4XPYA

Crystal structure of hemerythrin : l114y mutant
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
131
structure length
131
Chain Sequence
MALMTWTAAEFGTNVGFADDQHKTIFDMVNKLHDTAATGNRSEIGKQLDALIDYVVMHFKSEETEMQKKGYADFAAHKAEHDKLVGVCADLQKKFHAGEAEVNQDTTRFVRDWYVNHIPKVDKLYGPCLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxygen binding protein
molecule keywords Bacteriohemerythrin
publication title The bacteriohemerythrin from Methylococcus capsulatus (Bath): Crystal structures reveal that Leu114 regulates a water tunnel.
pubmed doi rcsb
total genus 58
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2015-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01814 Hemerythrin Hemerythrin HHE cation binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.50 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Hemerythrin-like 4xpyA00
1A7EA 3AGUA 2HMZA 4XPWA 3WAQA 3WHNA 1A7DA 3AGTA 1HMDA 2AVKA 1I4YA 2MHRA 2HMQA 4XPYA 1I4ZA 4XPXA 2AWYA 2AWCA 1HMOA 4XQ1A
chains in the Genus database with same CATH superfamily
4GYTA 3WODF 2VCBA 2P0NA 1OW6A 3AGUA 3U8PA 1ZVZA 1FAPB 2B0JA 4B6IA 4DJ9A 4Z9JA 5JUAA 2KW3C 3K66A 2WVOA 2YL0A 5DQTA 3CAXA 1RCPA 4IAQA 2DYRC 1ORJA 1PV3A 1IW7F 5A6AA 1ZW3A 1V4AA 4K7BA 3BEHA 2L6FA 2HS5A 4HEAJ 4DRIB 5L0HA 4YL1A 1OCCC 2OKUA 4DXWA 5EGYA 3JTLO 1OKKD 2ETSA 1TQGA 3M79A 4HFFB 4PR9A 3RH3A 4KC9A 1Z63A 3SXYA 3O39A 3MYFA 2Q9AA 3L0IA 3F46A 4PJLA 3G4XA 3LAYA 3SP1A 4ER9A 2R7VA 3PCVA 4BEMJ 2ASRA 2KYHA 2L7AA 4OIPF 2UUIA 4OD4A 5DQZA 2WL8A 1WTYA 3R2PA 4MTGA 5HSWA 3S0XA 1FMVA 5D92A 4CJOA 5KYWA 3LEOA 4XEKA 2M64A 1A0BA 3C7JA 3DI5A 4NQFA 2XXAB 3LNMB 1NLXA 3CQZA 1OCRC 4YT4A 3SZRA 3FVYA 5KYXB 3ZTZA 2EINC 5A69A 1QZXA 2LQGA 3M4CA 1GS9A 1MQVA 1A41A 2YL1A 3T4RA 3EHMA 1M6TA 1AEPA 2HMQA 3ABKC 4FX5A 1I4ZA 2GWWA 4I44A 3SNHA 1TWCA 1FNTc 3N0TA 3NKEA 3S9OA 5A6JA 4KNVA 1D1AA 2HV7A 2XM0A 3I5PA 3K7DA 1A7VA 3GWLA 3TOLA 1OCZC 1D0YA 2IXPA 3TJ6A 2MWQA 1GQAA 1YARO 2W9YA 3CZ6A 1GM5A 2YRFA 1LM3B 4CS8C 3DJNB 2A0UA 2R7UA 3MX3A 1YVIA 4KI2A 1ZHXA 5T3TA 1SMYF 1ZYRF 1R4TA 4BJ1A 1TFOB 5JLIA 1I5NA 3MBGA 3LJBA 3NYLA 3B0VC 1TWAA 3VRCA 1Z6AA 5B1BC 1VOMA 3IPMO 3U5SA 2YQYA 3CSKA 5KYYA 2ICWG 4I1OB 2HV6A 3GWNA 3OEOA 1WWPA 2DI3A 4NTAA 3PHF2 2EPLX 2TMVP 4YWQA 2R02A 3H2VA 2HFIA 2O9XA 2UUHA 1MMAA 2Q9CA 2D5RB 2VH3A 3EGDB 4E0IA 3PMRA 4JEAA 4UDVA 5IY5C 1JPNA 1V74B 2Y3GA 3JSEO 4LACB 2EIJC 2OEVA 4M63A 4OD5A 3U9MA 5L0FA 4CBEA 3C8GD 3ZG1A 4OIQF 4U5EE 3UMHA 3ZIBA 3EFOA 