4XPYA

Crystal structure of hemerythrin : l114y mutant
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
131
structure length
131
Chain Sequence
MALMTWTAAEFGTNVGFADDQHKTIFDMVNKLHDTAATGNRSEIGKQLDALIDYVVMHFKSEETEMQKKGYADFAAHKAEHDKLVGVCADLQKKFHAGEAEVNQDTTRFVRDWYVNHIPKVDKLYGPCLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bacteriohemerythrin
publication title The bacteriohemerythrin from Methylococcus capsulatus (Bath): Crystal structures reveal that Leu114 regulates a water tunnel.
pubmed doi rcsb
molecule tags Oxygen binding protein
total genus 58
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2015-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01814 Hemerythrin Hemerythrin HHE cation binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.50 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Hemerythrin-like 4xpyA00
1A7DA 2MHRA 2HMQA 2AWCA 3WAQA 1I4ZA 4XPYA 2AWYA 4XPXA 1A7EA 2AVKA 2HMZA 3WHNA 4XQ1A 4XPWA 1HMOA 3AGUA 3AGTA 1I4YA 1HMDA
chains in the Genus database with same CATH superfamily
4EBBA 4P9TA 2IXMA 1XZPA 2MHRA 4JCZA 4Z9HA 2Z15A 2LFFA 3HLZA 3CZ6A 3OEOA 1L3PA 1NFNA 2G62A 2PNOA 4MNDA 2Q00A 3EZIA 4ULWA 5E3AA 4U9DA 1EA8A 3IQ5A 2PX3A 2XSEA 5JSLA 3QMKA 3SNHA 3ZQVA 2J8WA 3US6A 4BEJA 5DS6A 5A6JA 2CW0F 2IBFA 3SYNA 3KKBA 3ZWIA 3NYLA 2OJQA 4YT8A 4ZLCA 4EWCA 1KTMA 1M2VA 4EHPA 3EFOA 3B71A 4DVYP 2R7XA 2P7VA 1TWCA 4HEAJ 2WVOA 2L6HA 2OCCC 2W45A 4PJLA 4PFPA 3BRJA 5CIVA 1RMVA 3N2ZB 1LKXA 1XZQA 3DKAA 2GDCA 4XPWA 1NU9C 3FAPB 3T9OA 4YK5A 4EIYA 1JOGA 1ORSC 2HV7A 3TJ5A 1RJ9A 2EINC 1RKCA 1JR8A 3UMIA 2DI3A 2EPLX 3NKDA 5L0IA 4Z9JA 3ZQYA 1QPUA 4O7GA 3LEVA 2OU6A 4DOZA 2G3VA 4QDLA 5JT4A 1DOWA 2P1AA 3IQ6A 1WGWA 2KC3A 3C62A 1W2WA 4MVSA 5HSWA 4MVQA 1JAFA 1OCRC 1L7CA 3LUTB 1MMNA 2EIKC 3NMIA 5KYWB 3K1HA 4N06A 4NTBA 3UNGC 4WGYA 3MFNA 1O3UA 4MTGA 5L3VA 1ZW2A 1FAPB 1UG7A 2FAPB 4JC7A 4MW8A 3B0VC 3AG2C 3FXHA 2H7BA 2ZXPA 2W9YA 3RVZA 1CGOA 2XLWA 2R7UA 1Z7Qc 4Q7CA 3LNRA 4YL3A 3DMDA 4YL0A 1RJ9B 1CGME 3IEEA 5A6AA 3IQCA 4LLCA 2OEXA 3SXZA 5COMA 4C3EA 5KYUA 1C17M 1S7ZA 2NG1A 3QTHA 1OCCC 4OD5A 4KBLA 4XEKA 2HJ3A 1ZYRF 2XXAB 1Y4CA 4JJFA 1WTYA 1WWPA 2OJED 3HNIA 3F46A 3T4RA 2YLGA 1Q0KA 2XLOA 1IW7F 2Y39A 3DAFA 2LFDA 3Q7GA 1T01A 1XWJA 1LE2A 4J7TA 4XEFA 4A4AA 4Z9IA 3JCUQ 2B0HA 1VK5A 1VYIA 1YAUO 4CDVA 1FMWA 3V5YA 1YLMA 3ZTMA 2DYSC 5D92A 4EBJA 1YA9A 2TMVP 2VCBA 4RDAA 3OWTA 4MVMA 3W8IA 1FNTc 1HMOA 1N1CA 5B3SC 3DM9B 1QQ3A 1WN0A 3AGTA 4CJGA 3A11A 3Q6NA 