4A2NB

Crystal structure of ma-icmt
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
192
structure length
192
Chain Sequence
MNENLWKICFIVMFIIWVFVRKVYGTRAMKNKSKKKVRPNFEKSLVFLNFIGMVFLPLTAVFSSYLDSFNINLPDSIRLFALIVTFLNIGLFTKIHKDLGNNWSAILEIKDGHKLVKEGIYKNIRHPMYAHLWLWVITQGIILSNWVVLIFGIVAWAILYFIRVPKEEELLIEEFGDEYIEYMGKTGRLFPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords ISOPRENYLCYSTEINE CARBOXYL METHYLTRANSFERASE
publication title Mechanism of Isoprenylcysteine Carboxyl Methylation from the Crystal Structure of the Integral Membrane Methyltransferase Icmt.
pubmed doi rcsb
source organism Methanosarcina acetivorans
total genus 65
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2011-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04140 ICMT Isoprenylcysteine carboxyl methyltransferase (ICMT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1630 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4a2nB00
4A2NB
chains in the Genus database with same CATH superfamily
2GFHA 2YWAA 4CIPA 2CNWD 3IQ6A 4J7YA 1V4AA 1YLMA 1D1CA 5JSLA 1LE2A 3EHNA 2BL2A 3FHDA 3K33A 1Y6DA 4C3DA 1E2XA 2GAQA 3N2ZB 1ZHYA 2A6HF 2CW0F 1V54C 5B1BC 4N6CA 3TOMA 2OOCA 5DLJA 2AU5A 1RXQA 4PJJA 2JD3A 1FTSA 1M57C 1VK5A 3RH3A 4AE4B 1RKEB 4CJOA 2IXMA 4N4WA 3C8GB 1TWCA 2VCCA 3TULA 3S84A 3V5ZA 3VRCA 2YZSA 1PV3A 3JRTA 4JEAA 3EQLF 2YVKA 2ZPAA 4CS8A 1AUEA 4IARA 1U0BB 1OQCA 1Y4CA 2XM0A 5IY5C 1O5HA 2I15A 4MTOA 1YVIA 1HY5A 2WVQA 1D0YA 1NSGB 2DGJA 3UGPA 3HNKA 4E0IA 1JMWA 1G4WR 3BRJA 3IQTA 4JJGA 1ZW2A 3AOUA 1WASA 2HUJA 1OKKA 2ASRA 3QTHA 4IGGA 3VM6A 5K0IA 1BZ4A 1N1CA 2WZLA 2Q9AA 4QDLA 3F47A 1ZHZA 2XLOA 2XM4A 3ZTZA 1M56C 4Z9JA 4P6IC 3QVYA 1G4US 1LI7A 3U5SA 4G7HF 2XXAA 1T6QA 2J8WA 4DBQA 2OJED 1Z5ZA 2L7AA 4CDVA 1H6GA 3A9CA 1JOGA 4NCQA 4MNDA 4U5GA 1EKYA 5BQGA 5TJ5E 2OJQA 3AG2C 3SXMA 5L0FA 1EI7A 2AWCA 4OIRF 3EG9A 1TFKB 3LLKA 4U5FE 2IBFA 2Q00A 4CIHA 2C03A 2R03A 2Y3HA 4BJ1A 3AG4C 1Z3IX 2Y39A 4IAOA 1ORJA 1OW6A 3DKAA 3NMIA 4XPWA 1LE4A 5EHHA 2R7OA 3AGTA 5KYUB 1GQAA 1MMDA 2LIGA 2VASA 2VCBA 3MX3A 1AEPA 4LDRA 2J46A 1TWAA 3RKOF 4K1OA 4OD5A 5A6JA 2A0UA 4LLCA 3V5YA 5KYXB 3G4ZA 2EPLX 1QKRA 2VB6A 4DRJB 2EPMX 2JPUA 2Y3DA 3K7DA 3WODF 2HJMA 1K04A 2A6EF 4CS7A 4M63A 5F5FA 3EGXA 3AG3C 4NQFA 1T9KA 5L0IA 3LNRA 1OKKD 2EINC 3GM3A 4YL3A 2Q3TA 3LS1A 5KYNA 2XL6A 3OEOA 1Q0DA 1T5OA 2XL8A 5GPGB 3POVA 1A7DA 2KYHA 1U89A 4QI0A 2WVNA 1NFOA 4D4XA 1CPQA 3EGDB 5HV9A 5DS4A 3US6A 1D0XA 1CGNA 4MVRA 2YEVA 3VYWA 1QQ3A 1YZAA 1HMOA 2R7XA 1QSPA 2GWWA 2WL8A 3LEVA 4NTBA 2HMZA 3WG7C 2WVOA 1LKXA 3HTKC 5E2QA 4E7SA 1EQ1A 1C03A 1TR2A 4IWBA 3DI5A 3TQOA 5JLIA 1YJGA 3DM5A 3JSEO 1LS1A 3FMSA 4JKVA 1FFHA 3EJNA 2KQ9A 4ULWA 5KYYA 4EKWA 2MHRA 2XS1A 5JRAA 1NZEA 2QLAA 3F46A 3MYIA 2LK4A 1D1AA 2VCAA 2WB7A 2XLEA 2MYSA 4G7ZF 1I4ZA 4W8KA 3ATPA 3ZWIA 3NYMA 3O6XA 3U2LA 1K05A 1TKNA 4PJMA 1H9TA 4D4NA 2Q9CA 3O55A 1NFNA 1OW7A 3C18A 3V7OA 2PP4A 1VTMP 1E86A 2DB4A 4FAPB 3W2WA 1NU7D 4NTAA 2J45A 4CX9A 3VF0A 3W2VA 4B6IA 3FOOA 3LS0A 4IJJA 4Z9HA 2YL3A 3SNHA 3LLIA 1MQVA 1HMDA 4MVUA 3SXZA 4C7OB 3SP1A 3SYNA 3LAYA 5JVEA 3GODA 2ZXWC 4KBLA 1Q0GA 3M15A 2DYRC 3S28A 1ZU5A 1T6IA 1WGWA 3DAFA 3DZAA 3QW0A 3ITFA 2HJ3A 3UMIA 2NSGA 2XL4A 4CJGA 2J0WA 3RQGA 4LLEA 4EUKB 5JT4A 4OD4A 5HSWA 3AGUA 3M1CB 4CDAA 1KTMA 2J9UA 1J8MF 3H65A 4WGYA 4JW1A 3PDMP 4OIPF 4XEVA 1WN0A 1LIHA 2KK1A 3U2MA 3S90A 1VOMA 3HNJA 4PK4A 5B1AC 3EPVA 3ZVRA 1O87A 3NKDA 2P1AA 1M2VA 1PD0A 2QTVA 2KW3C 3FAJA 3PCVA 1TWGA 4HEAJ 3JCUQ 3MBGA 2L9JA 4BG0A 2QE9A 4IB4A 3GEIA 