A;  2OOC A;  1CGM E;  1OKK A;  4AE4 B;  3ASN C;  3T6B A;  3VF0 A;  1OCO C;  2H8A A;  1CGN A;  4BEM J;  5E33 A;  1TWG A;  1WOL A;  3B71 A;  4M63 A;  4G7H F;  3DAG A;  3M15 A;  2EPO A;  2JX0 A;  2QE9 A;  4HFF B;  2L6H A;  4NTB A;  1BBH A;  5IY5 C;  4E7S A;  2WB7 A;  4CS9 A;  1LE4 A;  4BJ5 C;  1D0X A;  5AGF A;  4DRI B;  4YWQ A;  2EPN A;  4H54 A;  2XLO A;  2X51 A;  3EJN A;  3O39 A;  1YAU O;  1CPR A;  4LLC A;  3SZR A;  3C18 A;  4HFK B;  3AQC A;  3K1I C;  4JCH A;  4WAB A;  1BZ4 A;  3ATP A;  3MYF A;  3U3B A;  3ZWI A;  1E83 A;  4KNV A;  5KYX B;  4G7Z F;  4K1O A;  3RQF A;  1E84 A;  3EH2 A;  4EWC A;  4EUK B;  1GS9 A;  2Q9A A;  1KNY A;  1NZE A;  3JRM O;  4MW8 A;  5CI9 A;  3NRH A;  3RKO F;  3CEX A;  5L0I A;  2XLW A;  4CDA A;  1GGQ A;  1M56 C;  1N1C A;  4MND A;  2LSE A;  2PX3 A;  4FAP B;  3DXJ F;  3U9J A;  4XEF A;  2ASR A;  1Z7Q c;  1D1A A;  3EGX B;  2XM4 A;  2IXP A;  3TOM A;  1NFN A;  2HV7 A;  1ST6 A;  1A7D A;  3JZ0 A;  2NG1 A;  1TQG A;  1AEP A;  2HSQ A;  2PNO A;  2ZD9 A;  2BL2 A;  4OD5 A;  1VLS A;  5F5H A;  3N2Z B;  2L7A A;  3CAX A;  1FMV A;  2PF4 E;  3KKB A;  4DRJ B;  2C03 A;  2IYL D;  2YLD A;  2GA0 A;  3M79 A;  2EPM X;  4K0D A;  2R7Q A;  3L34 A;  4FX5 A;  2CDQ A;  2KQ9 A;  2H7O A;  2YKZ A;  3DI5 A;  4YT5 A;  4NTF A;  2A0U A;  3EHM A;  4J32 B;  2YL7 A;  5A6J A;  1NBB A;  3VM6 A;  2KSF A;  4MQ9 F;  2KK1 A;  2QLA A;  4O79 A;  4BPM A;  1SZI A;  3JT1 A;  3KYJ A;  3ZQY A;  1DOW A;  4JTC B;  4D4N A;  1ZHZ A;  3KYI A;  3S0X A;  4JKV A;  5L0C A;  1FTS A;  1Y4C A;  1D0Z A;  2QUP A;  3G50 A;  3V5Y A;  5L0D A;  2A6H F;  1RMV A;  2NUP B;  4ZLC A;  1E86 A;  3DKA A;  2FGY A;  4FWV A;  2VH3 A;  2J8W A;  3Q7L A;  1V4A A;  2HMZ A;  1ZW3 A;  4DBR A;  3FAJ A;  3RYL A;  1SF8 A;  3EQL F;  2KC3 A;  5JRA A;  1QLE C;  3T6G B;  4PAC A;  4HEA J;  2X0C A;  2JPU A;  3AGU A;  2OKU A;  4E0I A;  4Z9J A;  2XXA A;  5HV9 A;  1V55 C;  3OA1 A;  2LFF A;  4U5F E;  3FDQ A;  4QDL A;  3JRT A;  2YZS A;  2QY9 A;  3FHD A;  5KYW B;  2J9V A;  4YN0 B;  2EIL C;  4RDA A;  1EA8 A;  3EGD B;  1PCX A;  1NSG B;  1D1B A;  2RD9 A;  4PJL A;  1E85 A;  3EH1 A;  4WJ0 A;  1OW6 A;  3AG4 C;  1VB5 A;  4J7Y A;  5GPG B;  1ZHX A;  3SXK A;  3HNK A;  4RBN A;  4Q4Z F;  4XPW A;  3S29 A;  1A7V A;  3HNI A;  3AQB A;  1NLX A;  1G8X A;  4PFO A;  2NUT A;  1J8Y F;  3ABL C;  4JTA B;  3T4R A;  4RD9 A;  2XLE A;  5JT4 A;  2VCA A;  4KBL A;  3NYM A;  2M4E A;  4P9T A;  1Z6A A;  2E87 A;  3GWN A;  4BJ1 A;  1A7E A;  4EIY A;  5A6K A;  3K7D A;  3R7C A;  3SNH A;  1UFB A;  1LI7 A;  2G3K A;  2KYH A;  2VC9 A;  2ZXO A;  3QTH A;  3GEH A;  2EIK C;  1HMO A;  