4A2NB

Crystal structure of ma-icmt
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
192
structure length
192
Chain Sequence
MNENLWKICFIVMFIIWVFVRKVYGTRAMKNKSKKKVRPNFEKSLVFLNFIGMVFLPLTAVFSSYLDSFNINLPDSIRLFALIVTFLNIGLFTKIHKDLGNNWSAILEIKDGHKLVKEGIYKNIRHPMYAHLWLWVITQGIILSNWVVLIFGIVAWAILYFIRVPKEEELLIEEFGDEYIEYMGKTGRLFPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ISOPRENYLCYSTEINE CARBOXYL METHYLTRANSFERASE
publication title Mechanism of Isoprenylcysteine Carboxyl Methylation from the Crystal Structure of the Integral Membrane Methyltransferase Icmt.
pubmed doi rcsb
source organism Methanosarcina acetivorans
molecule tags Transferase
total genus 65
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2011-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04140 ICMT Isoprenylcysteine carboxyl methyltransferase (ICMT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1630 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4a2nB00
4A2NB
chains in the Genus database with same CATH superfamily
4O6MA 3LNRA 4XLNF 1BR2A 2RSEB 2HJMA 1ORSC 3T4RA 2LCHA 1JOGA 2LP4A 4QDLA 1LI7A 4CDAA 3VM6A 2DYSC 2DYRC 3K7DA 2XLDA 1RKEB 3UGOA 2VASA 5DLJA 4JJGA 5KYWB 3RYLA 3JSZA 4XEVA 3A11A 3NMKA 1E2XA 4J7TA 4G7OF 4BJTA 4EBJA 1I4ZA 3C8ZA 4OIRF 3DI5A 2KYHA 3ZSUA 3IQTA 3CEXA 1KTMA 1UG7A 2CW0F 2PNOA 2W9YA 3DM5A 3DKAA 1QQ3A 4XTKA 3MBGA 2EPLX 3NMIA 4Q4ZF 4N06A 4CJGA 2XSEA 2JX0A 2LFFA 1YAUO 5JLIA 2Q9BA 3M1CB 4F4BA 2FGYA 1U0BB 3LLIA 1D0ZA 4KNVA 5EGYA 4IWBA 1CPRA 3QVZA 4M63A 4JEAA 5E3AA 1HMOA 2XLEA 1ZW2A 3IQCA 4DRJB 4MTOA 1JRAA 2QE9A 3B0VC 3TD7A 4OIOF 4CS8A 1TWCA 2EILC 5DS4A 2KK1A 2QY9A 3LAYA 4JCHA 5D91A 1N1CA 1LI5A 3ZDLA 3MYFA 3EPVA 2XL4A 1LS1A 1ZU5A 3SYNA 2G62A 4G0HA 3NYJA 2J45A 1L3PA 3ECSA 4YJWA 1VYIA 3V5ZA 1UFBA 3O10A 3K1HA 4ANJA 5BQHA 3GEEA 1NU9C 5DQTA 3EQLF 3GWLA 2H8AA 3O39A 2XM4A 3T6GB 2IOQA 1R4TA 2DB4A 4LACB 3FOPA 1MQVA 1LVKA 4MVUA 4E0IA 1G4WR 4K0DA 1CGOA 3TJ5A 4E18A 2YZSA 3POVA 1J8YF 4JCZA 2A68F 2PX0A 4CDVA 3CAXA 4KBLA 1G4US 3SXZA 1OCRC 2W4MA 2YRFA 3E70C 4JIOA 3BRJA 1E83A 4WABA 2XLOA 1T6UA 2HUJA 4WGYA 2PX3A 3GM2A 1YDIA 2B0HA 1EA8A 2XLWA 1HY5A 4ZLCA 4OIPF 256BA 2A0UA 1O3UA 2EIKC 2EPNA 1D1AA 3GORA 4PJNA 2HV6A 2J7PD 3NRHA 4JW1A 4D4NA 2KJGA 5B3IA 1G8XA 1AVOB 1RKEA 1ZHYA 5JRAA 1RCPA 2R9RB 5B1BC 1ORYA 3U0CA 3EFOB 1RMVA 3AG4C 5BQIA 2R7UA 2Q9CA 1BBHA 1C03A 2HV7A 2MHRA 2WVQA 5E2QA 4EWCA 5A6JA 3UNGC 1FNTc 4G7HF 4BJ5A 3QMKA 3B71A 5HV9A 2VC9A 4U5EE 3DE9A 3EHNA 4MVQA 5E3CA 1C17M 4G78A 1O87A 1NFNA 2P0NA 3RH3A 3V5YA 3EZHA 3K33A 2HMZA 3ABLC 3AQCA 5JS5A 3IHUA 3LEVA 4DBQA 1A0BA 1A7EA 3FVYA 3LLKA 2OEVA 2R7QA 5K0IA 2J9UA 2VCAA 3U5SA 4N4WA 1EQ1A 3BEHA 4MVRA 1D1BA 4JTCB 3UMHA 4Q5SF 5E33A 2XS8A 3S9OA 4ER9A 2NSFA 3QW0A 1H6GA 5B1AC 1V74B 4AX2A 4K1OA 4NTFA 4RD9A 1NSGB 2NG1A 2O9XA 3QTHA 1TWHA 4O6NA 3C18A 3K66A 5L3QA 4J7YA 2BL2A 1YZAA 1ST6A 4AE4A 2H7OA 2P61A 1Y4CA 2A6EF 3EGXB 4CBEA 3LEOA 2Y3BA 3RQFA 2XLVA 4EHPA 3ZIBA 3J06A 2WZLA 4DJ9A 2J8WA 2J0XA 4C7OB 3DXJF 2J7PA 4A4AA 3HNKA 3RVYA 1U89A 2HJ3A 1OQCA 4IARA 1ORJA 1RJ9A 1YZCA 5L0GA 2XXAB 2HS5A 2IXMA 4DBRA 3NG1A 2J46A 3U3BA 1W2WA 5L3VA 3ZTZA 2CNWD 3S90A 1PD1A 1OKKD 1G5ZA 5DQZA 3GEIA 3ATPA 5EHHA 2VCBA 3C8GB 2LQGA 2Q7RA 1M57C 2R02A 3EGDA 2YWAA 1H9GA 3SZRA 4KC9A 1H9TA 2I8BA 4H54A 2L9JA 4XPWA 1ZW3A 2A6HF 4A2NB 4PR9A 3ASNC 3GODA 5KYYB 3DAGA 3IQ5A 3TJ6A 2XLMA 1TWAA 4EUKB 1XWJA 2KQ9A 4G7ZF 2NSGA 4P6IC 3EH2A 2XM0A 1AEPA 3HNIA 2L81A 2J9VA 1OW6A 3HKKA 1VK5A 1YYJA 3EFOA 2EINC 2ZXWC 1GS9A 3IEEA 5EK0A 