4IWBA 4CSAA 3NMJA 3I4UA 1T9KA 4QDLA 5KYXA 4O79A 4KNWA 3HNLA 3FHDA 1ST6A 3EH1A 1NFNA 2J9BA 2PBEA 2YL7A 1T5OA 2PX0A 3S27A 4YL0A 4MVQA 2YEVA 3KYIA 2R05A 2CGEA 4Z9HA 2YKZA 3JRMO 4J7YA 3ZC4A 3M1CB 3NRHA 3KH2A 4A4AA 3GEHA 2GA0A 1RKEB 1OR3A 1T6IA 2NSFA 3H65A 3UMKA 1RXQA 1R5ID 3V5XA 3VAYA 3W2VA 4ZLCA 4U5BE 1HW1A 1ZHZA 2XLVA 2HJMA 5AC4A 3DMDA 3RQFA 4PACA 2KNHA 1LI7A 1LKXA 2XLMA 2QUPA 2XL8A 4JJFA 4XQ1A 2J9WA 1H9GA 3L8IA 2F22A 3FOOA 3DE8A 4E17A 3NMKA 4K0DA 3KPHA 1NU7D 3GORA 4YJWA 2XLEA 1AUEA 1BBHA 3K1HA 4HFKB 4JJGA 3US6A 5E33A 4D4NA 4CS9C 2OOCA 4CIPA 3IHUA 3LESA 3AGTA 2Y3DA 2HSQA 5K0IA 3S29A 1HE9A 3TD7A 4DBRA 4BPMA 2CCYA 2XLWA 3HJCA 4C3BA 2LFDA 3DM5A 4IGGA 3OA1A 4XLPF 3UGPA 1ZHTA 2R7OA 4LLEA 5KYWB 2A69F 3EGDA 3E70C 2MYSA 2HKVA 4C7OB 1VYIA 1VYKA 3ZWIA 3GM1A 4W8KA 3W4YA 1MMNA 3ABLC 3JT1A 3N2ZB 1D1BA 2BE5F 5AC5A 2G62A 2A6HF 1SYQA 3Q6MA 2R9RB 4WJ0A 1YAUO 1HMOA 1H7IA 2W4BA 3QVZA 3TOMA 4HE8D 4XEVA 1J8YF 1YJGA 2J7PD 2NSGA 2VCAA 4E0HA 3O6XA 1E2XA 1YZCA 4MVOA 2FGYA 1WN0A 3GM2A 1T01A 4NTFA 5T1DB 1CGOA 4CDAA 2QLAA 3AQCA 3HKKA 4XPWA 1NBBA 3WAQA 4DVYP 4H4KC 4L6RA 4U5FE 3TJ5A 1OCOC 1I4YA 2FFHA 2IXOA 2KK1A 2YL3A 1C03A 4AX2A 1RKEA 2Y39A 1D0ZA 5E3CA 5CI9A 1TKNA 1G8XA 3RIPA 3MYIA 3NKDA 3DAGA 4LDKA 1E83A 4JW1A 3B0UX 1MMGA 2CNWD 1QQ3A 1G4US 1H6GA 2XM4A 4NY3A 1CPQA 1ORSC 2I15A 2R7SA 4A2NB 4NCQA 1S7ZA 3QTHA 4JEBA 2VB6A 4WGYA 4DRJB 1PCXA 4EBJA 5KYYB 1HW2A 1XWJA 1M2VA 4EUKB 1LS4A 4P9FA 2DGJA 3V7OA 2PX3A 2KSFA 1HE1A 2A1DD 4ULVA 1L7CA 2W45A 2QY9A 3K1IA 1M57C 4O6YA 5E3AA 5KYUB 5L3QA 2ZPAA 4I1MA 4MW3A 3SXKA 2HUJA 2HMZA 3A11A 4AE4A 1MNEA 1QSPA 2XSEA 1D0XA 1YA7O 4LDRA 3DXJF 1Q0KA 2JX0A 4N4WA 3EFOB 1LE4A 3C18A 1KNYA 2DYSC 2A6EF 2HSBA 2MHRA 2YZSA 4G7OF 1YYJA 4J30B 1UG7A 4NC3A 4XTKA 3LNRA 1ZZPA 3JSZA 3AOUA 3FOPA 5A6KA 5B3SC 2P6VA 4JTCB 4Q7CA 3JZ0A 3HNJA 4P6IC 2AP3A 1BR1A 2OU6A 2OG2A 3DD7A 1ZHYA 2EPKX 2B0HA 3B9QA 3NYMA 3U9JA 5L0JA 4EBBA 4NTBA 1AVOB 3U2MA 3U2LA 2ZXPA 3QW0A 1ZU4A 4ONSA 1IZMA 1TWHA 1Z23A 3SYNA 1M56C 2EPOA 2GDCA 3RQGA 2R03A 4MVSA 4QI0A 1BDJB 4EWCA 4MQ9F 2Q00A 2ZXWC 2VCCA 3NYJA 1G5ZA 2X51A 3G4ZA 2L6HA 2IXMA 2L9JA 2CYDA 3GEIA 1E85A 4PJJA 3HNIA 1YDIA 4EKWA 4E7SA 5BQIA 1B68A 2G3KA 4C3EA 1DOVA 2OEXA 3EQLF 3GANA 3KL4A 3R7CA 1M2OA 1U6HA 2D4UA 2NUTA 4BJ6A 1CGME 3M4BA 4JZAA 2V3CC 1OKKA 1K40A 2P7VA 3MFNA 2BL2A 4FWVA 3V5YA 2VASA 3EGXB 2WZFA 2KC3A 5JVEA 1APCA 1NZEA 2AWCA 1NU9C 5KYUA 4Q4ZF 1SZIA 1OW7A 3LS1A 4OINF 1VMAA 2XL4A 2YLGA 3RKOF 4G7ZF 4JURI 3UMIA 1JOGA 1PD0A 2XL6A 