4EUKB

Crystal structure
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
152
structure length
152
Chain Sequence
b'MDLVQKQKSLQDYTKSLFLEGILDSQFLQLQQLQDESNPDFVSQVVTLFFQDSDRILNDLSLSLDQQVVDFKKVDPHVHQLKGSSSSIGAQRVKNACVVFRSFCEQQNVEACHRCLQQVKQEYYLVKNRLETLFKLEQQIVASGGMIPAVEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histidine kinase 5
molecule tags Signaling protein
source organism Arabidopsis thaliana
publication title Structure-Function Analysis of Arabidopsis thaliana Histidine Kinase AHK5 Bound to Its Cognate Phosphotransfer Protein AHP1.
pubmed doi rcsb
total genus 66
structure length 152
sequence length 152
ec nomenclature
pdb deposition date 2012-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01627 Hpt Hpt domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.160 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) HPT domain 4eukB00
1Y6DA 4G78A 2LCHA 1FR0A 4PACA 1A0BA 1QSPA 1TQGA 2R25A 1OXBA 1YVIA 3MYFA 4EUKB 3IQTA 2Q4FA 1C02A 1WN0A 1OXKA 2LD6A 3US6A 3KYIA 3KYJA 2LP4A 1C03A 1BDJB 2A0BA 1SR2A 3U3BA 2OOCA 1I5NA
chains in the Genus database with same CATH superfamily
1Y6DA 1VTMP 1XZPA 1Z6AA 2J0WA 3EQLF 1PCXA 4NQFA 1NZEA 4YK5A 4YT2A 1FR0A 4LDQA 4YT5A 1V4AA 2L7AA 1A0BA 3C18A 3U8VA 2J9UA 1HY5A 1ZVZA 2KJGA 3AGUA 5F5HA 3T6BA 1E84A 2EPMX 4AX2A 2R9RB 2J8WA 3JYHA 2H7VC 3O55A 4JVSA 3FXHA 5AC5A 2Q4FA 4Z9IA 4PFOA 4OIRF 2WZGA 4IB4A 2JD3A 3EJNA 4E7ZA 4H4KC 4IAQA 3KYIA 3EFOA 4W8KA 3QVYA 2R7RA 1BR2A 3PCVA 2G3VA 3EGXB 1Z7Qc 4U5CE 3B9QA 5E33A 2OG2A 2ZPAA 2JPUA 1PD1A 1ORSC 2A69F 3T9OA 4XEVA 3RIPA 2TMVP 5KYWB 3NYJA 2J46A 4CSAC 4UDVA 3SXZA 2A6EF 3U3FA 2NG1A 3U0CA 3QMKA 1I4ZA 3S90A 1A7VA 3DXJF 3RKOF 1XZQA 2QTVA 2IXNA 4MVOA 5A6KA 2JX0A 1A41A 2KQ9A 1M2OA 4CBEA 2H7BA 4XLNF 1OR3A 1JRAA 4W8PA 1JR8A 1APCA 2Q9BA 2LK4A 1LI7A 2YEVA 2ZXRA 2R7SA 1HMDA 4LLEA 4IGGA 2R7UA 4N4WA 1CPRA 2A68F 3GM1A 5DQZA 3WODF 2R7QA 1CGOA 3F47A 4J30B 1E2XA 4KC9A 2CYDA 4CX9A 3AQBA 3GODA 1WATA 2HV6A 4G78A 4JTAB 1L3PA 3C63A 4LDRA 3U9JA 4CS7A 4I44A 2HS5A 3GEHA 4AE4B 1D0ZA 2DI3A 3AJMA 1E83A 3TOLA 4CS8C 5F5FA 3EZIA 4U5BE 2YL1A 1WOLA 2DGJA 2KK1A 1TWHA 4P9TA 4YJWA 3RYLA 4L6RA 3M1CB 5AC4A 2MHRA 3IQTA 5EK0A 4U5GA 2IXPA 5D91A 2MWQA 3HNLA 1OKKA 4DBRA 4JEAA 3PHF2 1LI5A 3KH2A 4JCZA 3VM6A 2YWAA 1GGQA 1E86A 1VB5A 4O6MA 4K0DA 1T6IA 1QKRA 3DZAA 3I4UA 4Z9JA 4BJ5C 3O39A 5HSWA 1C17M 4HFKB 2OKUA 1RJ9A 1ORJA 4DRJB 2A6HF 1TWGA 2GDCA 2NSGA 3HNKA 4MVSA 4DRHB 1YJGA 2J7PD 2XLHA 3EZHA 2AVKA 4GQHA 4HEAJ 1G5ZA 1LE2A 1OR2A 3UGPA 