1T01 A;  4E18 A;  4DXW A;  4H4K C;  3UR3 C;  3LJB A;  1OXK A;  2HJM A;  2OG2 A;  3C63 A;  3IPM O;  2R02 A;  4A2N B;  2CNW A;  2XXA B;  1V74 B;  3DM5 A;  1XWJ A;  1HW2 A;  1BR4 A;  3EFO B;  4JUR I;  2NPU A;  2B0H A;  3O10 A;  1R4T A;  2VB6 A;  4FES A;  1Q0K A;  1ZW2 A;  1M2V B;  4KC9 A;  4LDR A;  1Z5Z A;  2W4M A;  5COF A;  2J9B A;  4JEA A;  2Q9C A;  1FAP B;  1LI5 A;  3EGD A;  3S90 A;  1QKR A;  1WAS A;  3PHF 2;  2HZ8 A;  3GOR A;  4MVZ A;  1LM3 B;  1RJ9 A;  2P1A A;  2HJ3 A;  4ONS A;  4W8P A;  4X0R A;  4AL0 A;  3A9C A;  2EIN C;  3ZTZ A;  2YLG A;  3B0U X;  2W4B A;  2AWC A;  3EG9 B;  3W8H A;  3FVY A;  4MVO A;  2YRF A;  1FFH A;  3E9V A;  2DYR C;  3QZC A;  2L6G A;  3HKK A;  3RQG A;  3DD7 A;  4CS7 A;  1ZHW A;  3S84 A;  2OEX A;  1E2X A;  2PBE A;  5DS6 A;  5JLI A;  1OR3 A;  2CW0 F;  3POV A;  3FOP A;  3WOD F;  2G3V A;  5CIV A;  2O9X A;  2KNH A;  5B1A C;  4AE4 A;  3NDB B;  2NUP A;  4WGZ A;  4K7B A;  4BJT A;  2JD3 A;  3HJC A;  2W45 A;  4JW1 A;  4MS2 A;  4W8K A;  4CDY A;  5L0J A;  2MHR A;  2A0B A;  2EPK X;  4QI0 A;  5JS5 A;  3ABK C;  2Y39 A;  3LUT B;  1UG7 A;  4MVM A;  2Q4F A;  3EPV A;  2H7V C;  1C03 A;  4XEK A;  1C17 M;  1NU9 C;  2B0J A;  2YHS A;  3MLG A;  2R7O A;  3CZ6 A;  2Y69 C;  3KPH A;  3LNR A;  4IRU A;  3U2M A;  4BG0 A;  3RIP A;  1XZQ A;  3U8V A;  1LS1 A;  3LLK A;  4AL1 A;  3CSK A;  3A11 A; 
#chains in the Genus database with same CATH homology
 3IQ5 A;  256B A;  2YLI A;  2YLD A;  3M79 A;  2XLM A;  3QW1 A;  2YKZ A;  1JAF A;  2XL6 A;  3IQ6 A;  4IAR A;  2YL7 A;  1NBB A;  3M4C A;  2QLA A;  3ZQY A;  4D4N A;  4JKV A;  1E86 A;  2XLH A;  4IAQ A;  4IB4 A;  2J8W A;  5JUA A;  5JRA A;  3HNL A;  2YL3 A;  4D4X A;  1YYJ A;  4CIP A;  2XM0 A;  4U9D A;  1EKY A;  3M4B A;  1S05 A;  4WGY A;  4L6R A;  4JE9 A;  1APC A;  3DE8 A;  1E85 A;  1RCP A;  3QVY A;  1CGO A;  3VRC A;  1CPQ A;  4ULV A;  3HNK A;  3NMI A;  1A7V A;  2CCY A;  3HNI A;  3NMK A;  3L1M A;  4N4W A;  2XLE A;  1QPU A;  4CDV A;  5JT4 A;  2XL8 A;  2BC5 A;  4U9E A;  4EIY A;  4ER9 A;  4NC3 A;  2YL0 A;  1YYX A;  1QQ3 A;  4CX9 A;  1MQV A;  3C63 A;  2YL1 A;  5JP7 A;  5JVE A;  3FOO A;  2XLV A;  2J9B A;  4JEA A;  1CGN A;  4JEB A;  3ZTM A;  1GQA A;  1LM3 B;  3M15 A;  2XLD A;  3DE9 A;  3ZTZ A;  2YLG A;  1BBH A;  3ZQV A;  5AGF A;  1M6T A;  3HNJ A;  2XLO A;  3QW0 A;  1CPR A;  4N6H A;  3ZWI A;  5JSL A;  1E83 A;  5JLI A;  3FOP A;  3QVZ A;  3NMJ A;  1E84 A;  4WGZ A;  4CJO A;  4CDY A;  3C62 A;  2XLW A;  4CDA A;  5B3I A;  5JS5 A;  1YZA A;  4CJG A;  2XM4 A;  3U8P A;  3TOL A;  3TOM A;  1YZC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...