4EUKB

Crystal structure
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
152
structure length
152
Chain Sequence
MDLVQKQKSLQDYTKSLFLEGILDSQFLQLQQLQDESNPDFVSQVVTLFFQDSDRILNDLSLSLDQQVVDFKKVDPHVHQLKGSSSSIGAQRVKNACVVFRSFCEQQNVEACHRCLQQVKQEYYLVKNRLETLFKLEQQIVASGGMIPAVEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Function Analysis of Arabidopsis thaliana Histidine Kinase AHK5 Bound to Its Cognate Phosphotransfer Protein AHP1.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Signaling protein
molecule keywords Histidine kinase 5
total genus 66
structure length 152
sequence length 152
ec nomenclature
pdb deposition date 2012-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01627 Hpt Hpt domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.160 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) HPT domain 4eukB00
3IQTA 3U3BA 4PACA 1I5NA 2Q4FA 1C03A 1TQGA 2LD6A 4G78A 1QSPA 3KYJA 1YVIA 2OOCA 1Y6DA 1A0BA 2LCHA 1OXKA 3MYFA 2R25A 1SR2A 1OXBA 2A0BA 1BDJB 1WN0A 1C02A 3KYIA 1FR0A 4EUKB 2LP4A 3US6A
chains in the Genus database with same CATH superfamily
5E3AA 3TQOA 3S0XA 2DI3A 2QE9A 1G4US 3H65A 3HNJA 3RW0A 4YWQA 2R7XA 3OEOA 1A7DA 1RKCA 3LJBA 4MVQA 4EHPA 5L0IA 2TMVP 3HJCA 4JURI 4P9FA 3V5YA 3LEOA 2A6EF 4WJ0A 3LS0A 1LPEA 1D1AA 2R05A 3B9QA 5T1DB 4E17A 5L3QA 3B0UX 1VYIA 4IRUA 2EINC 3ASOC 1T5OA 1Y6DA 2J0WA 1MMGA 3LNMB 4ULWA 3JTLO 5AGFA 3EFOB 3SZRA 3T9OA 5K0IA 1RKEA 5B1AC 1CGNA 2J9UA 2B0JA 3ATPA 3DKAA 2OU6A 3IQCA 3K33A 4XLNF 2EIMC 3EGDA 4CJGA 5DQTA 4NY3A 3MFNA 2V3CC 5JUAA 2OEXA 2RD9A 4IWBA 4I44A 4B6IA 3M15A 3U3FA 1HW1A 1VLSA 2WZFA 4DBQA 4Q5SF 3LLIA 1TWHA 4PFPA 4BJ1A 3DI5A 4CJOA 5JLIA 1MMAA 2EPLX 1OKKA 2DYRC 4DVZA 1C03A 4IAOA 4I1OB 1KNYA 3Q6NA 3SXYA 1H9TA 1NU7D 4JJGA 3LUTB 3K1IA 2G62A 3DM9B 3LLKA 1NU9C 4U9DA 1BBHA 2AWCA 2CNWA 2H7VC 1D1BA 4K1OA 1A0BA 4OIPF 1A41A 3TK0A 1NFOA 4JEBA 2KW3C 4WGZA 4CS8C 2L6FA 1YYXA 4HFFB 3UGPA 4FX5A 4JW1A 1JR8A 1H6GA 4YT5A 3DE9A 4HEAJ 3C8GB 2DGJA 4G0HA 2NPUA 4JJFA 4N4WA 3ZWIA 2LP4A 4J7TA 4AE4A 4RDAA 3U2LA 1IW7F 4UDVA 1LI5A 3TOLA 2B0HA 1RXQA 1OW8A 2H8AA 3ASNC 4JKVA 4QDLA 5A6AA 1SZIA 4U5HA 2J7PA 4A2NB 2YEVA 3AQBA 2I8BA 4AK9A 1HMOA 3V7OA 5JP7A 3SYNA 1F1MA 1OR2A 2ASRA 3QVZA 1G4WR 1T6UA 1ZU4A 2HFIA 3KPHA 3RQEA 1TR2A 4A4AA 1PD1A 1EI7A 4X0RA 1E85A 3T4RA 2Q00A 1OXBA 2PBEA 2VCAA 3GM2A 2WZGA 2R7QA 5B3IA 2R7VA 1SYQA 4JTDB 2OJQA 4PJLA 1RJ9B 3Q7GA 4WABA 2PX3A 3S27A 5DS4A 1WASA 1ZU5A 2WVQA 2Y39A 1OCRC 3AQCA 3M4BA 3ZTMA 5CI9A 5L3VA 4J7YA 5DQZA 