2EIJC 5D91A 3RQEA 3EHNA 1FFTC 2CCYA 2PF4E 3KPHA 3RQGA 3X1OA 3MBGA 4IAOA 5DVWA 4BJ6C 4G7ZF 2WB7A 4PJNA 4XLPF 4Q5SF 2QY9A 4NQFA 3S27A 1ZHXA 4YT5A 5L3QA 4R32A 3SZRA 4D4XA 5KYUB 1MNEA 4O6NA 3RIPA 3EGXA 4U5EE 1Z23A 3MYFA 3GM1A 3LNMB 1TQGA 5T3TA 5DLJA 3TJ6A 4U5GA 3W8HA 5BQHA 4HE8D 4YL1A 3FMSA 1OQCA 3W2VA 3ABKC 1Y6DA 1MNDA 2D4UA 3L8JA 3GM2A 4C7OA 4KC9A 4YWQA 2H7OA 1VLSA 1SR2A 2J0WA 4W8PA 1CGNA 2JX0A 4RBNA 4I1OB 1M57C 1GM5A 1Z3IX 4DBRA 1I5NA 1VB5A 4C7OB 1YZAA 1E85A 4P6IC 3U9JA 3ITFA 2EPNA 3VYWA 3LJBA 3RVYA 4I44A 4DRJB 4U5DE 4CIHA 4OD4A 2AWCA 3GWNA 5FZTA 2ZXOA 5COGA 3G4XA 1NG1A 1ZHZA 4P9FA 3SP1A 3ZIBA 3EGDB 1D0XA 3IPMO 1ORJA 3ZTZA 2EIMC 3HJCA 3QVYA 4IWBA 1OKKD 4BJ5A 1NSGB 3SEOA 2AVKA 1M6TA 2EPMX 3DJNB 3GODA 5JUAA 3E9VA 5JS5A 2QNLA 2OOCA 3GEEA 4MW3A 1OKKA 2YL3A 4K1OA 4A2NB 1JRAA 3U8PA 3LAYA 3O10A 2YQYA 2A69F 4DVZA 3TK0A 2CNWA 3W4YA 4CS8A 2F22A 4JEBA 4U5HA 4XEVA 5E33A 3FDQA 3KYJA 1YJGA 2R7WA 3GEIA 2EPOA 2WL8A 4D4NA 2L6FA 4JRZA 3JT1A 4E0HA 3GEHA 2R05A 1GGQA 2XLEA 4BJ5C 3MX3A 2R25A 4JEAA 3K33A 4C3DA 4AL1A 3L8IA 3W2WA 2LD6A 3K66A 2Y3HA 1SF8A 1R5ID 3O6XA 3N24A 2C04A 3IQTA 4JJGA 1D1BA 3I4UA 1CPQA 2YWAA 1JPJA 4NTAA 1MMAA 4PACA 4MVOA 1J8MF 1T6UA 4W8KA 3ZDLA 5HV9A 1O5HA 4CS8C 4NY3A 1GS9A 4HFFB 1EQ1A 4K0DA 2A6EF 2L6GA 1MQVA 5DQZA 4OIOF 1VLTA 1QLEC 2Q9AA 3ABMC 3NDBB 3EHMA 1Z6AA 3L1MA 2IOQA 4IARA 2I15A 3SXMA 3CQZA 4DXWA 5A69A 2YLDA 4NC3A 2NPUA 2QUPA 3S29A 4FAPB 2GWWA 1U89A 2UUHA 1K05A 1UFBA 2HV6A 2MYSA 3NMKA 2M64A 3JSEO 3PCVA 3KYIA 1SYQA 1YA7O 3A9CA 3M79A 4J7YA 2KSFA 4KI2A 2A6HF 5L0FA 4CSAC 2RD9A 4LACB 1BR4A 2RSEB 3PMRA 3RKOF 3U2MA 4AE4A 4DRIB 1KNYA 2YLIA 4JIOA 1E84A 5AGFA 5F28E 3POVA 1LS4A 1M2VB 1H9GA 3EFOB 4WABA 4ZLDA 4XQ1A 3VAYA 1D1AA 1GQAA 1VMAA 1B68A 2OQMA 5JLIA 4MS2A 2XLVA 3C7JA 3KMIA 2YRFA 2OEVA 4C3BA 5BUOA 2XL6A 5L0GA 5DS5A 2WZLA 1RXQA 3GWLA 3NYMA 3O55A 4LDRA 2OG2A 1BZ4A 1ZW3A 5GPGB 3M1CB 5EHHA 4XWJA 2PX0A 1A7DA 2Q4FA 3HNKA 4U9EA 3ZSUA 1V54C 1CPRA 2IXPA 3UMHA 1F1MA 2W4MA 2I8BA 4MVUA 3C8GD 3EH1A 2Q3TA 2R02A 1SZIA 3AJMA 1Z5ZA 3CEXA 4RD9A 4XLNF 4BJ6A 3DM5A 4J30B 2BL2A 2D5RB 3VRCA 3C8GA 4I1MA 4AE4B 2YVKA 3QW0A 4DJ9A 4KNWA 3L34A 3EPVA 4MVRA 4G78A 3HTKC 4CS9A 1TKNA 2XLMA 2VB6A 4FX5A 1V55C 4CS7A 5A6KA 3LESA 5KYYA 1ZHTA 256BA 3G50A 4KNVA 2R7VA 2XLHA 3LLIA 1NLXA 2WVQA 1TR2A 4PJMA 1A0BA 1PD0A 1ZZPA 4MQ9F 2XL4A 2ZD9A 1TWHA 2KYHA 1D0YA 2AP3A 1ORYA 3B9QA 2KJGA 3JZ0A 3KH2A 3LS0A 4O6YA 1LI5A 4PFOA 3WAQA 4LDQA 5CI8A 3ATPA 2JD3A 3HNJA 3H2VA 1YYXA 2P61A 