4A2NB

Crystal structure of ma-icmt
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
192
structure length
192
Chain Sequence
MNENLWKICFIVMFIIWVFVRKVYGTRAMKNKSKKKVRPNFEKSLVFLNFIGMVFLPLTAVFSSYLDSFNINLPDSIRLFALIVTFLNIGLFTKIHKDLGNNWSAILEIKDGHKLVKEGIYKNIRHPMYAHLWLWVITQGIILSNWVVLIFGIVAWAILYFIRVPKEEELLIEEFGDEYIEYMGKTGRLFPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ISOPRENYLCYSTEINE CARBOXYL METHYLTRANSFERASE
publication title Mechanism of Isoprenylcysteine Carboxyl Methylation from the Crystal Structure of the Integral Membrane Methyltransferase Icmt.
pubmed doi rcsb
source organism Methanosarcina acetivorans
molecule tags Transferase
total genus 65
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2011-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04140 ICMT Isoprenylcysteine carboxyl methyltransferase (ICMT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1630 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4a2nB00
4A2NB
chains in the Genus database with same CATH superfamily
5L3QA 4I1MA 1T5OA 1ZZPA 3AQBA 4KNWA 1E85A 3DJUB 1WN0A 3NKEA 2B0JA 2EIMC 2HJMA 2X51A 1AEPA 4H54A 4U9EA 4N4WA 2OQMA 4P9TA 3ZC4A 5KYWA 4ZLDA 3VYWA 2DYRC 2XLHA 3CSKA 5AC5A 2R03A 2X0CA 1QVXA 2KQ9A 4J7TA 1YDIA 2XS1A 4FWVA 3TOMA 4LERA 1FR0A 1C03A 3S84A 3HLZA 4JVSA 1ZHTA 2P0NA 3ASNC 4BJ5C 4IWBA 2GAQA 4RBNA 2HV7A 3U5SA 4A4AA 2YL3A 2XLMA 3GORA 1ZVZA 5HV9A 2G62A 2XL6A 3DM5A 1ZYRF 5A6KA 1T9KA 3ECSA 3ZWIA 4JW1A 3ZQYA 3U8PA 3W2WA 2ETSA 3WODF 1OW6A 4QDLA 1U0BB 3H65A 1YVIA 3V7OA 3V5ZA 2L7AA 5DS6A 3FXHA 2YLIA 4U5FE 3VF0A 4LDKA 2ASRA 1PCXA 3GODA 4EBBA 1E86A 1G4WR 2B0HA 5T3TA 4IAOA 3S9OA 4LACB 3GWLA 3EFOA 2EPMX 2G3VA 3OWTA 2HSQA 3ABMC 3U8VA 5A6BD 5F5HA 2YRFA 4DRHB 2WL8A 3DXJF 3O55A 3N0TA 4CDAA 1LKXA 2DGJA 1Y6DA 1O3UA 1SMYF 5D92A 2NUTB 1LIHA 4U5HA 3ZTMA 3ASOC 4XPXA 4NQFA 4OIQF 3V5XA 3WAQA 2P7VA 3L0IA 5DLJA 2AVKA 2PFDA 3WG7C 1VOMA 1V4AA 1MNDA 3G4XA 1JPNA 2YL7A 2GA0A 3EGXB 3O10A 1I4ZA 1NFOA 5B3SC 1N1CA 5KYUB 1OW7A 2A0BA 3ABLC 4PR9A 2XLDA 3MLGA 4OD4A 4E7ZA 3DZAA 3IQTA 4G7ZF 2WZGA 2IXOA 3RKOF 4BJ6C 3QVYA 4XPYA 5EK0A 3AG4C 2GWWA 3QMKA 3EH1A 3AJMA 4MVMA 1VB5A 4C7OB 2QUPA 3Q7LA 4HFKB 4HEAJ 4YT2A 2O9XA 2NUPB 3S27A 1JR8A 1K40A 1Z5ZA 3K1IA 3JSZA 4DOZA 2W45A 2HSBA 3TQOA 4Z9HA 4EWCA 2R05A 1D1BA 3RQEA 4NTFA 1B68A 1LE2A 1HW2A 3N24A 2IYLD 3UGPA 1BDJB 1TWGA 2AWYA 3RQGA 3SYNA 1NG1A 1FMVA 3EHMA 3Q7GA 1ZHZA 3CQZA 2AWCA 2EPOA 2NPUA 2QE9A 2XRHA 1HE9A 2WVOA 3ZIBA 4EBJA 2PX0A 3RH3A 4N6CA 5JSLA 1LPEA 4QI0A 5COMA 3QTHA 1NU7D 3HNJA 3UMIA 3KYJA 3W2VA 2CGEA 1Q0FA 4DBQA 5BQIA 1XZQA 4W8KA 3SXYA 3B71A 3U3FA 1WATA 2J46A 3DKAA 4AE4B 1H9TA 4JKVA 4MW3A 2IOQA 1HE1A 4N06A 1PV3A 4OD5A 1G5ZA 2EIJC 4M63A 3ZSUA 4BJTA 3GWNA 1SF8A 1H6GA 3AGUA 4AL0A 1L3PA 1E84A 1GM5A 1JRAA 4LDRA 1SYQA 4MVQA 4XTKA 2L6FA 3LNRA 3U0CA 2KC3A 3C18A 3DAGA 4U9DA 4U5EE 2I15A 3R7CA 2C03A 1CGNA 2XL4A 4IRUA 4XWJA 3T6GB 1C02A 1D0ZA 4E18A 3O39A 3L1MA 1W2WA 3DE9A 3IQ5A 2KGOA 4MVZA 1ZU5A 3LESA 2ZD9A 4KNVA 3RVZA 4YT5A 4BG0A 2XXAB 3JCUQ 4C3BA 1D0XA 2Z15A 2R9RB 4WJ0A 1LM3B 1QSPA 3KL4A 3MX3A 4J7YA 3SXZA 2E87A 3C8GB 4J32B 3NMJA 3TOLA 4D4NA 4D4XA 1CPQA 1RKEA 4NCQA 4PJNA 3I4UA 3HTKC 4DRJB 4MS2A 1WWPA 2F22A 2CYDA 2PF4E 2UUHA 4JTDB 4BEMJ 1V74B 1YAUO 4CDVA 4JEAA 3DE8A 2Y3BA 5B3IA 5JS5A 1BR1A 1TQGA 3M4BA 3K33A 4PJMA 5JRAA 4JURI 3FDQA 2J9BA 4JCZA 4JTCB 4ZLCA 3T6JA 2MHRA 3DI5A 3UMKA 2WVQA 2XM4A 1HMDA 1L7CA 1SR2A 4Z9IA 3ZVRA 1I5NA 4P9FA 1OKKA 1ZU4A 1FFHA 1V54C 2J9WA 1MNEA 3A9CA 4ONSA 2ZXPA 4I44A 3NRHA 