2OEVA 4C3EA 4K7BA 1BZ4A 1NZEA 4RD9A 2JD3A 1S7ZA 3MX3A 3FMSA 3WODF 1NSGB 4Z9HA 3GEIA 2VB6A 2J9BA 3HTKC 4AL1A 2L6GA 5KYWA 1Z63A 2LSEA 1CPRA 2P61A 3EH1A 3IQ5A 3QZCA 2J7PD 2VH3A 4W8PA 3C63A 3BRJA 1MNDA 1WTYA 3I5PA 4ZLDA 1I4ZA 1WOLA 3ABMC 3NMKA 3FXHA 1TFKB 2LQGA 4XEKA 2XLVA 1XWJA 1O87A 4EIYA 2R7RA 2XRHA 1OR3A 3B71A 4H54A 2YLDA 5A69A 1QPUA 3NYJA 1YLMA 3A11A 3ZG1A 2VASA 1LS1A 2JPUA 1N1CA 1RCPA 2HV7A 3RYLA 2R9RB 3W2WA 4OIQF 4J32B 1MQVA 4KC9A 3C62A 1CGOA 4MNDA 5KYNA 4Z9IA 3KL4A 2CDQA 2HJMA 4IARA 3QVYA 4N6HA 3JRTA 1HE9A 2CNWD 3PDMP 1VK5A 1Y4CA 3T6GB 3TJ5A 2Q3TA 3ABLC 1APCA 4JRZA 3KYJA 3TJ6A 1Q0MA 2L9JA 1WWPA 4U9EA 1M57C 4U5EE 2XL4A 2EILC 2R02A 2BL2A 2Y3HA 1NLXA 1YYJA 2LK4A 3J06A 4P6IC 4RBNA 5HSWA 2YL1A 2LFDA 1T9KA 1ZVZA 4JVSA 3U5SA 5FZTA 4U5BE 1T01A 4EKWA 3TULA 2BC5A 4GEHA 3B0VC 1YZAA 2YQYA 5CIVA 1K04A 4CSAC 2C03A 3JCUQ 2YLIA 5E2QA 2H7OA 3IQTA 2HV6A 4U5CE 5BQIA 5B3SC 1E84A 2J9VA 1D0XA 5JRAA 4XWJA 3C7JA 2W9YA 2J8WA 4C3DA 3HNKA 3RIPA 2YLGA 2EPMX 3T6BA 2KC3A 4MVSA 3U0CA 2GWWA 2ZXWC 2KSFA 2UUIA 2R7TA 3UNGC 2OQMA 3NKDA 4DBRA 1H9GA 3UMIA 2NUTB 2XM4A 5BUOA 2XLOA 3OWTA 3QW0A 2R7SA 4W8KA 1OCZC 2WB7A 3C8GA 3V5XA 2CYDA 3OA1A 4ER9A 5F28E 4CDYA 3S29A 1M2VB 2I15A 1HE1A 3K1HA 4XPYA 1T6IA 3NDBB 4C7OA 1GS9A 2XL6A 3GEHA 4NCQA 3DAGA 2EIJC 3VAYA 1B68A 2CCYA 2P0NA 1TWCA 2R7OA 3R7CA 2IXMA 2A0UA 1OCCC 2MYSA 4YT8A 4KI2A 1Z23A 2J0XA 1YDIA 4H4KC 2J46A 2YL3A 3EG9B 3M1CB 3DWWA 1W2WA 2AP3A 3DXJF 3GM3A 3HLZA 4JTCB 1Z3IX 2R03A 4CBEA 1V54C 3QMKA 1YZCA 1SMYF 2GAQA 3DJNB 1JRAA 3GANA 4DXWA 4OIOF 1QSPA 2OOCA 4PR9A 5KYUA 3KMIA 3NRHA 1RJ9A 3GEEA 3GWLA 3FHDA 3MYFA 3UMKA 2NG1A 4U5GA 3PCVA 1DOVA 4FAPB 4KNWA 3IQ6A 5F5FA 4XEVA 3DJUB 3RVYA 1TFOB 4CS9C 3QW1A 5JSLA 4ZLCA 3RQGA 4GYTA 3RQFA 2J9WA 3UMHA 2HSBA 3AG1C 3PMRA 4XQ1A 3K6BA 2YWAA 5JT4A 2EPNA 2CGEA 4JIOA 4CS7A 1JPJA 2HMQA 1MMNA 4KBLA 1YJGA 4JCHA 4MTFA 4EBBA 2FAPB 1G5ZA 1TQGA 4DVYP 1JMWA 2A6HF 5TJ5E 2YHSA 5F5HA 3S84A 1A7EA 1YAUO 3AGUA 3G4XA 3B0PA 1JAFA 3JYHA 2ZXOA 3W4YA 2LCHA 2VCCA 2WL8A 3CAXA 5A6KA 5A6BD 3VRCA 5EGYA 4DRIB 5KYXA 2YL0A 1YARO 1OCOC 2D5RB 3EHNA 3NYLA 4MTOA 3S90A 2XS1A 3WHNA 2XM0A 3A9CA 4XPXA 3SXMA 1D0ZA 3IEEA 4MVMA 1V4AA 3RFYA 1VMAA 2H7BA 4MVZA 2DB4A 5A6JA 4YL1A 3GORA 3S9OA 1PV3A 4CIHA 2M4EA 1JOGA 2KNHA 3EPVA 4R32A 3PHF2 1EQ1A 2KJGA 4C3BA 1BR4A 3KKBA 4YT2A 4YL3A 4BJ6A 2L6HA 3NG1A 3X1OA 1C17M 1AVOB 1LE2A 2NUPA 2W45A 2VCBA 4YK5A 4O79A 5KYYB 3M4CA 1LS4A 2P1AA 2Y69C 4LLCA 4N06A 2XXAB 2G3VA 4G78A 4JTAB 3EGXA 2XL8A 5T3WA 1I4YA 3ZSUA 1D1CA 1KTMA 2MHRA 1HMDA 