4EUKB

Crystal structure
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
152
structure length
152
Chain Sequence
MDLVQKQKSLQDYTKSLFLEGILDSQFLQLQQLQDESNPDFVSQVVTLFFQDSDRILNDLSLSLDQQVVDFKKVDPHVHQLKGSSSSIGAQRVKNACVVFRSFCEQQNVEACHRCLQQVKQEYYLVKNRLETLFKLEQQIVASGGMIPAVEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Histidine kinase 5
publication title Structure-Function Analysis of Arabidopsis thaliana Histidine Kinase AHK5 Bound to Its Cognate Phosphotransfer Protein AHP1.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 66
structure length 152
sequence length 152
ec nomenclature
pdb deposition date 2012-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01627 Hpt Hpt domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.160 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) HPT domain 4eukB00
1WN0A 1Y6DA 1FR0A 2Q4FA 1BDJB 1YVIA 3KYIA 1OXKA 4EUKB 3KYJA 4PACA 1QSPA 2LD6A 1I5NA 4G78A 1C02A 2OOCA 2LP4A 1SR2A 3MYFA 1OXBA 2LCHA 1A0BA 2R25A 3US6A 1C03A 3IQTA 1TQGA 3U3BA 2A0BA
chains in the Genus database with same CATH superfamily
2M64A 3T4RA 3RW0A 2YLGA 1ORSC 3KPHA 3MBGA 2A69F 4MTFA 2R7QA 2XRHA 1CGME 3RKOF 1M6TA 3NYLA 4IAOA 1C17M 4DXWA 1RKEB 2AP3A 5T3WA 3SXZA 3LEVA 2I8BA 3TJ6A 3B71A 3G50A 3JT1A 4BJ1A 2Q9AA 4IAQA 1JPNA 5B3IA 1XZPA 2LCHA 4LLEA 2QTVA 4NTBA 2XLWA 2YZSA 1JRAA 1OKKA 2QE9A 3EGXA 1FNTc 2YHSA 3CSKA 5B1AC 2J45A 3R7CA 3U5SA 5L3VA 3CAXA 2PNOA 4JEBA 3U8PA 3ZDLA 3IEEA 2Q7RA 3ASOC 4E7SA 2XXAB 4CJGA 3QW0A 3KL4A 2Y39A 3A9CA 3S0XA 1M56C 1WASA 3U2LA 3W4YA 2WZGA 4BJ5A 1FR0A 3B9QA 5DS4A 1T01A 4OD5A 2G3KA 4MVSA 2J0WA 2QNLA 4BEJA 1LS1A 1OXKA 4OIQF 4GYTA 3ZC4A 5F5HA 1RMVA 2L6HA 2OU6A 3HLZA 1T6QA 5CIVA 3GEHA 1Q0GA 3JTLO 2DB4A 4K1OA 4CSAC 1CGOA 1E2XA 2CNWD 2J46A 3WAQA 1DOWA 1UG7A 3E9VA 2LFFA 2R03A 3U8VA 1V74B 2J0XA 4PJLA 1H9TA 2JD3A 1D1CA 2KSFA 2KK1A 1A41A 4CDYA 1CGNA 2YVKA 2Q9BA 4KNVA 4G7ZF 1S05A 4P9TA 2KYHA 1TWGA 1BR1A 1XZQA 3JRMO 1LKXA 5COGA 3RF3A 3IQ5A 4FX5A 4AL1A 2TMVP 3SEOA 4K7BA 2QY9A 5DVWA 3LJBA 1ZHYA 3K1IC 3BEHA 3K33A 4MVZA 4R32A 2LD6A 3NYJA 1GGQA 4N06A 1O87A 2XLMA 2EPNA 3L1MA 5AGFA 1E86A 2YL1A 1RKCA 1ZU5A 1K40A 2NUTB 3EZHA 3F46A 2P61A 3LAYA 3V5ZA 2XL6A 5AC5A 1E83A 4JE9A 1VTMP 1FMVA 3K6BA 1VLTA 3RH3A 3MX3A 2W4MA 3TOMA 3W8HA 4D4XA 2EIJC 3B0VC 5JS5A 1JAFA 2EIMC 4JTCB 4U5FE 4Z9JA 4EWCA 5BQHA 1HY5A 4CSAA 4OIPF 1M2OA 3G4XA 4NY3A 4BEMJ 1ORYA 2KJGA 3QVZA 4PK4A 5D92A 2DYSC 3U3BA 4MVRA 2R7VA 3SXKA 4MTGA 4BJ6C 2W45A 3HNJA 3ZSUA 4DOZA 4GQHA 3LS0A 4YL1A 