3KL4A 4P9TA 4DVYP 1IW7F 3M79A 1QZXA 1G8XA 1SYQA 2HZ8A 1WWPA 3DD7A 2IYLD 3ABLC 2G3VA 1Q0FA 3EZHA 4XEKA 2A69F 2J9VA 3O39A 4O6NA 3T6GB 3DJNB 4JEBA 5A6AA 1M2OA 3JYHA 4N6HA 3GWNA 5EK0A 4DRHB 3OWTA 2X0CA 1RJ9A 4Q7CA 4E0HA 4HFKB 5L3QA 5T3TA 2PF4E 1I4YA 3R2PA 1NBBA 1OW8A 4PACA 3CQZA 3KMIA 1GS9A 1MMAA 3CEXA 1KU2A 3X2QC 3IPMO 4A2NB 4U5HA 1JRAA 4EHPA 5AC5A 2VC9A 2GDCA 2XXAB 4MS2A 4K7BA 1FR0A 1Z23A 1LI5A 5BQIA 3RW0A 5DQZA 2XRHA 2KNHA 2L81A 3U3FA 4H4KC 1D0ZA 4XQ1A 2P61A 1DOVA 1ORSC 2AP3A 2JX0A 3KYJA 5BUOA 2A1DD 1DOWA 1FMWA 3OA1A 2YLIA 3PMRA 4EBBA 4XEFA 2XSEA 3WHNA 1VYIA 2HKVA 2YL1A 3HKKA 3EG9B 3EH2A 3MFNA 3Q7GA 1ZHWA 2LFFA 4JE9A 5COMA 3ZDLA 4BPMA 1BR1A 1WATA 3S9OA 2R7QA 2NSFA 3LESA 4ER9A 5T1DB 2G62A 2FFHA 4EBJA 2AWYA 4FESA 1H9GA 2D5RB 4RD9A 2OKUA 3QW1A 2R7TA 1U6HA 1LS4A 1YYJA 2CGEA 3HNLA 3L0IA 4MVOA 3T6JA 4KNWA 3U8VA 5JP7A 4YJWA 4JJFA 4BJ5A 3HJCA 1OCOC 4JCZA 3ABMC 1MMGA 3AJMA 4DOZA 3JT1A 3W4YA 3K1IC 2Q9BA 2CDQA 3QVZA 4YK5A 3NYJA 3ZSUA 1YZCA 4I1MA 3EFOA 3NYLA 4MW3A 4JVSA 1F1MA 3JZ0A 4JTAB 4RDAA 3RF3A 2EIJC 3EGXB 2B0JA 4J7TA 1VMAA 2W4BA 2R7UA 2YL7A 3L1MA 5E3AA 1MNDA 4DJ9A 1W2WA 1A7VA 1OCRC 4U9EA 2EPKX 4HFFB 3ZC4A 3U9JA 4PFOA 3SEOA 1BBHA 4XWJA 1YA9A 2OEXA 1BR2A 2XLDA 2YKZA 4JURI 1SR2A 2ZXRA 3DAGA 4WABA 3S27A 4EWCA 3CSKA 3ECSA 3GWLA 4YWQA 3TK0A 2LQGA 3KKBA 1Z6AA 3BEHA 3Q6NA 3RFYA 1UFBA 4U5BE 2KSFA 4FWVA 3DE8A 2HFIA 2MWQA 3M4CA 1SF8A 4CSAC 1BR4A 4CDYA 4XLPF 2G3KA 4YT5A 2HV6A 4ZLDA 4OIQF 3DJUB 1QPUA 2WZFA 3GORA 3IEEA 4PJNA 5CI8A 4R32A 3RVYA 5L0DA 5L0JA 4JTDB 4X0RA 4JIOA 3G4XA 4E7ZA 5A6KA 5KYYB 2M64A 3L8JA 4AL1A 3H2UA 1K40A 1TFOB 4YT8A 1TQGA 1YA7O 4LDKA 1E84A 3C7JA 4W8PA 2NUTA 2P0NA 4U5CE 4IAQA 2UUHA 1ZHXA 3O10A 4PR9A 1YAUO 2P7VA 3LNMB 4NY3A 3RVZA 4ONSA 2B0HA 1J8YF 3ZQYA 4ANJA 1A0BA 4U5DE 5DQTA 2XLHA 1JAFA 1L7CA 2ZD9A 1OXBA 5JS5A 2LSEA 3HLZA 4LERA 1YARO 2R02A 2L6GA 3U8PA 4MTGA 1WTYA 3FDQA 4BJTA 5F5HA 5CIVA 1IZMA 1GM5A 5COGA 3J06A 2YLGA 2ETSA 4EIYA 2E87A 4CS9C 2Y3BA 4GQHA 5L0HA 2NUPA 5COFA 1AVOB 256BA 2R9RB 2EIKC 2PBEA 4O7GA 1YYXA 5AC4A 3UNGC 4NTFA 3DE9A 3GEEA 1ZYRF 1HE9A 1RKCA 2A0BA 4O6MA 4XLNF 1CGOA 1XZPA 2DYSC 1I5NA 2EPNA 2LCHA 2Z15A 2ZXPA 3E70C 2KGOA 3KYIA 2CYDA 1CGME 3WAQA 3KH2A 1D1BA 1HW1A 3LJBA 2OQMA 3GM2A 5E3CA 3RIPA 4C3EA 3I5PA 2QNLA 3HNIA 1VYKA 2H8AA 3JTLO 4N06A 4PFPA 5KYWA 1CPRA 1SZIA 1M2VB 1VB5A 3T4RA 4YT2A 4BJ6C 3MLGA 3FOPA 4WJ0A 5FZTA 4MVQA 1Q0MA 2M4EA 4O79A 4KC9A 4E18A 2J9WA 5E33A 2C04A 1S05A 2YHSA 1FNTc 1M6TA 2FGYA 5CI9A 3N24A 1FMVA 4HE8D 1R4TA 3LUTB 3T6BA 4LDQA 4AL0A 4DBRA 4ZLCA 2OU6A 1Q0KA 1RJ9B 4H54A 2RSEB 3K6BA 1MNEA 4XPXA 3S29A 2IXNA 2J9BA 3EZIA 3N0TA 3RQEA 3RYLA 5B3SC 4Q5SF 3B0PA 4RBNA 4P9FA 4PJLA 1HE1A 3U9MA 4BEJA 3UGOA 1FAPB 4DXWA 3K1HA 4GEHA 1S7ZA 2XLWA 1OXKA 2LD6A 2W4MA 5B3IA 5L3VA 4AX2A 4AE4A 2W45A 1RKEA 3NRHA 4I3MA 1NLXA 4F4BA 4YT4A 1E83A 2J7PA 4JC7A 1EA8A 3C62A 3C8GA 3DMDA 4JZAA 1TWHA 2XLVA 2AVKA 2Q4FA 4QI2A 2KC3A 1O3UA 4MW8A 3K1IA 5DS6A 4FX5A 1V55C 3V5XA 5A6BA 1G5ZA 1JPNA 1LPEA 3ZTMA 1NG1A 3B71A 2OG2A 1GGQA 3CZ6A 4MVSA 4MVMA 2BC5A 3EHMA 1WOLA 2HV7A 3JYYA 1QVXA 2IXOA 2IXPA 5A69A 4UDVA 1ZU4A 1APCA 2PNOA 3EH1A 1BDJB 4JCHA 3E9VA 3TJ6A 4EBKA 4JTCB 2HMQA 5BQHA 3VAYA 1V74B 1R5ID 1XWJA 1QLEC 4U5EE 3UMKA 3L8IA 3SXKA 1Z63A 2F22A 4XTKA 1KNYA 1SMYF 4I1OB 3DWWA 2IOQA 2LP4A 3EFOB 3NG1A 4CS8C 3X1OA 4CSAA 5DS5A 1YDIA 1ZVZA 2A68F 2L6HA 1E85A 2H7OA 4IRUA 2QUPA 2UUIA 3RQFA 3ABKC 3AQCA 2BE5F 4WGZA 2Q7RA 2HS5A 4CBEA 3W8HA 3C8ZA 4K0DA 1A41A 3I4UA 4JRZA 3A11A 3CAXA 4Z9IA 2DI3A 2EILC 3IHUA 1T6UA 2J7PD 1UG7A 