1OR3A 1HE1A 5EGYA 4XPXA 4CS9C 2HKVA 4IAQA 1RKEA 2XRHA 3E70C 3C8GB 3HNLA 3G4ZA 3M15A 1BDJB 1ZHWA 2XL8A 3MLGA 3U8VA 1E2XA 2ZXWC 2CDQA 3EG9A 2WZGA 3AQBA 1AEPA 4JE9A 4EBKA 2P0NA 4IB4A 1ZU5A 3ABLC 3C8ZA 5KYYB 4LLEA 3EJNA 2HZ8A 1APCA 3CSKA 2ICWG 1RCPA 1YYJA 2DYRC 3F47A 4MTOA 3RYLA 2HMQA 3PDMP 2HUJA 5CI9A 2J9VA 3UR3C 2Y3GA 3L0IA 3C18A 1BR1A 2ETSA 3DI5A 3V5XA 2PBEA 4BEMJ 5AC4A 1PV3A 4E7ZA 1QVXA 1HW2A 3AQCA 4JZAA 4MTFA 2QTVA 1OCOC 2LCHA 2LSEA 1QKRA 3EGXB 4PJJA 4CDYA 1G8XA 3RF3A 3DD7A 4UDVA 2QE9A 2B0JA 2VC9A 1RKEB 3M4BA 3FOPA 1JPNA 3ASOC 1T6QA 3B0PA 3UMKA 1Q0GA 3TULA 3WODF 4HFKB 2GA0A 4CX9A 2YKZA 4PK4A 1AUEA 1OXBA 3T6BA 3TD7A 2L7AA 4E18A 1FTSA 1NFOA 2CNWD 3EG9B 3UGOA 5L0DA 2LK4A 1PCXA 3FHDA 3LS1A 4B6IA 2EPKX 4WJ0A 3C63A 4MVZA 4ER9A 1IZMA 3EH2A 4JURI 2KK1A 1HMDA 4JTCB 5JP7A 2GFHA 2PP4A 3JYHA 3TOMA 4AX2A 4CIPA 4O79A 1TWAA 4JCHA 1VYKA 3VF0A 3K1IA 1ST6A 1OW7A 2IXOA 3I5QA 2BC5A 3JRMO 4ONSA 2X0CA 1EKYA 2MWQA 2NUPA 4NTFA 2EILC 1AVOB 2Q9CA 3EZHA 4U5FE 3R7CA 4X0RA 2A68F 3JYYA 2Y3DA 1H9TA 2ASRA 3S28A 2Q9BA 1D0ZA 4I3MA 3UGPA 2HMZA 4FESA 3FVYA 5T3WA 4DBQA 2YL1A 1V4AA 2KQ9A 3DWWA 4CSAA 1FMVA 4BJ1A 2VCAA 3ASNC 1LVKA 2VH3A 2YZSA 2DGJA 1ZU4A 1NZEA 3K1IC 1QSPA 1I4YA 2IYLD 3LEOA 5IY5C 3S9OA 2R7TA 4CJOA 1LE4A 4G0HA 2IXNA 3S0XA 2R7RA 2XM4A 5FCLA 2X51A 1OXKA 1U0BB 5KYWA 2R9RB 4G7HF 2XS1A 4IJJA 3X2QC 2V3CC 2FFHA 2WVNA 4YN0B 2NUPB 3GORA 3ECSA 1OW8A 2HSBA 4K7BA 3U9MA 4LERA 1DOVA 2HSQA 2J9UA 2M4EA 1ZHYA 2WZFA 5BQIA 4QI0A 3Q6MA 4XTKA 4ANJA 4H4KC 2J0XA 4JVSA 4BG0A 3S84A 3HKKA 2CYDA 3OA1A 3ZG1A 1LI7A 3U3FA 3O39A 3PHF2 4BJTA 1G4WR 2KW3C 3SXYA 1U6HA 2W4BA 3H65A 3BEHA 2LP4A 1QZXA 2YEVA 2XXAA 2H8AA 5L0JA 4JTDB 1WOLA 4AL0A 2QLAA 2HS5A 2H7VC 1MMGA 3RW0A 1I4ZA 2UUIA 4LDKA 3WG7C 1WASA 3DE9A 3JRTA 2R7OA 2R7SA 2AWYA 1NU7D 4OINF 1Z63A 1YARO 3AG4C 1ZVZA 2Q7RA 2CGEA 1H6GA 1A7EA 1A7VA 1OW6A 3GANA 4IGGA 1VOMA 2R7QA 2A1DD 3RFYA 4BPMA 1BR2A 5AC5A 4EUKB 4OIRF 4F4BA 5JRAA 1K04A 3B29A 3U0CA 1WATA 5KYXA 4JW1A 1JMWA 4ULVA 3FOOA 4CBEA 4H54A 3IHUA 5B1BC 3ZC4A 2E87A 4NCQA 1O87A 4OIQF 2LIGA 2VCCA 2OKUA 2YHSA 4DRHB 4E17A 5BQGA 3AOUA 3K7DA 3FAJA 1M2OA 4YJWA 2A0UA 3SXKA 1SMYF 3Q7LA 3TOLA 4XPYA 2Y69C 5A6BD 4PR9A 3NMJA 1E83A 1TFOB 3AG1C 5F5FA 1OCZC 2YL7A 3U3BA 3R2PA 1NBBA 3NKEA 5E2QA 5KYNA 4OIPF 5A6BA 4N4WA 5L0CA 3I5PA 2HJMA 2KGOA 3JSZA 3K6BA 3RQFA 3J06A 2J7PD 3VM6A 3M4CA 4J32B 1LPEA 1KU2A 1MMDA 2DB4A 1YVIA 1LS1A 2G3KA 4EKWA 3T6JA 1T9KA 2J7PA 3QW1A 2C03A 1J8YF 3ZVRA 5KYXB 5COFA 4CDAA 1V74B 1D1CA 