2WZLA 2R7UA 2Q4FA 1F1MA 3PMRA 2BL2A 2A6EF 2A0UA 4JRZA 4G78A 5COGA 3RVYA 4PK4A 3HNKA 3K1HA 3RW0A 1S05A 2XLOA 2R7QA 4L6RA 5E3AA 2YWAA 2H7VC 2VCBA 4JJFA 4EUKB 1TWCA 2XSEA 1UG7A 3T9OA 4A2NB 5AC4A 2LIGA 3EGDA 3UMHA 3Q6MA 2W4MA 2AP3A 3AG2C 1PD1A 3FAPB 3G50A 4I1OB 4YT8A 4Q7CA 1D1AA 4RDAA 5KYNA 4C3EA 2I8BA 4KI2A 2EPNA 1I4YA 3SXMA 2Q00A 3UR3C 1UFBA 4DRIB 1A0BA 1NSGB 2YZSA 1AVOB 1S7ZA 4E0IA 3W8HA 4U5GA 2YKZA 3LS0A 3NMIA 4XLPF 1H9GA 5JVEA 5KYWB 2YEVA 2CDQA 2RD9A 4LDQA 1K05A 4XLNF 4FESA 3DD7A 3K1IC 4DBRA 1NZEA 3FVYA 5A69A 1M2OA 1T01A 2R7SA 5F28E 2CNWD 3EZIA 1M2VA 1Q0KA 3JZ0A 2IXPA 3SXKA 1ZW3A 3KKBA 3M4CA 5L0IA 4CS9A 1LI5A 4ULVA 3U2MA 2AU5A 2MYSA 3C62A 1QPUA 3T4RA 4PFPA 2YLDA 2LP4A 3S28A 1A41A 4KBLA 5E3CA 1LS4A 2XM0A 3B9QA 3NYLA 1YA7O 5D91A 3SNHA 3BEHA 3K7DA 3U9MA 1RJ9B 1KU2A 3F47A 2ZXWC 5A6BA 2LQGA 3QVZA 4IJJA 3ZTZA 2NSGA 2V26A 1KNYA 1WOLA 3LEVA 4MVRA 2IBFA 1CPRA 4CIPA 4R32A 2OU6A 1O5HA 4AL1A 2VCAA 1TKNA 1J8YF 2DYSC 1OCCC 4NY3A 5GPGB 2CNWA 3EFOB 3JRTA 5DQZA 2OG2A 1QZXA 4IB4A 2YL1A 2C04A 4PJJA 5A6AA 5KYYA 2Q9BA 3H2UA 3MYIA 4K7BA 5B1AC 4UDVA 2PX3A 3IQCA 4LLCA 5JLIA 1M56C 3NDBB 4JE9A 4GQHA 4AX2A 4PFOA 4MQ9F 2A6HF 2XLWA 2L81A 3L8JA 3SEOA 5KYXA 5E2QA 1VLSA 3RQFA 3Q6NA 4YK5A 2VASA 3EJNA 2TMVP 4KC9A 3H2VA 1BR4A 3IQ6A 3M1CB 4NC3A 3OEOA 3L34A 4ULWA 2Q9CA 4CIHA 3HNIA 3IEEA 4PJLA 3C8GD 1O87A 4OIRF 3TJ6A 2DI3A 2VCCA 2YQYA 1ORJA 1RXQA 1EI7A 5HSWA 5EGYA 5FCLA 5BQGA 4JEBA 4YJWA 4G0HA 2QNLA 4JCHA 2EIKC 3SZRA 2W9YA 2P61A 3I5QA 1G8XA 3AG3C 3ATPA 2LFDA 3A11A 3U2LA 2XXAA 2KYHA 4B6IA 3N2ZB 1HMOA 256BA 1T6IA 2HKVA 5B1BC 1RMVA 2Y3GA 2IM8A 5E33A 2LD6A 4U5DE 1BBHA 2D4UA 2WZFA 2R7XA 3IHUA 1MMDA 2CCYA 2Y3HA 3B0VC 3LJBA 3EG9A 3JT1A 2KSFA 2YL0A 2OJQA 5TJ5E 3FAJA 3FMSA 2GDCA 1QLEC 2LSEA 4GEHA 2EPKX 2R7VA 1ZHXA 5L3VA 3KH2A 3F46A 1DOWA 1JAFA 1WASA 3C63A 3KMIA 3US6A 1WGWA 3X1OA 4RD9A 2J7PD 2HMZA 2P6VA 1D0YA 2L6GA 2OKUA 2R7WA 4W8PA 1EA8A 2Q9AA 3RIPA 3CZ6A 2J0XA 4I3MA 2OJED 3DM9B 3QW0A 4CS8A 4E0HA 5L0DA 2NSFA 4LLEA 2QLAA 3PHF2 2LK4A 3GEIA 2VC9A 4AK9A 2VB6A 3QW1A 2W4BA 4P6IC 3RF3A 4CSAA 2HJ3A 3DWWA 3LNMB 1NU9C 1MMAA 4YWQA 3TULA 3L8IA 3JRMO 4JC7A 1G4US 5CI9A 3TK0A 3UNGC 1YZAA 3E70C 2J45A 1LE4A 2KW3C 2YVKA 1FTSA 3U9JA 1YYJA 1H7IA 1YZCA 1Z23A 1Z6AA 4ANJA 2LFFA 2HMQA 2R7OA 2Y69C 3GANA 1A7EA 2FFHA 3NYJA 1CGOA 1K04A 4HE8D 1FNTc 3DMDA 2V3CC 4EBKA 2G3KA 2CW0F 3B0PA 3ZQVA 1VTMP 4OINF 4PACA 2ICWG 4XEKA 4E17A 1NBBA 4CJGA 4Q5SF 3PDMP 4O6MA 3C7JA 1TWAA 4BJ1A 3JTLO 3VRCA 5JUAA 4WABA 4WGYA 4CS9C 3KPHA 3LLIA 1GS9A 5DVWA 1RKEB 2J0WA 5EHHA 1E83A 3FHDA 1OCZC 1QKRA 2EPLX 1C17M 1T6QA 5T1DB 4Z9JA 1VK5A 2HFIA 2XL8A 3M79A 1Z63A 2BE5F 4MW8A 1PD0A 4CJOA 2PP4A 3AGTA 1YARO 2NUTA 1R4TA 3GM3A 1A7VA 2M4EA 3ZDLA 4EIYA 3LUTB 4JJGA 1YA9A 1R5ID 4IAQA 4K0DA 2P1AA 1ZHYA 2QTVA 3FOOA 1M6TA 2OEVA 5DQTA 3MBGA 1VMAA 1APCA 1FFTC 2ZXRA 3EGXA 5AGFA 5KYUA 4O6NA 1XZPA 5IY5C 2R02A 1RJ9A 2ZXOA 3GM2A 5DS5A 3RYLA 1OR3A 2OEXA 4EHPA 4CBEA 1VYIA 4N6HA 1OR2A 4G7HF 2JPUA 3W4YA 4QI2A 5JP7A 1LI7A 1JPJA 3EPVA 1MQVA 3AG1C 4IGGA 3EGDB 4C7OA 4MTGA 4CS7A 1TWHA 2NUPA 2R7TA 3B0UX 1D1CA 2L6HA 1OXKA 2OOCA 2H7BA 1VYKA 2J9UA 3CEXA 1FAPB 1Q0MA 1YJGA 4K1OA 3V5YA 1BZ4A 5A6JA 2YLGA 4JTAB 4XQ1A 4BJ5A 5L0JA 3DAFA 4YL0A 5COFA 5F5FA 2DB4A 3MFNA 3NMKA 4EKWA 4U5BE 2MWQA 3NYMA 1HY5A 4ER9A 4JIOA 3HKKA 1J8MF 1TFOB 2XLEA 3AOUA 3S29A 1Y4CA 2BC5A 4NTBA 4O79A 2VH3A 3VAYA 1HW1A 1Q0GA 2WB7A 4YN0B 1M2VB 4HFFB 3JYYA 4DVZA 3GEHA 4AE4A 1YLMA 2PBEA 1NFNA 5JT4A 1CGME 1FMWA 1XWJA 2Y3DA 3DJNB 4XEFA 1EQ1A 4H4KC 4DXWA 2H8AA 1ZHWA 3PCVA 