1ZYRF 3S28A 2RSEB 5COMA 4L6RA 2YZSA 4YJWA 1H7IA 1ORSC 3U8PA 4CDAA 1VYKA 3FAJA 1VLTA 3CSKA 3EHMA 3VF0A 2L81A 1BDJB 1U0BB 3K66A 4O7GA 4QI2A 1M6TA 3EFOA 4FWVA 1JPNA 1LVKA 2EPKX 3R2PA 1RKEB 2Q9AA 3UR3C 2WVNA 1Z6AA 4O6NA 4G7HF 1U6HA 4MS2A 2QY9A 2D4UA 4I1MA 2EPOA 4CS9A 2FGYA 2MWQA 2P7VA 4LERA 4E0IA 1I5NA 1ST6A 256BA 2PP4A 4Q7CA 4ULVA 3O10A 5AC4A 2XLHA 2Y3DA 1QVXA 2YRFA 3HNIA 4NQFA 4E0HA 1R5ID 3SNHA 1E2XA 1FTSA 1M2OA 3GM1A 3G4ZA 2KGOA 3SXKA 2XLMA 3I4UA 3O39A 1L3PA 1GM5A 3B29A 4LACB 1MMDA 1ZHZA 2AVKA 2R25A 3MYIA 2PFDA 3UGOA 1NFNA 2PNOA 4BJ5C 3H2VA 1YA7O 4AE4B 3C8GD 4LDKA 2QTVA 4PJJA 5COFA 5KYXB 4O6YA 3JSEO 3T6JA 3ZC4A 1Z5ZA 1FMVA 3M79A 3W2VA 3JRMO 2XS8A 1SF8A 1ZHWA 2V26A 3EH2A 3SXZA 4D4NA 1TKNA 3VYWA 1HW2A 3K7DA 2XLDA 2PF4E 3N0TA 4OD5A 4BJ6C 3AGTA 1PD0A 3JYYA 1O3UA 3ZQVA 1MNEA 2JX0A 3LESA 4AL0A 5A6BA 4OD4A 1ZZPA 3TD7A 3SP1A 2XXAA 2R7UA 1FAPB 3L0IA 1LI7A 2LIGA 4LLEA 4O6MA 1BR1A 3F47A 4PK4A 1OW7A 2A69F 1OQCA 2A0BA 1ZHXA 2HJ3A 1OW6A 3DAFA 4MVUA 4IB4A 1E86A 2P6VA 5T3TA 4JZAA 4ANJA 1D0YA 1TWAA 2NSGA 5BQGA 2GFHA 1L7CA 4IJJA 1AEPA 2ZD9A 3RVZA 4DRJB 3AG4C 2Q7RA 2X0CA 1VB5A 3EZHA 4U5DE 4YL0A 4AX2A 3FOOA 1BR2A 1QLEC 2Y3BA 3ABKC 2W4MA 1QQ3A 3DE8A 4PACA 2O9XA 1GGQA 3FAPB 4XTKA 2A1DD 3E70C 3U2MA 3JZ0A 5AC5A 3DMDA 2C04A 5IY5C 2LD6A 3AJMA 4Q4ZF 1ORJA 2KK1A 3Q7LA 5DS6A 2R7WA 3NYMA 2E87A 3FOPA 4OIRF 2KYHA 2OJED 1YVIA 3CEXA 3U9JA 2GDCA 1HY5A 5L0CA 1VOMA 5KYWB 1LIHA 5JS5A 1SR2A 3HNLA 5GPGB 4OINF 1LE4A 3I5QA 5D92A 5CI8A 1ZW3A 2HSQA 2IYLD 3RKOF 4EBJA 4G7ZF 3L8JA 2YVKA 2IXOA 2Q9BA 4JE9A 4IGGA 3DZAA 1E83A 4EUKB 4MTGA 5L0GA 5KYYA 2HKVA 3JSZA 2L7AA 4HE8D 3LEVA 5E3CA 3IHUA 3FVYA 3NKEA 3N24A 1M56C 4JC7A 4CDVA 5DLJA 1J8MF 5JVEA 1PCXA 2Q4FA 1TWGA 2WZLA 3EQLF 3N2ZB 1K40A 3NMIA 4MW3A 2W4BA 4CSAA 1YA9A 3ITFA 3LS1A 2FFHA 2F22A 3ECSA 3E9VA 4YT4A 5BQHA 1XZPA 1Q0DA 3G50A 4J30B 4JEAA 3TOMA 2HZ8A 4M63A 2WVOA 3IPMO 2HUJA 1ORYA 5D91A 4N6CA 4PFOA 2NSFA 4FESA 3K1IC 2ETSA 3DM5A 4NC3A 1KU2A 2XSEA 4BPMA 3LAYA 2UUHA 4WGYA 4NTFA 1FR0A 5DS5A 3W8IA 4P9TA 3V5ZA 2IOQA 4NTAA 1ZW2A 1WGWA 1WATA 2PX0A 3HKKA 4IAQA 4F4BA 3EGDB 3AG2C 2J45A 3C8ZA 1Q0KA 2M64A 3L34A 2ZXRA 3X2QC 1NBBA 1QZXA 3O55A 2Z15A 4MVOA 3W8HA 1ZHTA 3L8IA 1A7VA 2CW0F 2AWYA 1J8YF 1R4TA 3GODA 1OXKA 4JCZA 2DYSC 1FFHA 3DD7A 2Y3GA 1Z7Qc 4NTBA 4ONSA 1IZMA 3JT1A 1UG7A 3VM6A 2QUPA 4E7ZA 3POVA 3KYIA 2NUTA 4CS8A 2GA0A 4BJTA 2OG2A 2Q9CA 5EK0A 3SEOA 3CZ6A 4MQ9F 3BEHA 3ZDLA 3LNRA 2VC9A 1S05A 4KNVA 3US6A 4BEMJ 2X51A 3RH3A 3U3BA 4C7OB 4D4XA 4XEFA 1FMWA 3U9MA 5L0FA 3ZQYA 