3FXHA 3C8GD 3JSZA 2R7SA 1L3PA 3QMKA 2IM8A 5KYUA 2R7RA 4YN0B 4AK9A 4LACB 3TJ5A 5EGYA 2V3CC 3NDBB 3MYFA 4YL1A 3G50A 3NKEA 1C02A 4DVZA 2QY9A 1XZQA 4KNVA 3ZG1A 2LFDA 1OR3A 4YL0A 5A6BD 5KYXA 2H7VC 4C3BA 2R25A 2XS8A 3W8IA 2YLDA 2P6VA 4NC3A 4BEMJ 1ZZPA 2D4UA 2YL0A 1VLSA 3B29A 3GM1A 3AQBA 2YQYA 3PHF2 4MQ9F 1ORYA 1MMNA 2H7BA 3M4BA 5F28E 4Q4ZF 5JUAA 3NMJA 1VLTA 4J30B 3T9OA 4CS9A 3IQCA 2YRFA 3B0UX 2CCYA 3GANA 2EPOA 3SXYA 4BJ5C 3TD7A 4L6RA 2NUTB 3EGDA 1A7EA 4G0HA 3ZQVA 3IQ5A 2NG1A 2PFDA 1B68A 3QZCA 5AGFA 3ZIBA 5FCLA 2Y3GA 1OCCC 2R05A 4U9DA 5L0GA 3GEHA 2FAPB 2CNWA 1JPJA 3UMHA 4GYTA 2X51A 3FAPB 1T01A 2Y69C 4OINF 3ASOC 1RCPA 2I8BA 3KPHA 4MVZA 2ICWG 3C63A 1PD1A 2OEVA 2OCCC 3L34A 1HW2A 2HSBA 2WZGA 2NUPB 3U3BA 2NPUA 2XLMA 5T3WA 4DRIB 4BJ6A 2PX0A 1FFTC 4J32B 1LM3B 2GA0A 4G7OF 1OR2A 2HSQA 3LEOA 3ASNC 5D92A 2L6FA 2VH3A 3R7CA 2R7WA 2EIMC 3Q6MA 1Z7Qc 3K66A 4ULVA 3JRMO 2O9XA 2RD9A 3H2VA 2KJGA 5DVWA 4XPYA 3TOLA 1OCZC 3FVYA 3UR3C 5KYWB 3B0VC 1ST6A 4OIOF 1NU9C 2PX3A 1RMVA 4MTFA 2W9YA 1ZHTA 4G78A 3AG1C 3DM9B 3NMKA 5D91A 3S0XA 3SZRA 1LVKA 2ZXOA 4KI2A 2V26A 3B9QA 2TMVP 4C7OA 1C17M 4I44A 1PCXA 1JR8A 3I5QA 3Q7LA 5L0CA 3DXJF 4O6YA 4E17A 2R7VA 4A4AA 3U0CA 1ZW3A 2J0XA 1H7IA
chains in the Genus database with same CATH topology
2GFHA 2CNWD 1D1CA 3EHNA 3FHDA 3K33A 4C3DA 3N2ZB 1ZHYA 2A6HF 2CW0F 1V54C 5B1BC 5DLJA 4PJJA 2JD3A 1FTSA 1M57C 1VK5A 3RH3A 4AE4B 2IXMA 1TWCA 2YZSA 3JRTA 3EQLF 2ZPAA 4CS8A 5IY5C 1O5HA 2WVQA 1D0YA 2DGJA 3UGPA 4JJGA 1OKKA 1N1CA 2WZLA 2Q9AA 4QDLA 3F47A 1ZHZA 1M56C 4P6IC 2XXAA 4G7HF 4DBQA 1Z5ZA 4MNDA 4U5GA 3AG2C 4OIRF 3EG9A 3LLKA 4U5FE 4CIHA 2C03A 2Y3HA 4BJ1A 3AG4C 1Z3IX 2Y39A 4IAOA 5EHHA 2R7OA 5KYUB 1MMDA 2VASA 3MX3A 2J46A 1TWAA 3RKOF 4OD5A 4LLCA 5KYXB 2VB6A 3K7DA 2Y3DA 3WODF 2A6EF 4CS7A 4M63A 3EGXA 3AG3C 3LNRA 1OKKD 2EINC 2Q3TA 3LS1A 5KYNA 3OEOA 3POVA 4QI0A 2WVNA 3EGDB 5DS4A 1D0XA 2YEVA 3VYWA 2R7XA 2WL8A 3LEVA 3WG7C 2WVOA 1LKXA 3HTKC 5E2QA 4E7SA 1TR2A 4IWBA 3DM5A 1LS1A 1FFHA 3EJNA 2KQ9A 4ULWA 5KYYA 3F46A 1NZEA 1D1AA 2WB7A 2MYSA 4G7ZF 4W8KA 3NYMA 3O6XA 4PJMA 1TKNA 2Q9CA 3V7OA 2PP4A 3W2WA 1NU7D 2J45A 3W2VA 4B6IA 4IJJA 3LS0A 3SNHA 3LLIA 4C7OB 3SP1A 3SYNA 3LAYA 3GODA 2ZXWC 4KBLA 2DYRC 3S28A 1ZU5A 1WGWA 3DAFA 3DZAA 3ITFA 3UMIA 2XL4A 2J0WA 4LLEA 4OD4A 5HSWA 3M1CB 2J9UA 1J8MF 3H65A 4JW1A 4OIPF 1VOMA 4PK4A 5B1AC 3EPVA 3ZVRA 1O87A 3NKDA 2QTVA 1M2VA 1PD0A 2KW3C 3FAJA 4HEAJ 1TWGA 3JCUQ 4BG0A 2L9JA 4DVYP 3KL4A 1IW7F 1QZXA 1G8XA 3DD7A 2IYLD 3ABLC 2G3VA 3EZHA 2A69F 2J9VA 3O39A 4O6NA 3DJNB 1M2OA 3JYHA 3OWTA 1RJ9A 4Q7CA 4HFKB 5L3QA 5T3TA 2PF4E 3CQZA 3KMIA 3X2QC 1MMAA 1KU2A 4A2NB 4U5HA 2XXAB 4K7BA 1Z23A 5DQZA 2XRHA 2KNHA 2L81A 4H4KC 1D0ZA 5BUOA 2A1DD 3OA1A 1FMWA 3PMRA 4EBBA 2XSEA 1VYIA 3Q7GA 3EG9B 3EH2A 1ZHWA 1BR1A 2R7QA 3LESA 5T1DB 2G62A 2FFHA 4FESA 2D5RB 4RD9A 2R7TA 3L0IA 2CGEA 3T6JA 4KNWA 4BJ5A 4YJWA 4JJFA 3HJCA 1OCOC 3ABMC 1MMGA 4DOZA 3JT1A 3K1IC 2Q9BA 2CDQA 3NYJA 3ZSUA 4I1MA 3EFOA 3NYLA 4JVSA 4RDAA 2EIJC 3EGXB 2B0JA 1VMAA 2W4BA 2R7UA 5E3AA 1MNDA 1W2WA 1OCRC 4HFFB 3ZC4A 4PFOA 3SEOA 4XWJA 1BR2A 3S27A 4EWCA 4JURI 2ZXRA 3DAGA 4YWQA 3CSKA 3ECSA 3KKBA 1Z6AA 3Q6NA 3RFYA 4U5BE 4FWVA 2MWQA 4CSAC 1SF8A 1BR4A 4XLPF 2G3KA 4YT5A 2HV6A 4ZLDA 4OIQF 3DJUB 2WZFA 3IEEA 5CI8A 4PJNA 4X0RA 4E7ZA 5KYYB 4YT8A 2NUTA 4U5CE 1ZHXA 4NY3A 2P7VA 1J8YF 4ANJA 4U5DE 5DQTA 2LSEA 3HLZA 4LERA 3FDQA 4BJTA 5F5HA 1IZMA 2E87A 4CS9C 2Y3BA 2NUPA 2EIKC 4O7GA 3UNGC 1ZYRF 4O6MA 4XLNF 2ZXPA 2DYSC 2Z15A 3E70C 2KGOA 3KH2A 1D1BA 3LJBA 5E3CA 3RIPA 4C3EA 3I5PA 4N06A 5KYWA 