1HW1A 2L81A 1E86A 2R03A 2NUTA 1M56C 1LM3B 1PD1A 2O9XA 2XLDA 3S90A 3NYJA 1FFHA 1S05A 3EGDA 3DZAA 4GEHA 3RH3A 3H2UA 4GYTA 4U5BE 4G7OF 2J9BA 4N6CA 3MYIA 1H7IA 1VTMP 1G5ZA 1G4US 3GM3A 4YT2A 2KNHA 3EQLF 1K40A 1TFKB 3CAXA 4AK9A 1BBHA 1T6IA 2PFDA 5EK0A 3B0UX 1EI7A 4Q4ZF 3DXJF 5B1AC 2J46A 3AGUA 4FWVA 4JTAB 3U5SA 3NRHA 4N6HA 1YDIA 2NSGA 2NSFA 5DQTA 1YZCA 2V26A 4WGZA 2ZXRA 5L0HA 5T1DB 4E0IA 5K0IA 2NUTB 1T5OA 3QZCA 4JKVA 5TJ5E 5JVEA 2XS8A 1HY5A 3LLKA 3AG3C 4GQHA 2BE5F 2FGYA 3N0TA 4YT4A 3NG1A 5DS4A 1LIHA 1R4TA 1OR2A 2ZPAA 4M63A 4O6MA 3TQOA 4E7SA 1FR0A 4L6RA 2JPUA 1C02A 2LQGA 2P6VA 2XM0A 3DE8A 3DJUB 1Q0FA 2AU5A 2HFIA 5E3CA 4U5CE 1A41A 2A0BA 3WHNA 3T6GB 3JTLO 3V7OA 3QVZA 3V5ZA 1Q0DA 2J9WA 5F5HA 4QI2A 1TWGA 3U2LA 3KL4A 1C03A 2L9JA 2Y3BA 2J45A 4IRUA 5B3IA 2YL0A 1Q0MA 2IM8A 2VASA 3DAGA 1HE9A 2GAQA
chains in the Genus database with same CATH topology
1A7DA 2MHRA 2HMQA 2AWCA 3WAQA 1I4ZA 4XPYA 2AWYA 4XPXA 1A7EA 2AVKA 2HMZA 3WHNA 4XQ1A 4XPWA 1HMOA 3AGUA 3AGTA 1I4YA 1HMDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A7D A;  2MHR A;  2HMQ A;  2AWC A;  3WAQ A;  1I4Z A;  4XPY A;  2AWY A;  4XPX A;  1A7E A;  2AVK A;  2HMZ A;  3WHN A;  4XQ1 A;  4XPW A;  1HMO A;  3AGU A;  3AGT A;  1I4Y A;  1HMD A; 
#chains in the Genus database with same CATH topology
 4EBB A;  4P9T A;  2IXM A;  1XZP A;  2MHR A;  4JCZ A;  4Z9H A;  2Z15 A;  2LFF A;  3HLZ A;  3CZ6 A;  3OEO A;  1L3P A;  1NFN A;  2G62 A;  2PNO A;  4MND A;  2Q00 A;  3EZI A;  4ULW A;  5E3A A;  4U9D A;  1EA8 A;  3IQ5 A;  2PX3 A;  2XSE A;  5JSL A;  3QMK A;  3SNH A;  3ZQV A;  2J8W A;  3US6 A;  4BEJ A;  5DS6 A;  5A6J A;  2CW0 F;  2IBF A;  3SYN A;  3KKB A;  3ZWI A;  3NYL A;  2OJQ A;  4YT8 A;  4ZLC A;  4EWC A;  1KTM A;  1M2V A;  4EHP A;  3EFO A;  3B71 A;  4DVY P;  2R7X A;  2P7V A;  1TWC A;  4HEA J;  2WVO A;  2L6H A;  2OCC C;  2W45 A;  4PJL A;  4PFP A;  3BRJ A;  5CIV A;  1RMV A;  3N2Z B;  1LKX A;  1XZQ A;  3DKA A;  2GDC A;  4XPW A;  1NU9 C;  3FAP B;  3T9O A;  4YK5 A;  4EIY A;  1JOG A;  1ORS C;  2HV7 A;  3TJ5 A;  1RJ9 A;  2EIN C;  1RKC A;  1JR8 A;  3UMI A;  2DI3 A;  2EPL X;  3NKD A;  5L0I A;  4Z9J A;  3ZQY A;  1QPU A;  4O7G A;  3LEV A;  2OU6 A;  4DOZ A;  2G3V A;  4QDL A;  5JT4 A;  1DOW A;  2P1A A;  3IQ6 A;  1WGW A;  2KC3 A;  3C62 A;  1W2W A;  4MVS A;  5HSW A;  4MVQ A;  1JAF A;  1OCR C;  1L7C A;  3LUT B;  1MMN A;  2EIK C;  3NMI A;  5KYW B;  3K1H A;  4N06 A;  4NTB A;  3UNG C;  4WGY A;  3MFN A;  1O3U A;  4MTG A;  