5L0GA 1RCPA 2JX0A 3LAYA 4O7GA 2A68F 1IW7F 2RSEB 3LS1A 1EKYA 2IXNA 3UGOA 5DS4A 4JZAA 1ORYA 4CDYA 3M15A 2JD3A 3B29A 4FAPB 1U6HA 4MTOA 1LVKA 1OCRC 3ABKC 5BQHA 3ZG1A 1OXBA 3BRJA 2H7OA 4CS8C 2J9VA 1DOVA 1M57C 2R25A 4MTFA 3NKDA 3VM6A 5CI8A 4OIOF 1E2XA 1TR2A 4BPMA 1QQ3A 4MNDA 5KYYB 4CSAC 4G7OF 1TFKB 1Z3IX 1AUEA 4FX5A 3JSEO 4CX9A 3QZCA 1NLXA 2A69F 2FGYA 3C8GA 2HZ8A 3RFYA 2YHSA 3IPMO 3ITFA 3W8IA 5L0CA 4BJ6A 3CAXA 4C3DA 3S90A 2ZPAA 5KYXB 3FOPA 3EQLF 3TJ5A 3G4ZA 2XS8A 3R2PA 3POVA 3TD7A 1VLTA 2A1DD 2KNHA 3EHNA 1OCOC 4GYTA 4X0RA 4DJ9A 3LLKA 1KTMA 3HJCA 5K0IA 4Q4ZF 1MMNA 3MYFA 1YYXA 2Q3TA 3SP1A 1GQAA 1V55C 3WHNA 3AQCA 2KK1A 4MVSA 3T6BA 5L0FA 1U89A 3U3BA 2WVNA 4BEJA 3S0XA 1IZMA 2FAPB 2Y39A 2LCHA 3K66A 5L0HA 1OW8A 5BUOA 2M64A 3HNLA 2J8WA 2UUIA 4E7SA 4XPWA 3JYHA 4OIPF 1LS1A 2PNOA 3J06A 2L9JA 1ZW2A 3GEEA 2GFHA 1SZIA 2HV6A 2D5RB 1T6UA 4O6YA 2XLVA 1ORSC 5CIVA 3NG1A 2EINC 4WGZA 1GGQA 3X2QC 2NG1A 1BR2A 3EZHA 5T3WA 4U5CE 2IXMA 2J7PA 1OKKD 2OCCC 3EG9B 3KYIA 4IARA 4MVUA 4MVOA 3GM1A 1ST6A 5FZTA 3EH2A 3O6XA 3OA1A 2QY9A 3C8ZA 4YT4A 4YL1A 1JOGA 1Q0DA 1WTYA 1A7DA 3K6BA 3LEOA 4J30B 2HUJA 2Q7RA 4DVYP 4XEVA 1MMGA 2EILC 2HS5A 4NTAA 2KJGA 1Z7Qc 4F4BA 3I5PA 4YL3A 1JMWA 2R7RA 1OQCA 1RKCA 3E9VA
chains in the Genus database with same CATH topology
5L3QA 4I1MA 3AQBA 4KNWA 3DJUB 3NKEA 2B0JA 2EIMC 2X51A 3ZC4A 5KYWA 4ZLDA 3VYWA 2DYRC 3CSKA 2KQ9A 4FWVA 4LERA 3HLZA 4JVSA 1ZHTA 3ASNC 4BJ5C 4IWBA 4RBNA 2HV7A 2G62A 3DM5A 1ZYRF 3ECSA 4JW1A 3W2WA 3WODF 4QDLA 3H65A 3V7OA 5DS6A 4U5FE 4EBBA 1PCXA 3GODA 5T3TA 4IAOA 4LACB 3EFOA 3OWTA 2G3VA 3ABMC 5F5HA 2WL8A 3DXJF 3N0TA 1LKXA 2DGJA 1SMYF 5D92A 2NUTB 4U5HA 4OIQF 3ASOC 2P7VA 3L0IA 5DLJA 3WG7C 2PFDA 1VOMA 1MNDA 1JPNA 3EGXB 5B3SC 1N1CA 5KYUB 3ABLC 3MLGA 4OD4A 4E7ZA 3DZAA 4G7ZF 2WZGA 2IXOA 3RKOF 4BJ6C 3AG4C 3QMKA 3EH1A 4C7OB 3Q7LA 4HFKB 4HEAJ 4YT2A 2O9XA 2NUPB 3S27A 4DOZA 1Z5ZA 3JSZA 2W45A 4EWCA 1D1BA 3N24A 2IYLD 3UGPA 1TWGA 3SYNA 1NG1A 1FMVA 3EHMA 3Q7GA 1ZHZA 3CQZA 2XRHA 2WVOA 3ZIBA 2PX0A 3RH3A 4QI0A 1NU7D 3UMIA 3W2VA 2CGEA 4DBQA 4W8KA 2J46A 4AE4B 2IOQA 4N06A 4OD5A 2EIJC 4M63A 3ZSUA 4BJTA 1SF8A 4XTKA 3LNRA 3DAGA 4U5EE 2C03A 2XL4A 4IRUA 4XWJA 1D0ZA 3O39A 1W2WA 2KGOA 1ZU5A 3LESA 4KNVA 4YT5A 4BG0A 2XXAB 3JCUQ 4C3BA 1D0XA 2Z15A 4WJ0A 3MX3A 3KL4A 2E87A 4J32B 4PJNA 3I4UA 3HTKC 2PF4E 2Y3BA 1BR1A 3K33A 4PJMA 4JURI 3FDQA 4ZLCA 3T6JA 3UMKA 2WVQA 3ZVRA 1OKKA 1ZU4A 1FFHA 1V54C 2J9WA 1MNEA 2ZXPA 4I44A 3NRHA 2WZLA 2R7UA 3PMRA 2A6EF 4PK4A 3K1HA 2R7QA 5E3AA 2H7VC 4JJFA 1TWCA 2XSEA 4A2NB 3EGDA 3UMHA 3Q6MA 2W4MA 3AG2C 1PD1A 4I1OB 4YT8A 4Q7CA 1D1AA 4RDAA 5KYNA 4C3EA 2I8BA 4KI2A 3UR3C 2YZSA 1S7ZA 3W8HA 4U5GA 3LS0A 4XLPF 5KYWB 2CDQA 4XLNF 4FESA 3DD7A 3K1IC 4DBRA 1NZEA 3FVYA 1M2OA 2R7SA 2CNWD 3EZIA 1M2VA 2IXPA 3KKBA 4CS9A 2MYSA 3T4RA 4PFPA 3S28A 4KBLA 5E3CA 5D91A 3B9QA 3NYLA 3SNHA 3K7DA 1RJ9B 1KU2A 3F47A 2ZXWC 4IJJA 2V26A 3LEVA 1O5HA 4NY3A 1TKNA 1J8YF 2DYSC 1OCCC 2CNWA 3EFOB 3JRTA 5DQZA 2OG2A 1QZXA 5KYYA 2C04A 4PJJA 2Q9BA 5B1AC 4K7BA 2PX3A 4LLCA 3NDBB 1M56C 4AX2A 4PFOA 4MQ9F 2A6HF 3SEOA 2L81A 5KYXA 5E2QA 3Q6NA 2VASA 3EJNA 4KC9A 3M1CB 1BR4A 3OEOA 3L34A 4ULWA 2Q9CA 4CIHA 3IEEA 4PJLA 4OIRF 1O87A 5HSWA 5EGYA 5FCLA 4YJWA 4G0HA 4JCHA 2EIKC 3SZRA 2W9YA 3I5QA 1G8XA 3AG3C 2XXAA 4B6IA 3N2ZB 5B1BC 2Y3GA 5E33A 4U5DE 2WZFA 2R7XA 1MMDA 2Y3HA 3B0VC 3LJBA 3EG9A 3JT1A 3FAJA 2LSEA 1QLEC 4GEHA 2R7VA 1ZHXA 5L3VA 3KH2A 3F46A 3KMIA 3X1OA 1WGWA 4RD9A 2J7PD 2P6VA 1D0YA 2R7WA 3RIPA 2Q9AA 3CZ6A 2J0XA 4I3MA 3DM9B 4CS8A 3PHF2 4LLEA 4AK9A 2VB6A 4CSAA 2W4BA 