1VYKA 4PFPA 1SZIA 1M2VB 3T4RA 4YT2A 4BJ6C 3MLGA 4WJ0A 2M4EA 4O79A 4KC9A 2J9WA 5E33A 2C04A 2YHSA 2FGYA 5CI9A 3N24A 1FMVA 4HE8D 3T6BA 4DBRA 4ZLCA 1RJ9B 3K6BA 1MNEA 3S29A 2IXNA 3EZIA 3N0TA 5B3SC 3RYLA 4Q5SF 3B0PA 4RBNA 4PJLA 4BEJA 3UGOA 3K1HA 4GEHA 1S7ZA 5L3VA 2W4MA 4AX2A 4AE4A 2W45A 3NRHA 4I3MA 4YT4A 2J7PA 4JZAA 3DMDA 1TWHA 4QI2A 5DS6A 4FX5A 1V55C 1JPNA 1NG1A 2OG2A 3CZ6A 3EHMA 2HV7A 2IXOA 2IXPA 1ZU4A 3EH1A 4JCHA 3E9VA 3VAYA 1QLEC 4U5EE 3UMKA 1Z63A 4XTKA 4I1OB 1SMYF 2IOQA 4CS8C 3EFOB 3NG1A 3X1OA 4CSAA 5DS5A 2A68F 2H7OA 4IRUA 3ABKC 3AQCA 2BE5F 4CBEA 3W8HA 4K0DA 3I4UA 2EILC 2J7PD 3JSZA 2R7SA 3QMKA 5KYUA 2R7RA 4YN0B 4AK9A 4LACB 5EGYA 2V3CC 3NDBB 4DVZA 3NKEA 5F5FA 2QY9A 3ZG1A 4KNVA 5KYXA 2H7VC 4C3BA 3W8IA 2P6VA 3AQBA 3PHF2 4MQ9F 1MMNA 2H7BA 4Q4ZF 4J30B 4CS9A 3B0UX 4BJ5C 3GANA 3TD7A 2NUTB 3EGDA 4G0HA 2NG1A 2PFDA 3QZCA 5FCLA 3ZIBA 2Y3GA 1OCCC 2CNWA 1JPJA 3UMHA 4GYTA 2X51A 2Y69C 4OINF 3ASOC 2I8BA 1PD1A 2OCCC 3L34A 2WZGA 2NUPB 4F4BA 5T3WA 4BJ6A 2PX0A 1FFTC 4J32B 4G7OF 3ASNC 5D92A 2VH3A 2R7WA 2EIMC 3Q6MA 3K66A 2O9XA 2KJGA 5DVWA 1OCZC 3FVYA 3UR3C 5KYWB 3B0VC 1ST6A 4OIOF 1NU9C 2PX3A 2W9YA 1ZHTA 3AG1C 3DM9B 5D91A 3S0XA 3SZRA 1LVKA 2ZXOA 4KI2A 2V26A 3B9QA 4C7OA 4I44A 1PCXA 3I5QA 3Q7LA 3DXJF 4O6YA 2R7VA 2J0XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A2N B; 
#chains in the Genus database with same CATH topology
 2GFH A;  2YWA A;  4CIP A;  2CNW D;  3IQ6 A;  4J7Y A;  1V4A A;  1YLM A;  1D1C A;  5JSL A;  1LE2 A;  3EHN A;  2BL2 A;  3FHD A;  3K33 A;  1Y6D A;  4C3D A;  1E2X A;  2GAQ A;  3N2Z B;  1ZHY A;  2A6H F;  2CW0 F;  1V54 C;  5B1B C;  4N6C A;  3TOM A;  2OOC A;  5DLJ A;  2AU5 A;  1RXQ A;  4PJJ A;  2JD3 A;  1FTS A;  1M57 C;  1VK5 A;  3RH3 A;  4AE4 B;  1RKE B;  4CJO A;  2IXM A;  4N4W A;  3C8G B;  1TWC A;  2VCC A;  3TUL A;  3S84 A;  3V5Z A;  3VRC A;  2YZS A;  1PV3 A;  3JRT A;  4JEA A;  3EQL F;  2YVK A;  2ZPA A;  4CS8 A;  1AUE A;  4IAR A;  1U0B B;  1OQC A;  1Y4C A;  2XM0 A;  5IY5 C;  1O5H A;  2I15 A;  4MTO A;  1YVI A;  1HY5 A;  2WVQ A;  1D0Y A;  1NSG B;  2DGJ A;  3UGP A;  3HNK A;  4E0I A;  1JMW A;  1G4W R;  3BRJ A;  3IQT A;  4JJG A;  1ZW2 A;  3AOU A;  1WAS A;  2HUJ A;  1OKK A;  2ASR A;  3QTH A;  4IGG A;  3VM6 A;  5K0I A;  1BZ4 A;  1N1C A;  2WZL A;  2Q9A A;  4QDL A;  3F47 A;  1ZHZ A;  2XLO A;  2XM4 A;  3ZTZ A;  1M56 C;  4Z9J A;  4P6I C;  3QVY A;  1G4U S;  1LI7 A;  3U5S A;  4G7H F;  2XXA A;  1T6Q A;  2J8W A;  4DBQ A;  2OJE D;  1Z5Z A;  2L7A A;  4CDV A;  1H6G A;  3A9C A;  1JOG A;  4NCQ A;  4MND A;  4U5G A;  1EKY A;  5BQG A;  5TJ5 E;  2OJQ A;  3AG2 C;  3SXM A;  5L0F A;  1EI7 A;  2AWC A;  4OIR F;  3EG9 A;  1TFK B;  3LLK A;  4U5F E;  2IBF A;  2Q00 A;  4CIH A;  2C03 A;  2R03 A;  2Y3H A;  4BJ1 A;  3AG4 C;  1Z3I X;  2Y39 A;  4IAO A;  1ORJ A;  1OW6 A;  3DKA A;  3NMI A;  4XPW A;  1LE4 A;  5EHH A;  2R7O A;  3AGT A;  5KYU B;  1GQA A;  1MMD A;  2LIG A;  2VAS A;  2VCB A;  3MX3 A;  1AEP A;  4LDR A;  2J46 A;  1TWA A;  3RKO F;  4K1O A;  4OD5 A;  5A6J A;  2A0U A;  4LLC A;  3V5Y A;  5KYX B;  3G4Z A;  2EPL X;  1QKR A;  2VB6 A;  4DRJ B;  2EPM X;  2JPU A;  2Y3D A;  3K7D A;  3WOD F;  2HJM A;  1K04 A;  2A6E F;  4CS7 A;  4M63 A;  5F5F A;  3EGX A;  3AG3 C;  4NQF A;  1T9K A;  5L0I A;  3LNR A;  1OKK D;  2EIN C;  3GM3 A;  4YL3 A;  2Q3T A;  3LS1 A;  5KYN A;  2XL6 A;  3OEO A;  1Q0D A;  1T5O A;  2XL8 A;  5GPG B;  3POV A;  1A7D A;  2KYH A;  1U89 A;  4QI0 A;  2WVN A;  1NFO A;  4D4X A;  1CPQ A;  3EGD B;  5HV9 A;  5DS4 A;  3US6 A;  1D0X A;  