4B6IA 4JCHA 5JSLA 1Z6AA 4MVOA 4U5DE 2HUJA 4PFPA 4FAPB 3EH2A 3KYIA 1RJ9B 3NYMA 1MNEA 2CNWA 4JIOA 3V5YA 5KYYA 4Q5SF 4A2NB 2J9UA 5D91A 1FMWA 3VYWA 4BG0A 3IPMO 2GDCA 3VF0A 2G62A 4CDAA 2X51A 2NSFA 3DMDA 3FOOA 1JMWA 3C7JA 5COFA 3RQEA 3HNIA 1KTMA 3K1IA 1WATA 4I3MA 1L7CA 1OXBA 2LIGA 5KYWB 2LSEA 3US6A 4YT8A 5EHHA 4O6NA 4ONSA 5F28E 2XL4A 1TQGA 3WHNA 2XM0A 3EGDB 4E7ZA 1RKEA 2P1AA 2ZXPA 2ASRA 1VB5A 4PJMA 3RVYA 1I4ZA 1HMDA 1M2VA 5E3CA 5KYXA 2L81A 3S27A 3H2VA 4C3BA 4JJGA 4LDKA 2GWWA 3VRCA 3HNKA 1WOLA 3EJNA 4MW8A 2KW3C 4W8PA 4BJ6A 1AUEA 3TJ5A 1HMOA 5L0JA 2YWAA 1NLXA 4AK9A 1BBHA 3EHNA 1EKYA 1NFOA 3DJUB 3TOLA 5A6BD 2XXAA 4EBKA 4EHPA 3FAJA 5KYNA 3QMKA 4PJJA 1YZAA 1ZVZA 3NMJA 3Q7LA 1MNDA 3V7OA 3UNGC 3ABMC 4LLCA 4XEVA 2WZLA 5FZTA 2Y3HA 2NUPB 3LUTB 1ST6A 2GAQA 4IJJA 5DS6A 5COMA 1H9GA 4EBJA 2R7SA 1YA9A 2IXPA 3PDMP 3C8ZA 2A68F 5IY5C 4QI2A 3S9OA 3O10A 3N0TA 1MMAA 3RVZA 4O6YA 1Z7Qc 4E0HA 4MQ9F 4I1OB 3NG1A 4U9EA 3WODF 3B0UX 5DQZA 4JC7A 3SYNA 3ZTMA 1AVOB 2YL0A 2DGJA 2ZPAA 3WG7C 4CS7A 4EBBA 5L0FA 1LE2A 4E18A 5GPGB 1TWAA 2IXNA 4YN0B 5KYUB 2CDQA 3QZCA 2IM8A 2R25A 3HKKA 2FAPB 1LM3B 4ANJA 1WGWA 3LEOA 2QLAA 5E3AA 4MVQA 3O6XA 4JZAA 2PFDA 3JYYA 1A7EA 2HSBA 4YT2A 5DQTA 1JR8A 2RD9A 4I44A 3T6JA 3CQZA 1D0ZA 2IXOA 2OEXA 3LESA 2GA0A 3M15A 3EFOB 5A6BA 1J8MF 1NU7D 1CPQA 2A6HF 2W4BA 3EG9B 3JZ0A 4IWBA 4DJ9A 2PX0A 2AU5A 4O7GA 3K66A 4CX9A 3UMKA 1O5HA 1TR2A 2QUPA 3KH2A 4HFKB 3AGUA 1V4AA 5A6AA 3NDBB 3QTHA 4XTKA 5CI9A 4LDQA 1DOVA 2NG1A 2AWCA 2E87A 2C03A 1OR3A 3IQCA 4DVZA 4BJTA 3DXJF 3FMSA 1O3UA 1K04A 1K05A 1KNYA 5AC4A 4QI0A 1Z23A 1Z3IX 1PV3A 1D0YA 2D5RB 2IXMA 4U5HA 5DLJA 1LS4A 4KI2A 5B3SC 3M79A 1OR2A 2PX3A 2R02A 3GM2A 3O55A 3H2UA 3U3FA 2XM4A 1VK5A 2EPLX 3B0PA 1M57C 3AG4C 2GFHA 5BQIA 1W2WA 1ZHZA 2H7VC 1S7ZA 1VYKA 2XLOA 4YL3A 4OD4A 2A1DD 3DZAA 3JYHA 5KYWA 2Y69C 3KYJA 3L34A 2LQGA 5T1DB 3ZWIA 1H6GA 3DM9B 1Z63A 1TKNA 2OCCC 2V26A 4H54A 4KNWA 2EPMX 4YL0A 3T6BA 3NMKA 3G4ZA 3TQOA 2M4EA 4JVSA 1FTSA 3X2QC 3GEIA 3EGDA 2OG2A 3EQLF 4Q7CA 4KC9A 5FCLA 1YDIA 2P6VA 2OKUA 4XLNF 3C63A 1APCA 1OW8A 3RFYA 5E33A 2R7TA 2XLVA 1QVXA 3B29A 3JSEO 5JVEA 3SZRA 2Y3GA 1Q0FA 4Z9HA 1A7VA 3FHDA 2KGOA 4MNDA 3TK0A 2HV6A 4EIYA 1D0XA 2XS1A 4AX2A 1ZZPA 2PBEA 3N2ZB 3FXHA 2KQ9A 4G0HA 5L3QA 2YQYA 3EGXB 4G7HF 1LVKA 2R7UA 3DAFA 1HW2A 1OCCC 2Q4FA 3MLGA 1BZ4A 2XLEA 3HJCA 3M4BA 3Q7GA 1HE9A 1LI7A 3EH1A 4PJNA 1GM5A 2CW0F 3RQGA 1I5NA 2XSEA 3RQFA 3AJMA 3S28A 3AG3C 3DD7A 4N6CA 3H65A 2WB7A 3PHF2 2YKZA 1YJGA 4IRUA 1SR2A 1IZMA 2KNHA 3I4UA 1AEPA 4QDLA 4UDVA 2XLHA 