4EUKB

Crystal structure
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
152
structure length
152
Chain Sequence
MDLVQKQKSLQDYTKSLFLEGILDSQFLQLQQLQDESNPDFVSQVVTLFFQDSDRILNDLSLSLDQQVVDFKKVDPHVHQLKGSSSSIGAQRVKNACVVFRSFCEQQNVEACHRCLQQVKQEYYLVKNRLETLFKLEQQIVASGGMIPAVEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histidine kinase 5
publication title Structure-Function Analysis of Arabidopsis thaliana Histidine Kinase AHK5 Bound to Its Cognate Phosphotransfer Protein AHP1.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Signaling protein
total genus 66
structure length 152
sequence length 152
ec nomenclature
pdb deposition date 2012-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01627 Hpt Hpt domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.160 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) HPT domain 4eukB00
1YVIA 2A0BA 1A0BA 2LP4A 3IQTA 3KYIA 3KYJA 4EUKB 1QSPA 1OXBA 1BDJB 1WN0A 1FR0A 2LCHA 4PACA 1Y6DA 3MYFA 3US6A 1TQGA 4G78A 1C02A 2Q4FA 1I5NA 1C03A 2LD6A 1SR2A 2R25A 2OOCA 3U3BA 1OXKA
chains in the Genus database with same CATH superfamily
2PX3A 3ZTZA 2NSGA 3JRMO 3QW1A 1NU9C 2L6FA 2C03A 4NC3A 5E2QA 2KSFA 3FAPB 3IQTA 2VB6A 3CAXA 3U3FA 4EWCA 2J9VA 4DVZA 3C7JA 2RSEB 4YWQA 5K0IA 1MMDA 3GORA 4IAQA 4LDKA 4PFOA 3X2QC 1FFTC 2OCCC 4ONSA 4EKWA 5KYYB 2UUIA 2WZFA 2XLOA 1ZW3A 5HV9A 3H2VA 4KI2A 1A7DA 3M4BA 2L7AA 2AVKA 2HJMA 4BEJA 3EZIA 1RKEA 3EGDA 3US6A 4U5HA 4EBKA 5JVEA 2VCCA 3IHUA 4NTFA 2H7BA 5JUAA 3AQCA 1ORJA 1GS9A 1WTYA 2VCBA 2WVNA 1UFBA 2Y69C 3S27A 3FVYA 4JURI 1HW1A 1K04A 4CS9A 5L0HA 3AJMA 1XZPA 3NYJA 4YL3A 2YL1A 4C3EA 3W2VA 2ETSA 1VK5A 2FGYA 1T6UA 3NKDA 4U5CE 3S28A 1OCRC 2JX0A 2EPKX 4U5FE 2LFDA 2FAPB 1HMOA 2R02A 3JYYA 1N1CA 1S05A 3K66A 4WGZA 4E0HA 3PDMP 2EPMX 4DXWA 2XM0A 2IBFA 1NFOA 1OW6A 1LIHA 3GWLA 2HFIA 1MNEA 1CGNA 4IJJA 4MTFA 4U9EA 2M4EA 4I3MA 4D4XA 2J7PD 2NG1A 3NKEA 4O79A 2IXNA 4JE9A 1OR3A 1LVKA 3DAFA 1ZVZA 5AGFA 5COMA 4PJJA 3B0UX 4JKVA 1LI5A 2LK4A 2V3CC 4IWBA 4MVSA 3F47A 4YL0A 2Z15A 3E70C 3O39A 1W2WA 2QY9A 3OEOA 4HFKB 3TOLA 3WHNA 4MNDA 1U0BB 3NRHA 2R03A 4AX2A 2Q4FA 1VLTA 4M63A 