2DB4A 2XLOA 2ZXRA 1BR4A 4GEHA 4N6HA 2L81A 3C8GB 4BEJA 3WG7C 2GFHA 1LI5A 1JR8A 3EH2A 2WZLA 2QTVA 2LK4A 3J06A 4CDVA 1Q0MA 1UFBA 3QMKA 3JRTA 2GAQA 5COGA 3RF3A 3RYLA 2J46A 2J45A 2LP4A 5F5HA 4MVMA 4LERA 5BUOA 5FCLA 1E84A 1YA9A 5DS5A 4XEFA 3E9VA 2YWAA 3G50A 1U89A 3H2UA 3FXHA 2XLDA 1Z5ZA 4W8PA 5JT4A 5BQHA 2P61A 4E18A 2EIMC 3ATPA 4YT5A 1HY5A 2IBFA 2J0XA 2VC9A 2R7RA 4DRHB 4G0HA 1K05A 3LEVA 3ASOC 4KBLA 4CSAC 1Z3IX 1TWGA 1M2VB 4WGZA 4PFOA 3M15A 4LDQA 4JCZA 3HNKA 4JIOA 1QVXA 5B3IA 3N24A 4JCHA 1YLMA 4CIHA 2QE9A 2XLHA 3LLKA 4RDAA 5JP7A 3I5QA 2E87A 4YN0B 3RW0A 3KMIA 1K04A 4BJ5A 1LIHA 4ULWA 4AE4B 3DAFA 4XPYA 3DJUB 3C63A 1SF8A 3UNGC 1PD1A 3EGXA 4LLCA 4WABA 2IYLD 1RJ9A 4IJJA 4PJNA 4IARA 2ZD9A 4CDYA 4K1OA 2EILC 2IOQA 1S05A 1EA8A 2G3VA 2ZXOA 2YLIA 4BJ5C 3KYJA 3K6BA 3QVYA 1OXBA 1XZPA 3K33A 1N1CA 4MTFA 4D4XA 5L0IA 3C8GA 4FESA 4OIRF 3T6BA 3AG2C 2BC5A 4E7ZA 4O7GA 4AK9A 5AGFA 1SR2A 2EPMX 3LS0A 1L3PA 4GQHA 5BQGA 4XLNF 4U9EA 3SXZA 1EKYA 1HMDA 4MNDA 2AVKA 4C3DA 1W2WA 3B29A 3GM3A 4P9TA 1YYXA 1NFOA 4X0RA 3LUTB 5JSLA 3B71A 1QPUA 1O3UA 2Y69C 3A9CA 1OXKA 4ANJA 3EJNA 1FFHA 3DZAA 4JTDB 4DVZA 5EHHA 1XZQA 2M4EA 2RSEB 2P1AA 4JTAB 3EG9B 4FAPB 2NUTB 2NPUA 4G7HF 2OQMA 5B1AC 1T6UA 4U9DA 4IRUA 2WVNA 2IM8A 3NG1A 3TULA 1V54C 3ZQVA 5JS5A 1G4WR 4I3MA 3SXMA 2YLDA 3ABMC 4MVRA 1FMWA 4OIOF 3GODA 3FMSA 3WHNA 1O87A 3DE9A 3T9OA 1RMVA 2OJED 3Q7LA 1NG1A 3VF0A 1QKRA 2LCHA 5A6BD 2H7OA 1LE2A 3ITFA 4G78A 1BZ4A 3ASNC 4J32B 4Q5SF 3X1OA 4J7TA 1JMWA 3IQ6A 5EK0A 2EPNA 4CX9A 5L3VA 3AJMA 3IQ5A 1Q0FA 3ZDLA 1YZAA 3DKAA 2LFFA 3ZVRA 1JRAA 2J7PA 2PNOA 1Q0GA 3T6GB 3C8ZA 1KU2A 3RFYA 5HV9A 2C04A 4CS8A 4MVZA 3K1IC 2H8AA 2V26A 3DM9B 3DWWA 5COMA 4PJMA 2XRHA 4U5DE 256BA 2JD3A 4YL3A 1ZW2A 3ECSA 3RQEA 3T6JA 2NUPB 4BJTA 4C7OA 3GEEA 2Q4FA 2LSEA 3QZCA 1GGQA 4JKVA 3IQTA 2PFDA 5KYNA 4U5CE 1ZHWA 2PP4A 1OQCA 2Q3TA 3FAJA 3IQCA 2CNWA 3EHNA 3L1MA 3EG9A 1EQ1A 4RBNA 3VM6A 3EZHA 4YK5A 2XS1A 3NDBB 3F47A 3RVZA 1RKCA 2R25A 3B0PA 3Q7GA 3SEOA 1DOWA 4N6CA 3U8VA 2Q7RA 3CEXA 3POVA 1U0BB 1RJ9B 1TR2A 2KJGA 1FFTC 3U3FA 1A7EA 3UR3C 3W8HA 1Y6DA 5COFA 5F5FA 3HLZA 2H7VC 3RVYA 3W8IA 1A7DA 2PF4E 4N06A 4JE9A 1Z7Qc 4YT8A 3HTKC 4DBQA 5DS4A 4RD9A 2HZ8A 4Z9IA 4CS7A 5DS6A 5JRAA 5A6BA 5CI8A 1ZU5A 3FDQA 1D1CA 2X0CA 2W4MA 1OW8A 4IB4A 3ZTMA 4U5GA 3OWTA 4BJ6C 5D91A 2CW0F 2Y3HA 4BG0A 1MMDA 3ZSUA 1H9TA 3EZIA 2R7XA 1VLTA 2C03A 3C62A 2L6GA 1OR2A 5L0DA 1V55C 2AU5A 2H7BA 1Q0DA 4O6NA 1E86A 3AQBA 2FAPB 3VYWA 1LS1A 2YVKA 5DLJA 1WGWA 2XXAA 2NUPA 2WB7A 