4ZLCA 3GANA 2HV7A 1FAPB 4YWQA 2BL2A 2WZFA 3ZG1A 4MW3A 4C3DA 2VC9A 4J32B 2P7VA 4XPXA 4H4KC 1ZW3A 4ER9A 5L0CA 3OWTA 3PCVA 3UGPA 4O6MA 1HE1A 3U9MA 2HJ3A 4ULWA 2MYSA 2YRFA 3UGOA 2YL3A 2PF4E 2G3VA 1SF8A 2WVNA 1V54C 3TULA 2JPUA 2A6EF 3LS1A 4JKVA 1T6UA 3V5XA 1YYXA 3X1OA 5K0IA 3C62A 3C8GB 2V3CC 3L8IA 4RD9A 3ABKC 2LP4A 2HZ8A 2R7OA 5EK0A 3ECSA 3POVA 4ZLDA 3SXMA 1XWJA 1YZCA 4YT5A 4PR9A 1GS9A 1RCPA 4AE4B 1NSGB 3DKAA 3K7DA 3Q6NA 3EFOA 3IQTA 4MTOA 3ZTZA 2X0CA 3EG9A 1SZIA 2VCAA 3UMHA 2Z15A 3S90A 1BR4A 2CCYA 1YLMA 2R7RA 2HKVA 3SNHA 3HTKC 1OCRC 2UUIA 4X0RA 5HV9A 1G4US 3GORA 2HFIA 1NU9C 2HJMA 5A69A 3FDQA 1MMNA 1U0BB 3JCUQ 2LFDA 5TJ5E 4FESA 4ULVA 4C7OB 4PACA 4JTDB 1YYJA 4W8KA 4J30B 1QPUA 3DJNB 3OA1A 1ZU4A 2R9RB 3AG2C 3CZ6A 3L8JA 4YJWA 3SXYA 4XWJA 1H7IA 5L0DA 1FFHA 2F22A 3GM3A 2CGEA 1N1CA 1Y4CA 5BUOA 5F5FA 4MVUA 1VLSA 4DVYP 5BQGA 4NCQA 4G7OF 4DBQA 2R7WA 1ZHXA 2VB6A 3MFNA 1QKRA 2LK4A 3ZIBA 5T3TA 1LIHA 3LNRA 3ZVRA 1NG1A 4CS8A 2H7BA 3M1CB 2R7XA 3EZIA 2FGYA 1Q0DA 3LNMB 4C3EA 4WABA 2A0BA 3RYLA 1EI7A 2I15A 4U5EE 5A6JA 2J7PD 3EPVA 2XS8A 2NUTA 1Y6DA 3S29A 3W2WA 1QQ3A 2D4UA 2Y3BA 1YVIA 2Q00A 3AQBA 4OIOF 3C8GD 2L7AA 1G5ZA 1L3PA 2C04A 4GEHA 4U9DA 4XQ1A 2W9YA 1M2VB 2J9BA 3OEOA 4L6RA 5KYXB 2B0HA 3DI5A 3MYFA 2EILC 1YA7O 2EPOA 5JUAA 4XPWA 2HMQA 3JRTA 3ZQVA 2MHRA 1A0BA 3ZQYA 4CS9A 4E0IA 3UR3C 4CDVA 5JT4A 4IGGA 1G4WR 1Q0MA 3GWNA 2CYDA 2IYLD 2VASA 3LLKA 1RJ9A 1Q0KA 3EHMA 4I1MA 1F1MA 1RXQA 4O79A 3DE8A 1WWPA 1FFTC 1NBBA 1VOMA 2HSQA 4DBRA 2YLDA 3TD7A 3L0IA 1ZYRF 3DWWA 4DRHB 2YL7A 1NFNA 2AVKA 2WL8A 3NKEA 4CBEA 4JJFA 3IQ6A 2VH3A 4EUKB 1TWHA 3I5PA 1QSPA 1QZXA 2AWYA 2Q3TA 3FOPA 4FWVA 4AL0A 3GODA 3FAPB 3RIPA 4J7YA 4CJOA 4DRJB 4RDAA 5JRAA 2O9XA 3UMIA 1TWCA 4OIRF 3S84A 1OQCA 4JTAB 4CS9C 1SYQA 2L9JA 4YT4A 2H8AA 4K0DA 1E85A 2ICWG 3VM6A 1OW7A 3AOUA 3ABLC 1GQAA 1D1AA 2J7PA 2YLIA 1MQVA 2BC5A 2ZXRA 3DAGA 3NKDA 4IARA 4NQFA 4P9FA 256BA 1JOGA 1R5ID 2OJED 4LDRA 1SMYF 3C8GA 4MVMA 4D4NA 1YAUO 4WJ0A 4YK5A 3T6GB 2B0JA 3BRJA 4E17A 5L0IA 4CIHA 1U89A 4N6HA 2OEVA 3IHUA 1BDJB 1OCZC 3GWLA 2KC3A 4AE4A 4Q4ZF 4NTFA 2J9WA 4A4AA 3QW1A 2FFHA 4PFOA 1PD1A 1OCOC 1MMDA 3CEXA 4G78A 5CI8A 2NUPA 1Z5ZA 3JSZA 4JW1A 2DYRC 4DRIB 4MS2A 2HMZA 3K1HA 2ZXWC 3U9JA 5A6KA 2MWQA 5L0GA 1LPEA 3M4CA 2EINC 2IOQA 4XEKA 1VYIA 2H7OA 4HE8D 4XLPF 3O39A 4EKWA 3GEEA 4HEAJ 2OJQA 2P0NA 3HNLA 2J8WA 2JX0A 3U0CA 4C7OA 4CIPA 1QLEC 2ETSA 3FVYA 1ZHTA 3I5QA 5E2QA 1G8XA 2DI3A 2WVQA 1KU2A 3F47A 5B1BC 2NSGA 1WN0A 2XLDA 3NMIA 3AGTA 3R2PA 1B68A 4XEFA 1TFKB 1E84A 4J7TA 4RBNA 