1K04A 3DMDA 4C3BA 1O5HA 2LQGA 4E0HA 1AEPA 2FFHA 1D1AA 1TWAA 3IEEA 3AG4C 3JRMO 3JYYA 5BQGA 1K05A 4JJFA 3B0UX 4PK4A 2NUTB 4G0HA 5JT4A 2YLDA 5A6BD 1WN0A 1YA9A 4MW3A 4XPYA 5T3TA 1TWCA 3MLGA 2QLAA 2ASRA 4E18A 3ABLC 3KYJA 5A6AA 5JUAA 1OQCA 1VOMA 4HFFB 4X0RA 4MW8A 1MQVA 3GWNA 1NFNA 3DE9A 1ZW2A 3FOOA 3K66A 1QLEC 3KPHA 4U5DE 1YYXA 1H6GA 2IXMA 2PBEA 1G4WR 1N1CA 5KYUB 1YA7O 2Y3BA 2V26A 1PV3A 2HKVA 2EINC 3N24A 3NG1A 5KYXB 4DVYP 4DJ9A 4MVQA 2P61A 1WGWA 2XM0A 2DB4A 2I8BA 2XS1A 1OCOC 3UMIA 4K7BA 2KW3C 1SZIA 4YL0A 3ZWIA 2I15A 4CSAA 2L6HA 1YVIA 1PD0A 1VYIA 3K1IC 3QVZA 3ZSUA 2C03A 2OJED 5A6BA 2IYLD 4YL3A 5T3WA 3RQFA 3UR3C 1OW8A 4NTBA 5E3CA 1G8XA 3N0TA 1MMDA 2J9VA 5L0GA 2WB7A 1T01A 2HMZA 3W2VA 4AL1A 2WL8A 4JIOA 3E9VA 3K1IA 2A0BA 2EPOA 1D1CA 5COGA 1ZW3A 3JRTA 5KYXA 2OU6A 2NPUA 3LNMB 1FFHA 3HTKC 3S84A 1FMVA 1YLMA 1JOGA 1NSGB 2J7PA 2WZLA 2XLVA 1ZYRF 2M64A 1M2VA 2L6GA 4U5FE 3W2WA 4EBJA 5CIVA 4JEBA 5B3IA 3T6JA 4KNVA 1Y4CA 1GS9A 3VF0A 1VLSA 2QNLA 1A7DA 1T5OA 1QSPA 2OCCC 2Q9CA 3F46A 4MTGA 4N6CA 2XLOA 3M15A 5AGFA 1RMVA 3O10A 1OW7A 5L3VA 3C8GB 2VC9A 5KYWA 3X1OA 4EBKA 1DOWA 2WZFA 3H2VA 1QZXA 4ULVA 1ZZPA 4XEFA 1L7CA 1O87A 4E0IA 3RVYA 3VAYA 3VRCA 1R4TA 3FDQA 5A69A 4G7OF 3HJCA 1K40A 1MMNA 4YT4A 1ZHZA 3K33A 3EFOB 4JTCB 4E7SA 1E85A 1U0BB 3NMKA 4D4NA 2WVOA 5B1AC 3DE8A 1CPQA 2WVNA 2OJQA 3O6XA 3RFYA 3NYLA 4PACA 1RKEA 1H7IA 3GEIA 1WTYA 2RSEB 3LLKA 3NMJA 2YLIA 4IAOA 3VYWA 3L34A 4QDLA 4U5EE 2R25A 4BEJA 1OCRC 2GWWA 3RF3A 1YYJA 2VCBA 3K1HA 5KYYB 2MYSA 1ZU5A 2OQMA 3FOPA 1QPUA 4FWVA 4N06A 3ZTZA 4NY3A 2B0JA 4ZLCA 3FAPB 1WASA 2GFHA 2NUTA 5BQHA 1NBBA 2XLWA 2Y39A 3EHMA 1MNEA 3U2MA 2BE5F 2XRHA 4AE4A 1V54C 3AGTA 1ZU4A 4J32B 4U9DA 1LPEA 4CS8A 3IQ5A 3K7DA 1A7EA 2CDQA 4XQ1A 5DS6A 1D1BA 2LSEA 2Y3GA 3L0IA 3LEOA 3S9OA 3SNHA 1HE9A 2EIMC 3EPVA 3EG9B 4EIYA 3I5PA 2PX0A 3JT1A 4G7HF 1RJ9B 3SP1A 3TULA 3A9CA 1Q0DA 1M6TA 1TR2A 1NLXA 2YL0A 4XPWA 1HW2A 2QUPA 1OXBA 3LS0A 4YT8A 1Z3IX 1YZCA 1MMAA 4OD5A 3T4RA 2F22A 4EUKB 1YAUO 1YARO 1OCZC 2B0HA 3JZ0A 4BJ1A 2EIJC 4FX5A 4F4BA 1GM5A 2C04A 4CJGA 4D4XA 3DM5A 4FESA 4PJMA 3RW0A 1UG7A 5L3QA 5BUOA 1O3UA 3JSEO 2L81A 3HKKA 2D4UA 5IY5C 4BEMJ 3QZCA 2P1AA 4R32A 2H8AA 4LLCA 3ABKC 2O9XA 1LKXA 3W8IA 2M4EA 2IBFA 1I5NA 1W2WA 4Q5SF 3A11A 1EKYA 1IZMA 2ICWG 2AWCA 3EGXA 4BJ6A 2R7OA 2YVKA 2J45A 3GWLA 5JVEA 3ECSA 4IWBA 4XPXA 2WVQA 2CNWD 2YRFA 5JS5A 2DYSC 2CCYA 3M79A 1NG1A 3U9MA 1XWJA 1J8YF 4G7ZF 1JMWA 5KYNA 4CIHA 4CIPA 3DD7A 4CDAA 1V55C 5E2QA 1S7ZA 2H7OA 3HNJA 1KTMA 2EPKX 4HE8D 2YHSA 4MQ9F 3L8JA 3RVZA 2AU5A 