3O10A 3LLIA 4JVSA 2R7TA 2LIGA 4O6MA 2LD6A 3AG1C 5L0CA 4CS9A 5F28E 2HJ3A 1F1MA 5E2QA 2WVQA 1WATA 3TK0A 4JRZA 1FTSA 1O5HA 2JPUA 2YHSA 3PDMP 1KTMA 3U0CA 3QW1A 2J8WA 4JC7A 2CDQA 2Z15A 5TJ5E 2Q9BA 2R7QA 2J0WA 4XPXA 2EIKC 1VLSA 1CPRA 1WASA 4QI2A 4U5HA 3MLGA 5GPGB 2AWYA 4AL0A 4R32A 4EHPA 5T3WA 3X2QC 4PK4A 2I8BA 3UGOA 4IAOA 4YT2A 2R7WA 4H54A 4F4BA 5CIVA 3AG3C 5DVWA 3V5ZA 3L8JA 2A68F 2J9VA 3IEEA 3KKBA 3BRJA 1CGNA 4MW8A 4XWJA 2RD9A 5FZTA 3U3BA 1T6QA 2KQ9A 2NG1A 1JAFA 2KGOA 3S28A 1NSGB 1Y4CA 1VB5A 2J9UA 3JCUQ 4ZLDA 1LVKA 2OJQA 4CJGA 4MVUA 1EI7A 1LPEA 2A0BA 1MNDA 1TFKB 1J8MF 1ORYA 2IXNA 2Y3BA 3EPVA 3TQOA 4EIYA 3AG4C 1WOLA 3FAPB 3ZQYA 4EBKA 3S84A 1VTMP 2WZGA 3L34A 4PFPA 4DOZA 1JPJA 4MTOA 4MS2A 3S90A 2QNLA 3O55A 1VK5A 2OCCC 1QLEC 4AL1A 2XS8A 1BR2A 1C02A 1C17M 3NMIA 3Q6NA 5L0GA 1FR0A 3JYHA 3W2WA 3JYYA
chains in the Genus database with same CATH topology
1A7EA 3AGUA 2HMZA 4XPWA 3WAQA 3WHNA 1A7DA 3AGTA 1HMDA 2AVKA 1I4YA 2MHRA 2HMQA 4XPYA 1I4ZA 4XPXA 2AWYA 2AWCA 1HMOA 4XQ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A7E A;  3AGU A;  2HMZ A;  4XPW A;  3WAQ A;  3WHN A;  1A7D A;  3AGT A;  1HMD A;  2AVK A;  1I4Y A;  2MHR A;  2HMQ A;  4XPY A;  1I4Z A;  4XPX A;  2AWY A;  2AWC A;  1HMO A;  4XQ1 A; 
#chains in the Genus database with same CATH topology
 4GYT A;  3WOD F;  2VCB A;  2P0N A;  1OW6 A;  3AGU A;  3U8P A;  1ZVZ A;  1FAP B;  2B0J A;  4B6I A;  4DJ9 A;  4Z9J A;  5JUA A;  2KW3 C;  3K66 A;  2WVO A;  2YL0 A;  5DQT A;  3CAX A;  1RCP A;  4IAQ A;  2DYR C;  1ORJ A;  1PV3 A;  1IW7 F;  5A6A A;  1ZW3 A;  1V4A A;  4K7B A;  3BEH A;  2L6F A;  2HS5 A;  4HEA J;  4DRI B;  5L0H A;  4YL1 A;  1OCC C;  2OKU A;  4DXW A;  5EGY A;  3JTL O;  1OKK D;  2ETS A;  1TQG A;  3M79 A;  4HFF B;  4PR9 A;  3RH3 A;  4KC9 A;  1Z63 A;  3SXY A;  3O39 A;  3MYF A;  2Q9A A;  3L0I A;  3F46 A;  4PJL A;  3G4X A;  3LAY A;  3SP1 A;  4ER9 A;  2R7V A;  3PCV A;  4BEM J;  2ASR A;  2KYH A;  2L7A A;  4OIP F;  2UUI A;  4OD4 A;  5DQZ A;  2WL8 A;  1WTY A;  3R2P A;  4MTG A;  5HSW A;  3S0X A;  1FMV A;  5D92 A;  4CJO A;  5KYW A;  3LEO A;  4XEK A;  2M64 A;  1A0B A;  3C7J A;  3DI5 A;  4NQF A;  2XXA B;  3LNM B;  1NLX A;  3CQZ A;  1OCR C;  4YT4 A;  3SZR A;  3FVY A;  5KYX B;  3ZTZ A;  2EIN C;  5A69 A;  1QZX A;  2LQG A;  3M4C A;  1GS9 A;  1MQV A;  1A41 A;  2YL1 A;  3T4R A;  3EHM A;  1M6T A;  1AEP A;  2HMQ A;  3ABK C;  4FX5 A;  1I4Z A;  2GWW A;  4I44 A;  3SNH A;  1TWC A;  1FNT c;  3N0T A;  3NKE A;  3S9O