2Y3DA 1EA8A 1LI5A 2HS5A 5KYUA 3MYIA 3W2VA 1ZHWA 1C02A 2L6FA 4XPYA 4U5BE 1I4YA 4M63A 2OOCA 4Z9IA 3DM5A 1T9KA 1OW6A 2NPUA 4KBLA 1PCXA 4CS8C 1MMGA 1IW7F 1CPRA 4WGZA 4JEAA 5JLIA 1C03A 5L0HA 1T6IA 4BPMA 1HW1A 2XL8A 3ASNC 4U5GA 2J9VA 1EQ1A 3U2MA 1ZW2A 2OQMA 5DS5A 1BR2A 2PP4A 1NZEA 1OKKD 1R4TA 1WTYA 2A0UA 2EIKC 2EPKX 2RSEB 2VCBA 3DE9A 3KKBA 4JCZA 2L6GA 3QVYA 4N4WA 4LACB 1J8YF 4OINF 1U6HA 1V55C 3VAYA 1JPJA 4JURI 1ORJA 3W8IA 1VMAA 5HSWA 1UFBA 4NC3A 3T9OA 3AG1C 2ZXOA 2R05A 4HFFB 3GM1A 1D1BA 4JRZA 4U5CE 4P6IC 4IB4A 1A7DA 3ATPA 3KMIA 2WVOA 3NRHA 3Q6MA 3PMRA 2ZD9A 3A11A 3J06A 3ITFA 3SP1A 3AQCA 3N24A 4F4BA 5KYYB 4NTAA 3E70C 1YARO 2VCCA 4WGYA 4BJ5C 2IBFA 2YEVA 2BE5F 1PD0A 5EGYA 1T5OA 2UUHA 3LLIA 1TFOB 5JP7A 2Q9CA 1LE4A 4LERA 3C18A
chains in the Genus database with same CATH topology
1WN0A 1Y6DA 1FR0A 2Q4FA 1BDJB 1YVIA 3KYIA 1OXKA 4EUKB 3KYJA 4PACA 1QSPA 2LD6A 1I5NA 4G78A 1C02A 2OOCA 2LP4A 1SR2A 3MYFA 1OXBA 2LCHA 1A0BA 2R25A 3US6A 1C03A 3IQTA 1TQGA 3U3BA 2A0BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WN0 A;  1Y6D A;  1FR0 A;  2Q4F A;  1BDJ B;  1YVI A;  3KYI A;  1OXK A;  4EUK B;  3KYJ A;  4PAC A;  1QSP A;  2LD6 A;  1I5N A;  4G78 A;  1C02 A;  2OOC A;  2LP4 A;  1SR2 A;  3MYF A;  1OXB A;  2LCH A;  1A0B A;  2R25 A;  3US6 A;  1C03 A;  3IQT A;  1TQG A;  3U3B A;  2A0B A; 
#chains in the Genus database with same CATH topology
 2M64 A;  3T4R A;  3RW0 A;  2YLG A;  1ORS C;  3KPH A;  3MBG A;  2A69 F;  4MTF A;  2R7Q A;  2XRH A;  1CGM E;  3RKO F;  1M6T A;  3NYL A;  4IAO A;  1C17 M;  4DXW A;  1RKE B;  2AP3 A;  5T3W A;  3SXZ A;  3LEV A;  2I8B A;  3TJ6 A;  3B71 A;  3G50 A;  3JT1 A;  4BJ1 A;  2Q9A A;  4IAQ A;  1JPN A;  5B3I A;  1XZP A;  2LCH A;  4LLE A;  2QTV A;  4NTB A;  2XLW A;  2YZS A;  1JRA A;  1OKK A;  2QE9 A;  3EGX A;  1FNT c;  2YHS A;  3CSK A;  5B1A C;  2J45 A;  3R7C A;  3U5S A;  5L3V A;  3CAX A;  2PNO A;  4JEB A;  3U8P A;  3ZDL A;  3IEE A;  2Q7R A;  3ASO C;  4E7S A;  2XXA B;  4CJG A;  3QW0 A;  3KL4 A;  2Y39 A;  3A9C A;  3S0X A;  1M56 C;  1WAS A;  3U2L A;  3W4Y A;  2WZG A;  4BJ5 A;  1FR0 A;  3B9Q A;  5DS4 A;  1T01 A;  4OD5 A;  2G3K A;  4MVS A;  2J0W A;  2QNL A;  4BEJ A;  1LS1 A;  1OXK A;  4OIQ F;  4GYT A;  3ZC4 A;  5F5H A;  1RMV A;  2L6H A;  2OU6 A;  3HLZ A;  1T6Q A;  5CIV A;  3GEH A;  1Q0G A;  3JTL O;  2DB4 A;  4K1O A;  4CSA C;  1CGO A;  1E2X A;  2CNW D;  2J46 A;  3WAQ A;  1DOW A;  1UG7 A;  3E9V A;  2LFF A;  2R03 A;  3U8V A;  1V74 B;  2J0X A;  4PJL A;  1H9T A;  2JD3 A;  1D1C A;  