5L3V A;  1ZW2 A;  1FAP B;  1UG7 A;  2FAP B;  4JC7 A;  4MW8 A;  3B0V C;  3AG2 C;  3FXH A;  2H7B A;  2ZXP A;  2W9Y A;  3RVZ A;  1CGO A;  2XLW A;  2R7U A;  1Z7Q c;  4Q7C A;  3LNR A;  4YL3 A;  3DMD A;  4YL0 A;  1RJ9 B;  1CGM E;  3IEE A;  5A6A A;  3IQC A;  4LLC A;  2OEX A;  3SXZ A;  5COM A;  4C3E A;  5KYU A;  1C17 M;  1S7Z A;  2NG1 A;  3QTH A;  1OCC C;  4OD5 A;  4KBL A;  4XEK A;  2HJ3 A;  1ZYR F;  2XXA B;  1Y4C A;  4JJF A;  1WTY A;  1WWP A;  2OJE D;  3HNI A;  3F46 A;  3T4R A;  2YLG A;  1Q0K A;  2XLO A;  1IW7 F;  2Y39 A;  3DAF A;  2LFD A;  3Q7G A;  1T01 A;  1XWJ A;  1LE2 A;  4J7T A;  4XEF A;  4A4A A;  4Z9I A;  3JCU Q;  2B0H A;  1VK5 A;  1VYI A;  1YAU O;  4CDV A;  1FMW A;  3V5Y A;  1YLM A;  3ZTM A;  2DYS C;  5D92 A;  4EBJ A;  1YA9 A;  2TMV P;  2VCB A;  4RDA A;  3OWT A;  4MVM A;  3W8I A;  1FNT c;  1HMO A;  1N1C A;  5B3S C;  3DM9 B;  1QQ3 A;  1WN0 A;  3AGT A;  4CJG A;  3A11 A;  3Q6N A;  2EIJ C;  5D91 A;  3RQE A;  3EHN A;  1FFT C;  2CCY A;  2PF4 E;  3KPH A;  3RQG A;  3X1O A;  3MBG A;  4IAO A;  5DVW A;  4BJ6 C;  4G7Z F;  2WB7 A;  4PJN A;  4XLP F;  4Q5S F;  2QY9 A;  4NQF A;  3S27 A;  1ZHX A;  4YT5 A;  5L3Q A;  4R32 A;  3SZR A;  4D4X A;  5KYU B;  1MNE A;  4O6N A;  3RIP A;  3EGX A;  4U5E E;  1Z23 A;  3MYF A;  3GM1 A;  3LNM B;  1TQG A;  5T3T A;  5DLJ A;  3TJ6 A;  4U5G A;  3W8H A;  5BQH A;  4HE8 D;  4YL1 A;  3FMS A;  1OQC A;  3W2V A;  3ABK C;  1Y6D A;  1MND A;  2D4U A;  3L8J A;  3GM2 A;  4C7O A;  4KC9 A;  4YWQ A;  2H7O A;  1VLS A;  1SR2 A;  2J0W A;  4W8P A;  1CGN A;  2JX0 A;  4RBN A;  4I1O B;  1M57 C;  1GM5 A;  1Z3I X;  4DBR A;  1I5N A;  1VB5 A;  4C7O B;  1YZA A;  1E85 A;  4P6I C;  3U9J A;  3ITF A;  2EPN A;  3VYW A;  3LJB A;  3RVY A;  4I44 A;  4DRJ B;  4U5D E;  4CIH A;  4OD4 A;  2AWC A;  3GWN A;  5FZT A;  2ZXO A;  5COG A;  3G4X A;  1NG1 A;  1ZHZ A;  4P9F A;  3SP1 A;  3ZIB A;  3EGD B;  1D0X A;  3IPM O;  1ORJ A;  3ZTZ A;  2EIM C;  3HJC A;  3QVY A;  4IWB A;  1OKK D;  4BJ5 A;  1NSG B;  3SEO A;  2AVK A;  1M6T A;  2EPM X;  3DJN B;  3GOD A;  5JUA A;  3E9V A;  5JS5 A;  2QNL A;  2OOC A;  3GEE A;  4MW3 A;  1OKK A;  2YL3 A;  4K1O A;  4A2N B;  1JRA A;  3U8P A;  3LAY A;  3O10 A;  2YQY A;  2A69 F;  4DVZ A;  3TK0 A;  2CNW A;  3W4Y A;  4CS8 A;  2F22 A;  4JEB A;  4U5H A;  4XEV A;  5E33 A;  3FDQ A;  3KYJ A;  1YJG A;  2R7W A;  3GEI A;  2EPO A;  2WL8 A;  4D4N A;  2L6F A;  4JRZ A;  3JT1 A;  4E0H A;  3GEH A;  2R05 A;  1GGQ A;  2XLE A;  4BJ5 C;  3MX3 A;  2R25 A;  