A;  5A6J A;  4KNV A;  1D1A A;  2HV7 A;  2XM0 A;  3I5P A;  3K7D A;  1A7V A;  3GWL A;  3TOL A;  1OCZ C;  1D0Y A;  2IXP A;  3TJ6 A;  2MWQ A;  1GQA A;  1YAR O;  2W9Y A;  3CZ6 A;  1GM5 A;  2YRF A;  1LM3 B;  4CS8 C;  3DJN B;  2A0U A;  2R7U A;  3MX3 A;  1YVI A;  4KI2 A;  1ZHX A;  5T3T A;  1SMY F;  1ZYR F;  1R4T A;  4BJ1 A;  1TFO B;  5JLI A;  1I5N A;  3MBG A;  3LJB A;  3NYL A;  3B0V C;  1TWA A;  3VRC A;  1Z6A A;  5B1B C;  1VOM A;  3IPM O;  3U5S A;  2YQY A;  3CSK A;  5KYY A;  2ICW G;  4I1O B;  2HV6 A;  3GWN A;  3OEO A;  1WWP A;  2DI3 A;  4NTA A;  3PHF 2;  2EPL X;  2TMV P;  4YWQ A;  2R02 A;  3H2V A;  2HFI A;  2O9X A;  2UUH A;  1MMA A;  2Q9C A;  2D5R B;  2VH3 A;  3EGD B;  4E0I A;  3PMR A;  4JEA A;  4UDV A;  5IY5 C;  1JPN A;  1V74 B;  2Y3G A;  3JSE O;  4LAC B;  2EIJ C;  2OEV A;  4M63 A;  4OD5 A;  3U9M A;  5L0F A;  4CBE A;  3C8G D;  3ZG1 A;  4OIQ F;  4U5E E;  3UMH A;  3ZIB A;  3EFO A;  4IWB A;  4CSA A;  3NMJ A;  3I4U A;  1T9K A;  4QDL A;  5KYX A;  4O79 A;  4KNW A;  3HNL A;  3FHD A;  1ST6 A;  3EH1 A;  1NFN A;  2J9B A;  2PBE A;  2YL7 A;  1T5O A;  2PX0 A;  3S27 A;  4YL0 A;  4MVQ A;  2YEV A;  3KYI A;  2R05 A;  2CGE A;  4Z9H A;  2YKZ A;  3JRM O;  4J7Y A;  3ZC4 A;  3M1C B;  3NRH A;  3KH2 A;  4A4A A;  3GEH A;  2GA0 A;  1RKE B;  1OR3 A;  1T6I A;  2NSF A;  3H65 A;  3UMK A;  1RXQ A;  1R5I D;  3V5X A;  3VAY A;  3W2V A;  4ZLC A;  4U5B E;  1HW1 A;  1ZHZ A;  2XLV A;  2HJM A;  5AC4 A;  3DMD A;  3RQF A;  4PAC A;  2KNH A;  1LI7 A;  1LKX A;  2XLM A;  2QUP A;  2XL8 A;  4JJF A;  4XQ1 A;  2J9W A;  1H9G A;  3L8I A;  2F22 A;  3FOO A;  3DE8 A;  4E17 A;  3NMK A;  4K0D A;  3KPH A;  1NU7 D;  3GOR A;  4YJW A;  2XLE A;  1AUE A;  1BBH A;  3K1H A;  4HFK B;  4JJG A;  3US6 A;  5E33 A;  4D4N A;  4CS9 C;  2OOC A;  4CIP A;  3IHU A;  3LES A;  3AGT A;  2Y3D A;  2HSQ A;  5K0I A;  3S29 A;  1HE9 A;  3TD7 A;  4DBR A;  4BPM A;  2CCY A;  2XLW A;  3HJC A;  4C3B A;  2LFD A;  3DM5 A;  4IGG A;  3OA1 A;  4XLP F;  3UGP A;  1ZHT A;  2R7O A;  4LLE A;  5KYW B;  2A69 F;  3EGD A;  3E70 C;  2MYS A;  2HKV A;  4C7O B;  1VYI A;  1VYK A;  3ZWI A;  3GM1 A;  4W8K A;  3W4Y A;  1MMN A;  3ABL C;  3JT1 A;  3N2Z B;  1D1B A;  2BE5 F;  5AC5 A;  2G62 A;  2A6H F;  1SYQ A;  3Q6M A;  2R9R B;  4WJ0 A;  1YAU O;  1HMO A;  1H7I A;  2W4B A;  3QVZ A;  3TOM A;  4HE8 D;  4XEV A;  1J8Y F;  1YJG A;  2J7P D;  2NSG A;  2VCA A;  4E0H A;  3O6X A;  1E2X A;  1YZC A;  4MVO A;  2FGY A;  1WN0 A;  3GM2 A;  1T01 A;  4NTF A;  5T1D