1VTMP 3JYHA 5KYXB 2Y3DA 2W4BA 1JAFA 2YL1A 2EPKX 1VB5A 2A1DD 1T6QA 4JJFA 1VYKA 4U5CE 3S29A 2AU5A 4WJ0A 3NKDA 3C8GD 4DVZA 1M56C 5DVWA 3CZ6A 1Z3IX 1Z6AA 4GYTA 4X0RA 1HW1A 3Q7GA 2HKVA 2AWCA 4YL3A 2F22A 4U9DA 1GQAA 4CIPA 4FESA 2YLGA 4NTBA 2MWQA 2IXPA 4HE8D 4P9TA 4R32A 4CS9C 3M15A 2C04A 1SR2A 2NUPA 1TFOB 5L0FA 2H7VC 1Z7Qc 3VYWA 4Z9JA 2WL8A 2E87A 5F5FA 3PMRA 3DZAA 1FAPB 3RQGA 2CNWA 2DI3A 4IRUA 1XZQA 1NZEA 2AP3A 1VOMA 2Q9AA 4GQHA 5L0JA 4W8KA 1LKXA 4BEMJ 4HEAJ 2CYDA 3GM3A 3JCUQ 3K1IA 2ICWG 3FMSA 5D92A 1OR2A 4HFKB 4O6YA 2OOCA 4MTGA 1J8MF 3O55A 5JP7A 2LIGA 2Q3TA 3UMKA 3DE8A 4EBKA 1FFHA 2C03A 3LNMB 3I5QA 4IGGA 3TULA 4I1OB 4IB4A 3NMJA 1ZYRF 4YT2A 2G3VA 1E85A 2HSQA 3UMIA 4OIQF 1BR1A 4XQ1A 4JURI 3FOOA 5JVEA 2P7VA 4WGZA 1YA9A 2OCCC 3EG9A 1OCOC 4L6RA 5COFA 3S0XA 3MFNA 2VCCA 2YL7A 1SMYF 3B0UX 1DOVA 3ASOC 4YK5A 3W8IA 4CDYA 2KC3A 3LUTB 2M64A 4HFFB 4J32B 1M2VA 2OU6A 2R25A 2GAQA 1V4AA 1LS4A 1K40A 1O5HA 1ZHZA 2GA0A 2XRHA 3Q6NA 4ULWA 4MVSA 3TOLA 3ZVRA 3KYIA 3KH2A 2H7BA 2VH3A 1OXKA 2IM8A 2WZGA 2GFHA 1RXQA 1JPNA 1V55C 3AQBA 3KL4A 3NYMA 4GEHA 3GANA 1ZZPA 4C3BA 4C3DA 2EIMC 1F1MA 3W2WA 4OINF 3L34A 2PFDA 5KYWA 2CCYA 2WVOA 4MVMA 4XPYA 3UR3C 4YT4A 4PK4A 4JC7A 4BJ6C 4YWQA 1D1CA 3KYJA 1A7DA 2LFDA 1MMNA 3OA1A 4DOZA 3PHF2 1PV3A 3SNHA 2KNHA 3U3FA 4E0HA 2WVNA 3H2VA 3QVYA 4LLEA 1LPEA 1C02A 2ZPAA 4JRZA 5AC4A 5GPGB 4EKWA 3L8JA 2B0JA 3N0TA 2XLHA 3AG1C 3C63A 3SXKA 5A6BD 1EKYA 5BUOA 1YARO 2OG2A 4O7GA 5COMA 3FDQA 1ZHXA 2HFIA 1EI7A 2L6GA 2OEXA 3S84A 1I4YA 2YQYA 5KYUB 2OJED 2OJQA 5L0IA 4RBNA 2Q00A 1VMAA 1I5NA 1K05A 3GEHA 2X0CA 2M4EA 3H2UA 3M79A 4MNDA 3EHMA 1AUEA 1ZU4A 1YYXA 4Q7CA 2XL6A 3RVZA 4CJOA 2X51A 4U5FE 1BZ4A 3LS1A 4LLCA 5DS6A 2D4UA 1K04A 4AL1A 3FXHA 4IJJA 3S28A 5KYNA 2YLDA 1PD0A 1Q0GA 1Z23A 1OCCC 1S7ZA 2QNLA 2EPOA 3SP1A 2R7XA 3JRMO 3HTKC 3LJBA 1ZHTA 2R7SA 3HNLA 4YT5A 5JSLA 5A69A 3G50A 2L6FA 1GM5A 5FCLA 4E7ZA 4YN0B 1TFKB 2J0WA 2BC5A 2WZFA 4LERA 4BJ1A 2MYSA 3E9VA 4LDRA 3V7OA 2HSBA 1ZHWA 2Z15A 3MLGA 4OD5A 4U5BE 3TQOA 5F5HA 2Y69C 3AJMA 4NTAA 4MVZA 3RFYA 3V5XA 4CS8C 3FHDA 2R7OA 2YLIA 3AG3C 4CSAA 1HE9A 1QLEC 3LS0A 1WTYA 4D4XA 4JEBA 4XEKA 2GWWA 1V54C 3RF3A 3W4YA 1KU2A 1OW8A 4NCQA 2YHSA 2ETSA 4XEFA 4ONSA 3AOUA 1T9KA 4MTFA 4DVYP 1MNEA 3SEOA 4EBBA 1OXBA 4LDQA 5L0CA 1VLTA 3FAJA 4E17A 5A6AA 2FAPB 3O6XA 2AVKA 2XS1A 2ZXRA 1FMVA 3GM1A 1BR4A 4W8PA 1HE1A 3H65A 3OEOA 1CGME 4NY3A 4O79A 5T3TA 5B3SC 1JPJA 3JT1A 1WASA 1APCA 2Y3HA 2CDQA 2YL3A 3C62A 3AG2C 3DD7A 1QVXA 4JE9A 5COGA 4JVSA 3DJUB 4PACA 1WGWA 5IY5C 1LIHA 1WN0A 3KKBA 2PBEA 3IQ6A 5L0HA 3AGTA 1NU7D 3PDMP 5AGFA 3ZQVA 2IXOA 2UUIA 2AWYA 3EJNA 4KNWA 2EIJC 1MMAA 1QZXA 3G4ZA 4ULVA 3U8PA 2A0BA 3S27A 1IZMA 3NYLA 1OKKA 3U9JA 2A69F 4YL0A 2YVKA 3Q7LA 1JR8A 1WATA 1FFTC 3T6BA 3Q6MA 3U2LA 3T9OA 1T5OA 1MMGA 1LE2A 2P6VA 4K7BA 3EGXA 4XWJA 3RW0A 2JPUA 3DAFA 3QZCA 4BJ5C 4FAPB 2IBFA 2W45A 5A6KA 4U9EA 1OR3A 4H4KC 4C7OA 2V3CC 1DOWA 5T3WA 1L7CA 3QW1A 3MYIA 2XXAA 5CI9A 4PFOA 4XLPF 1R5ID 3ZWIA 2NPUA 5JUAA 3PCVA 1Q0DA 4I44A 2R7RA 4IAOA 3JRTA 2R7VA 4ZLDA 3WODF 3KMIA 3G4XA 3C8GA 2IXNA 2NUTB 3LESA 4YL1A 5KYUA 1E86A 3NKEA 1HW2A 1U6HA 2CGEA 1CPQA 4MVOA 3I4UA 4IAQA 1SF8A 1A41A 4J30B 2Q4FA 3U8VA 3HJCA 5KYYA 3DM9B 3ABMC 1FMWA 2QUPA 3RIPA 3B29A 3U9MA 1YJGA 3M4CA 4LDKA 2PF4E 3SXMA 4AK9A 1WOLA 4JTDB 1SZIA 1YA7O 4AE4B 5AC5A 2QLAA 3VAYA 4UDVA 1CGNA 2KGOA 4CIHA 3RQEA 3GWNA 1NBBA 3N2ZB 3ABKC 5KYXA 1Q0MA 1ZVZA 2D5RB 1RJ9B 3EZIA 2J9WA 3F46A 4I1MA 2TMVP 2L6HA 3K6BA 4YT8A 1B68A 3MX3A 4BG0A 1BDJB 3X2QC 3TK0A 2GDCA 2Y3GA 4JTAB 2OKUA 3WAQA 3WG7C 