3WG7C 1QKRA 2OKUA 4QI0A 3U8VA 2XLWA 4PJMA 3ZIBA 4CX9A 4G7OF 4BG0A 3O6XA 3KH2A 3F46A 1V55C 2KQ9A 2NUPB 4E7SA 1T6QA 1LKXA 1FFTC 5DVWA 2IXPA 3RF3A 2OCCC 3EZIA 1DOWA 1FNTc 1CGME 4PJNA 4XLPF 3EGXB 4U5FE 2ICWG 3AOUA 3MBGA 4CIPA 2ZPAA 5KYUB 1VTMP 4EWCA 1V74B 1ZHYA 3MLGA 1EA8A 3AG3C 3GWNA 3WAQA 5FCLA 1Q0FA 2YL7A 2XLEA 4DRHB 1UFBA 5COGA 4Z9JA 4EBKA 5E33A 1RMVA 2HMZA 2ZXPA 2QNLA 4DJ9A 4YN0B 1G8XA 1K05A 2LFFA 1CPQA 2G3KA 4XPWA 1NG1A 1OKKD 5HV9A 2IBFA 2YKZA 1GQAA 3Q6MA 1XZQA 2BE5F 2HS5A 2QLAA 4HFKB 4BEJA 4DOZA 1M2VA 4BJ5A 4LDQA 4E18A 3ZVRA 3NMJA 5L0HA 3H2UA 3FDQA 4I3MA 1O5HA 5L0DA 3C18A 3ZTZA 5L0JA 1U89A 4MVRA 4LDRA 4MW8A 5EHHA 2IM8A 1Q0GA 1C02A 1WN0A 2IXNA 3EG9A 3EJNA 4GQHA 3CQZA 4K0DA 3L1MA 5B1BC 1EKYA 1LM3B 1AUEA 3QTHA 2EIKC 2AU5A 2A68F
chains in the Genus database with same CATH topology
3IQTA 3U3BA 4PACA 1I5NA 2Q4FA 1C03A 1TQGA 2LD6A 4G78A 1QSPA 3KYJA 1YVIA 2OOCA 1Y6DA 1A0BA 2LCHA 1OXKA 3MYFA 2R25A 1SR2A 1OXBA 2A0BA 1BDJB 1WN0A 1C02A 3KYIA 1FR0A 4EUKB 2LP4A 3US6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IQT A;  3U3B A;  4PAC A;  1I5N A;  2Q4F A;  1C03 A;  1TQG A;  2LD6 A;  4G78 A;  1QSP A;  3KYJ A;  1YVI A;  2OOC A;  1Y6D A;  1A0B A;  2LCH A;  1OXK A;  3MYF A;  2R25 A;  1SR2 A;  1OXB A;  2A0B A;  1BDJ B;  1WN0 A;  1C02 A;  3KYI A;  1FR0 A;  4EUK B;  2LP4 A;  3US6 A; 
#chains in the Genus database with same CATH topology
 5E3A A;  3TQO A;  3S0X A;  2DI3 A;  2QE9 A;  1G4U S;  3H65 A;  3HNJ A;  3RW0 A;  4YWQ A;  2R7X A;  3OEO A;  1A7D A;  1RKC A;  3LJB A;  4MVQ A;  4EHP A;  5L0I A;  2TMV P;  3HJC A;  4JUR I;  4P9F A;  3V5Y A;  3LEO A;  2A6E F;  4WJ0 A;  3LS0 A;  1LPE A;  1D1A A;  2R05 A;  3B9Q A;  5T1D B;  4E17 A;  5L3Q A;  3B0U X;  1VYI A;  4IRU A;  2EIN C;  3ASO C;  1T5O A;  1Y6D A;  2J0W A;  1MMG A;  3LNM B;  4ULW A;  3JTL O;  5AGF A;  3EFO B;  3SZR A;  3T9O A;  5K0I A;  1RKE A;  5B1A C;  1CGN A;  2J9U A;  2B0J A;  3ATP A;  3DKA A;  2OU6 A;  3IQC A;  3K33 A;  4XLN F;  2EIM C;  3EGD A;  4CJG A;  5DQT A;  4NY3 A;  3MFN A;  2V3C C;  5JUA A;  2OEX A;  2RD9 A;  4IWB A;  4I44 A;  4B6I A;  3M15 A;  3U3F A;  1HW1 A;  1VLS A;  2WZF A;  4DBQ A;  4Q5S F;  3LLI A;  1TWH A;  4PFP A;  4BJ1 A;  3DI5 A;  4CJO A;  5JLI A;  1MMA A;  2EPL X;  1OKK A;  2DYR C;  4DVZ A;  1C03 A;  4IAO A;  4I1O B;  1KNY A;  3Q6N A;  3SXY A;  1H9T A;  1NU7 D;  4JJG A;  3LUT B;  3K1I A;  2G62 A;  3DM9 B;  3LLK A;  1NU9 C;  4U9D A;  1BBH A;  2AWC A;  2CNW A;  2H7V C;  1D1B A;  4K1O A;  1A0B A;  4OIP