1CGN A;  4MVR A;  2YEV A;  3VYW A;  1QQ3 A;  1YZA A;  1HMO A;  2R7X A;  1QSP A;  2GWW A;  2WL8 A;  3LEV A;  4NTB A;  2HMZ A;  3WG7 C;  2WVO A;  1LKX A;  3HTK C;  5E2Q A;  4E7S A;  1EQ1 A;  1C03 A;  1TR2 A;  4IWB A;  3DI5 A;  3TQO A;  5JLI A;  1YJG A;  3DM5 A;  3JSE O;  1LS1 A;  3FMS A;  4JKV A;  1FFH A;  3EJN A;  2KQ9 A;  4ULW A;  5KYY A;  4EKW A;  2MHR A;  2XS1 A;  5JRA A;  1NZE A;  2QLA A;  3F46 A;  3MYI A;  2LK4 A;  1D1A A;  2VCA A;  2WB7 A;  2XLE A;  2MYS A;  4G7Z F;  1I4Z A;  4W8K A;  3ATP A;  3ZWI A;  3NYM A;  3O6X A;  3U2L A;  1K05 A;  1TKN A;  4PJM A;  1H9T A;  4D4N A;  2Q9C A;  3O55 A;  1NFN A;  1OW7 A;  3C18 A;  3V7O A;  2PP4 A;  1VTM P;  1E86 A;  2DB4 A;  4FAP B;  3W2W A;  1NU7 D;  4NTA A;  2J45 A;  4CX9 A;  3VF0 A;  3W2V A;  4B6I A;  3FOO A;  3LS0 A;  4IJJ A;  4Z9H A;  2YL3 A;  3SNH A;  3LLI A;  1MQV A;  1HMD A;  4MVU A;  3SXZ A;  4C7O B;  3SP1 A;  3SYN A;  3LAY A;  5JVE A;  3GOD A;  2ZXW C;  4KBL A;  1Q0G A;  3M15 A;  2DYR C;  3S28 A;  1ZU5 A;  1T6I A;  1WGW A;  3DAF A;  3DZA A;  3QW0 A;  3ITF A;  2HJ3 A;  3UMI A;  2NSG A;  2XL4 A;  4CJG A;  2J0W A;  3RQG A;  4LLE A;  4EUK B;  5JT4 A;  4OD4 A;  5HSW A;  3AGU A;  3M1C B;  4CDA A;  1KTM A;  2J9U A;  1J8M F;  3H65 A;  4WGY A;  4JW1 A;  3PDM P;  4OIP F;  4XEV A;  1WN0 A;  1LIH A;  2KK1 A;  3U2M A;  3S90 A;  1VOM A;  3HNJ A;  4PK4 A;  5B1A C;  3EPV A;  3ZVR A;  1O87 A;  3NKD A;  2P1A A;  1M2V A;  1PD0 A;  2QTV A;  2KW3 C;  3FAJ A;  3PCV A;  1TWG A;  4HEA J;  3JCU Q;  3MBG A;  2L9J A;  4BG0 A;  2QE9 A;  4IB4 A;  3GEI A;  3KL4 A;  4P9T A;  4DVY P;  1IW7 F;  3M79 A;  1QZX A;  1G8X A;  1SYQ A;  2HZ8 A;  1WWP A;  3DD7 A;  2IYL D;  3ABL C;  2G3V A;  1Q0F A;  3EZH A;  4XEK A;  2A69 F;  2J9V A;  3O39 A;  4O6N A;  3T6G B;  3DJN B;  4JEB A;  5A6A A;  1M2O A;  3JYH A;  4N6H A;  3GWN A;  5EK0 A;  4DRH B;  3OWT A;  2X0C A;  1RJ9 A;  4Q7C A;  4E0H A;  4HFK B;  5L3Q A;  5T3T A;  2PF4 E;  1I4Y A;  3R2P A;  1NBB A;  1OW8 A;  4PAC A;  3CQZ A;  3KMI A;  1GS9 A;  1MMA A;  3CEX A;  1KU2 A;  3X2Q C;  3IPM O;  4A2N B;  4U5H A;  1JRA A;  4EHP A;  5AC5 A;  2VC9 A;  2GDC A;  2XXA B;  4MS2 A;  4K7B A;  1FR0 A;  1Z23 A;  1LI5 A;  5BQI A;  3RW0 A;  5DQZ A;  2XRH A;  2KNH A;  2L81 A;  3U3F A;  4H4K C;  1D0Z A;  4XQ1 A;  2P61 A;  1DOV A;  1ORS C;  2AP3 A;  2JX0 A;  3KYJ A;  5BUO A;  2A1D D;  1DOW A;  1FMW A;  3OA1 A;  2YLI A;  3PMR A;  4EBB A;  4XEF A;  2XSE A;  3WHN A;  1VYI A;  2HKV A;  2YL1 A;  3HKK A;  3EG9 B;  3EH2 A;  3MFN A;  3Q7G A;  1ZHW A;  2LFF A;  4JE9 A;  5COM A;  3ZDL A;  4BPM A;  1BR1 A;  1WAT A;  3S9O A;  2R7Q A;  2NSF A;  3LES A;  4ER9 A;  5T1D B;  2G62 A;  2FFH A;  4EBJ A;  2AWY A;  4FES A;  1H9G A;  2D5R B;  4RD9 A;  2OKU A;  3QW1 A;  2R7T A;  1U6H A;  1LS4 A;  1YYJ A;  2CGE A;  3HNL A;  3L0I A;  4MVO A;  3T6J A;  4KNW A;  3U8V A;  5JP7 A;  4YJW A;  4JJF A;  4BJ5 A;  3HJC A;  1OCO C;  4JCZ A;  3ABM C;  1MMG A;  3AJM A;  4DOZ A;  3JT1 A;  3W4Y A;  3K1I C;  2Q9B A;  2CDQ A;  3QVZ A;  4YK5 A;  3NYJ A;  3ZSU A;  1YZC A;  4I1M A;  3EFO A;  3NYL A;  4MW3 A;  4JVS A;  1F1M A;  3JZ0 A;  4JTA B;  4RDA A;  3RF3 A;  2EIJ C;  3EGX B;  2B0J A;  4J7T A;  1VMA A;  2W4B A;  2R7U A;  2YL7 A;  3L1M A;  5E3A A;  1MND A;  4DJ9 A;  1W2W A;  1A7V A;  1OCR C;  4U9E A;  2EPK X;  4HFF B;  3ZC4 A;  3U9J A;  4PFO A;  3SEO A;  1BBH A;  4XWJ A;  1YA9 A;  2OEX A;  1BR2 A;  2XLD A;  2YKZ A;  4JUR I;  1SR2 A;  2ZXR A;  3DAG A;  4WAB A;  3S27 A;  4EWC A;  3CSK A;  3ECS A;  3GWL