3ASNC 1VLSA 3FOPA 3NYMA 1FMVA 1OW7A 1WASA 3MFNA 4DRHB 4CSAA 2YL7A 4D4NA 2ZXPA 3LJBA 2LSEA 2Y3GA 4K7BA 2XSEA 5DLJA 1NU7D 4MVZA 2KQ9A 1FAPB 2HZ8A 1Q0DA 3TQOA 3JRTA 2NSFA 3UMHA 256BA 3A9CA 3VYWA 4OD5A 2KNHA 2KYHA 3KH2A 2XS8A 1M2VA 3FXHA 3AGTA 1U6HA 3HTKC 3LNRA 5L3VA 1FFHA 4RD9A 1D1AA 2XLHA 3C18A 1BDJB 2XS1A 3VM6A 2AP3A 4A2NB 5A6KA 1AEPA 3LLKA 4E7SA 1RJ9A 3QZCA 2CNWA 3HNLA 1YLMA 3JT1A 4P9TA 3DM5A 3AG2C 1FMWA 4U5GA 4OIPF 2OKUA 4XPXA 1VOMA 1H6GA 1PCXA 2QLAA 1Z7Qc 2PNOA 3U9MA 3U8PA 2H7VC 4WABA 3HNJA 1MNDA 2MWQA 3B9QA 3OA1A 1J8YF 1RKCA 1KTMA 2J45A 4JTCB 1OR2A 3L8JA 3M15A 3L34A 3EH1A 3U9JA 1CPQA 2HJ3A 3W4YA 1WN0A 5T3WA 3EGXB 1FR0A 1Q0MA 2ZXOA 4JJGA 3MLGA 4C3BA 1QLEC 3RQEA 3MYFA 2B0JA 2OEVA 4XEFA 1M57C 2ZXRA 4E17A 1YA7O 2QNLA 3ZQYA 4C7OA 2G62A 1LS1A 2A69F 2R05A 1OKKD 3OWTA 3SZRA 3RF3A 3SP1A 2LQGA 4JVSA 4NTAA 1SZIA 3X1OA 4YT5A 3CQZA 3TJ5A 3LS1A 1C17M 3RYLA 4ZLCA 2L6GA 2OQMA 4DBRA 5BUOA 5KYNA 5F28E 1Z3IX 2W4BA 3EFOB 5A6AA 4MVRA 2PF4E 5DVWA 5B3SC 3C8ZA 3HNIA 5B1AC 4IARA 2WB7A 2A0UA 4CS9C 1BR2A 1QVXA 2H8AA 3S0XA 4DJ9A 1Y6DA 1GQAA 1DOWA 2IYLD 3GODA 2QE9A 1OCZC 3EH2A 5KYWB 2J46A 1V54C 2YLIA 3C8GA 4A4AA 4I44A 1WGWA 3U3BA 1LKXA 2YZSA 4AE4A 1D1CA 2R7UA 3ABLC 2X0CA 3RFYA 4EBBA 4CIPA 2LIGA 3DI5A 3ECSA 5JS5A 1IZMA 2O9XA 4Z9HA 3ZVRA 1CGME 5DS6A 1T6IA 3LAYA 3LESA 4FESA 2LP4A 4J7TA 3RH3A 3KYIA 2ZXWC 3KYJA 3ZDLA 2Q7RA 1E83A 3ABKC 2XL6A 3O6XA 3S84A 3K33A 1SMYF 3UGOA 1Y4CA 1H7IA 4E7ZA 2YRFA 1EQ1A 1YYJA 3GEHA 2M64A 2P6VA 1HY5A 3FOOA 3ITFA 4O6MA 4W8PA 1QPUA 5DS4A 4BJ5A 5F5FA 3T6GB 1GGQA 2DB4A 1ZU4A 3AQBA 2BC5A 2A6EF 2YL3A 4ULVA 2NPUA 5CIVA 3MYIA 3U8VA 1XZQA 2AU5A 5KYXB 3WODF 1OCOC 5A6BA 2WVQA 3NYLA 3SXMA 4L6RA 4WJ0A 3H65A 1SYQA 2ZPAA 3G50A 4JRZA 4RDAA 4ANJA 5DS5A 1R5ID 2R7VA 2I15A 1OW8A 1RMVA 1I4YA 3ZQVA 1E86A 4G0HA 2NUPB 3ZC4A 3LUTB 4PR9A 4CX9A 1UG7A 3K1HA 3DE8A 4H4KC 4JJFA 1ZHYA 2YEVA 2DYRC 4JTAB 3S9OA 4FAPB 1Q0GA 3V7OA 3H2UA 1BBHA 4JCZA 2V26A 4JTDB 4AE4B 2WZGA 4CS7A 4DRJB 2D4UA 2AWYA 2F22A 2YKZA 5B1BC 2HV7A 2MYSA 2XXAA 2KW3C 4YT8A 1D0XA 1I4ZA 3N2ZB 4HFFB 1JPNA 5EK0A 2Y39A 2OOCA 3K1IC 3L8IA 1ZZPA 3EHNA 4AL0A 4CS8A 3DD7A 1VMAA 3AGUA 3GM3A 