B;  1CGO A;  4CDA A;  2QLA A;  3AQC A;  3HKK A;  4XPW A;  1NBB A;  3WAQ A;  4DVY P;  4H4K C;  4L6R A;  4U5F E;  3TJ5 A;  1OCO C;  1I4Y A;  2FFH A;  2IXO A;  2KK1 A;  2YL3 A;  1C03 A;  4AX2 A;  1RKE A;  2Y39 A;  1D0Z A;  5E3C A;  5CI9 A;  1TKN A;  1G8X A;  3RIP A;  3MYI A;  3NKD A;  3DAG A;  4LDK A;  1E83 A;  4JW1 A;  3B0U X;  1MMG A;  2CNW D;  1QQ3 A;  1G4U S;  1H6G A;  2XM4 A;  4NY3 A;  1CPQ A;  1ORS C;  2I15 A;  2R7S A;  4A2N B;  4NCQ A;  1S7Z A;  3QTH A;  4JEB A;  2VB6 A;  4WGY A;  4DRJ B;  1PCX A;  4EBJ A;  5KYY B;  1HW2 A;  1XWJ A;  1M2V A;  4EUK B;  1LS4 A;  4P9F A;  2DGJ A;  3V7O A;  2PX3 A;  2KSF A;  1HE1 A;  2A1D D;  4ULV A;  1L7C A;  2W45 A;  2QY9 A;  3K1I A;  1M57 C;  4O6Y A;  5E3A A;  5KYU B;  5L3Q A;  2ZPA A;  4I1M A;  4MW3 A;  3SXK A;  2HUJ A;  2HMZ A;  3A11 A;  4AE4 A;  1MNE A;  1QSP A;  2XSE A;  1D0X A;  1YA7 O;  4LDR A;  3DXJ F;  1Q0K A;  2JX0 A;  4N4W A;  3EFO B;  1LE4 A;  3C18 A;  1KNY A;  2DYS C;  2A6E F;  2HSB A;  2MHR A;  2YZS A;  4G7O F;  1YYJ A;  4J30 B;  1UG7 A;  4NC3 A;  4XTK A;  3LNR A;  1ZZP A;  3JSZ A;  3AOU A;  3FOP A;  5A6K A;  5B3S C;  2P6V A;  4JTC B;  4Q7C A;  3JZ0 A;  3HNJ A;  4P6I C;  2AP3 A;  1BR1 A;  2OU6 A;  2OG2 A;  3DD7 A;  1ZHY A;  2EPK X;  2B0H A;  3B9Q A;  3NYM A;  3U9J A;  5L0J A;  4EBB A;  4NTB A;  1AVO B;  3U2M A;  3U2L A;  2ZXP A;  3QW0 A;  1ZU4 A;  4ONS A;  1IZM A;  1TWH A;  1Z23 A;  3SYN A;  1M56 C;  2EPO A;  2GDC A;  3RQG A;  2R03 A;  4MVS A;  4QI0 A;  1BDJ B;  4EWC A;  4MQ9 F;  2Q00 A;  2ZXW C;  2VCC A;  3NYJ A;  1G5Z A;  2X51 A;  3G4Z A;  2L6H A;  2IXM A;  2L9J A;  2CYD A;  3GEI A;  1E85 A;  4PJJ A;  3HNI A;  1YDI A;  4EKW A;  4E7S A;  5BQI A;  1B68 A;  2G3K A;  4C3E A;  1DOV A;  2OEX A;  3EQL F;  3GAN A;  3KL4 A;  3R7C A;  1M2O A;  1U6H A;  2D4U A;  2NUT A;  4BJ6 A;  1CGM E;  3M4B A;  4JZA A;  2V3C C;  1OKK A;  1K40 A;  2P7V A;  3MFN A;  2BL2 A;  4FWV A;  3V5Y A;  2VAS A;  3EGX B;  2WZF A;  2KC3 A;  5JVE A;  1APC A;  1NZE A;  2AWC A;  1NU9 C;  5KYU A;  4Q4Z F;  1SZI A;  1OW7 A;  3LS1 A;  4OIN F;  1VMA A;  2XL4 A;  2YLG A;  3RKO F;  4G7Z F;  4JUR I;  3UMI A;  1JOG A;  1PD0 A;  2XL6 A;  2DB4 A;  2XLO A;  2ZXR A;  1BR4 A;  4GEH A;  4N6H A;  2L81 A;  3C8G B;  4BEJ A;  3WG7 C;  2GFH A;  1LI5 A;  1JR8 A;  3EH2 A;  2WZL A;  2QTV A;  2LK4 A;  3J06 A;  4CDV A;  1Q0M A;  1UFB A;  3QMK A;  3JRT A;  2GAQ A;  5COG A;  3RF3 A;  3RYL A;  2J46 A;  2J45 A;  2LP4 A;  5F5H A;  4MVM A;  4LER