1RKCA 2LD6A 3F47A 3EGDB 5JT4A 1MNDA 1VLSA 3DJNB 3R2PA 1NLXA 4CS9A 1LE4A 1QSPA 2UUHA 2V26A 4QI2A 3B9QA 2JD3A 1T6IA 1FR0A 2YL0A 2ZXPA 1T01A 1FTSA 2ASRA 2XL8A 4JKVA 4I3MA 4U5DE 1TR2A 4JZAA 1Q0KA 3US6A 5TJ5E 2I15A 1MMDA 3C7JA 2ZD9A 3WHNA 3N24A 4B6IA 3UGPA 5DS5A 3NDBB 2LK4A 4NC3A 4PFPA 4Z9IA 1TKNA 3L1MA 4NQFA 4FX5A 4E7SA 4PJJA 1IW7F 4BPMA 4OD4A 4CX9A 4PJMA 5F28E 5CIVA 4MQ9F 1PCXA 3JYYA 4RDAA 1KNYA 2G3KA 3B0PA 3L0IA 4U5HA 3OWTA 3W2VA 3A9CA 3M4BA 5L0DA 4Z9HA 3DWWA 4MS2A 4DXWA 2EPMX 2P1AA 4N6HA 2RD9A 1NFOA 2R7TA 3VRCA 3HNJA 2J9BA 3DMDA 3X1OA 5T1DB 3ZQYA 2NUPB 3R7CA 4CS7A 3CQZA 2OQMA 2R05A 4C3EA 3RKOF 2NUTA 1H7IA 1QKRA 4AL0A 2YEVA 3EH1A 3AGUA 2DGJA 3HLZA 4PJLA 3L8IA 4DRHB 4N6CA 3U2MA 3JSEO 3ZTMA 1TWGA 1Q0FA 3ITFA 4BEJA 5CI8A 1SYQA 2ZXOA 1Z5ZA 2YKZA 2HMQA 4U5GA 3IPMO 2LSEA 5A6BA 4KI2A 3K1IC 1JMWA 1HMDA 3W8HA 3FAPB 2WB7A 1E84A 1QPUA 2R03A 1WWPA 4EIYA 2KW3C 1XZPA 1A7VA 4MW8A 3ZC4A 2IYLD 2VB6A 5BQGA 5HSWA 2R7WA 1LM3B 5FZTA 2BE5F 4MW3A 4FWVA 4BJ6A 2PP4A 1M2OA 2QTVA 2Y39A 3JZ0A 3SXYA 2L7AA 3ZG1A 4DRIB 3KPHA 1YVIA 1Z63A 3I5PA 4QI0A 3JTLO 1OW7A 3EG9B 1Y6DA 1YLMA 1GGQA 4P9FA 3T6JA 3TOMA 1D0XA 3VF0A 2KSFA 1TQGA 2FFHA 4CSAC 1M6TA 1M2VB 3CSKA 1NG1A 4XPXA 2HZ8A 1OCZC 1S05A 1D0YA
chains in the Genus database with same CATH topology
4O6MA 3LNRA 4XLNF 1BR2A 4QDLA 2DYSC 2DYRC 3K7DA 3UGOA 2VASA 5DLJA 4JJGA 5KYWB 3RYLA 3JSZA 4G7OF 4BJTA 4OIRF 3ZSUA 2CW0F 2W9YA 3DM5A 4XTKA 4Q4ZF 4N06A 2XSEA 2Q9BA 3M1CB 4F4BA 2FGYA 3LLIA 1D0ZA 4KNVA 5EGYA 4IWBA 4M63A 5E3AA 3B0VC 3TD7A 4OIOF 4CS8A 1TWCA 2EILC 5DS4A 2QY9A 3LAYA 4JCHA 5D91A 1N1CA 3EPVA 2XL4A 1LS1A 1ZU5A 3SYNA 2G62A 4G0HA 3NYJA 2J45A 3ECSA 4YJWA 1VYIA 3K1HA 4ANJA 1NU9C 5DQTA 3EQLF 3O39A 2IOQA 4LACB 1LVKA 4K0DA 2YZSA 3POVA 1J8YF 2A68F 2PX0A 4KBLA 1OCRC 2W4MA 3E70C 2PX3A 4ZLCA 4OIPF 4CSAC 2EIKC 4PJNA 1D1AA 2HV6A 2J7PD 3NRHA 4JW1A 2KJGA 1G8XA 1ZHYA 5B1BC 3EFOB 3AG4C 2R7UA 2Q9CA 2HV7A 4G7HF 2WVQA 5E2QA 4EWCA 3UNGC 4BJ5A 3QMKA 4U5EE 3EHNA 5E3CA 1O87A 3RH3A 3EZHA 3K33A 3ABLC 3AQCA 3LEVA 4DBQA 3LLKA 3FVYA 2R7QA 2J9UA 1D1BA 3UMHA 4Q5SF 5E33A 5B1AC 4AX2A 4RD9A 2NG1A 2O9XA 5L3QA 1TWHA 4O6NA 3K66A 1ST6A 4AE4A 2H7OA 4CBEA 2A6EF 3EGXB 2Y3BA 3ZIBA 2WZLA 2J0XA 4C7OB 3DXJF 2J7PA 1RJ9A 2XXAB 2IXMA 4DBRA 3NG1A 2J46A 5L3VA 1W2WA 2CNWD 1PD1A 1OKKD 5DQZA 5EHHA 5KYUB 1M57C 3EGDA 3SZRA 4KC9A 2I8BA 2L9JA 2A6HF 4A2NB 3ASNC 3GODA 5KYYB 3DAGA 1TWAA 2KQ9A 4G7ZF 4P6IC 3EH2A 2L81A 2J9VA 1VK5A 3EFOA 3IEEA 2EINC 2ZXWC 3JYHA 5KYXB 2Y3DA 2W4BA 4JJFA 2A1DD 1VYKA 4U5CE 3S29A 4WJ0A 3NKDA 4DVZA 1M56C 5DVWA 3CZ6A 1Z3IX 1Z6AA 4GYTA 4X0RA 3Q7GA 4FESA 2MWQA 2IXPA 4HE8D 4CS9C 2C04A 2NUPA 2H7VC 3VYWA 2WL8A 2E87A 5F5FA 3PMRA 3DZAA 2CNWA 4IRUA 1NZEA 1VOMA 2Q9AA 4W8KA 1LKXA 4HEAJ 3JCUQ 5D92A 3T4RA 4HFKB 4O6YA 1J8MF 2Q3TA 3UMKA 1FFHA 2C03A 3I5QA 4I1OB 4YT2A 1ZYRF 4OIQF 2G3VA 3UMIA 1BR1A 4JURI 2P7VA 2OCCC 3EG9A 1OCOC 3S0XA 1SMYF 3B0UX 3ASOC 3W8IA 4HFFB 4J32B 1M2VA 3Q6NA 2XRHA 1ZHZA 1O5HA 4ULWA 3ZVRA 3KH2A 2H7BA 2VH3A 2WZGA 2GFHA 1JPNA 1V55C 3AQBA 3KL4A 3NYMA 4GEHA 3GANA 4C3BA 4C3DA 2EIMC 3W2WA 4OINF 3L34A 2PFDA 5KYWA 2WVOA 3UR3C 4YT4A 4PK4A 4BJ6C 4YWQA 1D1CA 1MMNA 3OA1A 4DOZA 3PHF2 3SNHA 2KNHA 2WVNA 4LLEA 2ZPAA 2B0JA 3N0TA 3AG1C 5BUOA 2OG2A 4O7GA 3FDQA 1ZHXA 4RBNA 1VMAA 2M4EA 4MNDA 3EHMA 1ZU4A 4Q7CA 2X51A 4U5FE 3LS1A 4LLCA 5DS6A 4IJJA 3S28A 5KYNA 1PD0A 1Z23A 3SP1A 1OCCC 1S7ZA 2R7XA 3HTKC 3LJBA 1ZHTA 2R7SA 4YT5A 5FCLA 4E7ZA 4YN0B 2J0WA 2WZFA 4LERA 4BJ1A 2MYSA 3E9VA 3V7OA 1ZHWA 2Z15A 3MLGA 4OD5A 4U5BE 5F5HA 2Y69C 3RFYA 4CS8C 3FHDA 