3CQZA 4EHPA 4P9FA 1RXQA 3JTLO 3OA1A 1ZHWA 2EPLX 2LFFA 2FAPB 2AWYA 2XL4A 2UUHA 4JKVA 2OEXA 1YDIA 2ZXOA 3JSZA 4EBBA 3OWTA 4MVMA 2OEVA 4PJJA 5COFA 1DOVA 1V74B 1KU2A 3G50A 3V5YA 3EGDB 3NKDA 2HZ8A 3Q6NA 3V5XA 3ZVRA 3LESA 1SYQA 3L8IA 1T9KA 5L0HA 1LVKA 3ZTMA 5EHHA 5K0IA 2XXAA 4J7YA 4WGZA 3NYMA 1WWPA 5B1BC 3LUTB 3W4YA 1HMOA 2IOQA 3LLIA 2P7VA 2YLGA 3C8GD 2XLEA 3V7OA 1EI7A 1LE4A 5L0IA 4WGYA 1NU7D 2XS8A 3RH3A 4MNDA 1FFTC 5DLJA 2Y69C 4O7GA 2X0CA 3EHNA 1NU9C 1QQ3A 1TFKB 5T1DB 3UMHA 1JPJA 3G4ZA 4ER9A 5L0CA 4BPMA 2AP3A 4A2NB 2IXOA 4MTFA 1H9GA 1Z5ZA 3GM2A 2D5RB 4LERA 4C3DA 4YWQA 1UFBA 2XM4A 4MVZA 4C7OB 2L6FA 4EKWA 4KI2A 4C7OA 3CAXA 1ORYA 2CGEA 3TJ6A 1ZHTA 5A6JA 5TJ5E 3M4CA 2KC3A 4JC7A 2PFDA 2W45A 4LDKA 1BR4A 1RCPA 4NTAA 1U89A 4U5HA 4IRUA 3SZRA 1HE1A 2ZXPA 5HV9A 4QI2A 5D92A 3NMIA 4NTFA 3QW1A 4U9EA 4I1MA 3ZDLA 3J06A 4WABA 3ASOC 1Z23A 2EILC 3UNGC 3C8ZA 3W8HA 3ZIBA 1Q0GA 1J8MF 4BG0A 2KSFA 3SXYA 1C03A 1D0XA 2KYHA 2J9BA 2PNOA 1TFOB 3ITFA 4GEHA 3TQOA 3UMKA 2V3CC 2Y3DA 1G4US 3HLZA 2NUPA 1M57C 3CSKA 4MVUA 2Q3TA 1ZHXA 3B71A 1OKKD 3GANA 5COMA 4BJTA 4OIQF 1LM3B 4Z9HA 1OW6A 3G4XA 2GA0A 2ZD9A 5KYYA 5DQTA 1OCCC 5EGYA 1Q0FA 2UUIA 1ZHYA 2IM8A 2Q9AA 3AOUA 3NDBB 3PDMP 3QTHA 4MVRA 3S28A 1BR1A 2XL8A 2YQYA 3LAYA 4ULWA 3Q6MA 1RKEB 1FNTc 2LIGA 3AQCA 3OEOA 4A4AA 2Z15A 3E70C 2HV7A 3DAGA 3R2PA 2YL3A 4CDYA 2HMQA 2EPNA 3AG3C 3GORA 2YKZA 3TK0A 3NRHA 3IQ6A 3V5ZA 3IQCA 1LIHA 2HSQA 2Y3HA 3CZ6A 4K1OA 2VASA 3SEOA 4QI0A 3H2UA 3T6GB 1SR2A 1U6HA 2R7TA 3LS1A 1S05A 3H65A 3GM3A 1LS4A 2HJ3A 3L1MA 4JTDB 4YL1A 1Q0MA 3DWWA 2YZSA 3DKAA 3ZQYA 3C8GA 4DBQA 3UGOA 1SMYF 3LEVA 2R7WA 256BA 1FTSA 2LCHA 5L0JA 4ZLDA 2CW0F 1RKCA 4DRIB 4P6IC 3M4BA 3WHNA 2EIKC 5L0FA 5JSLA 1VYKA 3I5QA 4E17A 4LACB 3B0VC 1M2VB 2P6VA 3ATPA 3C62A 4MTOA 4PJNA 1M56C 4AL0A 3B29A 4JE9A 4NC3A 3BRJA 3TD7A 1IW7F 5CI8A 2Q7RA 3S29A 3U8PA 4DOZA 4CS9C 2LD6A 3US6A 3DI5A 2L9JA 3RQGA 5GPGB 1B68A 1SF8A 4BJ5A 2HFIA 4EWCA 2R7VA 1HW1A 2LFDA 3ASNC 1D0YA 2HJMA 4J7TA 4RDAA 2NSFA 1ST6A 3C7JA 3U3BA 3ZG1A 2OOCA 1QVXA 3B0PA 4B6IA 2RD9A 2G3KA 3EG9A 4XEKA 3PMRA 1F1MA 2ZXWC 4N6HA 4ONSA 3FAJA 4FAPB 2R02A 3FMSA 1EA8A 3Q7GA 4IJJA 4OINF 4RD9A 3KKBA 3KL4A 4ANJA 3ZC4A 3LNRA 2XXAB 2A1DD 1VK5A 3IPMO 2VCAA 2DYRC 3N2ZB 4KNWA 2KNHA 3CEXA 3GEEA 3MYFA 1GQAA 5JP7A 5KYUA 2QE9A 4O6NA 3LJBA 3S0XA 1OXKA 4XWJA 3DAFA 3SYNA 2W4BA 3ABMC 3MFNA 5FCLA 4OIPF 2PF4E 1LS1A 3WAQA 4XLPF 3TOMA 2XL6A 4CS9A 2XLMA 1TKNA 4M63A 5DS5A 2J0XA 2Q00A 3FHDA 2X51A 1BZ4A 4OD4A 5E3AA 3TJ5A 3X2QC 5F28E 2XSEA 3QW0A 4RBNA 4I3MA 5L0DA 