A;  4YWQ A;  3TK0 A;  2LQG A;  3KKB A;  1Z6A A;  3BEH A;  3Q6N A;  3RFY A;  1UFB A;  4U5B E;  2KSF A;  4FWV A;  3DE8 A;  2HFI A;  2MWQ A;  3M4C A;  1SF8 A;  4CSA C;  1BR4 A;  4CDY A;  4XLP F;  2G3K A;  4YT5 A;  2HV6 A;  4ZLD A;  4OIQ F;  3DJU B;  1QPU A;  2WZF A;  3GOR A;  3IEE A;  4PJN A;  5CI8 A;  4R32 A;  3RVY A;  5L0D A;  5L0J A;  4JTD B;  4X0R A;  4JIO A;  3G4X A;  4E7Z A;  5A6K A;  5KYY B;  2M64 A;  3L8J A;  4AL1 A;  3H2U A;  1K40 A;  1TFO B;  4YT8 A;  1TQG A;  1YA7 O;  4LDK A;  1E84 A;  3C7J A;  4W8P A;  2NUT A;  2P0N A;  4U5C E;  4IAQ A;  2UUH A;  1ZHX A;  3O10 A;  4PR9 A;  1YAU O;  2P7V A;  3LNM B;  4NY3 A;  3RVZ A;  4ONS A;  2B0H A;  1J8Y F;  3ZQY A;  4ANJ A;  1A0B A;  4U5D E;  5DQT A;  2XLH A;  1JAF A;  1L7C A;  2ZD9 A;  1OXB A;  5JS5 A;  2LSE A;  3HLZ A;  4LER A;  1YAR O;  2R02 A;  2L6G A;  3U8P A;  4MTG A;  1WTY A;  3FDQ A;  4BJT A;  5F5H A;  5CIV A;  1IZM A;  1GM5 A;  5COG A;  3J06 A;  2YLG A;  2ETS A;  4EIY A;  2E87 A;  4CS9 C;  2Y3B A;  4GQH A;  5L0H A;  2NUP A;  5COF A;  1AVO B;  256B A;  2R9R B;  2EIK C;  2PBE A;  4O7G A;  1YYX A;  5AC4 A;  3UNG C;  4NTF A;  3DE9 A;  3GEE A;  1ZYR F;  1HE9 A;  1RKC A;  2A0B A;  4O6M A;  4XLN F;  1CGO A;  1XZP A;  2DYS C;  1I5N A;  2EPN A;  2LCH A;  2Z15 A;  2ZXP A;  3E70 C;  2KGO A;  3KYI A;  2CYD A;  1CGM E;  3WAQ A;  3KH2 A;  1D1B A;  1HW1 A;  3LJB A;  2OQM A;  3GM2 A;  5E3C A;  3RIP A;  4C3E A;  3I5P A;  2QNL A;  3HNI A;  1VYK A;  2H8A A;  3JTL O;  4N06 A;  4PFP A;  5KYW A;  1CPR A;  1SZI A;  1M2V B;  1VB5 A;  3T4R A;  4YT2 A;  4BJ6 C;  3MLG A;  3FOP A;  4WJ0 A;  5FZT A;  4MVQ A;  1Q0M A;  2M4E A;  4O79 A;  4KC9 A;  4E18 A;  2J9W A;  5E33 A;  2C04 A;  1S05 A;  2YHS A;  1FNT c;  1M6T A;  2FGY A;  5CI9 A;  3N24 A;  1FMV A;  4HE8 D;  1R4T A;  3LUT B;  3T6B A;  4LDQ A;  4AL0 A;  4DBR A;  4ZLC A;  2OU6 A;  1Q0K A;  1RJ9 B;  4H54 A;  2RSE B;  3K6B A;  1MNE A;  4XPX A;  3S29 A;  2IXN A;  2J9B A;  3EZI A;  3N0T A;  3RQE A;  3RYL A;  5B3S C;  4Q5S F;  3B0P A;  4RBN A;  4P9F A;  4PJL A;  1HE1 A;  3U9M A;  4BEJ A;  3UGO A;  1FAP B;  4DXW A;  3K1H A;  4GEH A;  1S7Z A;  2XLW A;  1OXK A;  2LD6 A;  2W4M A;  5B3I A;  5L3V A;  4AX2 A;  4AE4 A;  2W45 A;  1RKE A;  3NRH A;  4I3M A;  1NLX A;  4F4B A;  4YT4 A;  1E83 A;  2J7P A;  4JC7 A;  1EA8 A;  3C62 A;  3C8G A;  3DMD A;  4JZA A;  1TWH A;  2XLV A;  2AVK A;  2Q4F A;  4QI2 A;  2KC3 A;  1O3U A;  4MW8 A;  3K1I A;  5DS6 A;  4FX5 A;  1V55 C;  3V5X A;  5A6B A;  1G5Z A;  1JPN A;  1LPE A;  3ZTM A;  1NG1 A;  3B71 A;  2OG2 A;  1GGQ A;  3CZ6 A;  4MVS A;  4MVM A;  2BC5 A;  3EHM A;  1WOL A;  2HV7 A;  3JYY A;  1QVX A;  2IXO A;  2IXP A;  5A69 A;  4UDV A;  1ZU4 A;  1APC A;  2PNO A;  3EH1 A;  1BDJ B;  4JCH A;  3E9V A;  3TJ6 A;  4EBK A;  4JTC B;  2HMQ A;  5BQH A;  3VAY A;  1V74 B;  1R5I D;  1XWJ A;  1QLE C;  4U5E E;  3UMK A;  3L8I A;  3SXK A;  1Z63 A;  2F22 A;  4XTK A;  1KNY A;  1SMY F;  4I1O B;  3DWW A;  2IOQ A;  2LP4 A;  3EFO B;  3NG1 A;  4CS8 C;  3X1O A;  4CSA A;  5DS5 A;  1YDI A;  1ZVZ A;  2A68 F;  2L6H A;  1E85 A;  2H7O A;  4IRU A;  2QUP A;  2UUI A;  3RQF A;  3ABK C;  3AQC A;  2BE5 F;  4WGZ A;  2Q7R A;  2HS5 A;  4CBE A;  3W8H A;  3C8Z A;  4K0D A;  1A41 A;  3I4U A;  4JRZ A;  3A11 A;  3CAX A;  4Z9I A;  2DI3 A;  2EIL C;  3IHU A;  1T6U A;  2J7P D;  1UG7 A;  3FXH A;  3C8G D;  3JSZ A;  2R7S A;  1L3P A;  3QMK A;  2IM8 A;  5KYU A;  2R7R A;  4YN0 B;  4AK9 A;  4LAC B;  3TJ5 A;  5EGY A;  2V3C C;  3NDB B;  3MYF A;  4YL1 A;  3G50 A;  