2KSF A;  2KK1 A;  1A41 A;  4CDY A;  1CGN A;  2YVK A;  2Q9B A;  4KNV A;  4G7Z F;  1S05 A;  4P9T A;  2KYH A;  1TWG A;  1BR1 A;  1XZQ A;  3JRM O;  1LKX A;  5COG A;  3RF3 A;  3IQ5 A;  4FX5 A;  4AL1 A;  2TMV P;  3SEO A;  4K7B A;  2QY9 A;  5DVW A;  3LJB A;  1ZHY A;  3K1I C;  3BEH A;  3K33 A;  4MVZ A;  4R32 A;  2LD6 A;  3NYJ A;  1GGQ A;  4N06 A;  1O87 A;  2XLM A;  2EPN A;  3L1M A;  5AGF A;  1E86 A;  2YL1 A;  1RKC A;  1ZU5 A;  1K40 A;  2NUT B;  3EZH A;  3F46 A;  2P61 A;  3LAY A;  3V5Z A;  2XL6 A;  5AC5 A;  1E83 A;  4JE9 A;  1VTM P;  1FMV A;  3K6B A;  1VLT A;  3RH3 A;  3MX3 A;  2W4M A;  3TOM A;  3W8H A;  4D4X A;  2EIJ C;  3B0V C;  5JS5 A;  1JAF A;  2EIM C;  4JTC B;  4U5F E;  4Z9J A;  4EWC A;  5BQH A;  1HY5 A;  4CSA A;  4OIP F;  1M2O A;  3G4X A;  4NY3 A;  4BEM J;  1ORY A;  2KJG A;  3QVZ A;  4PK4 A;  5D92 A;  2DYS C;  3U3B A;  4MVR A;  2R7V A;  3SXK A;  4MTG A;  4BJ6 C;  2W45 A;  3HNJ A;  3ZSU A;  4DOZ A;  4GQH A;  3LS0 A;  4YL1 A;  4B6I A;  4JCH A;  5JSL A;  1Z6A A;  4MVO A;  4U5D E;  2HUJ A;  4PFP A;  4FAP B;  3EH2 A;  3KYI A;  1RJ9 B;  3NYM A;  1MNE A;  2CNW A;  4JIO A;  3V5Y A;  5KYY A;  4Q5S F;  4A2N B;  2J9U A;  5D91 A;  1FMW A;  3VYW A;  4BG0 A;  3IPM O;  2GDC A;  3VF0 A;  2G62 A;  4CDA A;  2X51 A;  2NSF A;  3DMD A;  3FOO A;  1JMW A;  3C7J A;  5COF A;  3RQE A;  3HNI A;  1KTM A;  3K1I A;  1WAT A;  4I3M A;  1L7C A;  1OXB A;  2LIG A;  5KYW B;  2LSE A;  3US6 A;  4YT8 A;  5EHH A;  4O6N A;  4ONS A;  5F28 E;  2XL4 A;  1TQG A;  3WHN A;  2XM0 A;  3EGD B;  4E7Z A;  1RKE A;  2P1A A;  2ZXP A;  2ASR A;  1VB5 A;  4PJM A;  3RVY A;  1I4Z A;  1HMD A;  1M2V A;  5E3C A;  5KYX A;  2L81 A;  3S27 A;  3H2V A;  4C3B A;  4JJG A;  4LDK A;  2GWW A;  3VRC A;  3HNK A;  1WOL A;  3EJN A;  4MW8 A;  2KW3 C;  4W8P A;  4BJ6 A;  1AUE A;  3TJ5 A;  1HMO A;  5L0J A;  2YWA A;  1NLX A;  4AK9 A;  1BBH A;  3EHN A;  1EKY A;  1NFO A;  3DJU B;  3TOL A;  5A6B D;  2XXA A;  4EBK A;  4EHP A;  3FAJ A;  5KYN A;  3QMK A;  4PJJ A;  1YZA A;  1ZVZ A;  3NMJ A;  3Q7L A;  1MND A;  3V7O A;  3UNG C;  3ABM C;  4LLC A;  4XEV A;  2WZL A;  5FZT A;  2Y3H A;  2NUP B;  3LUT B;  1ST6 A;  2GAQ A;  4IJJ A;  5DS6 A;  5COM A;  1H9G A;  4EBJ A;  2R7S A;  1YA9 A;  2IXP A;  3PDM P;  3C8Z A;  2A68 F;  5IY5 C;  4QI2 A;  3S9O A;  3O10 A;  3N0T A;  1MMA A;  3RVZ A;  4O6Y A;  1Z7Q c;  4E0H A;  4MQ9 F;  4I1O B;  3NG1 A;  4U9E A;  3WOD F;  3B0U X;  5DQZ A;  4JC7 A;  3SYN A;  3ZTM A;  1AVO B;  2YL0 A;  2DGJ A;  2ZPA A;  3WG7 C;  4CS7 A;  4EBB