F;  1A41 A;  3TK0 A;  1NFO A;  4JEB A;  2KW3 C;  4WGZ A;  4CS8 C;  2L6F A;  1YYX A;  4HFF B;  3UGP A;  4FX5 A;  4JW1 A;  1JR8 A;  1H6G A;  4YT5 A;  3DE9 A;  4HEA J;  3C8G B;  2DGJ A;  4G0H A;  2NPU A;  4JJF A;  4N4W A;  3ZWI A;  2LP4 A;  4J7T A;  4AE4 A;  4RDA A;  3U2L A;  1IW7 F;  4UDV A;  1LI5 A;  3TOL A;  2B0H A;  1RXQ A;  1OW8 A;  2H8A A;  3ASN C;  4JKV A;  4QDL A;  5A6A A;  1SZI A;  4U5H A;  2J7P A;  4A2N B;  2YEV A;  3AQB A;  2I8B A;  4AK9 A;  1HMO A;  3V7O A;  5JP7 A;  3SYN A;  1F1M A;  1OR2 A;  2ASR A;  3QVZ A;  1G4W R;  1T6U A;  1ZU4 A;  2HFI A;  3KPH A;  3RQE A;  1TR2 A;  4A4A A;  1PD1 A;  1EI7 A;  4X0R A;  1E85 A;  3T4R A;  2Q00 A;  1OXB A;  2PBE A;  2VCA A;  3GM2 A;  2WZG A;  2R7Q A;  5B3I A;  2R7V A;  1SYQ A;  4JTD B;  2OJQ A;  4PJL A;  1RJ9 B;  3Q7G A;  4WAB A;  2PX3 A;  3S27 A;  5DS4 A;  1WAS A;  1ZU5 A;  2WVQ A;  2Y39 A;  1OCR C;  3AQC A;  3M4B A;  3ZTM A;  5CI9 A;  5L3V A;  4J7Y A;  5DQZ A;  2OEV A;  4C3E A;  4K7B A;  1BZ4 A;  1NZE A;  4RD9 A;  2JD3 A;  1S7Z A;  3MX3 A;  3FMS A;  3WOD F;  1NSG B;  4Z9H A;  3GEI A;  2VB6 A;  2J9B A;  3HTK C;  4AL1 A;  2L6G A;  5KYW A;  1Z63 A;  2LSE A;  1CPR A;  2P61 A;  3EH1 A;  3IQ5 A;  3QZC A;  2J7P D;  2VH3 A;  4W8P A;  3C63 A;  3BRJ A;  1MND A;  1WTY A;  3I5P A;  4ZLD A;  1I4Z A;  1WOL A;  3ABM C;  3NMK A;  3FXH A;  1TFK B;  2LQG A;  4XEK A;  2XLV A;  1XWJ A;  1O87 A;  4EIY A;  2R7R A;  2XRH A;  1OR3 A;  3B71 A;  4H54 A;  2YLD A;  5A69 A;  1QPU A;  3NYJ A;  1YLM A;  3A11 A;  3ZG1 A;  2VAS A;  1LS1 A;  2JPU A;  1N1C A;  1RCP A;  2HV7 A;  3RYL A;  2R9R B;  3W2W A;  4OIQ F;  4J32 B;  1MQV A;  4KC9 A;  3C62 A;  1CGO A;  4MND A;  5KYN A;  4Z9I A;  3KL4 A;  2CDQ A;  2HJM A;  4IAR A;  3QVY A;  4N6H A;  3JRT A;  1HE9 A;  2CNW D;  3PDM P;  1VK5 A;  1Y4C A;  3T6G B;  3TJ5 A;  2Q3T A;  3ABL C;  1APC A;  4JRZ A;  3KYJ A;  3TJ6 A;  1Q0M A;  2L9J A;  1WWP A;  4U9E A;  1M57 C;  4U5E E;  2XL4 A;  2EIL C;  2R02 A;  2BL2 A;  2Y3H A;  1NLX A;  1YYJ A;  2LK4 A;  3J06 A;  4P6I C;  4RBN A;  5HSW A;  2YL1 A;  2LFD A;  1T9K A;  1ZVZ A;  4JVS A;  3U5S A;  5FZT A;  4U5B E;  1T01 A;  4EKW A;  3TUL A;  2BC5 A;  4GEH A;  3B0V C;  1YZA A;  2YQY A;  5CIV A;  1K04 A;  4CSA C;  2C03 A;  3JCU Q;  2YLI A;  5E2Q A;  2H7O A;  3IQT A;  2HV6 A;  4U5C E;  5BQI A;  5B3S C;  1E84 A;  2J9V A;  1D0X A;  5JRA A;  4XWJ A;  3C7J A;  2W9Y A;  2J8W A;  4C3D A;  3HNK A;  3RIP A;  2YLG A;  2EPM X;  3T6B A;  2KC3 A;  4MVS A;  3U0C A;  2GWW A;  2ZXW C;  2KSF