4P6IC 1NU9C 1MMAA 4YWQA 5CI9A 3UNGC 3E70C 2J45A 2KW3C 1FTSA 1Z23A 1Z6AA 4ANJA 2R7OA 2Y69C 3GANA 2FFHA 3NYJA 4HE8D 3DMDA 2V3CC 2G3KA 2CW0F 3B0PA 4OINF 4Q5SF 4O6MA 4BJ1A 1TWAA 4CS9C 3LLIA 5DVWA 2J0WA 5EHHA 3FHDA 1OCZC 5T1DB 1VK5A 1Z63A 2BE5F 1PD0A 2PP4A 2NUTA 2M4EA 4JJGA 4K0DA 1ZHYA 2QTVA 5DQTA 1VMAA 1FFTC 2ZXRA 3EGXA 5KYUA 4O6NA 5IY5C 1RJ9A 2ZXOA 5DS5A 3RYLA 4CBEA 1VYIA 4G7HF 4QI2A 1JPJA 3EPVA 3AG1C 3EGDB 4C7OA 4CS7A 1TWHA 2NUPA 2R7TA 3B0UX 1D1CA 2H7BA 1VYKA 2J9UA 4BJ5A 3DAFA 5F5FA 4U5BE 2MWQA 3NYMA 1J8MF 3S29A 4O79A 2VH3A 3VAYA 2WB7A 4YN0B 1M2VB 4HFFB 4DVZA 4AE4A 1FMWA 2Y3DA 3DJNB 4H4KC 1ZHWA 3LAYA 4O7GA 2A68F 1IW7F 3LS1A 2IXNA 3UGOA 5DS4A 4JZAA 2JD3A 1LVKA 1OCRC 3ABKC 3ZG1A 2H7OA 4CS8C 2J9VA 1M57C 3NKDA 5CI8A 4OIOF 1TR2A 5KYYB 4CSAC 4MNDA 4G7OF 1Z3IX 4FX5A 3QZCA 2A69F 2FGYA 3W8IA 3RFYA 2R7RA 2YHSA 3ITFA 4BJ6A 4C3DA 2ZPAA 5KYXB 3EQLF 3POVA 3TD7A 2KNHA 2A1DD 3EHNA 4GYTA 1OCOC 4X0RA 3LLKA 3HJCA 4Q4ZF 1MMNA 2Q3TA 3SP1A 1V55C 3AQCA 3T6BA 2WVNA 4BEJA 3S0XA 1IZMA 2Y39A 3K66A 5BUOA 4E7SA 3JYHA 4OIPF 1LS1A 2L9JA 2GFHA 1SZIA 2HV6A 2D5RB 4O6YA 3NG1A 2EINC 3X2QC 2NG1A 1BR2A 3EZHA 5T3WA 4U5CE 2IXMA 2J7PA 3EG9B 1OKKD 2OCCC 1ST6A 3EH2A 3O6XA 3OA1A 2QY9A 4YT4A 3K6BA 4J30B 4DVYP 1MMGA 2EILC 2KJGA 4F4BA 3I5PA 2YEVA 3E9VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A2N B; 
#chains in the Genus database with same CATH topology
 5L3Q A;  4I1M A;  1T5O A;  1ZZP A;  3AQB A;  4KNW A;  1E85 A;  3DJU B;  1WN0 A;  3NKE A;  2B0J A;  2EIM C;  2HJM A;  2X51 A;  1AEP A;  4H54 A;  4U9E A;  4N4W A;  2OQM A;  4P9T A;  3ZC4 A;  5KYW A;  4ZLD A;  3VYW A;  2DYR C;  2XLH A;  3CSK A;  5AC5 A;  2R03 A;  2X0C A;  1QVX A;  2KQ9 A;  4J7T A;  1YDI A;  2XS1 A;  4FWV A;  3TOM A;  4LER A;  1FR0 A;  1C03 A;  3S84 A;  3HLZ A;  4JVS A;  1ZHT A;  2P0N A;  3ASN C;  4BJ5 C;  4IWB A;  2GAQ A;  4RBN A;  2HV7 A;  3U5S A;  4A4A A;  2YL3 A;  2XLM A;  3GOR A;  1ZVZ A;  5HV9 A;  2G62 A;  2XL6 A;  3DM5 A;  1ZYR F;  5A6K A;  1T9K A;  3ECS A;  3ZWI A;  4JW1 A;  3ZQY A;  3U8P A;  3W2W A;  2ETS A;  3WOD F;  1OW6 A;  4QDL A;  1U0B B;  3H65 A;  1YVI A;  3V7O A;  3V5Z A;  2L7A A;  5DS6 A;  3FXH A;  2YLI A;  4U5F E;  3VF0 A;  4LDK A;  2ASR A;  1PCX A;  3GOD A;  4EBB A;  1E86 A;  1G4W R;  2B0H A;  5T3T A;  4IAO A;  3S9O A;  4LAC B;  3GWL A;  3EFO A;  2EPM X;  2G3V A;  3OWT A;  2HSQ A;  3ABM C;  3U8V A;  5A6B D;  5F5H A;  2YRF A;  4DRH B;  2WL8 A;  3DXJ F;  3O55 A;  3N0T A;  4CDA A;  1LKX A;  2DGJ A;  1Y6D A;  1O3U A;  1SMY F;  5D92 A;  2NUT B;  1LIH A;  4U5H A;  3ZTM A;  3ASO C;  4XPX A;  4NQF A;  4OIQ F;  3V5X A;  3WAQ A;  2P7V A;  3L0I A;  5DLJ A;  2AVK A;  2PFD A;  3WG7 C;  1VOM A;  1V4A A;  1MND A;  3G4X A;  1JPN A;  2YL7 A;  2GA0 A;  3EGX B;  3O10 A;  1I4Z A;  1NFO A;  5B3S C;  1N1C A;  5KYU B;  1OW7 A;  2A0B A;  3ABL C;  4PR9 A;  2XLD A;  3MLG A;  4OD4 A;  4E7Z A;  3DZA A;  3IQT A;  4G7Z F;  2WZG A;  2IXO A;  3RKO F;  4BJ6 C;  3QVY A;  4XPY A;  5EK0 A;  3AG4 C;  2GWW A;  3QMK A;  3EH1 A;  3AJM A;  4MVM A;  1VB5 A;  4C7O B;  2QUP A;  3Q7L A;  4HFK B;  4HEA J;  4YT2 A;  2O9X A;  2NUP B;  3S27 A;  1JR8 A;  1K40 A;  1Z5Z A;  3K1I A;  3JSZ A;  4DOZ A;  2W45 A;  2HSB A;  3TQO A;  4Z9H A;  4EWC A;  2R05 A;  1D1B A;  3RQE A;  4NTF A;  1B68 A;  1LE2 A;  1HW2 A;  3N24 A;  2IYL D;  3UGP A;  1BDJ B;  1TWG A;  2AWY A;  3RQG A;  3SYN A;  1NG1 A;  1FMV A;  3EHM A;  3Q7G A;  1ZHZ A;  3CQZ A;  2AWC A;  2EPO A;  2NPU A;  2QE9 A;  2XRH A;  1HE9 A;  2WVO A;  3ZIB A;  