A;  5L0F A;  1LE2 A;  4E18 A;  5GPG B;  1TWA A;  2IXN A;  4YN0 B;  5KYU B;  2CDQ A;  3QZC A;  2IM8 A;  2R25 A;  3HKK A;  2FAP B;  1LM3 B;  4ANJ A;  1WGW A;  3LEO A;  2QLA A;  5E3A A;  4MVQ A;  3O6X A;  4JZA A;  2PFD A;  3JYY A;  1A7E A;  2HSB A;  4YT2 A;  5DQT A;  1JR8 A;  2RD9 A;  4I44 A;  3T6J A;  3CQZ A;  1D0Z A;  2IXO A;  2OEX A;  3LES A;  2GA0 A;  3M15 A;  3EFO B;  5A6B A;  1J8M F;  1NU7 D;  1CPQ A;  2A6H F;  2W4B A;  3EG9 B;  3JZ0 A;  4IWB A;  4DJ9 A;  2PX0 A;  2AU5 A;  4O7G A;  3K66 A;  4CX9 A;  3UMK A;  1O5H A;  1TR2 A;  2QUP A;  3KH2 A;  4HFK B;  3AGU A;  1V4A A;  5A6A A;  3NDB B;  3QTH A;  4XTK A;  5CI9 A;  4LDQ A;  1DOV A;  2NG1 A;  2AWC A;  2E87 A;  2C03 A;  1OR3 A;  3IQC A;  4DVZ A;  4BJT A;  3DXJ F;  3FMS A;  1O3U A;  1K04 A;  1K05 A;  1KNY A;  5AC4 A;  4QI0 A;  1Z23 A;  1Z3I X;  1PV3 A;  1D0Y A;  2D5R B;  2IXM A;  4U5H A;  5DLJ A;  1LS4 A;  4KI2 A;  5B3S C;  3M79 A;  1OR2 A;  2PX3 A;  2R02 A;  3GM2 A;  3O55 A;  3H2U A;  3U3F A;  2XM4 A;  1VK5 A;  2EPL X;  3B0P A;  1M57 C;  3AG4 C;  2GFH A;  5BQI A;  1W2W A;  1ZHZ A;  2H7V C;  1S7Z A;  1VYK A;  2XLO A;  4YL3 A;  4OD4 A;  2A1D D;  3DZA A;  3JYH A;  5KYW A;  2Y69 C;  3KYJ A;  3L34 A;  2LQG A;  5T1D B;  3ZWI A;  1H6G A;  3DM9 B;  1Z63 A;  1TKN A;  2OCC C;  2V26 A;  4H54 A;  4KNW A;  2EPM X;  4YL0 A;  3T6B A;  3NMK A;  3G4Z A;  3TQO A;  2M4E A;  4JVS A;  1FTS A;  3X2Q C;  3GEI A;  3EGD A;  2OG2 A;  3EQL F;  4Q7C A;  4KC9 A;  5FCL A;  1YDI A;  2P6V A;  2OKU A;  4XLN F;  3C63 A;  1APC A;  1OW8 A;  3RFY A;  5E33 A;  2R7T A;  2XLV A;  1QVX A;  3B29 A;  3JSE O;  5JVE A;  3SZR A;  2Y3G A;  1Q0F A;  4Z9H A;  1A7V A;  3FHD A;  2KGO A;  4MND A;  3TK0 A;  2HV6 A;  4EIY A;  1D0X A;  2XS1 A;  4AX2 A;  1ZZP A;  2PBE A;  3N2Z B;  3FXH A;  2KQ9 A;  4G0H A;  5L3Q A;  2YQY A;  3EGX B;  4G7H F;  1LVK A;  2R7U A;  3DAF A;  1HW2 A;  1OCC C;  2Q4F A;  3MLG A;  1BZ4 A;  2XLE A;  3HJC A;  3M4B A;  3Q7G A;  1HE9 A;  1LI7 A;  3EH1 A;  4PJN A;  1GM5 A;  2CW0 F;  3RQG A;  1I5N A;  2XSE A;  3RQF A;  3AJM A;  3S28 A;  3AG3 C;  3DD7 A;  4N6C A;  3H65 A;  2WB7 A;  3PHF 2;  2YKZ A;  1YJG A;  4IRU A;  1SR2 A;  1IZM A;  2KNH A;  3I4U A;  1AEP A;  4QDL A;  4UDV A;  2XLH A;  4ZLC A;  3GAN A;  2HV7 A;  1FAP B;  4YWQ A;  2BL2 A;  2WZF A;  3ZG1 A;  4MW3 A;  4C3D A;  2VC9 A;  4J32 B;  2P7V A;  4XPX A;  4H4K C;  1ZW3 A;  4ER9 A;  5L0C A;  3OWT A;  3PCV A;  3UGP A;  4O6M A;  1HE1 A;  3U9M A;  2HJ3 A;  4ULW A;  2MYS A;  2YRF A;  3UGO A;  2YL3 