3NKE A;  1C02 A;  4DVZ A;  2QY9 A;  1XZQ A;  4KNV A;  3ZG1 A;  2LFD A;  1OR3 A;  4YL0 A;  5A6B D;  5KYX A;  2H7V C;  4C3B A;  2R25 A;  2XS8 A;  3W8I A;  2YLD A;  2P6V A;  4NC3 A;  4BEM J;  1ZZP A;  2D4U A;  2YL0 A;  1VLS A;  3B29 A;  3GM1 A;  3AQB A;  2YQY A;  3PHF 2;  4MQ9 F;  1ORY A;  1MMN A;  2H7B A;  3M4B A;  5F28 E;  4Q4Z F;  5JUA A;  3NMJ A;  1VLT A;  4J30 B;  3T9O A;  4CS9 A;  3IQC A;  2YRF A;  3B0U X;  2CCY A;  3GAN A;  2EPO A;  3SXY A;  4BJ5 C;  3TD7 A;  4L6R A;  2NUT B;  3EGD A;  1A7E A;  4G0H A;  3ZQV A;  3IQ5 A;  2NG1 A;  2PFD A;  1B68 A;  3QZC A;  5AGF A;  3ZIB A;  5FCL A;  2Y3G A;  1OCC C;  2R05 A;  4U9D A;  5L0G A;  3GEH A;  2FAP B;  2CNW A;  1JPJ A;  3UMH A;  4GYT A;  2X51 A;  3FAP B;  1T01 A;  2Y69 C;  4OIN F;  3ASO C;  1RCP A;  2I8B A;  3KPH A;  4MVZ A;  2ICW G;  3C63 A;  1PD1 A;  2OEV A;  2OCC C;  3L34 A;  1HW2 A;  2HSB A;  2WZG A;  2NUP B;  3U3B A;  2NPU A;  2XLM A;  5T3W A;  4DRI B;  4BJ6 A;  2PX0 A;  1FFT C;  4J32 B;  1LM3 B;  2GA0 A;  4G7O F;  1OR2 A;  2HSQ A;  3LEO A;  3ASN C;  5D92 A;  2L6F A;  2VH3 A;  3R7C A;  2R7W A;  2EIM C;  3Q6M A;  1Z7Q c;  3K66 A;  4ULV A;  3JRM O;  2O9X A;  2RD9 A;  3H2V A;  2KJG A;  5DVW A;  4XPY A;  3TOL A;  1OCZ C;  3FVY A;  3UR3 C;  5KYW B;  3B0V C;  1ST6 A;  4OIO F;  1NU9 C;  2PX3 A;  1RMV A;  4MTF A;  2W9Y A;  1ZHT A;  4G78 A;  3AG1 C;  3DM9 B;  3NMK A;  5D91 A;  3S0X A;  3SZR A;  1LVK A;  2ZXO A;  4KI2 A;  2V26 A;  3B9Q A;  2TMV P;  4C7O A;  1C17 M;  4I44 A;  1PCX A;  1JR8 A;  3I5Q A;  3Q7L A;  5L0C A;  3DXJ F;  4O6Y A;  4E17 A;  2R7V A;  4A4A A;  3U0C A;  1ZW3 A;  2J0X A;  1H7I A; 
#chains in the Genus database with same CATH homology
 2GFH A;  2CNW D;  1D1C A;  3EHN A;  3FHD A;  3K33 A;  4C3D A;  3N2Z B;  1ZHY A;  2A6H F;  2CW0 F;  1V54 C;  5B1B C;  5DLJ A;  4PJJ A;  2JD3 A;  1FTS A;  1M57 C;  1VK5 A;  3RH3 A;  4AE4 B;  2IXM A;  1TWC A;  2YZS A;  3JRT A;  3EQL F;  2ZPA A;  4CS8 A;  5IY5 C;  1O5H A;  2WVQ A;  1D0Y A;  2DGJ A;  3UGP A;  4JJG A;  1OKK A;  1N1C A;  2WZL A;  2Q9A A;  4QDL A;  3F47 A;  1ZHZ A;  1M56 C;  4P6I C;  2XXA A;  4G7H F;  4DBQ A;  1Z5Z A;  4MND A;  4U5G A;  3AG2 C;  4OIR F;  3EG9 A;  3LLK A;  4U5F E;  4CIH A;  2C03 A;  2Y3H A;  4BJ1 A;  3AG4 C;  1Z3I X;  2Y39 A;  4IAO A;  5EHH A;  2R7O A;  5KYU B;  1MMD A;  2VAS A;  3MX3 A;  2J46 A;  1TWA A;  3RKO F;  4OD5 A;  4LLC A;  5KYX B;  2VB6 A;  3K7D A;  2Y3D A;  3WOD F;  2A6E F;  4CS7 A;  4M63 A;  3EGX A;  3AG3 C;  3LNR A;  1OKK D;  2EIN C;  2Q3T A;  3LS1 A;  5KYN A;  3OEO A;  3POV A;  4QI0 A;  2WVN A;  3EGD B;  5DS4 A;  1D0X A;  2YEV A;  3VYW A;  2R7X A;  2WL8 A;  3LEV A;  3WG7 C;  2WVO A;  1LKX A;  3HTK C;  5E2Q A;  4E7S A;  1TR2 A;  4IWB A;  3DM5 A;  1LS1 A;  1FFH A;  3EJN A;  2KQ9 A;  4ULW A;  5KYY A;  3F46 A;  1NZE A;  1D1A A;  2WB7 A;  2MYS A;  4G7Z F;  4W8K A;  3NYM A;  3O6X A;  4PJM A;  1TKN A;  2Q9C A;  3V7O A;  2PP4 A;  3W2W A;  1NU7 D;  2J45 A;  3W2V A;  4B6I A;  4IJJ A;  3LS0 A;  3SNH A;  3LLI A;  4C7O B;  3SP1 A;  3SYN A;  3LAY A;  3GOD A;  2ZXW C;  4KBL A;  2DYR C;  3S28 A;  1ZU5 A;  1WGW A;  3DAF A;  3DZA A;  3ITF A;  3UMI A;  2XL4 A;  2J0W A;  4LLE A;  4OD4 A;  5HSW A;  3M1C B;  2J9U A;  1J8M F;  3H65 A;  4JW1 A;  4OIP F;  1VOM A;  4PK4 A;  5B1A C;  3EPV A;  3ZVR A;  1O87 A;  3NKD A;  2QTV A;  1M2V A;  1PD0 A;  2KW3 C;  3FAJ A;  4HEA J;  1TWG A;  3JCU Q;  4BG0 A;  2L9J A;  4DVY P;  3KL4 A;  1IW7 F;  1QZX A;  1G8X A;  3DD7 A;  2IYL D;  3ABL C;  2G3V A;  