4JEA A;  3K33 A;  4C3D A;  4AL1 A;  3L8I A;  3W2W A;  2LD6 A;  3K66 A;  2Y3H A;  1SF8 A;  1R5I D;  3O6X A;  3N24 A;  2C04 A;  3IQT A;  4JJG A;  1D1B A;  3I4U A;  1CPQ A;  2YWA A;  1JPJ A;  4NTA A;  1MMA A;  4PAC A;  4MVO A;  1J8M F;  1T6U A;  4W8K A;  3ZDL A;  5HV9 A;  1O5H A;  4CS8 C;  4NY3 A;  1GS9 A;  4HFF B;  1EQ1 A;  4K0D A;  2A6E F;  2L6G A;  1MQV A;  5DQZ A;  4OIO F;  1VLT A;  1QLE C;  2Q9A A;  3ABM C;  3NDB B;  3EHM A;  1Z6A A;  3L1M A;  2IOQ A;  4IAR A;  2I15 A;  3SXM A;  3CQZ A;  4DXW A;  5A69 A;  2YLD A;  4NC3 A;  2NPU A;  2QUP A;  3S29 A;  4FAP B;  2GWW A;  1U89 A;  2UUH A;  1K05 A;  1UFB A;  2HV6 A;  2MYS A;  3NMK A;  2M64 A;  3JSE O;  3PCV A;  3KYI A;  1SYQ A;  1YA7 O;  3A9C A;  3M79 A;  4J7Y A;  2KSF A;  4KI2 A;  2A6H F;  5L0F A;  4CSA C;  2RD9 A;  4LAC B;  1BR4 A;  2RSE B;  3PMR A;  3RKO F;  3U2M A;  4AE4 A;  4DRI B;  1KNY A;  2YLI A;  4JIO A;  1E84 A;  5AGF A;  5F28 E;  3POV A;  1LS4 A;  1M2V B;  1H9G A;  3EFO B;  4WAB A;  4ZLD A;  4XQ1 A;  3VAY A;  1D1A A;  1GQA A;  1VMA A;  1B68 A;  2OQM A;  5JLI A;  4MS2 A;  2XLV A;  3C7J A;  3KMI A;  2YRF A;  2OEV A;  4C3B A;  5BUO A;  2XL6 A;  5L0G A;  5DS5 A;  2WZL A;  1RXQ A;  3GWL A;  3NYM A;  3O55 A;  4LDR A;  2OG2 A;  1BZ4 A;  1ZW3 A;  5GPG B;  3M1C B;  5EHH A;  4XWJ A;  2PX0 A;  1A7D A;  2Q4F A;  3HNK A;  4U9E A;  3ZSU A;  1V54 C;  1CPR A;  2IXP A;  3UMH A;  1F1M A;  2W4M A;  2I8B A;  4MVU A;  3C8G D;  3EH1 A;  2Q3T A;  2R02 A;  1SZI A;  3AJM A;  1Z5Z A;  3CEX A;  4RD9 A;  4XLN F;  4BJ6 A;  3DM5 A;  4J30 B;  2BL2 A;  2D5R B;  3VRC A;  3C8G A;  4I1M A;  4AE4 B;  2YVK A;  3QW0 A;  4DJ9 A;  4KNW A;  3L34 A;  3EPV A;  4MVR A;  4G78 A;  3HTK C;  4CS9 A;  1TKN A;  2XLM A;  2VB6 A;  4FX5 A;  1V55 C;  4CS7 A;  5A6K A;  3LES A;  5KYY A;  1ZHT A;  256B A;  3G50 A;  4KNV A;  2R7V A;  2XLH A;  3LLI A;  1NLX A;  2WVQ A;  1TR2 A;  4PJM A;  1A0B A;  1PD0 A;  1ZZP A;  4MQ9 F;  2XL4 A;  2ZD9 A;  1TWH A;  2KYH A;  1D0Y A;  2AP3 A;  1ORY A;  3B9Q A;  2KJG A;  3JZ0 A;  3KH2 A;  3LS0 A;  4O6Y A;  1LI5 A;  4PFO A;  3WAQ A;  4LDQ A;  5CI8 A;  3ATP A;  2JD3 A;  3HNJ A;  3H2V A;  1YYX A;  2P61 A;  1OR3 A;  1HE1 A;  5EGY A;  4XPX A;  4CS9 C;  2HKV A;  4IAQ A;  1RKE A;  2XRH A;  3E70 C;  3C8G B;  3HNL A;  3G4Z A;  3M15 A;  1BDJ B;  1ZHW A;  2XL8 A;  3MLG A;  3U8V A;  1E2X A;  2ZXW C;  2CDQ A;  3EG9 A;  2WZG A;  3AQB A;  1AEP A;  4JE9 A;  4EBK A;  2P0N A;  4IB4 A;  1ZU5 A;  3ABL C;  3C8Z A;  