1EQ1A 2P0NA 1R5ID 4PR9A 5B3SC 4WJ0A 4JURI 2A0UA 3U2LA 3DJNB 1YZAA 4CJOA 2R03A 3POVA 4O79A 3RQEA 4I1OB 3NKEA 1TQGA 2KGOA 4JW1A 4H54A 2BC5A 1CGME 2BL2A 1VMAA 3DM9B 4C3EA 3BEHA 5JLIA 2VCCA 1C02A 3WG7C 2YL7A 3HNIA 1JAFA 2LP4A 5BQIA 3MX3A 2R7XA 3JCUQ 1T6QA 4DVZA 5DS4A 2G62A 2FGYA 2GAQA 2PX3A 4JRZA 4GYTA 5JRAA 1BBHA 1I4YA 1MNDA 3AG1C 1FMWA 1H9TA 1T6UA 3IHUA 5DVWA 1Q0KA 3SXKA 4JJGA 2VH3A 1KNYA 5CI9A 4MS2A 4CDVA 3MBGA 2HUJA 1VLTA 1MMGA 2NUPB 4YN0B 4DXWA 2XLDA 4NCQA 3ZQVA 3FVYA 3K6BA 3SXMA 4OIOF 3EH2A 4O6YA 4Q4ZF 1JPNA 1NFOA 2ETSA 4PFPA 1Z63A 2PP4A 3S27A 3U5SA 2J9WA 2W9YA 3R7CA 2W4MA 2CNWA 2VB6A 1BDJB 1FAPB 2HSBA 4KBLA 4PJLA 5FZTA 1AUEA 3KMIA 3EGDA 4AK9A 4BJ6C 3Q7LA 2E87A 3DJUB 2QY9A 1CGNA 3MYIA 4IARA 4Q7CA 3AG2C 1AVOB 3EH1A 4XTKA 4JCHA 4JZAA 2R05A
chains in the Genus database with same CATH topology
1Y6DA 4G78A 2LCHA 1FR0A 4PACA 1A0BA 1QSPA 1TQGA 2R25A 1OXBA 1YVIA 3MYFA 4EUKB 3IQTA 2Q4FA 1C02A 1WN0A 1OXKA 2LD6A 3US6A 3KYIA 3KYJA 2LP4A 1C03A 1BDJB 2A0BA 1SR2A 3U3BA 2OOCA 1I5NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y6D A;  4G78 A;  2LCH A;  1FR0 A;  4PAC A;  1A0B A;  1QSP A;  1TQG A;  2R25 A;  1OXB A;  1YVI A;  3MYF A;  4EUK B;  3IQT A;  2Q4F A;  1C02 A;  1WN0 A;  1OXK A;  2LD6 A;  3US6 A;  3KYI A;  3KYJ A;  2LP4 A;  1C03 A;  1BDJ B;  2A0B A;  1SR2 A;  3U3B A;  2OOC A;  1I5N A; 
#chains in the Genus database with same CATH topology
 1Y6D A;  1VTM P;  1XZP A;  1Z6A A;  2J0W A;  3EQL F;  1PCX A;  4NQF A;  1NZE A;  4YK5 A;  4YT2 A;  1FR0 A;  4LDQ A;  4YT5 A;  1V4A A;  2L7A A;  1A0B A;  3C18 A;  3U8V A;  2J9U A;  1HY5 A;  1ZVZ A;  2KJG A;  3AGU A;  5F5H A;  3T6B A;  1E84 A;  2EPM X;  4AX2 A;  2R9R B;  2J8W A;  3JYH A;  2H7V C;  3O55 A;  4JVS A;  3FXH A;  5AC5 A;  2Q4F A;  4Z9I A;  4PFO A;  4OIR F;  2WZG A;  4IB4 A;  2JD3 A;  3EJN A;  4E7Z A;  4H4K C;  4IAQ A;  3KYI A;  3EFO A;  4W8K A;  3QVY A;  2R7R A;  1BR2 A;  3PCV A;  2G3V A;  3EGX B;  1Z7Q c;  4U5C E;  3B9Q A;  5E33 A;  2OG2 A;  2ZPA A;  2JPU A;  1PD1 A;  1ORS C;  2A69 F;  3T9O A;  4XEV A;  3RIP A;  2TMV P;  5KYW B;  3NYJ A;  2J46 A;  4CSA C;  4UDV A;  3SXZ A;  2A6E F;  3U3F A;  2NG1 A;  3U0C A;  3QMK A;  1I4Z A;  3S90 A;  1A7V A;  3DXJ F;  3RKO F;  1XZQ A;  2QTV A;  2IXN A;  4MVO A;  5A6K A;  2JX0 A;  1A41 A;  2KQ9 A;  1M2O A;  4CBE A;  2H7B A;  4XLN F;  1OR3 A;  1JRA A;  4W8P A;  1JR8 A;  1APC A;  2Q9B A;  2LK4 A;  1LI7 A;  2YEV A;  2ZXR A;  2R7S A;  1HMD A;  4LLE A;  4IGG A;  2R7U A;  4N4W A;  1CPR A;  