2R7OA 3AG3C 4CSAA 1QLEC 3LS0A 1V54C 1KU2A 2YHSA 4DVYP 1MNEA 3SEOA 4EBBA 3FAJA 3O6XA 2ZXRA 1FMVA 1BR4A 3H65A 3OEOA 4NY3A 4O79A 5T3TA 5B3SC 1JPJA 3JT1A 2Y3HA 3DD7A 2CDQA 3AG2C 4JVSA 3DJUB 5IY5C 1WGWA 3KKBA 1NU7D 2IXOA 3EJNA 4KNWA 2EIJC 1MMAA 1QZXA 3S27A 1IZMA 3NYLA 1OKKA 2A69F 3Q7LA 1FFTC 3T6BA 3Q6MA 1MMGA 2P6VA 4K7BA 4XWJA 3EGXA 3DAFA 3QZCA 4BJ5C 2W45A 4H4KC 4C7OA 2V3CC 5T3WA 2XXAA 5CI9A 4PFOA 4XLPF 2R7RA 4I44A 2R7VA 4ZLDA 4IAOA 3JRTA 3WODF 3KMIA 3LESA 5KYUA 2IXNA 2NUTB 3NKEA 2CGEA 3I4UA 4J30B 1SF8A 5KYYA 3HJCA 3DM9B 3ABMC 1FMWA 3RIPA 2PF4E 4AK9A 1SZIA 4AE4B 3VAYA 2KGOA 4CIHA 3N2ZB 5KYXA 3ABKC 3EZIA 2D5RB 1RJ9B 4I1MA 2J9WA 3F46A 3K6BA 4YT8A 3MX3A 4BG0A 3X2QC 2Y3GA 3WG7C 3F47A 3EGDB 1MNDA 3DJNB 4CS9A 2V26A 4QI2A 3B9QA 2JD3A 2ZXPA 1FTSA 4I3MA 4U5DE 1TR2A 4JZAA 4B6IA 1MMDA 3NDBB 3UGPA 3N24A 5DS5A 4PFPA 1TKNA 4FX5A 4E7SA 4PJJA 1IW7F 4OD4A 4PJMA 4MQ9F 1PCXA 4RDAA 2G3KA 3B0PA 3L0IA 4U5HA 3OWTA 3W2VA 2R7TA 3DMDA 3X1OA 5T1DB 2NUPB 4CS7A 3CQZA 4C3EA 3RKOF 2NUTA 2YEVA 3EH1A 2DGJA 3HLZA 4PJLA 1TWGA 3ITFA 4BEJA 5CI8A 2ZXOA 1Z5ZA 4U5GA 2LSEA 4KI2A 3K1IC 3W8HA 2WB7A 2KW3C 3ZC4A 2IYLD 2VB6A 5HSWA 2R7WA 2BE5F 4BJ6A 4FWVA 2PP4A 1M2OA 2QTVA 2Y39A 1Z63A 3ZG1A 3I5PA 4QI0A 3EG9B 3T6JA 1D0XA 2FFHA 1M2VB 3CSKA 1NG1A 1OCZC 1D0YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A2N B; 
#chains in the Genus database with same CATH topology
 4O6M A;  3LNR A;  4XLN F;  1BR2 A;  2RSE B;  2HJM A;  1ORS C;  3T4R A;  2LCH A;  1JOG A;  2LP4 A;  4QDL A;  1LI7 A;  4CDA A;  3VM6 A;  2DYS C;  2DYR C;  3K7D A;  2XLD A;  1RKE B;  3UGO A;  2VAS A;  5DLJ A;  4JJG A;  5KYW B;  3RYL A;  3JSZ A;  4XEV A;  3A11 A;  3NMK A;  1E2X A;  4J7T A;  4G7O F;  4BJT A;  4EBJ A;  1I4Z A;  3C8Z A;  4OIR F;  3DI5 A;  2KYH A;  3ZSU A;  3IQT A;  3CEX A;  1KTM A;  1UG7 A;  2CW0 F;  2PNO A;  2W9Y A;  3DM5 A;  3DKA A;  1QQ3 A;  4XTK A;  3MBG A;  2EPL X;  3NMI A;  4Q4Z F;  4N06 A;  4CJG A;  2XSE A;  2JX0 A;  2LFF A;  1YAU O;  5JLI A;  2Q9B A;  3M1C B;  4F4B A;  2FGY A;  1U0B B;  3LLI A;  1D0Z A;  4KNV A;  5EGY A;  4IWB A;  1CPR A;  3QVZ A;  4M63 A;  4JEA A;  5E3A A;  1HMO A;  2XLE A;  1ZW2 A;  3IQC A;  4DRJ B;  4MTO A;  1JRA A;  2QE9 A;  3B0V C;  3TD7 A;  4OIO F;  4CS8 A;  1TWC A;  2EIL C;  5DS4 A;  2KK1 A;  2QY9 A;  3LAY A;  4JCH A;  5D91 A;  1N1C A;  1LI5 A;  3ZDL A;  3MYF A;  3EPV A;  2XL4 A;  1LS1 A;  1ZU5 A;  3SYN A;  2G62 A;  4G0H A;  3NYJ A;  2J45 A;  1L3P A;  3ECS A;  4YJW A;  1VYI A;  3V5Z A;  1UFB A;  3O10 A;  3K1H A;  4ANJ A;  5BQH A;  3GEE A;  1NU9 C;  5DQT A;  3EQL F;  3GWL A;  2H8A A;  3O39 A;  2XM4 A;  3T6G B;  2IOQ A;  1R4T A;  2DB4 A;  4LAC B;  3FOP A;  1MQV A;  1LVK A;  4MVU A;  4E0I A;  1G4W R;  4K0D A;  1CGO A;  3TJ5 A;  4E18 A;  2YZS A;  3POV A;  1J8Y F;  4JCZ A;  2A68 F;  2PX0 A;  4CDV A;  3CAX A;  4KBL A;  1G4U S;  3SXZ A;  1OCR C;  2W4M A;  2YRF A;  3E70 C;  4JIO A;  3BRJ A;  1E83 A;  4WAB A;  2XLO A;  1T6U A;  2HUJ A;  4WGY A;  2PX3 A;  3GM2 A;  1YDI A;  2B0H A;  1EA8 A;  2XLW A;  1HY5 A;  4ZLC A;  4OIP F;  256B A;  2A0U A;  1O3U A;  2EIK C;  2EPN A;  1D1A A;  3GOR A;  4PJN A;  2HV6 A;  2J7P D;  3NRH A;  4JW1 A;  4D4N A;  2KJG A;  5B3I A;  1G8X A;  1AVO B;  1RKE A;  1ZHY A;  5JRA A;  1RCP A;  2R9R B;  5B1B C;  1ORY A;  3U0C A;  3EFO B;  1RMV A;  3AG4 C;  5BQI A;  2R7U A;  2Q9C A;  1BBH A;  1C03 A;  2HV7 A;  2MHR A;  2WVQ A;  5E2Q A;  4EWC A;  5A6J A;  3UNG C;  1FNT c;  4G7H F;  4BJ5 A;  3QMK A;  3B71 A;  5HV9 A;  2VC9 A;  4U5E E;  