5KYY B;  4LLE A;  3EJN A;  2HZ8 A;  1APC A;  3CSK A;  2ICW G;  1RCP A;  1YYJ A;  2DYR C;  3F47 A;  4MTO A;  3RYL A;  2HMQ A;  3PDM P;  2HUJ A;  5CI9 A;  2J9V A;  3UR3 C;  2Y3G A;  3L0I A;  3C18 A;  1BR1 A;  2ETS A;  3DI5 A;  3V5X A;  2PBE A;  4BEM J;  5AC4 A;  1PV3 A;  4E7Z A;  1QVX A;  1HW2 A;  3AQC A;  4JZA A;  4MTF A;  2QTV A;  1OCO C;  2LCH A;  2LSE A;  1QKR A;  3EGX B;  4PJJ A;  4CDY A;  1G8X A;  3RF3 A;  3DD7 A;  4UDV A;  2QE9 A;  2B0J A;  2VC9 A;  1RKE B;  3M4B A;  3FOP A;  1JPN A;  3ASO C;  1T6Q A;  3B0P A;  3UMK A;  1Q0G A;  3TUL A;  3WOD F;  4HFK B;  2GA0 A;  4CX9 A;  2YKZ A;  4PK4 A;  1AUE A;  1OXB A;  3T6B A;  3TD7 A;  2L7A A;  4E18 A;  1FTS A;  1NFO A;  2CNW D;  3EG9 B;  3UGO A;  5L0D A;  2LK4 A;  1PCX A;  3FHD A;  3LS1 A;  4B6I A;  2EPK X;  4WJ0 A;  3C63 A;  4MVZ A;  4ER9 A;  1IZM A;  3EH2 A;  4JUR I;  2KK1 A;  1HMD A;  4JTC B;  5JP7 A;  2GFH A;  2PP4 A;  3JYH A;  3TOM A;  4AX2 A;  4CIP A;  4O79 A;  1TWA A;  4JCH A;  1VYK A;  3VF0 A;  3K1I A;  1ST6 A;  1OW7 A;  2IXO A;  3I5Q A;  2BC5 A;  3JRM O;  4ONS A;  2X0C A;  1EKY A;  2MWQ A;  2NUP A;  4NTF A;  2EIL C;  1AVO B;  2Q9C A;  3EZH A;  4U5F E;  3R7C A;  4X0R A;  2A68 F;  3JYY A;  2Y3D A;  1H9T A;  2ASR A;  3S28 A;  2Q9B A;  1D0Z A;  4I3M A;  3UGP A;  2HMZ A;  4FES A;  3FVY A;  5T3W A;  4DBQ A;  2YL1 A;  1V4A A;  2KQ9 A;  3DWW A;  4CSA A;  1FMV A;  4BJ1 A;  2VCA A;  3ASN C;  1LVK A;  2VH3 A;  2YZS A;  2DGJ A;  1ZU4 A;  1NZE A;  3K1I C;  1QSP A;  1I4Y A;  2IYL D;  3LEO A;  5IY5 C;  3S9O A;  2R7T A;  4CJO A;  1LE4 A;  4G0H A;  2IXN A;  3S0X A;  2R7R A;  2XM4 A;  5FCL A;  2X51 A;  1OXK A;  1U0B B;  5KYW A;  2R9R B;  4G7H F;  2XS1 A;  4IJJ A;  3X2Q C;  2V3C C;  2FFH A;  2WVN A;  4YN0 B;  2NUP B;  3GOR A;  3ECS A;  1OW8 A;  2HSB A;  4K7B A;  3U9M A;  4LER A;  1DOV A;  2HSQ A;  2J9U A;  2M4E A;  1ZHY A;  2WZF A;  5BQI A;  4QI0 A;  3Q6M A;  4XTK A;  4ANJ A;  4H4K C;  2J0X A;  4JVS A;  4BG0 A;  3S84 A;  3HKK A;  2CYD A;  3OA1 A;  3ZG1 A;  1LI7 A;  3U3F A;  3O39 A;  3PHF 2;  4BJT A;  1G4W R;  2KW3 C;  3SXY A;  1U6H A;  2W4B A;  3H65 A;  3BEH A;  2LP4 A;  1QZX A;  2YEV A;  2XXA A;  2H8A A;  5L0J A;  4JTD B;  1WOL A;  4AL0 A;  2QLA A;  2HS5 A;  2H7V C;  1MMG A;  3RW0 A;  1I4Z A;  2UUI A;  4LDK A;  3WG7 C;  1WAS A;  3DE9 A;  3JRT A;  2R7O A;  2R7S A;  2AWY A;  1NU7 D;  4OIN F;  1Z63 A;  1YAR O;  3AG4 C;  1ZVZ A;  2Q7R A;  2CGE A;  1H6G A;  1A7E A;  1A7V A;  1OW6 A;  3GAN A;  