A;  2PF4 E;  2G3V A;  1SF8 A;  2WVN A;  1V54 C;  3TUL A;  2JPU A;  2A6E F;  3LS1 A;  4JKV A;  1T6U A;  3V5X A;  1YYX A;  3X1O A;  5K0I A;  3C62 A;  3C8G B;  2V3C C;  3L8I A;  4RD9 A;  3ABK C;  2LP4 A;  2HZ8 A;  2R7O A;  5EK0 A;  3ECS A;  3POV A;  4ZLD A;  3SXM A;  1XWJ A;  1YZC A;  4YT5 A;  4PR9 A;  1GS9 A;  1RCP A;  4AE4 B;  1NSG B;  3DKA A;  3K7D A;  3Q6N A;  3EFO A;  3IQT A;  4MTO A;  3ZTZ A;  2X0C A;  3EG9 A;  1SZI A;  2VCA A;  3UMH A;  2Z15 A;  3S90 A;  1BR4 A;  2CCY A;  1YLM A;  2R7R A;  2HKV A;  3SNH A;  3HTK C;  1OCR C;  2UUI A;  4X0R A;  5HV9 A;  1G4U S;  3GOR A;  2HFI A;  1NU9 C;  2HJM A;  5A69 A;  3FDQ A;  1MMN A;  1U0B B;  3JCU Q;  2LFD A;  5TJ5 E;  4FES A;  4ULV A;  4C7O B;  4PAC A;  4JTD B;  1YYJ A;  4W8K A;  4J30 B;  1QPU A;  3DJN B;  3OA1 A;  1ZU4 A;  2R9R B;  3AG2 C;  3CZ6 A;  3L8J A;  4YJW A;  3SXY A;  4XWJ A;  1H7I A;  5L0D A;  1FFH A;  2F22 A;  3GM3 A;  2CGE A;  1N1C A;  1Y4C A;  5BUO A;  5F5F A;  4MVU A;  1VLS A;  4DVY P;  5BQG A;  4NCQ A;  4G7O F;  4DBQ A;  2R7W A;  1ZHX A;  2VB6 A;  3MFN A;  1QKR A;  2LK4 A;  3ZIB A;  5T3T A;  1LIH A;  3LNR A;  3ZVR A;  1NG1 A;  4CS8 A;  2H7B A;  3M1C B;  2R7X A;  3EZI A;  2FGY A;  1Q0D A;  3LNM B;  4C3E A;  4WAB A;  2A0B A;  3RYL A;  1EI7 A;  2I15 A;  4U5E E;  5A6J A;  2J7P D;  3EPV A;  2XS8 A;  2NUT A;  1Y6D A;  3S29 A;  3W2W A;  1QQ3 A;  2D4U A;  2Y3B A;  1YVI A;  2Q00 A;  3AQB A;  4OIO F;  3C8G D;  2L7A A;  1G5Z A;  1L3P A;  2C04 A;  4GEH A;  4U9D A;  4XQ1 A;  2W9Y A;  1M2V B;  2J9B A;  3OEO A;  4L6R A;  5KYX B;  2B0H A;  3DI5 A;  3MYF A;  2EIL C;  1YA7 O;  2EPO A;  5JUA A;  4XPW A;  2HMQ A;  3JRT A;  3ZQV A;  2MHR A;  1A0B A;  3ZQY A;  4CS9 A;  4E0I A;  3UR3 C;  4CDV A;  5JT4 A;  4IGG A;  1G4W R;  1Q0M A;  3GWN A;  2CYD A;  2IYL D;  2VAS A;  3LLK A;  1RJ9 A;  1Q0K A;  3EHM A;  4I1M A;  1F1M A;  1RXQ A;  4O79 A;  3DE8 A;  1WWP A;  1FFT C;  1NBB A;  1VOM A;  2HSQ A;  4DBR A;  2YLD A;  3TD7 A;  3L0I A;  1ZYR F;  3DWW A;  4DRH B;  2YL7 A;  1NFN A;  2AVK A;  2WL8 A;  3NKE A;  4CBE A;  4JJF A;  3IQ6 A;  2VH3 A;  4EUK B;  1TWH A;  3I5P A;  1QSP A;  1QZX A;  2AWY A;  2Q3T A;  3FOP A;  4FWV A;  4AL0 A;  3GOD A;  3FAP B;  3RIP A;  4J7Y A;  4CJO A;  4DRJ B;  4RDA A;  5JRA A;  2O9X A;  3UMI A;  1TWC A;  4OIR F;  3S84 A;  1OQC A;  4JTA B;  4CS9 C;  1SYQ A;  2L9J A;  4YT4 A;  2H8A A;  4K0D A;  1E85 A;  2ICW G;  3VM6 A;  1OW7 A;  3AOU A;  3ABL C;  1GQA A;  1D1A A;  2J7P A;  2YLI A;  1MQV A;  2BC5 A;  2ZXR A;  