4EBJ A;  2PX0 A;  3RH3 A;  4N6C A;  5JSL A;  1LPE A;  4QI0 A;  5COM A;  3QTH A;  1NU7 D;  3HNJ A;  3UMI A;  3KYJ A;  3W2V A;  2CGE A;  1Q0F A;  4DBQ A;  5BQI A;  1XZQ A;  4W8K A;  3SXY A;  3B71 A;  3U3F A;  1WAT A;  2J46 A;  3DKA A;  4AE4 B;  1H9T A;  4JKV A;  4MW3 A;  2IOQ A;  1HE1 A;  4N06 A;  1PV3 A;  4OD5 A;  1G5Z A;  2EIJ C;  4M63 A;  3ZSU A;  4BJT A;  3GWN A;  1SF8 A;  1H6G A;  3AGU A;  4AL0 A;  1L3P A;  1E84 A;  1GM5 A;  1JRA A;  4LDR A;  1SYQ A;  4MVQ A;  4XTK A;  2L6F A;  3LNR A;  3U0C A;  2KC3 A;  3C18 A;  3DAG A;  4U9D A;  4U5E E;  2I15 A;  3R7C A;  2C03 A;  1CGN A;  2XL4 A;  4IRU A;  4XWJ A;  3T6G B;  1C02 A;  1D0Z A;  4E18 A;  3O39 A;  3L1M A;  1W2W A;  3DE9 A;  3IQ5 A;  2KGO A;  4MVZ A;  1ZU5 A;  3LES A;  2ZD9 A;  4KNV A;  3RVZ A;  4YT5 A;  4BG0 A;  2XXA B;  3JCU Q;  4C3B A;  1D0X A;  2Z15 A;  2R9R B;  4WJ0 A;  1LM3 B;  1QSP A;  3KL4 A;  3MX3 A;  4J7Y A;  3SXZ A;  2E87 A;  3C8G B;  4J32 B;  3NMJ A;  3TOL A;  4D4N A;  4D4X A;  1CPQ A;  1RKE A;  4NCQ A;  4PJN A;  3I4U A;  3HTK C;  4DRJ B;  4MS2 A;  1WWP A;  2F22 A;  2CYD A;  2PF4 E;  2UUH A;  4JTD B;  4BEM J;  1V74 B;  1YAU O;  4CDV A;  4JEA A;  3DE8 A;  2Y3B A;  5B3I A;  5JS5 A;  1BR1 A;  1TQG A;  3M4B A;  3K33 A;  4PJM A;  5JRA A;  4JUR I;  3FDQ A;  2J9B A;  4JCZ A;  4JTC B;  4ZLC A;  3T6J A;  2MHR A;  3DI5 A;  3UMK A;  2WVQ A;  2XM4 A;  1HMD A;  1L7C A;  1SR2 A;  4Z9I A;  3ZVR A;  1I5N A;  4P9F A;  1OKK A;  1ZU4 A;  1FFH A;  1V54 C;  2J9W A;  1MNE A;  3A9C A;  4ONS A;  2ZXP A;  4I44 A;  3NRH A;  2WZL A;  2R7U A;  2Q4F A;  1F1M A;  3PMR A;  2BL2 A;  2A6E F;  2A0U A;  4JRZ A;  4G78 A;  5COG A;  3RVY A;  4PK4 A;  3HNK A;  3K1H A;  3RW0 A;  1S05 A;  2XLO A;  2R7Q A;  4L6R A;  5E3A A;  2YWA A;  2H7V C;  2VCB A;  4JJF A;  4EUK B;  1TWC A;  2XSE A;  1UG7 A;  3T9O A;  4A2N B;  5AC4 A;  2LIG A;  3EGD A;  3UMH A;  3Q6M A;  2W4M A;  2AP3 A;  3AG2 C;  1PD1 A;  3FAP B;  3G50 A;  4I1O B;  4YT8 A;  4Q7C A;  1D1A A;  4RDA A;  5KYN A;  4C3E A;  2I8B A;  4KI2 A;  2EPN A;  1I4Y A;  3SXM A;  2Q00 A;  3UR3 C;  1UFB A;  4DRI B;  1A0B A;  1NSG B;  2YZS A;  1AVO B;  1S7Z A;  4E0I A;  3W8H A;  4U5G A;  2YKZ A;  3LS0 A;  3NMI A;  4XLP F;  1H9G A;  5JVE A;  5KYW B;  2YEV A;  2CDQ A;  2RD9 A;  4LDQ A;  1K05 A;  4XLN F;  4FES A;  3DD7 A;  3K1I C;  4DBR A;  1NZE A;  3FVY A;  5A69 A;  1M2O A;  1T01 A;  2R7S A;  5F28 E;  2CNW D;  3EZI A;  1M2V A;  1Q0K A;  3JZ0 A;  2IXP A;  3SXK A;  1ZW3 A;  3KKB A;  3M4C A;  5L0I A;  4CS9 A;  1LI5 A;  4ULV A;  3U2M A;  2AU5 A;  2MYS A;  3C62 A;  1QPU A;  3T4R A;  4PFP A;  2YLD A;  2LP4 A;  3S28 A;  1A41 A;  4KBL A;  5E3C A;  1LS4 A;  2XM0 A;  3B9Q A;  3NYL A;  1YA7 O;  5D91 A;  3SNH A;  3BEH A;  3K7D A;  3U9M A;  1RJ9 B;  1KU2 A;  3F47 A;  2ZXW C;  5A6B A;  2LQG A;  3QVZ A;  4IJJ A;  3ZTZ A;  2NSG A;  2V26 A;  1KNY A;  1WOL A;  3LEV A;  4MVR A;  2IBF A;  1CPR A;  4CIP A;  4R32 A;  2OU6 A;  1O5H A;  4AL1 A;  2VCA A;  1TKN A;  1J8Y F;  2DYS C;  1OCC C;  4NY3 A;  5GPG B;  2CNW A;  3EFO B;  3JRT A;  5DQZ A;  2OG2 A;  1QZX A;  4IB4 A;  2YL1 A;  2C04 A;  4PJJ A;  5A6A A;  5KYY A;  2Q9B A;  3H2U A;  3MYI A;  4K7B A;  5B1A C;  4UDV A;  2PX3 A;  3IQC A;  4LLC A;  5JLI A;  1M56 C;  3NDB B;  4JE9 A;  4GQH A;  4AX2 A;  4PFO A;  4MQ9 F;  2A6H F;  2XLW A;  2L81 A;  3L8J A;  3SEO A;  5KYX A;  5E2Q A;  1VLS A;  3RQF A;  3Q6N A;  4YK5 A;  2VAS A;  3EJN A;  2TMV P;  4KC9 A;  3H2V A;  1BR4 A;  3IQ6 A;  3M1C B;  4NC3 A;  3OEO A;  3L34 A;  4ULW