3DE9 A;  3EHN A;  4MVQ A;  5E3C A;  1C17 M;  4G78 A;  1O87 A;  1NFN A;  2P0N A;  3RH3 A;  3V5Y A;  3EZH A;  3K33 A;  2HMZ A;  3ABL C;  3AQC A;  5JS5 A;  3IHU A;  3LEV A;  4DBQ A;  1A0B A;  1A7E A;  3FVY A;  3LLK A;  2OEV A;  2R7Q A;  5K0I A;  2J9U A;  2VCA A;  3U5S A;  4N4W A;  1EQ1 A;  3BEH A;  4MVR A;  1D1B A;  4JTC B;  3UMH A;  4Q5S F;  5E33 A;  2XS8 A;  3S9O A;  4ER9 A;  2NSF A;  3QW0 A;  1H6G A;  5B1A C;  1V74 B;  4AX2 A;  4K1O A;  4NTF A;  4RD9 A;  1NSG B;  2NG1 A;  2O9X A;  3QTH A;  1TWH A;  4O6N A;  3C18 A;  3K66 A;  5L3Q A;  4J7Y A;  2BL2 A;  1YZA A;  1ST6 A;  4AE4 A;  2H7O A;  2P61 A;  1Y4C A;  2A6E F;  3EGX B;  4CBE A;  3LEO A;  2Y3B A;  3RQF A;  2XLV A;  4EHP A;  3ZIB A;  3J06 A;  2WZL A;  4DJ9 A;  2J8W A;  2J0X A;  4C7O B;  3DXJ F;  2J7P A;  4A4A A;  3HNK A;  3RVY A;  1U89 A;  2HJ3 A;  1OQC A;  4IAR A;  1ORJ A;  1RJ9 A;  1YZC A;  5L0G A;  2XXA B;  2HS5 A;  2IXM A;  4DBR A;  3NG1 A;  2J46 A;  3U3B A;  1W2W A;  5L3V A;  3ZTZ A;  2CNW D;  3S90 A;  1PD1 A;  1OKK D;  1G5Z A;  5DQZ A;  3GEI A;  3ATP A;  5EHH A;  2VCB A;  3C8G B;  2LQG A;  2Q7R A;  1M57 C;  2R02 A;  3EGD A;  2YWA A;  1H9G A;  3SZR A;  4KC9 A;  1H9T A;  2I8B A;  4H54 A;  2L9J A;  4XPW A;  1ZW3 A;  2A6H F;  4A2N B;  4PR9 A;  3ASN C;  3GOD A;  5KYY B;  3DAG A;  3IQ5 A;  3TJ6 A;  2XLM A;  1TWA A;  4EUK B;  1XWJ A;  2KQ9 A;  4G7Z F;  2NSG A;  4P6I C;  3EH2 A;  2XM0 A;  1AEP A;  3HNI A;  2L81 A;  2J9V A;  1OW6 A;  3HKK A;  1VK5 A;  1YYJ A;  3EFO A;  2EIN C;  2ZXW C;  1GS9 A;  3IEE A;  5EK0 A;  1VTM P;  3JYH A;  5KYX B;  2Y3D A;  2W4B A;  1JAF A;  2YL1 A;  2EPK X;  1VB5 A;  2A1D D;  1T6Q A;  4JJF A;  1VYK A;  4U5C E;  3S29 A;  2AU5 A;  4WJ0 A;  3NKD A;  3C8G D;  4DVZ A;  1M56 C;  5DVW A;  3CZ6 A;  1Z3I X;  1Z6A A;  4GYT A;  4X0R A;  1HW1 A;  3Q7G A;  2HKV A;  2AWC A;  4YL3 A;  2F22 A;  4U9D A;  1GQA A;  4CIP A;  4FES A;  2YLG A;  4NTB A;  2MWQ A;  2IXP A;  4HE8 D;  4P9T A;  4R32 A;  4CS9 C;  3M15 A;  2C04 A;  1SR2 A;  2NUP A;  1TFO B;  5L0F A;  2H7V C;  1Z7Q c;  3VYW A;  4Z9J A;  2WL8 A;  2E87 A;  5F5F A;  3PMR A;  3DZA A;  1FAP B;  3RQG A;  2CNW A;  2DI3 A;  4IRU A;  1XZQ A;  1NZE A;  2AP3 A;  1VOM A;  2Q9A A;  4GQH A;  5L0J A;  4W8K A;  1LKX A;  4BEM J;  4HEA J;  2CYD A;  3GM3 A;  3JCU Q;  3K1I A;  2ICW G;  3FMS A;  5D92 A;  1OR2 A;  4HFK B;  4O6Y A;  2OOC A;  4MTG A;  1J8M F;  3O55 A;  5JP7 A;  2LIG A;  2Q3T A;  3UMK A;  3DE8 A;  4EBK A;  1FFH A;  2C03 A;  3LNM B;  3I5Q A;  4IGG A;  3TUL A;  4I1O B;  4IB4 A;  3NMJ A;  1ZYR F;  4YT2 A;  2G3V A;  1E85 A;  2HSQ A;  3UMI A;  4OIQ F;  1BR1 A;  4XQ1 A;  4JUR I;  3FOO A;  5JVE A;  2P7V A;  4WGZ A;  1YA9 A;  2OCC C;  3EG9 A;  1OCO C;  4L6R A;  5COF A;  3S0X A;  3MFN A;  2VCC A;  2YL7 A;  1SMY F;  3B0U X;  1DOV A;  3ASO C;  4YK5 A;  3W8I A;  4CDY A;  2KC3 A;  3LUT B;  2M64 A;  4HFF B;  4J32 B;  1M2V A;  2OU6 A;  2R25 A;  2GAQ A;  1V4A A;  1LS4 A;  1K40 A;  1O5H A;  1ZHZ A;  2GA0 A;  2XRH A;  3Q6N A;  4ULW A;  4MVS A;  3TOL A;  3ZVR A;  3KYI A;  3KH2 A;  2H7B A;  2VH3 A;  1OXK A;  2IM8 A;  2WZG A;  2GFH A;  1RXQ A;  1JPN A;  1V55 C;  3AQB A;  3KL4 A;  3NYM A;  4GEH A;  3GAN A;  1ZZP A;  4C3B A;  4C3D A;  2EIM C;  1F1M A;  3W2W A;  4OIN F;  3L34 A;  2PFD A;  5KYW A;  2CCY A;  2WVO A;  4MVM A;  4XPY A;  3UR3 C;  4YT4 A;  4PK4 A;  4JC7 A;  4BJ6 C;  4YWQ A;  1D1C A;  3KYJ A;  1A7D A;  2LFD A;  1MMN A;  3OA1 A;  4DOZ A;  3PHF 2;  1PV3 A;  3SNH A;  2KNH A;  3U3F A;  4E0H A;  2WVN A;  3H2V