1YVIA 1JMWA 4QI0A 1EI7A 2JD3A 3C63A 1AVOB 3SEOA 1EA8A 3DZAA 4MVUA 4N6HA 3T6JA 3UNGC 2EINC 3V5ZA 1RKEB 3EGDB 1T6QA 3B29A 1U89A 4I1OB 4C3DA 1KU2A 2R7TA 2Q9CA 3FAJA 3K7DA 1NZEA 3GANA 3KKBA 1NSGB 1LS4A 5AC5A 2EIJC 1GM5A 4BJTA 5L3QA 1V4AA 3VF0A 4CDAA 4J30B 4QI2A 1MMNA 2CGEA 1G5ZA 3ZWIA 1ZHWA 2RD9A 4CDYA 1A7VA 1JAFA 1YJGA 3MBGA 3AG3C 2UUHA 1I5NA 1C03A 2BE5F 2LD6A 4B6IA 2BL2A 1M6TA 1MMGA 3PHF2 3ASOC 5JRAA 4IB4A 3KPHA 4MVMA 3DXJF 4XWJA 4G7ZF 3BRJA 4MW8A 5IY5C 3UMIA 1ZW2A 2HUJA 2YQYA 4FWVA 3W2WA 1T5OA 1HMDA 3HKKA 1A0BA 2XLWA 4K0DA 4XEKA 5T3TA 1OQCA 2I8BA 1YA9A 2GDCA 2LFFA 3AOUA 3TOMA 3VAYA 1OXBA 2HSQA 3GEIA 2L6HA 1PD1A 2E87A 4FX5A 5EGYA 1B68A 1MMAA 2LCHA 4W8KA 4I1MA 4KNVA 2MHRA 3QW0A 3J06A 4JC7A 2W4MA 2R7WA 4OIOF 5L0DA 2J7PA 1LI7A 3Q7LA 3HNKA 4J7YA 2H7OA 3RKOF 4CJOA 2G3KA 5L0GA 4PK4A 3S90A 1M2VB 1RCPA 2YVKA 5CI9A 3ZIBA 2IXPA 1LE4A 2B0HA 4IAOA 2ASRA 4ULWA 1O5HA 1OXKA 3NMJA 5E3AA 2YHSA 4LLCA 4NCQA 4YK5A 3RW0A 2TMVP 1O87A 5BQHA 2XLEA 4JEAA 2EIKC 2OU6A 3E9VA 2WZLA 3FHDA 4KNWA 2DI3A 4JZAA 3B71A 2J9WA 1BR1A 1RJ9B 2PFDA 2NUTA 4K1OA 5DQTA 2J8WA 4BJ5C 1TWGA 1RXQA 3AG4C 4PJMA 1YZCA 1QSPA 1YDIA 4DBQA 1PV3A 1F1MA 1D1BA 3TJ6A 2VASA 1XWJA 2YLGA 1G4US 1J8MF 5JP7A 4U5BE 1OCCC 3JTLO 2Q3TA 3TK0A 5DQZA 2Q00A 2HKVA 3EQLF 4LDRA 2KJGA 3V5XA 4XTKA 1TKNA 2PX0A 1KNYA 3EJNA 2R7QA 3NDBB 2HV6A 3SXZA 4E18A 5KYYA 4YJWA 3EZHA 4NTBA 1YARO 1E84A 4XLPF 2VCAA 1HE9A 1LPEA 3O10A 3NG1A 4N06A 4JW1A 4U5DE 3L0IA 4PJNA 2L81A 3V5YA 2IOQA 3BEHA 3SNHA 3R7CA 3W8HA 2Q9AA 4MS2A 1TFOB 1ZHXA 2P1AA 2P61A 1H9GA 4C7OB 2GWWA 2GA0A 4WGYA 1G8XA 2XRHA 1BR4A 2Y3HA 4DOZA 3FMSA 5TJ5E 3JYHA 2P0NA 3DJNB 4PACA 4O6YA 1T01A 4XEVA 2ICWG 4CSAC 4G7OF 5L0CA 1ZHTA 2IXOA 3U2MA 3M4CA 1V74B 3M79A 4ZLDA 4R32A 3M1CB 4G78A 4HEAJ 1C02A 1K40A 2HS5A 4EBJA 2D5RB 2OJQA 3EHMA 1ST6A 4MQ9F 1CPRA 3QMKA 3RVYA 4YT4A 5A69A 3U5SA 1ZHZA 5GPGB 1TR2A 3FDQA 2L9JA 5JT4A 1VTMP 1ZU5A 4MW3A 2XM4A 5FZTA 3K6BA 2CNWD 2W9YA 1A7EA 4XLNF 3UMKA 4O7GA 1D0ZA 1OKKA 3QTHA 4PFPA 4AL1A 2PBEA 3A11A 3C8GB 3CEXA 1TWAA 3DJUB 3GM2A 4P9FA 3T4RA 4CDVA 4CIHA 5EHHA 4Q5SF 4F4BA 2QUPA 1JPJA 4MVQA 3WG7C 1R4TA 3W8IA 1LE2A 3EPVA 2GFHA 2EPLX 