A;  2UUI A;  2R7T A;  3UNG C;  2OQM A;  3NKD A;  4DBR A;  1H9G A;  3UMI A;  2NUT B;  2XM4 A;  5BUO A;  2XLO A;  3OWT A;  3QW0 A;  2R7S A;  4W8K A;  1OCZ C;  2WB7 A;  3C8G A;  3V5X A;  2CYD A;  3OA1 A;  4ER9 A;  5F28 E;  4CDY A;  3S29 A;  1M2V B;  2I15 A;  1HE1 A;  3K1H A;  4XPY A;  1T6I A;  3NDB B;  4C7O A;  1GS9 A;  2XL6 A;  3GEH A;  4NCQ A;  3DAG A;  2EIJ C;  3VAY A;  1B68 A;  2CCY A;  2P0N A;  1TWC A;  2R7O A;  3R7C A;  2IXM A;  2A0U A;  1OCC C;  2MYS A;  4YT8 A;  4KI2 A;  1Z23 A;  2J0X A;  1YDI A;  4H4K C;  2J46 A;  2YL3 A;  3EG9 B;  3M1C B;  3DWW A;  1W2W A;  2AP3 A;  3DXJ F;  3GM3 A;  3HLZ A;  4JTC B;  1Z3I X;  2R03 A;  4CBE A;  1V54 C;  3QMK A;  1YZC A;  1SMY F;  2GAQ A;  3DJN B;  1JRA A;  3GAN A;  4DXW A;  4OIO F;  1QSP A;  2OOC A;  4PR9 A;  5KYU A;  3KMI A;  3NRH A;  1RJ9 A;  3GEE A;  3GWL A;  3FHD A;  3MYF A;  3UMK A;  2NG1 A;  4U5G A;  3PCV A;  1DOV A;  4FAP B;  4KNW A;  3IQ6 A;  5F5F A;  4XEV A;  3DJU B;  3RVY A;  1TFO B;  4CS9 C;  3QW1 A;  5JSL A;  4ZLC A;  3RQG A;  4GYT A;  3RQF A;  2J9W A;  3UMH A;  2HSB A;  3AG1 C;  3PMR A;  4XQ1 A;  3K6B A;  2YWA A;  5JT4 A;  2EPN A;  2CGE A;  4JIO A;  4CS7 A;  1JPJ A;  2HMQ A;  1MMN A;  4KBL A;  1YJG A;  4JCH A;  4MTF A;  4EBB A;  2FAP B;  1G5Z A;  1TQG A;  4DVY P;  1JMW A;  2A6H F;  5TJ5 E;  2YHS A;  5F5H A;  3S84 A;  1A7E A;  1YAU O;  3AGU A;  3G4X A;  3B0P A;  1JAF A;  3JYH A;  2ZXO A;  3W4Y A;  2LCH A;  2VCC A;  2WL8 A;  3CAX A;  5A6K A;  5A6B D;  3VRC A;  5EGY A;  4DRI B;  5KYX A;  2YL0 A;  1YAR O;  1OCO C;  2D5R B;  3EHN A;  3NYL A;  4MTO A;  3S90 A;  2XS1 A;  3WHN A;  2XM0 A;  3A9C A;  4XPX A;  3SXM A;  1D0Z A;  3IEE A;  4MVM A;  1V4A A;  3RFY A;  1VMA A;  2H7B A;  4MVZ A;  2DB4 A;  5A6J A;  4YL1 A;  3GOR A;  3S9O A;  1PV3 A;  4CIH A;  2M4E A;  1JOG A;  2KNH A;  3EPV A;  4R32 A;  3PHF 2;  1EQ1 A;  2KJG A;  4C3B A;  1BR4 A;  3KKB A;  4YT2 A;  4YL3 A;  4BJ6 A;  2L6H A;  3NG1 A;  3X1O A;  1C17 M;  1AVO B;  1LE2 A;  2NUP A;  2W45 A;  2VCB A;  4YK5 A;  4O79 A;  5KYY B;  3M4C A;  1LS4 A;  2P1A A;  2Y69 C;  4LLC A;  4N06 A;  2XXA B;  2G3V A;  4G78 A;  4JTA B;  3EGX A;  2XL8 A;  5T3W A;  1I4Y A;  3ZSU A;  1D1C A;  1KTM A;  2MHR A;  1HMD A;  1ZYR F;  3S28 A;  2RSE B;  5COM A;  4L6R A;  2YZS A;  4YJW A;  1H7I A;  1ORS C;  3U8P A;  4CDA A;  1VYK A;  3FAJ A;  1VLT A;  3CSK A;  3EHM A;  3VF0 A;  2L81 A;  1BDJ B;  1U0B B;  3K66 A;  4O7G A;  4QI2 A;  1M6T A;  3EFO A;  4FWV A;  1JPN A;  1LVK A;  2EPK X;  3R2P A;  1RKE