A;  3QVY A;  4LLE A;  1LPE A;  1C02 A;  2ZPA A;  4JRZ A;  5AC4 A;  5GPG B;  4EKW A;  3L8J A;  2B0J A;  3N0T A;  2XLH A;  3AG1 C;  3C63 A;  3SXK A;  5A6B D;  1EKY A;  5BUO A;  1YAR O;  2OG2 A;  4O7G A;  5COM A;  3FDQ A;  1ZHX A;  2HFI A;  1EI7 A;  2L6G A;  2OEX A;  3S84 A;  1I4Y A;  2YQY A;  5KYU B;  2OJE D;  2OJQ A;  5L0I A;  4RBN A;  2Q00 A;  1VMA A;  1I5N A;  1K05 A;  3GEH A;  2X0C A;  2M4E A;  3H2U A;  3M79 A;  4MND A;  3EHM A;  1AUE A;  1ZU4 A;  1YYX A;  4Q7C A;  2XL6 A;  3RVZ A;  4CJO A;  2X51 A;  4U5F E;  1BZ4 A;  3LS1 A;  4LLC A;  5DS6 A;  2D4U A;  1K04 A;  4AL1 A;  3FXH A;  4IJJ A;  3S28 A;  5KYN A;  2YLD A;  1PD0 A;  1Q0G A;  1Z23 A;  1OCC C;  1S7Z A;  2QNL A;  2EPO A;  3SP1 A;  2R7X A;  3JRM O;  3HTK C;  3LJB A;  1ZHT A;  2R7S A;  3HNL A;  4YT5 A;  5JSL A;  5A69 A;  3G50 A;  2L6F A;  1GM5 A;  5FCL A;  4E7Z A;  4YN0 B;  1TFK B;  2J0W A;  2BC5 A;  2WZF A;  4LER A;  4BJ1 A;  2MYS A;  3E9V A;  4LDR A;  3V7O A;  2HSB A;  1ZHW A;  2Z15 A;  3MLG A;  4OD5 A;  4U5B E;  3TQO A;  5F5H A;  2Y69 C;  3AJM A;  4NTA A;  4MVZ A;  3RFY A;  3V5X A;  4CS8 C;  3FHD A;  2R7O A;  2YLI A;  3AG3 C;  4CSA A;  1HE9 A;  1QLE C;  3LS0 A;  1WTY A;  4D4X A;  4JEB A;  4XEK A;  2GWW A;  1V54 C;  3RF3 A;  3W4Y A;  1KU2 A;  1OW8 A;  4NCQ A;  2YHS A;  2ETS A;  4XEF A;  4ONS A;  3AOU A;  1T9K A;  4MTF A;  4DVY P;  1MNE A;  3SEO A;  4EBB A;  1OXB A;  4LDQ A;  5L0C A;  1VLT A;  3FAJ A;  4E17 A;  5A6A A;  2FAP B;  3O6X A;  2AVK A;  2XS1 A;  2ZXR A;  1FMV A;  3GM1 A;  1BR4 A;  4W8P A;  1HE1 A;  3H65 A;  3OEO A;  1CGM E;  4NY3 A;  4O79 A;  5T3T A;  5B3S C;  1JPJ A;  3JT1 A;  1WAS A;  1APC A;  2Y3H A;  2CDQ A;  2YL3 A;  3C62 A;  3AG2 C;  3DD7 A;  1QVX A;  4JE9 A;  5COG A;  4JVS A;  3DJU B;  4PAC A;  1WGW A;  5IY5 C;  1LIH A;  1WN0 A;  3KKB A;  2PBE A;  3IQ6 A;  5L0H A;  3AGT A;  1NU7 D;  3PDM P;  5AGF A;  3ZQV A;  2IXO A;  2UUI A;  2AWY A;  3EJN A;  4KNW A;  2EIJ C;  1MMA A;  1QZX A;  3G4Z A;  4ULV A;  3U8P A;  2A0B A;  3S27 A;  1IZM A;  3NYL A;  1OKK A;  3U9J A;  2A69 F;  4YL0 A;  2YVK A;  3Q7L A;  1JR8 A;  1WAT A;  1FFT C;  3T6B A;  3Q6M A;  3U2L A;  3T9O A;  1T5O A;  1MMG A;  1LE2 A;  2P6V A;  4K7B A;  3EGX A;  4XWJ A;  3RW0 A;  2JPU A;  3DAF A;  3QZC A;  4BJ5 C;  4FAP B;  2IBF A;  2W45 A;  5A6K A;  4U9E A;  1OR3 A;  4H4K C;  4C7O A;  2V3C C;  1DOW A;  5T3W A;  1L7C A;  3QW1 A;  3MYI A;  2XXA A;  5CI9 A;  4PFO A;  4XLP F;  1R5I D;  3ZWI A;  2NPU A;  5JUA A;  3PCV A;  1Q0D A;  4I44 A;  2R7R A;  4IAO A;  3JRT A;  2R7V A;  4ZLD A;  3WOD F;  3KMI A;  3G4X A;  3C8G A;  2IXN A;  2NUT B;  3LES A;  4YL1 A;  5KYU A;  1E86 A;  3NKE A;  1HW2 A;  1U6H A;  2CGE A;  1CPQ A;  4MVO A;  3I4U A;  4IAQ A;  1SF8 A;  1A41 A;  4J30 B;  2Q4F A;  3U8V A;  3HJC A;  5KYY A;  3DM9 B;  3ABM C;  1FMW A;  2QUP A;  3RIP A;  3B29 A;  3U9M A;  1YJG A;  3M4C A;  4LDK A;  2PF4 E;  3SXM A;  4AK9 A;  1WOL A;  4JTD B;  1SZI A;  1YA7 O;  4AE4 B;  5AC5 A;  2QLA A;  3VAY A;  4UDV A;  1CGN A;  2KGO A;  4CIH A;  3RQE A;  3GWN A;  1NBB A;  3N2Z B;  3ABK C;  5KYX A;  1Q0M A;  1ZVZ A;  2D5R B;  1RJ9 B;  3EZI A;  2J9W A;  3F46 A;  4I1M A;  2TMV P;  2L6H A;  3K6B A;  4YT8 A;  1B68 A;  3MX3 A;  4BG0 A;  1BDJ B;  3X2Q C;  3TK0 A;  2GDC A;  2Y3G A;  4JTA B;  2OKU A;  3WAQ A;  3WG7 C;  1RKC A;  2LD6 A;  3F47 A;  3EGD B;  5JT4 A;  1MND A;  1VLS A;  3DJN B;  3R2P A;  1NLX A;  4CS9 A;  1LE4 A;  1QSP A;  2UUH A;  2V26 A;  4QI2 A;  3B9Q A;  2JD3 A;  1T6I A;  1FR0 A;  2YL0 A;  