4IGG A;  1VOM A;  2R7Q A;  2A1D D;  3RFY A;  4BPM A;  1BR2 A;  5AC5 A;  4EUK B;  4OIR F;  4F4B A;  5JRA A;  1K04 A;  3B29 A;  3U0C A;  1WAT A;  5KYX A;  4JW1 A;  1JMW A;  4ULV A;  3FOO A;  4CBE A;  4H54 A;  3IHU A;  5B1B C;  3ZC4 A;  2E87 A;  4NCQ A;  1O87 A;  4OIQ F;  2LIG A;  2VCC A;  2OKU A;  2YHS A;  4DRH B;  4E17 A;  5BQG A;  3AOU A;  3K7D A;  3FAJ A;  1M2O A;  4YJW A;  2A0U A;  3SXK A;  1SMY F;  3Q7L A;  3TOL A;  4XPY A;  2Y69 C;  5A6B D;  4PR9 A;  3NMJ A;  1E83 A;  1TFO B;  3AG1 C;  5F5F A;  1OCZ C;  2YL7 A;  3U3B A;  3R2P A;  1NBB A;  3NKE A;  5E2Q A;  5KYN A;  4OIP F;  5A6B A;  4N4W A;  5L0C A;  3I5P A;  2HJM A;  2KGO A;  3JSZ A;  3K6B A;  3RQF A;  3J06 A;  2J7P D;  3VM6 A;  3M4C A;  4J32 B;  1LPE A;  1KU2 A;  1MMD A;  2DB4 A;  1YVI A;  1LS1 A;  2G3K A;  4EKW A;  3T6J A;  1T9K A;  2J7P A;  3QW1 A;  2C03 A;  1J8Y F;  3ZVR A;  5KYX B;  5COF A;  4CDA A;  1V74 B;  1D1C A;  1HW1 A;  2L81 A;  1E86 A;  2R03 A;  2NUT A;  1M56 C;  1LM3 B;  1PD1 A;  2O9X A;  2XLD A;  3S90 A;  3NYJ A;  1FFH A;  1S05 A;  3EGD A;  3DZA A;  4GEH A;  3RH3 A;  3H2U A;  4GYT A;  4U5B E;  4G7O F;  2J9B A;  4N6C A;  3MYI A;  1H7I A;  1VTM P;  1G5Z A;  1G4U S;  3GM3 A;  4YT2 A;  2KNH A;  3EQL F;  1K40 A;  1TFK B;  3CAX A;  4AK9 A;  1BBH A;  1T6I A;  2PFD A;  5EK0 A;  3B0U X;  1EI7 A;  4Q4Z F;  3DXJ F;  5B1A C;  2J46 A;  3AGU A;  4FWV A;  4JTA B;  3U5S A;  3NRH A;  4N6H A;  1YDI A;  2NSG A;  2NSF A;  5DQT A;  1YZC A;  2V26 A;  4WGZ A;  2ZXR A;  5L0H A;  5T1D B;  4E0I A;  5K0I A;  2NUT B;  1T5O A;  3QZC A;  4JKV A;  5TJ5 E;  5JVE A;  2XS8 A;  1HY5 A;  3LLK A;  3AG3 C;  4GQH A;  2BE5 F;  2FGY A;  3N0T A;  4YT4 A;  3NG1 A;  5DS4 A;  1LIH A;  1R4T A;  1OR2 A;  2ZPA A;  4M63 A;  4O6M A;  3TQO A;  4E7S A;  1FR0 A;  4L6R A;  2JPU A;  1C02 A;  2LQG A;  2P6V A;  2XM0 A;  3DE8 A;  3DJU B;  1Q0F A;  2AU5 A;  2HFI A;  5E3C A;  4U5C E;  1A41 A;  2A0B A;  3WHN A;  3T6G B;  3JTL O;  3V7O A;  3QVZ A;  3V5Z A;  1Q0D A;  2J9W A;  5F5H A;  4QI2 A;  1TWG A;  3U2L A;  3KL4 A;  1C03 A;  2L9J A;  2Y3B A;  2J45 A;  4IRU A;  5B3I A;  2YL0 A;  1Q0M A;  2IM8 A;  2VAS A;  3DAG A;  1HE9 A;  2GAQ A; 
#chains in the Genus database with same CATH homology
 1A7D A;  2MHR A;  2HMQ A;  2AWC A;  3WAQ A;  1I4Z A;  4XPY A;  2AWY A;  4XPX A;  1A7E A;  2AVK A;  2HMZ A;  3WHN A;  4XQ1 A;  4XPW A;  1HMO A;  3AGU A;  3AGT A;  1I4Y A;  1HMD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...