A;  2Q9C A;  4CIH A;  3HNI A;  3IEE A;  4PJL A;  3C8G D;  1O87 A;  4OIR F;  3TJ6 A;  2DI3 A;  2VCC A;  2YQY A;  1ORJ A;  1RXQ A;  1EI7 A;  5HSW A;  5EGY A;  5FCL A;  5BQG A;  4JEB A;  4YJW A;  4G0H A;  2QNL A;  4JCH A;  2EIK C;  3SZR A;  2W9Y A;  2P61 A;  3I5Q A;  1G8X A;  3AG3 C;  3ATP A;  2LFD A;  3A11 A;  3U2L A;  2XXA A;  2KYH A;  4B6I A;  3N2Z B;  1HMO A;  256B A;  1T6I A;  2HKV A;  5B1B C;  1RMV A;  2Y3G A;  2IM8 A;  5E33 A;  2LD6 A;  4U5D E;  1BBH A;  2D4U A;  2WZF A;  2R7X A;  3IHU A;  1MMD A;  2CCY A;  2Y3H A;  3B0V C;  3LJB A;  3EG9 A;  3JT1 A;  2KSF A;  2YL0 A;  2OJQ A;  5TJ5 E;  3FAJ A;  3FMS A;  2GDC A;  1QLE C;  2LSE A;  4GEH A;  2EPK X;  2R7V A;  1ZHX A;  5L3V A;  3KH2 A;  3F46 A;  1DOW A;  1JAF A;  1WAS A;  3C63 A;  3KMI A;  3US6 A;  1WGW A;  3X1O A;  4RD9 A;  2J7P D;  2HMZ A;  2P6V A;  1D0Y A;  2L6G A;  2OKU A;  2R7W A;  4W8P A;  1EA8 A;  2Q9A A;  3RIP A;  3CZ6 A;  2J0X A;  4I3M A;  2OJE D;  3DM9 B;  3QW0 A;  4CS8 A;  4E0H A;  5L0D A;  2NSF A;  4LLE A;  2QLA A;  3PHF 2;  2LK4 A;  3GEI A;  2VC9 A;  4AK9 A;  2VB6 A;  3QW1 A;  2W4B A;  4P6I C;  3RF3 A;  4CSA A;  2HJ3 A;  3DWW A;  3LNM B;  1NU9 C;  1MMA A;  4YWQ A;  3TUL A;  3L8I A;  3JRM O;  4JC7 A;  1G4U S;  5CI9 A;  3TK0 A;  3UNG C;  1YZA A;  3E70 C;  2J45 A;  1LE4 A;  2KW3 C;  2YVK A;  1FTS A;  3U9J A;  1YYJ A;  1H7I A;  1YZC A;  1Z23 A;  1Z6A A;  4ANJ A;  2LFF A;  2HMQ A;  2R7O A;  2Y69 C;  3GAN A;  1A7E A;  2FFH A;  3NYJ A;  1CGO A;  1K04 A;  4HE8 D;  1FNT c;  3DMD A;  2V3C C;  4EBK A;  2G3K A;  2CW0 F;  3B0P A;  3ZQV A;  1VTM P;  4OIN F;  4PAC A;  2ICW G;  4XEK A;  4E17 A;  1NBB A;  4CJG A;  4Q5S F;  3PDM P;  4O6M A;  3C7J A;  1TWA A;  4BJ1 A;  3JTL O;  3VRC A;  5JUA A;  4WAB A;  4WGY A;  4CS9 C;  3KPH A;  3LLI A;  1GS9 A;  5DVW A;  1RKE B;  2J0W A;  5EHH A;  1E83 A;  3FHD A;  1OCZ C;  1QKR A;  2EPL X;  1C17 M;  1T6Q A;  5T1D B;  4Z9J A;  1VK5 A;  2HFI A;  2XL8 A;  3M79 A;  1Z63 A;  2BE5 F;  4MW8 A;  1PD0 A;  4CJO A;  2PP4 A;  3AGT A;  1YAR O;  2NUT A;  1R4T A;  3GM3 A;  1A7V A;  2M4E A;  3ZDL A;  4EIY A;  3LUT B;  4JJG A;  1YA9 A;  1R5I D;  4IAQ A;  4K0D A;  2P1A A;  1ZHY A;  2QTV A;  3FOO A;  1M6T A;  2OEV A;  5DQT A;  3MBG A;  1VMA A;  1APC A;  1FFT C;  2ZXR A;  3EGX A;  5AGF A;  5KYU A;  4O6N A;  1XZP A;  5IY5 C;  2R02 A;  1RJ9 A;  2ZXO A;  3GM2 A;  5DS5 A;  3RYL A;  1OR3 A;  2OEX A;  4EHP A;  4CBE A;  1VYI A;  4N6H A;  1OR2 A;  4G7H F;  2JPU A;  3W4Y A;  4QI2 A;  5JP7 A;  1LI7 A;  1JPJ A;  3EPV A;  1MQV A;  3AG1 C;  4IGG A;  3EGD B;  4C7O A;  4MTG A;  4CS7 A;  1TWH A;  2NUP A;  2R7T A;  3B0U X;  1D1C A;  2L6H A;  1OXK A;  2OOC A;  2H7B A;  1VYK A;  2J9U A;  3CEX A;  1FAP B;  1Q0M A;  1YJG A;  4K1O A;  3V5Y A;  1BZ4 A;  5A6J A;  2YLG A;  4JTA B;  4XQ1 A;  4BJ5 A;  5L0J A;  3DAF A;  4YL0 A;  5COF A;  5F5F A;  2DB4 A;  3MFN A;  3NMK A;  4EKW A;  4U5B E;  2MWQ A;  3NYM A;  1HY5 A;  4ER9 A;  4JIO A;  3HKK A;  1J8M F;  1TFO B;  2XLE A;  3AOU A;  3S29 A;  1Y4C A;  2BC5 A;  4NTB A;  4O79 A;  2VH3 A;  3VAY A;  1HW1 A;  1Q0G A;  2WB7 A;  4YN0 B;  1M2V B;  4HFF B;  3JYY A;  4DVZ A;  3GEH A;  4AE4 A;  1YLM A;  2PBE A;  1NFN A;  5JT4 A;  1CGM E;  1FMW A;  1XWJ A;  2Y3D A;  3DJN B;  4XEF A;  1EQ1 A;  4H4K C;  4DXW A;  2H8A A;  1ZHW A;  3PCV A;  5L0G A;  1RCP A;  2JX0 A;  3LAY A;  4O7G A;  2A68 F;  1IW7 F;  2RSE B;  3LS1 A;  1EKY A;  2IXN A;  3UGO A;  5DS4 A;  4JZA A;  1ORY A;  4CDY A;  3M15 A;  2JD3 A;  3B29 A;  4FAP B;  1U6H A;  4MTO