2ZXP A;  1T01 A;  1FTS A;  2ASR A;  2XL8 A;  4JKV A;  4I3M A;  4U5D E;  1TR2 A;  4JZA A;  1Q0K A;  3US6 A;  5TJ5 E;  2I15 A;  1MMD A;  3C7J A;  2ZD9 A;  3WHN A;  3N24 A;  4B6I A;  3UGP A;  5DS5 A;  3NDB B;  2LK4 A;  4NC3 A;  4PFP A;  4Z9I A;  1TKN A;  3L1M A;  4NQF A;  4FX5 A;  4E7S A;  4PJJ A;  1IW7 F;  4BPM A;  4OD4 A;  4CX9 A;  4PJM A;  5F28 E;  5CIV A;  4MQ9 F;  1PCX A;  3JYY A;  4RDA A;  1KNY A;  2G3K A;  3B0P A;  3L0I A;  4U5H A;  3OWT A;  3W2V A;  3A9C A;  3M4B A;  5L0D A;  4Z9H A;  3DWW A;  4MS2 A;  4DXW A;  2EPM X;  2P1A A;  4N6H A;  2RD9 A;  1NFO A;  2R7T A;  3VRC A;  3HNJ A;  2J9B A;  3DMD A;  3X1O A;  5T1D B;  3ZQY A;  2NUP B;  3R7C A;  4CS7 A;  3CQZ A;  2OQM A;  2R05 A;  4C3E A;  3RKO F;  2NUT A;  1H7I A;  1QKR A;  4AL0 A;  2YEV A;  3EH1 A;  3AGU A;  2DGJ A;  3HLZ A;  4PJL A;  3L8I A;  4DRH B;  4N6C A;  3U2M A;  3JSE O;  3ZTM A;  1TWG A;  1Q0F A;  3ITF A;  4BEJ A;  5CI8 A;  1SYQ A;  2ZXO A;  1Z5Z A;  2YKZ A;  2HMQ A;  4U5G A;  3IPM O;  2LSE A;  5A6B A;  4KI2 A;  3K1I C;  1JMW A;  1HMD A;  3W8H A;  3FAP B;  2WB7 A;  1E84 A;  1QPU A;  2R03 A;  1WWP A;  4EIY A;  2KW3 C;  1XZP A;  1A7V A;  4MW8 A;  3ZC4 A;  2IYL D;  2VB6 A;  5BQG A;  5HSW A;  2R7W A;  1LM3 B;  5FZT A;  2BE5 F;  4MW3 A;  4FWV A;  4BJ6 A;  2PP4 A;  1M2O A;  2QTV A;  2Y39 A;  3JZ0 A;  3SXY A;  2L7A A;  3ZG1 A;  4DRI B;  3KPH A;  1YVI A;  1Z63 A;  3I5P A;  4QI0 A;  3JTL O;  1OW7 A;  3EG9 B;  1Y6D A;  1YLM A;  1GGQ A;  4P9F A;  3T6J A;  3TOM A;  1D0X A;  3VF0 A;  2KSF A;  1TQG A;  2FFH A;  4CSA C;  1M6T A;  1M2V B;  3CSK A;  1NG1 A;  4XPX A;  2HZ8 A;  1OCZ C;  1S05 A;  1D0Y A; 
#chains in the Genus database with same CATH homology
 4O6M A;  3LNR A;  4XLN F;  1BR2 A;  4QDL A;  2DYS C;  2DYR C;  3K7D A;  3UGO A;  2VAS A;  5DLJ A;  4JJG A;  5KYW B;  3RYL A;  3JSZ A;  4G7O F;  4BJT A;  4OIR F;  3ZSU A;  2CW0 F;  2W9Y A;  3DM5 A;  4XTK A;  4Q4Z F;  4N06 A;  2XSE A;  2Q9B A;  3M1C B;  4F4B A;  2FGY A;  3LLI A;  1D0Z A;  4KNV A;  5EGY A;  4IWB A;  4M63 A;  5E3A A;  3B0V C;  3TD7 A;  4OIO F;  4CS8 A;  1TWC A;  2EIL C;  5DS4 A;  2QY9 A;  3LAY A;  4JCH A;  5D91 A;  1N1C A;  3EPV A;  2XL4 A;  1LS1 A;  1ZU5 A;  3SYN A;  2G62 A;  4G0H A;  3NYJ A;  2J45 A;  3ECS A;  4YJW A;  1VYI A;  3K1H A;  4ANJ A;  1NU9 C;  5DQT A;  3EQL F;  3O39 A;  2IOQ A;  4LAC B;  1LVK A;  4K0D A;  2YZS A;  3POV A;  1J8Y F;  2A68 F;  2PX0 A;  4KBL A;  1OCR C;  2W4M A;  3E70 C;  2PX3 A;  4ZLC A;  4OIP F;  4CSA C;  2EIK C;  4PJN A;  1D1A A;  2HV6 A;  2J7P D;  3NRH A;  4JW1 A;  2KJG A;  1G8X A;  1ZHY A;  5B1B C;  3EFO B;  3AG4 C;  2R7U A;  2Q9C A;  2HV7 A;  4G7H F;  2WVQ A;  5E2Q A;  4EWC A;  3UNG C;  4BJ5 A;  3QMK A;  4U5E E;  3EHN A;  5E3C A;  1O87 A;  3RH3 A;  3EZH A;  3K33 A;  3ABL C;  3AQC A;  3LEV A;  4DBQ A;  3LLK A;  3FVY A;  2R7Q A;  2J9U A;  1D1B A;  3UMH A;  4Q5S F;  5E33 A;  5B1A C;  4AX2 A;  4RD9 A;  2NG1 A;  2O9X A;  5L3Q A;  1TWH A;  4O6N A;  3K66 A;  1ST6 A;  4AE4 A;  2H7O A;  4CBE A;  2A6E F;  3EGX B;  2Y3B A;  3ZIB A;  2WZL A;  2J0X A;  4C7O B;  3DXJ F;  2J7P A;  1RJ9 A;  2XXA B;  2IXM A;  4DBR A;  3NG1 A;  2J46 A;  5L3V A;  1W2W A;  2CNW D;  1PD1 A;  1OKK D;  5DQZ A;  5EHH A;  5KYU B;  1M57 C;  3EGD A;  3SZR A;  4KC9 A;  2I8B A;  2L9J A;  2A6H F;  4A2N B;  3ASN C;  3GOD A;  5KYY B;  3DAG A;  1TWA A;  2KQ9 A;  4G7Z F;  4P6I C;  3EH2 A;  2L81 A;  2J9V A;  1VK5 A;  3EFO A;  3IEE A;  2EIN C;  2ZXW C;  3JYH A;  5KYX B;  2Y3D A;  2W4B A;  4JJF A;  2A1D D;  