2A68 F;  3GM1 A;  5DQZ A;  3WOD F;  2R7Q A;  1CGO A;  3F47 A;  4J30 B;  1E2X A;  4KC9 A;  2CYD A;  4CX9 A;  3AQB A;  3GOD A;  1WAT A;  2HV6 A;  4G78 A;  4JTA B;  1L3P A;  3C63 A;  4LDR A;  3U9J A;  4CS7 A;  4I44 A;  2HS5 A;  3GEH A;  4AE4 B;  1D0Z A;  2DI3 A;  3AJM A;  1E83 A;  3TOL A;  4CS8 C;  5F5F A;  3EZI A;  4U5B E;  2YL1 A;  1WOL A;  2DGJ A;  2KK1 A;  1TWH A;  4P9T A;  4YJW A;  3RYL A;  4L6R A;  3M1C B;  5AC4 A;  2MHR A;  3IQT A;  5EK0 A;  4U5G A;  2IXP A;  5D91 A;  2MWQ A;  3HNL A;  1OKK A;  4DBR A;  4JEA A;  3PHF 2;  1LI5 A;  3KH2 A;  4JCZ A;  3VM6 A;  2YWA A;  1GGQ A;  1E86 A;  1VB5 A;  4O6M A;  4K0D A;  1T6I A;  1QKR A;  3DZA A;  3I4U A;  4Z9J A;  4BJ5 C;  3O39 A;  5HSW A;  1C17 M;  4HFK B;  2OKU A;  1RJ9 A;  1ORJ A;  4DRJ B;  2A6H F;  1TWG A;  2GDC A;  2NSG A;  3HNK A;  4MVS A;  4DRH B;  1YJG A;  2J7P D;  2XLH A;  3EZH A;  2AVK A;  4GQH A;  4HEA J;  1G5Z A;  1LE2 A;  1OR2 A;  3UGP A;  1K04 A;  3DMD A;  4C3B A;  1O5H A;  2LQG A;  4E0H A;  1AEP A;  2FFH A;  1D1A A;  1TWA A;  3IEE A;  3AG4 C;  3JRM O;  3JYY A;  5BQG A;  1K05 A;  4JJF A;  3B0U X;  4PK4 A;  2NUT B;  4G0H A;  5JT4 A;  2YLD A;  5A6B D;  1WN0 A;  1YA9 A;  4MW3 A;  4XPY A;  5T3T A;  1TWC A;  3MLG A;  2QLA A;  2ASR A;  4E18 A;  3ABL C;  3KYJ A;  5A6A A;  5JUA A;  1OQC A;  1VOM A;  4HFF B;  4X0R A;  4MW8 A;  1MQV A;  3GWN A;  1NFN A;  3DE9 A;  1ZW2 A;  3FOO A;  3K66 A;  1QLE C;  3KPH A;  4U5D E;  1YYX A;  1H6G A;  2IXM A;  2PBE A;  1G4W R;  1N1C A;  5KYU B;  1YA7 O;  2Y3B A;  2V26 A;  1PV3 A;  2HKV A;  2EIN C;  3N24 A;  3NG1 A;  5KYX B;  4DVY P;  4DJ9 A;  4MVQ A;  2P61 A;  1WGW A;  2XM0 A;  2DB4 A;  2I8B A;  2XS1 A;  1OCO C;  3UMI A;  4K7B A;  2KW3 C;  1SZI A;  4YL0 A;  3ZWI A;  2I15 A;  4CSA A;  2L6H A;  1YVI A;  1PD0 A;  1VYI A;  3K1I C;  3QVZ A;  3ZSU A;  2C03 A;  2OJE D;  5A6B A;  2IYL D;  4YL3 A;  5T3W A;  3RQF A;  3UR3 C;  1OW8 A;  4NTB A;  5E3C A;  1G8X A;  3N0T A;  1MMD A;  2J9V A;  5L0G A;  2WB7 A;  1T01 A;  2HMZ A;  3W2V A;  4AL1 A;  2WL8 A;  4JIO A;  3E9V A;  3K1I A;  2A0B A;  2EPO A;  1D1C A;  5COG A;  1ZW3 A;  3JRT A;  5KYX A;  2OU6 A;  2NPU A;  3LNM B;  1FFH A;  3HTK C;  3S84 A;  1FMV A;  1YLM A;  1JOG A;  1NSG B;  2J7P A;  2WZL A;  2XLV A;  1ZYR F;  2M64 A;  1M2V A;  2L6G A;  4U5F E;  3W2W A;  4EBJ A;  5CIV A;  4JEB A;  5B3I A;  3T6J A;  4KNV A;  1Y4C A;  1GS9 A;  3VF0 A;  1VLS A;  2QNL A;  1A7D A;  1T5O A;  1QSP A;  2OCC C;  2Q9C A;  3F46 A;  4MTG A;  4N6C A;  2XLO A;  3M15 A;  5AGF