A;  1LVK A;  1OCR C;  3ABK C;  5BQH A;  3ZG1 A;  1OXB A;  3BRJ A;  2H7O A;  4CS8 C;  2J9V A;  1DOV A;  1M57 C;  2R25 A;  4MTF A;  3NKD A;  3VM6 A;  5CI8 A;  4OIO F;  1E2X A;  1TR2 A;  4BPM A;  1QQ3 A;  4MND A;  5KYY B;  4CSA C;  4G7O F;  1TFK B;  1Z3I X;  1AUE A;  4FX5 A;  3JSE O;  4CX9 A;  3QZC A;  1NLX A;  2A69 F;  2FGY A;  3C8G A;  2HZ8 A;  3RFY A;  2YHS A;  3IPM O;  3ITF A;  3W8I A;  5L0C A;  4BJ6 A;  3CAX A;  4C3D A;  3S90 A;  2ZPA A;  5KYX B;  3FOP A;  3EQL F;  3TJ5 A;  3G4Z A;  2XS8 A;  3R2P A;  3POV A;  3TD7 A;  1VLT A;  2A1D D;  2KNH A;  3EHN A;  1OCO C;  4GYT A;  4X0R A;  4DJ9 A;  3LLK A;  1KTM A;  3HJC A;  5K0I A;  4Q4Z F;  1MMN A;  3MYF A;  1YYX A;  2Q3T A;  3SP1 A;  1GQA A;  1V55 C;  3WHN A;  3AQC A;  2KK1 A;  4MVS A;  3T6B A;  5L0F A;  1U89 A;  3U3B A;  2WVN A;  4BEJ A;  3S0X A;  1IZM A;  2FAP B;  2Y39 A;  2LCH A;  3K66 A;  5L0H A;  1OW8 A;  5BUO A;  2M64 A;  3HNL A;  2J8W A;  2UUI A;  4E7S A;  4XPW A;  3JYH A;  4OIP F;  1LS1 A;  2PNO A;  3J06 A;  2L9J A;  1ZW2 A;  3GEE A;  2GFH A;  1SZI A;  2HV6 A;  2D5R B;  1T6U A;  4O6Y A;  2XLV A;  1ORS C;  5CIV A;  3NG1 A;  2EIN C;  4WGZ A;  1GGQ A;  3X2Q C;  2NG1 A;  1BR2 A;  3EZH A;  5T3W A;  4U5C E;  2IXM A;  2J7P A;  1OKK D;  2OCC C;  3EG9 B;  3KYI A;  4IAR A;  4MVU A;  4MVO A;  3GM1 A;  1ST6 A;  5FZT A;  3EH2 A;  3O6X A;  3OA1 A;  2QY9 A;  3C8Z A;  4YT4 A;  4YL1 A;  1JOG A;  1Q0D A;  1WTY A;  1A7D A;  3K6B A;  3LEO A;  4J30 B;  2HUJ A;  2Q7R A;  4DVY P;  4XEV A;  1MMG A;  2EIL C;  2HS5 A;  4NTA A;  2KJG A;  1Z7Q c;  4F4B A;  3I5P A;  4YL3 A;  1JMW A;  2R7R A;  1OQC A;  1RKC A;  3E9V A; 
#chains in the Genus database with same CATH homology
 5L3Q A;  4I1M A;  3AQB A;  4KNW A;  3DJU B;  3NKE A;  2B0J A;  2EIM C;  2X51 A;  3ZC4 A;  5KYW A;  4ZLD A;  3VYW A;  2DYR C;  3CSK A;  2KQ9 A;  4FWV A;  4LER A;  3HLZ A;  4JVS A;  1ZHT A;  3ASN C;  4BJ5 C;  4IWB A;  4RBN A;  2HV7 A;  2G62 A;  3DM5 A;  1ZYR F;  3ECS A;  4JW1 A;  3W2W A;  3WOD F;  4QDL A;  3H65 A;  3V7O A;  5DS6 A;  4U5F E;  4EBB A;  1PCX A;  3GOD A;  5T3T A;  4IAO A;  4LAC B;  3EFO A;  3OWT A;  2G3V A;  3ABM C;  5F5H A;  2WL8 A;  3DXJ F;  3N0T A;  1LKX A;  2DGJ A;  1SMY F;  5D92 A;  2NUT B;  4U5H A;  4OIQ F;  3ASO C;  2P7V A;  3L0I A;  5DLJ A;  3WG7 C;  2PFD A;  1VOM A;  1MND A;  1JPN A;  3EGX B;  5B3S C;  1N1C A;  5KYU B;  3ABL C;  3MLG A;  4OD4 A;  4E7Z A;  3DZA A;  4G7Z F;  2WZG A;  2IXO A;  3RKO F;  4BJ6 C;  3AG4 C;  3QMK A;  3EH1 A;  4C7O B;  3Q7L A;  4HFK B;  4HEA J;  4YT2 A;  2O9X A;  2NUP B;  3S27 A;  4DOZ A;  1Z5Z A;  3JSZ A;  2W45 A;  4EWC A;  1D1B A;  3N24 A;  2IYL D;  3UGP A;  1TWG A;  3SYN A;  1NG1 A;  1FMV A;  3EHM A;  3Q7G A;  1ZHZ A;  3CQZ A;  2XRH A;  2WVO A;  3ZIB A;  2PX0 A;  3RH3 A;  4QI0 A;  1NU7 D;  3UMI A;  3W2V A;  2CGE A;  4DBQ A;  4W8K A;  2J46 A;  4AE4 B;  2IOQ A;  4N06 A;  4OD5 A;  2EIJ C;  4M63 A;  3ZSU A;  4BJT A;  1SF8 A;  4XTK A;  3LNR A;  3DAG A;  4U5E E;  2C03 A;  2XL4 A;  4IRU A;  4XWJ A;  1D0Z A;  3O39 A;  1W2W A;  2KGO A;  1ZU5 A;  3LES A;  4KNV A;  4YT5 A;  4BG0 A;  2XXA B;  3JCU Q;  4C3B A;  1D0X A;  2Z15 A;  4WJ0 A;  3MX3 A;  3KL4 A;  2E87 A;  4J32 B;  4PJN A;  3I4U A;  3HTK C;  2PF4 E;  2Y3B A;  1BR1 A;  3K33 A;  4PJM A;  4JUR I;  3FDQ A;  4ZLC A;  3T6J A;  3UMK A;  2WVQ A;  3ZVR A;  1OKK A;  1ZU4 A;  1FFH A;  1V54 C;  2J9W A;  1MNE A;  2ZXP A;  4I44 A;  3NRH A;  2WZL A;  2R7U A;  3PMR A;  2A6E F;  4PK4 A;  3K1H A;  2R7Q A;  5E3A A;  2H7V C;  