3DAG A;  3NKD A;  4IAR A;  4NQF A;  4P9F A;  256B A;  1JOG A;  1R5I D;  2OJE D;  4LDR A;  1SMY F;  3C8G A;  4MVM A;  4D4N A;  1YAU O;  4WJ0 A;  4YK5 A;  3T6G B;  2B0J A;  3BRJ A;  4E17 A;  5L0I A;  4CIH A;  1U89 A;  4N6H A;  2OEV A;  3IHU A;  1BDJ B;  1OCZ C;  3GWL A;  2KC3 A;  4AE4 A;  4Q4Z F;  4NTF A;  2J9W A;  4A4A A;  3QW1 A;  2FFH A;  4PFO A;  1PD1 A;  1OCO C;  1MMD A;  3CEX A;  4G78 A;  5CI8 A;  2NUP A;  1Z5Z A;  3JSZ A;  4JW1 A;  2DYR C;  4DRI B;  4MS2 A;  2HMZ A;  3K1H A;  2ZXW C;  3U9J A;  5A6K A;  2MWQ A;  5L0G A;  1LPE A;  3M4C A;  2EIN C;  2IOQ A;  4XEK A;  1VYI A;  2H7O A;  4HE8 D;  4XLP F;  3O39 A;  4EKW A;  3GEE A;  4HEA J;  2OJQ A;  2P0N A;  3HNL A;  2J8W A;  2JX0 A;  3U0C A;  4C7O A;  4CIP A;  1QLE C;  2ETS A;  3FVY A;  1ZHT A;  3I5Q A;  5E2Q A;  1G8X A;  2DI3 A;  2WVQ A;  1KU2 A;  3F47 A;  5B1B C;  2NSG A;  1WN0 A;  2XLD A;  3NMI A;  3AGT A;  3R2P A;  1B68 A;  4XEF A;  1TFK B;  1E84 A;  4J7T A;  4RBN A;  2Y3D A;  1EA8 A;  1LI5 A;  2HS5 A;  5KYU A;  3MYI A;  3W2V A;  1ZHW A;  1C02 A;  2L6F A;  4XPY A;  4U5B E;  1I4Y A;  4M63 A;  2OOC A;  4Z9I A;  3DM5 A;  1T9K A;  1OW6 A;  2NPU A;  4KBL A;  1PCX A;  4CS8 C;  1MMG A;  1IW7 F;  1CPR A;  4WGZ A;  4JEA A;  5JLI A;  1C03 A;  5L0H A;  1T6I A;  4BPM A;  1HW1 A;  2XL8 A;  3ASN C;  4U5G A;  2J9V A;  1EQ1 A;  3U2M A;  1ZW2 A;  2OQM A;  5DS5 A;  1BR2 A;  2PP4 A;  1NZE A;  1OKK D;  1R4T A;  1WTY A;  2A0U A;  2EIK C;  2EPK X;  2RSE B;  2VCB A;  3DE9 A;  3KKB A;  4JCZ A;  2L6G A;  3QVY A;  4N4W A;  4LAC B;  1J8Y F;  4OIN F;  1U6H A;  1V55 C;  3VAY A;  1JPJ A;  4JUR I;  1ORJ A;  3W8I A;  1VMA A;  5HSW A;  1UFB A;  4NC3 A;  3T9O A;  3AG1 C;  2ZXO A;  2R05 A;  4HFF B;  3GM1 A;  1D1B A;  4JRZ A;  4U5C E;  4P6I C;  4IB4 A;  1A7D A;  3ATP A;  3KMI A;  2WVO A;  3NRH A;  3Q6M A;  3PMR A;  2ZD9 A;  3A11 A;  3J06 A;  3ITF A;  3SP1 A;  3AQC A;  3N24 A;  4F4B A;  5KYY B;  4NTA A;  3E70 C;  1YAR O;  2VCC A;  4WGY A;  4BJ5 C;  2IBF A;  2YEV A;  2BE5 F;  1PD0 A;  5EGY A;  1T5O A;  2UUH A;  3LLI A;  1TFO B;  5JP7 A;  2Q9C A;  1LE4 A;  4LER A;  3C18 A; 
#chains in the Genus database with same CATH homology
 1WN0 A;  1Y6D A;  1FR0 A;  2Q4F A;  1BDJ B;  1YVI A;  3KYI A;  1OXK A;  4EUK B;  3KYJ A;  4PAC A;  1QSP A;  2LD6 A;  1I5N A;  4G78 A;  1C02 A;  2OOC A;  2LP4 A;  1SR2 A;  3MYF A;  1OXB A;  2LCH A;  1A0B A;  2R25 A;  3US6 A;  1C03 A;  3IQT A;  1TQG A;  3U3B A;  2A0B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...