A;  5BUO A;  5FCL A;  1E84 A;  1YA9 A;  5DS5 A;  4XEF A;  3E9V A;  2YWA A;  3G50 A;  1U89 A;  3H2U A;  3FXH A;  2XLD A;  1Z5Z A;  4W8P A;  5JT4 A;  5BQH A;  2P61 A;  4E18 A;  2EIM C;  3ATP A;  4YT5 A;  1HY5 A;  2IBF A;  2J0X A;  2VC9 A;  2R7R A;  4DRH B;  4G0H A;  1K05 A;  3LEV A;  3ASO C;  4KBL A;  4CSA C;  1Z3I X;  1TWG A;  1M2V B;  4WGZ A;  4PFO A;  3M15 A;  4LDQ A;  4JCZ A;  3HNK A;  4JIO A;  1QVX A;  5B3I A;  3N24 A;  4JCH A;  1YLM A;  4CIH A;  2QE9 A;  2XLH A;  3LLK A;  4RDA A;  5JP7 A;  3I5Q A;  2E87 A;  4YN0 B;  3RW0 A;  3KMI A;  1K04 A;  4BJ5 A;  1LIH A;  4ULW A;  4AE4 B;  3DAF A;  4XPY A;  3DJU B;  3C63 A;  1SF8 A;  3UNG C;  1PD1 A;  3EGX A;  4LLC A;  4WAB A;  2IYL D;  1RJ9 A;  4IJJ A;  4PJN A;  4IAR A;  2ZD9 A;  4CDY A;  4K1O A;  2EIL C;  2IOQ A;  1S05 A;  1EA8 A;  2G3V A;  2ZXO A;  2YLI A;  4BJ5 C;  3KYJ A;  3K6B A;  3QVY A;  1OXB A;  1XZP A;  3K33 A;  1N1C A;  4MTF A;  4D4X A;  5L0I A;  3C8G A;  4FES A;  4OIR F;  3T6B A;  3AG2 C;  2BC5 A;  4E7Z A;  4O7G A;  4AK9 A;  5AGF A;  1SR2 A;  2EPM X;  3LS0 A;  1L3P A;  4GQH A;  5BQG A;  4XLN F;  4U9E A;  3SXZ A;  1EKY A;  1HMD A;  4MND A;  2AVK A;  4C3D A;  1W2W A;  3B29 A;  3GM3 A;  4P9T A;  1YYX A;  1NFO A;  4X0R A;  3LUT B;  5JSL A;  3B71 A;  1QPU A;  1O3U A;  2Y69 C;  3A9C A;  1OXK A;  4ANJ A;  3EJN A;  1FFH A;  3DZA A;  4JTD B;  4DVZ A;  5EHH A;  1XZQ A;  2M4E A;  2RSE B;  2P1A A;  4JTA B;  3EG9 B;  4FAP B;  2NUT B;  2NPU A;  4G7H F;  2OQM A;  5B1A C;  1T6U A;  4U9D A;  4IRU A;  2WVN A;  2IM8 A;  3NG1 A;  3TUL A;  1V54 C;  3ZQV A;  5JS5 A;  1G4W R;  4I3M A;  3SXM A;  2YLD A;  3ABM C;  4MVR A;  1FMW A;  4OIO F;  3GOD A;  3FMS A;  3WHN A;  1O87 A;  3DE9 A;  3T9O A;  1RMV A;  2OJE D;  3Q7L A;  1NG1 A;  3VF0 A;  1QKR A;  2LCH A;  5A6B D;  2H7O A;  1LE2 A;  3ITF A;  4G78 A;  1BZ4 A;  3ASN C;  4J32 B;  4Q5S F;  3X1O A;  4J7T A;  1JMW A;  3IQ6 A;  5EK0 A;  2EPN A;  4CX9 A;  5L3V A;  3AJM A;  3IQ5 A;  1Q0F A;  3ZDL A;  1YZA A;  3DKA A;  2LFF A;  3ZVR A;  1JRA A;  2J7P A;  2PNO A;  1Q0G A;  3T6G B;  3C8Z A;  1KU2 A;  3RFY A;  5HV9 A;  2C04 A;  4CS8 A;  4MVZ A;  3K1I C;  2H8A A;  2V26 A;  3DM9 B;  3DWW A;  5COM A;  4PJM A;  2XRH A;  4U5D E;  256B A;  2JD3 A;  4YL3 A;  1ZW2 A;  3ECS A;  3RQE A;  3T6J A;  2NUP B;  4BJT A;  4C7O A;  3GEE A;  2Q4F A;  2LSE A;  3QZC A;  1GGQ A;  4JKV A;  3IQT A;  2PFD A;  5KYN A;  4U5C E;  1ZHW A;  2PP4 A;  1OQC A;  2Q3T A;  3FAJ A;  3IQC A;  2CNW