3EZH A;  2A69 F;  2J9V A;  3O39 A;  4O6N A;  3DJN B;  1M2O A;  3JYH A;  3OWT A;  1RJ9 A;  4Q7C A;  4HFK B;  5L3Q A;  5T3T A;  2PF4 E;  3CQZ A;  3KMI A;  3X2Q C;  1MMA A;  1KU2 A;  4A2N B;  4U5H A;  2XXA B;  4K7B A;  1Z23 A;  5DQZ A;  2XRH A;  2KNH A;  2L81 A;  4H4K C;  1D0Z A;  5BUO A;  2A1D D;  3OA1 A;  1FMW A;  3PMR A;  4EBB A;  2XSE A;  1VYI A;  3Q7G A;  3EG9 B;  3EH2 A;  1ZHW A;  1BR1 A;  2R7Q A;  3LES A;  5T1D B;  2G62 A;  2FFH A;  4FES A;  2D5R B;  4RD9 A;  2R7T A;  3L0I A;  2CGE A;  3T6J A;  4KNW A;  4BJ5 A;  4YJW A;  4JJF A;  3HJC A;  1OCO C;  3ABM C;  1MMG A;  4DOZ A;  3JT1 A;  3K1I C;  2Q9B A;  2CDQ A;  3NYJ A;  3ZSU A;  4I1M A;  3EFO A;  3NYL A;  4JVS A;  4RDA A;  2EIJ C;  3EGX B;  2B0J A;  1VMA A;  2W4B A;  2R7U A;  5E3A A;  1MND A;  1W2W A;  1OCR C;  4HFF B;  3ZC4 A;  4PFO A;  3SEO A;  4XWJ A;  1BR2 A;  3S27 A;  4EWC A;  4JUR I;  2ZXR A;  3DAG A;  4YWQ A;  3CSK A;  3ECS A;  3KKB A;  1Z6A A;  3Q6N A;  3RFY A;  4U5B E;  4FWV A;  2MWQ A;  4CSA C;  1SF8 A;  1BR4 A;  4XLP F;  2G3K A;  4YT5 A;  2HV6 A;  4ZLD A;  4OIQ F;  3DJU B;  2WZF A;  3IEE A;  5CI8 A;  4PJN A;  4X0R A;  4E7Z A;  5KYY B;  4YT8 A;  2NUT A;  4U5C E;  1ZHX A;  4NY3 A;  2P7V A;  1J8Y F;  4ANJ A;  4U5D E;  5DQT A;  2LSE A;  3HLZ A;  4LER A;  3FDQ A;  4BJT A;  5F5H A;  1IZM A;  2E87 A;  4CS9 C;  2Y3B A;  2NUP A;  2EIK C;  4O7G A;  3UNG C;  1ZYR F;  4O6M A;  4XLN F;  2ZXP A;  2DYS C;  2Z15 A;  3E70 C;  2KGO A;  3KH2 A;  1D1B A;  3LJB A;  5E3C A;  3RIP A;  4C3E A;  3I5P A;  4N06 A;  5KYW A;  1VYK A;  4PFP A;  1SZI A;  1M2V B;  3T4R A;  4YT2 A;  4BJ6 C;  3MLG A;  4WJ0 A;  2M4E A;  4O79 A;  4KC9 A;  2J9W A;  5E33 A;  2C04 A;  2YHS A;  2FGY A;  5CI9 A;  3N24 A;  1FMV A;  4HE8 D;  3T6B A;  4DBR A;  4ZLC A;  1RJ9 B;  3K6B A;  1MNE A;  3S29 A;  2IXN A;  3EZI A;  3N0T A;  5B3S C;  3RYL A;  4Q5S F;  3B0P A;  4RBN A;  4PJL A;  4BEJ A;  3UGO A;  3K1H A;  4GEH A;  1S7Z A;  5L3V A;  2W4M A;  4AX2 A;  4AE4 A;  2W45 A;  3NRH A;  4I3M A;  4YT4 A;  2J7P A;  4JZA A;  3DMD A;  1TWH A;  4QI2 A;  5DS6 A;  4FX5 A;  1V55 C;  1JPN A;  1NG1 A;  2OG2 A;  3CZ6 A;  3EHM A;  2HV7 A;  2IXO A;  2IXP A;  1ZU4 A;  3EH1 A;  4JCH A;  3E9V A;  3VAY A;  1QLE C;  4U5E E;  3UMK A;  1Z63 A;  4XTK A;  4I1O B;  1SMY F;  2IOQ A;  4CS8 C;  3EFO B;  3NG1 A;  3X1O A;  4CSA A;  5DS5 A;  2A68 F;  2H7O A;  4IRU A;  3ABK C;  3AQC A;  2BE5 F;  4CBE A;  3W8H A;  4K0D A;  3I4U A;  2EIL C;  2J7P D;  3JSZ A;  2R7S A;  3QMK A;  5KYU A;  2R7R A;  4YN0 B;  4AK9 A;  4LAC B;  5EGY A;  2V3C C;  3NDB B;  4DVZ A;  3NKE A;  5F5F A;  2QY9 A;  3ZG1 A;  4KNV A;  5KYX A;  2H7V C;  4C3B A;  3W8I A;  2P6V A;  3AQB A;  3PHF 2;  4MQ9 F;  1MMN A;  2H7B A;  4Q4Z F;  4J30 B;  4CS9 A;  3B0U X;  4BJ5 C;  3GAN A;  3TD7 A;  2NUT B;  3EGD A;  4G0H A;  2NG1 A;  2PFD A;  3QZC A;  5FCL A;  3ZIB A;  2Y3G A;  1OCC C;  2CNW A;  1JPJ A;  3UMH A;  4GYT A;  2X51 A;  2Y69 C;  4OIN F;  3ASO C;  2I8B A;  1PD1 A;  2OCC C;  3L34 A;  2WZG A;  2NUP B;  4F4B A;  5T3W A;  4BJ6 A;  2PX0 A;  1FFT C;  4J32 B;  4G7O F;  3ASN C;  5D92 A;  2VH3 A;  2R7W A;  2EIM C;  3Q6M A;  3K66 A;  2O9X A;  2KJG A;  5DVW A;  1OCZ C;  3FVY A;  3UR3 C;  5KYW B;  3B0V C;  1ST6 A;  4OIO F;  1NU9 C;  2PX3 A;  2W9Y A;  1ZHT A;  3AG1 C;  3DM9 B;  5D91 A;  3S0X A;  3SZR A;  1LVK A;  2ZXO A;  4KI2 A;  2V26 A;  3B9Q A;  4C7O A;  4I44 A;  1PCX A;  3I5Q A;  3Q7L A;  3DXJ F;  4O6Y A;  2R7V A;  2J0X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...