B;  2Q9A A;  3UR3 C;  2WVN A;  1Z6A A;  4O6N A;  4G7H F;  1U6H A;  4MS2 A;  2QY9 A;  2D4U A;  4I1M A;  2EPO A;  4CS9 A;  2FGY A;  2MWQ A;  2P7V A;  4LER A;  4E0I A;  1I5N A;  1ST6 A;  256B A;  2PP4 A;  4Q7C A;  4ULV A;  3O10 A;  5AC4 A;  2XLH A;  2Y3D A;  1QVX A;  2YRF A;  3HNI A;  4NQF A;  4E0H A;  1R5I D;  3SNH A;  1E2X A;  1FTS A;  1M2O A;  3GM1 A;  3G4Z A;  2KGO A;  3SXK A;  2XLM A;  3I4U A;  3O39 A;  1L3P A;  1GM5 A;  3B29 A;  4LAC B;  1MMD A;  1ZHZ A;  2AVK A;  2R25 A;  3MYI A;  2PFD A;  3UGO A;  1NFN A;  2PNO A;  4BJ5 C;  3H2V A;  1YA7 O;  4AE4 B;  3C8G D;  4LDK A;  2QTV A;  4PJJ A;  5COF A;  5KYX B;  4O6Y A;  3JSE O;  3T6J A;  3ZC4 A;  1Z5Z A;  1FMV A;  3M79 A;  3W2V A;  3JRM O;  2XS8 A;  1SF8 A;  1ZHW A;  2V26 A;  3EH2 A;  3SXZ A;  4D4N A;  1TKN A;  3VYW A;  1HW2 A;  3K7D A;  2XLD A;  2PF4 E;  3N0T A;  4OD5 A;  4BJ6 C;  3AGT A;  1PD0 A;  3JYY A;  1O3U A;  3ZQV A;  1MNE A;  2JX0 A;  3LES A;  4AL0 A;  5A6B A;  4OD4 A;  1ZZP A;  3TD7 A;  3SP1 A;  2XXA A;  2R7U A;  1FAP B;  3L0I A;  1LI7 A;  2LIG A;  4LLE A;  4O6M A;  1BR1 A;  3F47 A;  4PK4 A;  1OW7 A;  2A69 F;  1OQC A;  2A0B A;  1ZHX A;  2HJ3 A;  1OW6 A;  3DAF A;  4MVU A;  4IB4 A;  1E86 A;  2P6V A;  5T3T A;  4JZA A;  4ANJ A;  1D0Y A;  1TWA A;  2NSG A;  5BQG A;  2GFH A;  1L7C A;  4IJJ A;  1AEP A;  2ZD9 A;  3RVZ A;  4DRJ B;  3AG4 C;  2Q7R A;  2X0C A;  1VB5 A;  3EZH A;  4U5D E;  4YL0 A;  4AX2 A;  3FOO A;  1BR2 A;  1QLE C;  2Y3B A;  3ABK C;  2W4M A;  1QQ3 A;  3DE8 A;  4PAC A;  2O9X A;  1GGQ A;  3FAP B;  4XTK A;  2A1D D;  3E70 C;  3U2M A;  3JZ0 A;  5AC5 A;  3DMD A;  2C04 A;  5IY5 C;  2LD6 A;  3AJM A;  4Q4Z F;  1ORJ A;  2KK1 A;  3Q7L A;  5DS6 A;  2R7W A;  3NYM A;  2E87 A;  3FOP A;  4OIR F;  2KYH A;  2OJE D;  1YVI A;  3CEX A;  3U9J A;  2GDC A;  1HY5 A;  5L0C A;  1VOM A;  5KYW B;  1LIH A;  5JS5 A;  1SR2 A;  3HNL A;  5GPG B;  4OIN F;  1LE4 A;  3I5Q A;  5D92 A;  5CI8 A;  1ZW3 A;  2HSQ A;  2IYL D;  3RKO F;  4EBJ A;  4G7Z F;  3L8J A;  2YVK A;  2IXO A;  2Q9B A;  4JE9 A;  4IGG A;  3DZA A;  1E83 A;  4EUK B;  4MTG A;  5L0G A;  5KYY A;  2HKV A;  3JSZ A;  2L7A A;  4HE8 D;  3LEV A;  5E3C A;  3IHU A;  3FVY A;  3NKE A;  3N24 A;  1M56 C;  4JC7 A;  4CDV A;  5DLJ A;  1J8M F;  5JVE A;  1PCX A;  2Q4F A;  1TWG A;  2WZL A;  3EQL F;  3N2Z B;  1K40 A;  3NMI A;  4MW3 A;  2W4B A;  4CSA A;  1YA9 A;  3ITF A;  3LS1 A;  2FFH A;  2F22 A;  3ECS A;  3E9V A;  4YT4 A;  5BQH A;  1XZP A;  1Q0D A;  3G50 A;  4J30 B;  4JEA A;  3TOM A;  2HZ8 A;  4M63 