4JJF A;  1TWC A;  2XSE A;  4A2N B;  3EGD A;  3UMH A;  3Q6M A;  2W4M A;  3AG2 C;  1PD1 A;  4I1O B;  4YT8 A;  4Q7C A;  1D1A A;  4RDA A;  5KYN A;  4C3E A;  2I8B A;  4KI2 A;  3UR3 C;  2YZS A;  1S7Z A;  3W8H A;  4U5G A;  3LS0 A;  4XLP F;  5KYW B;  2CDQ A;  4XLN F;  4FES A;  3DD7 A;  3K1I C;  4DBR A;  1NZE A;  3FVY A;  1M2O A;  2R7S A;  2CNW D;  3EZI A;  1M2V A;  2IXP A;  3KKB A;  4CS9 A;  2MYS A;  3T4R A;  4PFP A;  3S28 A;  4KBL A;  5E3C A;  5D91 A;  3B9Q A;  3NYL A;  3SNH A;  3K7D A;  1RJ9 B;  1KU2 A;  3F47 A;  2ZXW C;  4IJJ A;  2V26 A;  3LEV A;  1O5H A;  4NY3 A;  1TKN A;  1J8Y F;  2DYS C;  1OCC C;  2CNW A;  3EFO B;  3JRT A;  5DQZ A;  2OG2 A;  1QZX A;  5KYY A;  2C04 A;  4PJJ A;  2Q9B A;  5B1A C;  4K7B A;  2PX3 A;  4LLC A;  3NDB B;  1M56 C;  4AX2 A;  4PFO A;  4MQ9 F;  2A6H F;  3SEO A;  2L81 A;  5KYX A;  5E2Q A;  3Q6N A;  2VAS A;  3EJN A;  4KC9 A;  3M1C B;  1BR4 A;  3OEO A;  3L34 A;  4ULW A;  2Q9C A;  4CIH A;  3IEE A;  4PJL A;  4OIR F;  1O87 A;  5HSW A;  5EGY A;  5FCL A;  4YJW A;  4G0H A;  4JCH A;  2EIK C;  3SZR A;  2W9Y A;  3I5Q A;  1G8X A;  3AG3 C;  2XXA A;  4B6I A;  3N2Z B;  5B1B C;  2Y3G A;  5E33 A;  4U5D E;  2WZF A;  2R7X A;  1MMD A;  2Y3H A;  3B0V C;  3LJB A;  3EG9 A;  3JT1 A;  3FAJ A;  2LSE A;  1QLE C;  4GEH A;  2R7V A;  1ZHX A;  5L3V A;  3KH2 A;  3F46 A;  3KMI A;  3X1O A;  1WGW A;  4RD9 A;  2J7P D;  2P6V A;  1D0Y A;  2R7W A;  3RIP A;  2Q9A A;  3CZ6 A;  2J0X A;  4I3M A;  3DM9 B;  4CS8 A;  3PHF 2;  4LLE A;  4AK9 A;  2VB6 A;  4CSA A;  2W4B A;  4P6I C;  1NU9 C;  1MMA A;  4YWQ A;  5CI9 A;  3UNG C;  3E70 C;  2J45 A;  2KW3 C;  1FTS A;  1Z23 A;  1Z6A A;  4ANJ A;  2R7O A;  2Y69 C;  3GAN A;  2FFH A;  3NYJ A;  4HE8 D;  3DMD A;  2V3C C;  2G3K A;  2CW0 F;  3B0P A;  4OIN F;  4Q5S F;  4O6M A;  4BJ1 A;  1TWA A;  4CS9 C;  3LLI A;  5DVW A;  2J0W A;  5EHH A;  3FHD A;  1OCZ C;  5T1D B;  1VK5 A;  1Z63 A;  2BE5 F;  1PD0 A;  2PP4 A;  2NUT A;  2M4E A;  4JJG A;  4K0D A;  1ZHY A;  2QTV A;  5DQT A;  1VMA A;  1FFT C;  2ZXR A;  3EGX A;  5KYU A;  4O6N A;  5IY5 C;  1RJ9 A;  2ZXO A;  5DS5 A;  3RYL A;  4CBE A;  1VYI A;  4G7H F;  4QI2 A;  1JPJ A;  3EPV A;  3AG1 C;  3EGD B;  4C7O A;  4CS7 A;  1TWH A;  2NUP A;  2R7T A;  3B0U X;  1D1C A;  2H7B A;  1VYK A;  2J9U A;  4BJ5 A;  3DAF A;  5F5F A;  4U5B E;  2MWQ A;  3NYM A;  1J8M F;  3S29 A;  4O79 A;  2VH3 A;  3VAY A;  2WB7 A;  4YN0 B;  1M2V B;  4HFF B;  4DVZ A;  4AE4 A;  1FMW A;  2Y3D A;  3DJN B;  4H4K C;  1ZHW A;  3LAY A;  4O7G A;  2A68 F;  1IW7 F;  3LS1 A;  2IXN A;  3UGO A;  5DS4 A;  4JZA A;  2JD3 A;  1LVK A;  1OCR C;  3ABK C;  3ZG1 A;  2H7O A;  4CS8 C;  2J9V A;  1M57 C;  3NKD A;  5CI8 A;  4OIO F;  1TR2 A;  5KYY B;  4CSA C;  4MND A;  4G7O F;  1Z3I X;  4FX5 A;  3QZC A;  2A69 F;  2FGY A;  3W8I A;  3RFY A;  2R7R A;  2YHS A;  3ITF A;  4BJ6 A;  4C3D A;  2ZPA A;  5KYX B;  3EQL F;  3POV A;  3TD7 A;  2KNH A;  2A1D D;  3EHN A;  4GYT A;  1OCO C;  4X0R A;  3LLK A;  3HJC A;  4Q4Z F;  1MMN A;  2Q3T A;  3SP1 A;  1V55 C;  3AQC A;  3T6B A;  2WVN A;  4BEJ A;  3S0X A;  1IZM A;  2Y39 A;  3K66 A;  5BUO A;  4E7S A;  3JYH A;  4OIP F;  1LS1 A;  2L9J A;  2GFH A;  1SZI A;  2HV6 A;  2D5R B;  4O6Y A;  3NG1 A;  2EIN C;  3X2Q C;  2NG1 A;  1BR2 A;  3EZH A;  5T3W A;  4U5C E;  2IXM A;  2J7P A;  3EG9 B;  1OKK D;  2OCC C;  1ST6 A;  3EH2 A;  3O6X A;  3OA1 A;  2QY9 A;  4YT4 A;  3K6B A;  4J30 B;  4DVY P;  1MMG A;  2EIL C;  2KJG A;  4F4B A;  3I5P A;  2YEV A;  3E9V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...