A;  1RMV A;  3O10 A;  1OW7 A;  5L3V A;  3C8G B;  2VC9 A;  5KYW A;  3X1O A;  4EBK A;  1DOW A;  2WZF A;  3H2V A;  1QZX A;  4ULV A;  1ZZP A;  4XEF A;  1L7C A;  1O87 A;  4E0I A;  3RVY A;  3VAY A;  3VRC A;  1R4T A;  3FDQ A;  5A69 A;  4G7O F;  3HJC A;  1K40 A;  1MMN A;  4YT4 A;  1ZHZ A;  3K33 A;  3EFO B;  4JTC B;  4E7S A;  1E85 A;  1U0B B;  3NMK A;  4D4N A;  2WVO A;  5B1A C;  3DE8 A;  1CPQ A;  2WVN A;  2OJQ A;  3O6X A;  3RFY A;  3NYL A;  4PAC A;  1RKE A;  1H7I A;  3GEI A;  1WTY A;  2RSE B;  3LLK A;  3NMJ A;  2YLI A;  4IAO A;  3VYW A;  3L34 A;  4QDL A;  4U5E E;  2R25 A;  4BEJ A;  1OCR C;  2GWW A;  3RF3 A;  1YYJ A;  2VCB A;  3K1H A;  5KYY B;  2MYS A;  1ZU5 A;  2OQM A;  3FOP A;  1QPU A;  4FWV A;  4N06 A;  3ZTZ A;  4NY3 A;  2B0J A;  4ZLC A;  3FAP B;  1WAS A;  2GFH A;  2NUT A;  5BQH A;  1NBB A;  2XLW A;  2Y39 A;  3EHM A;  1MNE A;  3U2M A;  2BE5 F;  2XRH A;  4AE4 A;  1V54 C;  3AGT A;  1ZU4 A;  4J32 B;  4U9D A;  1LPE A;  4CS8 A;  3IQ5 A;  3K7D A;  1A7E A;  2CDQ A;  4XQ1 A;  5DS6 A;  1D1B A;  2LSE A;  2Y3G A;  3L0I A;  3LEO A;  3S9O A;  3SNH A;  1HE9 A;  2EIM C;  3EPV A;  3EG9 B;  4EIY A;  3I5P A;  2PX0 A;  3JT1 A;  4G7H F;  1RJ9 B;  3SP1 A;  3TUL A;  3A9C A;  1Q0D A;  1M6T A;  1TR2 A;  1NLX A;  2YL0 A;  4XPW A;  1HW2 A;  2QUP A;  1OXB A;  3LS0 A;  4YT8 A;  1Z3I X;  1YZC A;  1MMA A;  4OD5 A;  3T4R A;  2F22 A;  4EUK B;  1YAU O;  1YAR O;  1OCZ C;  2B0H A;  3JZ0 A;  4BJ1 A;  2EIJ C;  4FX5 A;  4F4B A;  1GM5 A;  2C04 A;  4CJG A;  4D4X A;  3DM5 A;  4FES A;  4PJM A;  3RW0 A;  1UG7 A;  5L3Q A;  5BUO A;  1O3U A;  3JSE O;  2L81 A;  3HKK A;  2D4U A;  5IY5 C;  4BEM J;  3QZC A;  2P1A A;  4R32 A;  2H8A A;  4LLC A;  3ABK C;  2O9X A;  1LKX A;  3W8I A;  2M4E A;  2IBF A;  1I5N A;  1W2W A;  4Q5S F;  3A11 A;  1EKY A;  1IZM A;  2ICW G;  2AWC A;  3EGX A;  4BJ6 A;  2R7O A;  2YVK A;  2J45 A;  3GWL A;  5JVE A;  3ECS A;  4IWB A;  4XPX A;  2WVQ A;  2CNW D;  2YRF A;  5JS5 A;  2DYS C;  2CCY A;  3M79 A;  1NG1 A;  3U9M A;  1XWJ A;  1J8Y F;  4G7Z F;  1JMW A;  5KYN A;  4CIH A;  4CIP A;  3DD7 A;  4CDA A;  1V55 C;  5E2Q A;  1S7Z A;  2H7O A;  3HNJ A;  1KTM A;  2EPK X;  4HE8 D;  2YHS A;  4MQ9 F;  3L8J A;  3RVZ A;  2AU5 A;  3CQZ A;  4EHP A;  4P9F A;  1RXQ A;  3JTL O;  3OA1 A;  1ZHW A;  2EPL X;  2LFF A;  2FAP B;  2AWY A;  2XL4 A;  2UUH A;  4JKV A;  2OEX A;  1YDI A;  2ZXO A;  3JSZ A;  4EBB A;  3OWT A;  4MVM A;  2OEV A;  4PJJ A;  5COF A;  1DOV A;  1V74 B;  1KU2 A;  3G50 A;  3V5Y A;  3EGD B;  3NKD A;  2HZ8 A;  3Q6N A;  