A;  2WVO A;  3IPM O;  2HUJ A;  1ORY A;  5D91 A;  4N6C A;  4PFO A;  2NSF A;  4FES A;  3K1I C;  2ETS A;  3DM5 A;  4NC3 A;  1KU2 A;  2XSE A;  4BPM A;  3LAY A;  2UUH A;  4WGY A;  4NTF A;  1FR0 A;  5DS5 A;  3W8I A;  4P9T A;  3V5Z A;  2IOQ A;  4NTA A;  1ZW2 A;  1WGW A;  1WAT A;  2PX0 A;  3HKK A;  4IAQ A;  4F4B A;  3EGD B;  3AG2 C;  2J45 A;  3C8Z A;  1Q0K A;  2M64 A;  3L34 A;  2ZXR A;  3X2Q C;  1NBB A;  1QZX A;  3O55 A;  2Z15 A;  4MVO A;  3W8H A;  1ZHT A;  3L8I A;  1A7V A;  2CW0 F;  2AWY A;  1J8Y F;  1R4T A;  3GOD A;  1OXK A;  4JCZ A;  2DYS C;  1FFH A;  3DD7 A;  2Y3G A;  1Z7Q c;  4NTB A;  4ONS A;  1IZM A;  3JT1 A;  1UG7 A;  3VM6 A;  2QUP A;  4E7Z A;  3POV A;  3KYI A;  2NUT A;  4CS8 A;  2GA0 A;  4BJT A;  2OG2 A;  2Q9C A;  5EK0 A;  3SEO A;  3CZ6 A;  4MQ9 F;  3BEH A;  3ZDL A;  3LNR A;  2VC9 A;  1S05 A;  4KNV A;  3US6 A;  4BEM J;  2X51 A;  3RH3 A;  3U3B A;  4C7O B;  4D4X A;  4XEF A;  1FMW A;  3U9M A;  5L0F A;  3ZQY A;  3WG7 C;  1QKR A;  2OKU A;  4QI0 A;  3U8V A;  2XLW A;  4PJM A;  3ZIB A;  4CX9 A;  4G7O F;  4BG0 A;  3O6X A;  3KH2 A;  3F46 A;  1V55 C;  2KQ9 A;  2NUP B;  4E7S A;  1T6Q A;  1LKX A;  1FFT C;  5DVW A;  2IXP A;  3RF3 A;  2OCC C;  3EZI A;  1DOW A;  1FNT c;  1CGM E;  4PJN A;  4XLP F;  3EGX B;  4U5F E;  2ICW G;  3AOU A;  3MBG A;  4CIP A;  2ZPA A;  5KYU B;  1VTM P;  4EWC A;  1V74 B;  1ZHY A;  3MLG A;  1EA8 A;  3AG3 C;  3GWN A;  3WAQ A;  5FCL A;  1Q0F A;  2YL7 A;  2XLE A;  4DRH B;  1UFB A;  5COG A;  4Z9J A;  4EBK A;  5E33 A;  1RMV A;  2HMZ A;  2ZXP A;  2QNL A;  4DJ9 A;  4YN0 B;  1G8X A;  1K05 A;  2LFF A;  1CPQ A;  2G3K A;  4XPW A;  1NG1 A;  1OKK D;  5HV9 A;  2IBF A;  2YKZ A;  1GQA A;  3Q6M A;  1XZQ A;  2BE5 F;  2HS5 A;  2QLA A;  4HFK B;  4BEJ A;  4DOZ A;  1M2V A;  4BJ5 A;  4LDQ A;  4E18 A;  3ZVR A;  3NMJ A;  5L0H A;  3H2U A;  3FDQ A;  4I3M A;  1O5H A;  5L0D A;  3C18 A;  3ZTZ A;  5L0J A;  1U89 A;  4MVR A;  4LDR A;  4MW8 A;  5EHH A;  2IM8 A;  1Q0G A;  1C02 A;  1WN0 A;  2IXN A;  3EG9 A;  3EJN A;  4GQH A;  3CQZ A;  4K0D A;  3L1M A;  5B1B C;  1EKY A;  1LM3 B;  1AUE A;  3QTH A;  2EIK C;  2AU5 A;  2A68 F; 
#chains in the Genus database with same CATH homology
 3IQT A;  3U3B A;  4PAC A;  1I5N A;  2Q4F A;  1C03 A;  1TQG A;  2LD6 A;  4G78 A;  1QSP A;  3KYJ A;  1YVI A;  2OOC A;  1Y6D A;  1A0B A;  2LCH A;  1OXK A;  3MYF A;  2R25 A;  1SR2 A;  1OXB A;  2A0B A;  1BDJ B;  1WN0 A;  1C02 A;  3KYI A;  1FR0 A;  4EUK B;  2LP4 A;  3US6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...