A;  3EHN A;  3L1M A;  3EG9 A;  1EQ1 A;  4RBN A;  3VM6 A;  3EZH A;  4YK5 A;  2XS1 A;  3NDB B;  3F47 A;  3RVZ A;  1RKC A;  2R25 A;  3B0P A;  3Q7G A;  3SEO A;  1DOW A;  4N6C A;  3U8V A;  2Q7R A;  3CEX A;  3POV A;  1U0B B;  1RJ9 B;  1TR2 A;  2KJG A;  1FFT C;  3U3F A;  1A7E A;  3UR3 C;  3W8H A;  1Y6D A;  5COF A;  5F5F A;  3HLZ A;  2H7V C;  3RVY A;  3W8I A;  1A7D A;  2PF4 E;  4N06 A;  4JE9 A;  1Z7Q c;  4YT8 A;  3HTK C;  4DBQ A;  5DS4 A;  4RD9 A;  2HZ8 A;  4Z9I A;  4CS7 A;  5DS6 A;  5JRA A;  5A6B A;  5CI8 A;  1ZU5 A;  3FDQ A;  1D1C A;  2X0C A;  2W4M A;  1OW8 A;  4IB4 A;  3ZTM A;  4U5G A;  3OWT A;  4BJ6 C;  5D91 A;  2CW0 F;  2Y3H A;  4BG0 A;  1MMD A;  3ZSU A;  1H9T A;  3EZI A;  2R7X A;  1VLT A;  2C03 A;  3C62 A;  2L6G A;  1OR2 A;  5L0D A;  1V55 C;  2AU5 A;  2H7B A;  1Q0D A;  4O6N A;  1E86 A;  3AQB A;  2FAP B;  3VYW A;  1LS1 A;  2YVK A;  5DLJ A;  1WGW A;  2XXA A;  2NUP A;  2WB7 A;  3O10 A;  3LLI A;  4JVS A;  2R7T A;  2LIG A;  4O6M A;  2LD6 A;  3AG1 C;  5L0C A;  4CS9 A;  5F28 E;  2HJ3 A;  1F1M A;  5E2Q A;  2WVQ A;  1WAT A;  3TK0 A;  4JRZ A;  1FTS A;  1O5H A;  2JPU A;  2YHS A;  3PDM P;  1KTM A;  3U0C A;  3QW1 A;  2J8W A;  4JC7 A;  2CDQ A;  2Z15 A;  5TJ5 E;  2Q9B A;  2R7Q A;  2J0W A;  4XPX A;  2EIK C;  1VLS A;  1CPR A;  1WAS A;  4QI2 A;  4U5H A;  3MLG A;  5GPG B;  2AWY A;  4AL0 A;  4R32 A;  4EHP A;  5T3W A;  3X2Q C;  4PK4 A;  2I8B A;  3UGO A;  4IAO A;  4YT2 A;  2R7W A;  4H54 A;  4F4B A;  5CIV A;  3AG3 C;  5DVW A;  3V5Z A;  3L8J A;  2A68 F;  2J9V A;  3IEE A;  3KKB A;  3BRJ A;  1CGN A;  4MW8 A;  4XWJ A;  2RD9 A;  5FZT A;  3U3B A;  1T6Q A;  2KQ9 A;  2NG1 A;  1JAF A;  2KGO A;  3S28 A;  1NSG B;  1Y4C A;  1VB5 A;  2J9U A;  3JCU Q;  4ZLD A;  1LVK A;  2OJQ A;  4CJG A;  4MVU A;  1EI7 A;  1LPE A;  2A0B A;  1MND A;  1TFK B;  1J8M F;  1ORY A;  2IXN A;  2Y3B A;  3EPV A;  3TQO A;  4EIY A;  3AG4 C;  1WOL A;  3FAP B;  3ZQY A;  4EBK A;  3S84 A;  1VTM P;  2WZG A;  3L34 A;  4PFP A;  4DOZ A;  1JPJ A;  4MTO A;  4MS2 A;  3S90 A;  2QNL A;  3O55 A;  1VK5 A;  2OCC C;  1QLE C;  4AL1 A;  2XS8 A;  1BR2 A;  1C02 A;  1C17 M;  3NMI A;  3Q6N A;  5L0G A;  1FR0 A;  3JYH A;  3W2W A;  3JYY A; 
#chains in the Genus database with same CATH homology
 1A7E A;  3AGU A;  2HMZ A;  4XPW A;  3WAQ A;  3WHN A;  1A7D A;  3AGT A;  1HMD A;  2AVK A;  1I4Y A;  2MHR A;  2HMQ A;  4XPY A;  1I4Z A;  4XPX A;  2AWY A;  2AWC A;  1HMO A;  4XQ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...