3V5X A;  3ZVR A;  3LES A;  1SYQ A;  3L8I A;  1T9K A;  5L0H A;  1LVK A;  3ZTM A;  5EHH A;  5K0I A;  2XXA A;  4J7Y A;  4WGZ A;  3NYM A;  1WWP A;  5B1B C;  3LUT B;  3W4Y A;  1HMO A;  2IOQ A;  3LLI A;  2P7V A;  2YLG A;  3C8G D;  2XLE A;  3V7O A;  1EI7 A;  1LE4 A;  5L0I A;  4WGY A;  1NU7 D;  2XS8 A;  3RH3 A;  4MND A;  1FFT C;  5DLJ A;  2Y69 C;  4O7G A;  2X0C A;  3EHN A;  1NU9 C;  1QQ3 A;  1TFK B;  5T1D B;  3UMH A;  1JPJ A;  3G4Z A;  4ER9 A;  5L0C A;  4BPM A;  2AP3 A;  4A2N B;  2IXO A;  4MTF A;  1H9G A;  1Z5Z A;  3GM2 A;  2D5R B;  4LER A;  4C3D A;  4YWQ A;  1UFB A;  2XM4 A;  4MVZ A;  4C7O B;  2L6F A;  4EKW A;  4KI2 A;  4C7O A;  3CAX A;  1ORY A;  2CGE A;  3TJ6 A;  1ZHT A;  5A6J A;  5TJ5 E;  3M4C A;  2KC3 A;  4JC7 A;  2PFD A;  2W45 A;  4LDK A;  1BR4 A;  1RCP A;  4NTA A;  1U89 A;  4U5H A;  4IRU A;  3SZR A;  1HE1 A;  2ZXP A;  5HV9 A;  4QI2 A;  5D92 A;  3NMI A;  4NTF A;  3QW1 A;  4U9E A;  4I1M A;  3ZDL A;  3J06 A;  4WAB A;  3ASO C;  1Z23 A;  2EIL C;  3UNG C;  3C8Z A;  3W8H A;  3ZIB A;  1Q0G A;  1J8M F;  4BG0 A;  2KSF A;  3SXY A;  1C03 A;  1D0X A;  2KYH A;  2J9B A;  2PNO A;  1TFO B;  3ITF A;  4GEH A;  3TQO A;  3UMK A;  2V3C C;  2Y3D A;  1G4U S;  3HLZ A;  2NUP A;  1M57 C;  3CSK A;  4MVU A;  2Q3T A;  1ZHX A;  3B71 A;  1OKK D;  3GAN A;  5COM A;  4BJT A;  4OIQ F;  1LM3 B;  4Z9H A;  1OW6 A;  3G4X A;  2GA0 A;  2ZD9 A;  5KYY A;  5DQT A;  1OCC C;  5EGY A;  1Q0F A;  2UUI A;  1ZHY A;  2IM8 A;  2Q9A A;  3AOU A;  3NDB B;  3PDM P;  3QTH A;  4MVR A;  3S28 A;  1BR1 A;  2XL8 A;  2YQY A;  3LAY A;  4ULW A;  3Q6M A;  1RKE B;  1FNT c;  2LIG A;  3AQC A;  3OEO A;  4A4A A;  2Z15 A;  3E70 C;  2HV7 A;  3DAG A;  3R2P A;  2YL3 A;  4CDY A;  2HMQ A;  2EPN A;  3AG3 C;  3GOR A;  2YKZ A;  3TK0 A;  3NRH A;  3IQ6 A;  3V5Z A;  3IQC A;  1LIH A;  2HSQ A;  2Y3H A;  3CZ6 A;  4K1O A;  2VAS A;  3SEO A;  4QI0 A;  3H2U A;  3T6G B;  1SR2 A;  1U6H A;  2R7T A;  3LS1 A;  1S05 A;  3H65 A;  3GM3 A;  1LS4 A;  2HJ3 A;  3L1M A;  4JTD B;  4YL1 A;  1Q0M A;  3DWW A;  2YZS A;  3DKA A;  3ZQY A;  3C8G A;  4DBQ A;  3UGO A;  1SMY F;  3LEV A;  2R7W A;  256B A;  1FTS A;  2LCH A;  5L0J A;  4ZLD A;  2CW0 F;  1RKC A;  4DRI B;  4P6I C;  3M4B A;  3WHN A;  2EIK C;  5L0F A;  5JSL A;  1VYK A;  3I5Q A;  4E17 A;  4LAC B;  3B0V C;  1M2V B;  2P6V A;  3ATP A;  3C62 A;  4MTO A;  4PJN A;  1M56 C;  4AL0 A;  3B29 A;  4JE9 A;  4NC3 A;  3BRJ A;  3TD7 A;  1IW7 F;  5CI8 A;  2Q7R A;  3S29 A;  3U8P A;  4DOZ A;  4CS9 C;  2LD6 A;  3US6 A;  3DI5 A;  2L9J A;  3RQG