1VYK A;  4U5C E;  3S29 A;  4WJ0 A;  3NKD A;  4DVZ A;  1M56 C;  5DVW A;  3CZ6 A;  1Z3I X;  1Z6A A;  4GYT A;  4X0R A;  3Q7G A;  4FES A;  2MWQ A;  2IXP A;  4HE8 D;  4CS9 C;  2C04 A;  2NUP A;  2H7V C;  3VYW A;  2WL8 A;  2E87 A;  5F5F A;  3PMR A;  3DZA A;  2CNW A;  4IRU A;  1NZE A;  1VOM A;  2Q9A A;  4W8K A;  1LKX A;  4HEA J;  3JCU Q;  5D92 A;  3T4R A;  4HFK B;  4O6Y A;  1J8M F;  2Q3T A;  3UMK A;  1FFH A;  2C03 A;  3I5Q A;  4I1O B;  4YT2 A;  1ZYR F;  4OIQ F;  2G3V A;  3UMI A;  1BR1 A;  4JUR I;  2P7V A;  2OCC C;  3EG9 A;  1OCO C;  3S0X A;  1SMY F;  3B0U X;  3ASO C;  3W8I A;  4HFF B;  4J32 B;  1M2V A;  3Q6N A;  2XRH A;  1ZHZ A;  1O5H A;  4ULW A;  3ZVR A;  3KH2 A;  2H7B A;  2VH3 A;  2WZG A;  2GFH A;  1JPN A;  1V55 C;  3AQB A;  3KL4 A;  3NYM A;  4GEH A;  3GAN A;  4C3B A;  4C3D A;  2EIM C;  3W2W A;  4OIN F;  3L34 A;  2PFD A;  5KYW A;  2WVO A;  3UR3 C;  4YT4 A;  4PK4 A;  4BJ6 C;  4YWQ A;  1D1C A;  1MMN A;  3OA1 A;  4DOZ A;  3PHF 2;  3SNH A;  2KNH A;  2WVN A;  4LLE A;  2ZPA A;  2B0J A;  3N0T A;  3AG1 C;  5BUO A;  2OG2 A;  4O7G A;  3FDQ A;  1ZHX A;  4RBN A;  1VMA A;  2M4E A;  4MND A;  3EHM A;  1ZU4 A;  4Q7C A;  2X51 A;  4U5F E;  3LS1 A;  4LLC A;  5DS6 A;  4IJJ A;  3S28 A;  5KYN A;  1PD0 A;  1Z23 A;  3SP1 A;  1OCC C;  1S7Z A;  2R7X A;  3HTK C;  3LJB A;  1ZHT A;  2R7S A;  4YT5 A;  5FCL A;  4E7Z A;  4YN0 B;  2J0W A;  2WZF A;  4LER A;  4BJ1 A;  2MYS A;  3E9V A;  3V7O A;  1ZHW A;  2Z15 A;  3MLG A;  4OD5 A;  4U5B E;  5F5H A;  2Y69 C;  3RFY A;  4CS8 C;  3FHD A;  2R7O A;  3AG3 C;  4CSA A;  1QLE C;  3LS0 A;  1V54 C;  1KU2 A;  2YHS A;  4DVY P;  1MNE A;  3SEO A;  4EBB A;  3FAJ A;  3O6X A;  2ZXR A;  1FMV A;  1BR4 A;  3H65 A;  3OEO A;  4NY3 A;  4O79 A;  5T3T A;  5B3S C;  1JPJ A;  3JT1 A;  2Y3H A;  3DD7 A;  2CDQ A;  3AG2 C;  4JVS A;  3DJU B;  5IY5 C;  1WGW A;  3KKB A;  1NU7 D;  2IXO A;  3EJN A;  4KNW A;  2EIJ C;  1MMA A;  1QZX A;  3S27 A;  1IZM A;  3NYL A;  1OKK A;  2A69 F;  3Q7L A;  1FFT C;  3T6B A;  3Q6M A;  1MMG A;  2P6V A;  4K7B A;  4XWJ A;  3EGX A;  3DAF A;  3QZC A;  4BJ5 C;  2W45 A;  4H4K C;  4C7O A;  2V3C C;  5T3W A;  2XXA A;  5CI9 A;  4PFO A;  4XLP F;  2R7R A;  4I44 A;  2R7V A;  4ZLD A;  4IAO A;  3JRT A;  3WOD F;  3KMI A;  3LES A;  5KYU A;  2IXN A;  2NUT B;  3NKE A;  2CGE A;  3I4U A;  4J30 B;  1SF8 A;  5KYY A;  3HJC A;  3DM9 B;  3ABM C;  1FMW A;  3RIP A;  2PF4 E;  4AK9 A;  1SZI A;  4AE4 B;  3VAY A;  2KGO A;  4CIH A;  3N2Z B;  5KYX A;  3ABK C;  3EZI A;  2D5R B;  1RJ9 B;  4I1M A;  2J9W A;  3F46 A;  3K6B A;  4YT8 A;  3MX3 A;  4BG0 A;  3X2Q C;  2Y3G A;  3WG7 C;  3F47 A;  3EGD B;  1MND A;  3DJN B;  4CS9 A;  2V26 A;  4QI2 A;  3B9Q A;  2JD3 A;  2ZXP A;  1FTS A;  4I3M A;  4U5D E;  1TR2 A;  4JZA A;  4B6I A;  1MMD A;  3NDB B;  3UGP A;  3N24 A;  5DS5 A;  4PFP A;  1TKN A;  4FX5 A;  4E7S A;  4PJJ A;  1IW7 F;  4OD4 A;  4PJM A;  4MQ9 F;  1PCX A;  4RDA A;  2G3K A;  3B0P A;  3L0I A;  4U5H A;  3OWT A;  3W2V A;  2R7T A;  3DMD A;  3X1O A;  5T1D B;  2NUP B;  4CS7 A;  3CQZ A;  4C3E A;  3RKO F;  2NUT A;  2YEV A;  3EH1 A;  2DGJ A;  3HLZ A;  4PJL A;  1TWG A;  3ITF A;  4BEJ A;  5CI8 A;  2ZXO A;  1Z5Z A;  4U5G A;  2LSE A;  4KI2 A;  3K1I C;  3W8H A;  2WB7 A;  2KW3 C;  3ZC4 A;  2IYL D;  2VB6 A;  5HSW A;  2R7W A;  2BE5 F;  4BJ6 A;  4FWV A;  2PP4 A;  1M2O A;  2QTV A;  2Y39 A;  1Z63 A;  3ZG1 A;  3I5P A;  4QI0 A;  3EG9 B;  3T6J A;  1D0X A;  2FFH A;  1M2V B;  3CSK A;  1NG1 A;  1OCZ C;  1D0Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...