A;  5GPG B;  1B68 A;  1SF8 A;  4BJ5 A;  2HFI A;  4EWC A;  2R7V A;  1HW1 A;  2LFD A;  3ASN C;  1D0Y A;  2HJM A;  4J7T A;  4RDA A;  2NSF A;  1ST6 A;  3C7J A;  3U3B A;  3ZG1 A;  2OOC A;  1QVX A;  3B0P A;  4B6I A;  2RD9 A;  2G3K A;  3EG9 A;  4XEK A;  3PMR A;  1F1M A;  2ZXW C;  4N6H A;  4ONS A;  3FAJ A;  4FAP B;  2R02 A;  3FMS A;  1EA8 A;  3Q7G A;  4IJJ A;  4OIN F;  4RD9 A;  3KKB A;  3KL4 A;  4ANJ A;  3ZC4 A;  3LNR A;  2XXA B;  2A1D D;  1VK5 A;  3IPM O;  2VCA A;  2DYR C;  3N2Z B;  4KNW A;  2KNH A;  3CEX A;  3GEE A;  3MYF A;  1GQA A;  5JP7 A;  5KYU A;  2QE9 A;  4O6N A;  3LJB A;  3S0X A;  1OXK A;  4XWJ A;  3DAF A;  3SYN A;  2W4B A;  3ABM C;  3MFN A;  5FCL A;  4OIP F;  2PF4 E;  1LS1 A;  3WAQ A;  4XLP F;  3TOM A;  2XL6 A;  4CS9 A;  2XLM A;  1TKN A;  4M63 A;  5DS5 A;  2J0X A;  2Q00 A;  3FHD A;  2X51 A;  1BZ4 A;  4OD4 A;  5E3A A;  3TJ5 A;  3X2Q C;  5F28 E;  2XSE A;  3QW0 A;  4RBN A;  4I3M A;  5L0D A;  1EQ1 A;  2P0N A;  1R5I D;  4PR9 A;  5B3S C;  4WJ0 A;  4JUR I;  2A0U A;  3U2L A;  3DJN B;  1YZA A;  4CJO A;  2R03 A;  3POV A;  4O79 A;  3RQE A;  4I1O B;  3NKE A;  1TQG A;  2KGO A;  4JW1 A;  4H54 A;  2BC5 A;  1CGM E;  2BL2 A;  1VMA A;  3DM9 B;  4C3E A;  3BEH A;  5JLI A;  2VCC A;  1C02 A;  3WG7 C;  2YL7 A;  3HNI A;  1JAF A;  2LP4 A;  5BQI A;  3MX3 A;  2R7X A;  3JCU Q;  1T6Q A;  4DVZ A;  5DS4 A;  2G62 A;  2FGY A;  2GAQ A;  2PX3 A;  4JRZ A;  4GYT A;  5JRA A;  1BBH A;  1I4Y A;  1MND A;  3AG1 C;  1FMW A;  1H9T A;  1T6U A;  3IHU A;  5DVW A;  1Q0K A;  3SXK A;  4JJG A;  2VH3 A;  1KNY A;  5CI9 A;  4MS2 A;  4CDV A;  3MBG A;  2HUJ A;  1VLT A;  1MMG A;  2NUP B;  4YN0 B;  4DXW A;  2XLD A;  4NCQ A;  3ZQV A;  3FVY A;  3K6B A;  3SXM A;  4OIO F;  3EH2 A;  4O6Y A;  4Q4Z F;  1JPN A;  1NFO A;  2ETS A;  4PFP A;  1Z63 A;  2PP4 A;  3S27 A;  3U5S A;  2J9W A;  2W9Y A;  3R7C A;  2W4M A;  2CNW A;  2VB6 A;  1BDJ B;  1FAP B;  2HSB A;  4KBL A;  4PJL A;  5FZT A;  1AUE A;  3KMI A;  3EGD A;  4AK9 A;  4BJ6 C;  3Q7L A;  2E87 A;  3DJU B;  2QY9 A;  1CGN A;  3MYI A;  4IAR A;  4Q7C A;  3AG2 C;  1AVO B;  3EH1 A;  4XTK A;  4JCH A;  4JZA A;  2R05 A; 
#chains in the Genus database with same CATH homology
 1Y6D A;  4G78 A;  2LCH A;  1FR0 A;  4PAC A;  1A0B A;  1QSP A;  1TQG A;  2R25 A;  1OXB A;  1YVI A;  3MYF A;  4EUK B;  3IQT A;  2Q4F A;  1C02 A;  1WN0 A;  1OXK A;  2LD6 A;  3US6 A;  3KYI A;  3KYJ A;  2LP4 A;  1C03 A;  1BDJ B;  2A0B A;  1SR2 A;  3U3B A;  2OOC A;  1I5N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...