3R2PA 2Q9BA 4BJ6A 5B3IA 4J32B 2KK1A 1K05A 4KC9A 3GEEA 2CCYA 1SF8A 1TWCA 3HJCA 3IQCA 2R7RA 3B0PA 2YLDA 4MTGA 1Z6AA 3QVZA 4NQFA 4LACB 3SXYA 5F5HA 2XL4A 3N24A 5BQGA 1E85A 4JEBA 3CSKA 5T1DB 4GYTA 3RVZA 2EIMC 3T9OA 3UGPA 3ATPA 4MVOA 3IQ5A 1HE1A 2IM8A 3ZG1A 3TD7A 1V55C 2KGOA 5FCLA 4OINF 2DYSC 1ZYRF 2J9UA 3JSEO 2OEXA 3ZSUA 1JOGA 1L7CA 3LS0A 2EPNA 3KL4A 3LEVA 1WOLA 3TULA 3I4UA 1Q0FA 1TQGA 2C04A 1FNTc 3WAQA 4ER9A 1QKRA 2G3VA 4DVYP 1QZXA 5HSWA 2ZD9A 3GM1A 4XPYA 3F46A 1QQ3A 2CYDA 2R9RB 2R7SA 4OD4A 3EGXA 4RBNA 2J9BA 4U9DA 4LDQA 4EHPA 1O3UA 3Q6NA 1YZAA 1YYXA 1Z5ZA 5D92A 3SYNA 4BG0A 3JCUQ 1BZ4A 2A0BA 2XLDA 4XQ1A 2WL8A 2CDQA 2YWAA 2VH3A 4IGGA 2OG2A 2EILC 2WVOA 3LEOA 4NY3A 3CZ6A 2XXAB 4X0RA 5L0FA 5COFA 4EUKB 1NFNA 5JLIA 4BPMA 3JSZA 3RIPA 2QTVA 2VC9A 3C8GD 2XLVA 4AK9A 1CGOA 1T9KA 3IPMO 3B0VC 5L0IA 3NMKA 4KBLA 5COGA 5CI8A 2FFHA 2GAQA 2P7VA 1E2XA 3EG9A 4OIRF 4O6NA 4CBEA 4LERA 5E3CA 4Z9JA 3S29A 3UR3C 3KMIA 3DKAA 3EFOA 3Q6MA 1LM3B 1WWPA 5KYUA 4DRIB 3I5QA 1ORSC 1NBBA 2W45A 3VRCA 2A68F 4U5EE 1TFKB 3DM9B 3GWNA 2X51A 2Y3DA 1NLXA 3I5PA 5D91A 1HW2A 4JIOA 4H54A 3K1IA 5KYWA 3AG1C 3LNMB 3PCVA 3RQFA 3DE9A 2PP4A 1JR8A 4YT2A 3IEEA 3NMIA 4BJ1A 3DWWA 5BQIA 2DGJA 3HLZA 3POVA 2CW0F 4PJLA 5A6BD 4IRUA 1G4WR 2XLMA 4BEMJ 3Q7GA 1IW7F 3QVYA 1AUEA 5E33A 5L0JA 4Q7CA 4QDLA 3ZTMA 4JCHA 4E0IA 2A6HF 1M56C 1VB5A 1FTSA 4YL1A 3PMRA 2Y3BA 4EIYA 1H9TA 1APCA 1S7ZA 3N0TA 3G4XA 4G7HF 2YL0A 4OIQF 2XL8A 1YAUO 2HMZA 3LLIA 2HSBA 1Z63A 3IQ6A 4XPWA 4Z9IA 3SXKA 1Z23A 3O55A 2R7XA 3DAGA 2IXMA 1D0YA 1VYIA 3EG9B 3MX3A 1VYKA 4N4WA 1TWHA 5KYXA 3ABMC 3DMDA 1A41A 4BJ6C 5KYUB 1JRAA 4GEHA 2AWCA 2HMQA 3C62A 4CJGA 3JZ0A 1DOVA 2JPUA 1Q0KA 4P6IC 1WATA 3T6BA 4Q4ZF 1MQVA 2EPOA 3L1MA 4UDVA 2KC3A 1PD0A 3RQGA 5AC4A 4CS8C 1EKYA 2J0WA 1NG1A 2NUPA 4GQHA 3G4ZA 4N6CA 2NUTB 2R7OA 5A6JA 1ORYA 1L3PA 2J0XA 3U0CA 1M2OA 4MTOA 2OJED 4LLEA 1SR2A 5JSLA 2A1DD 2R25A 3U2LA 4YN0B 4HE8D
chains in the Genus database with same CATH topology
1YVIA 2A0BA 1A0BA 2LP4A 3IQTA 3KYIA 3KYJA 4EUKB 1QSPA 1OXBA 1BDJB 1WN0A 1FR0A 2LCHA 4PACA 1Y6DA 3MYFA 3US6A 1TQGA 4G78A 1C02A 2Q4FA 1I5NA 1C03A 2LD6A 1SR2A 2R25A 2OOCA 3U3BA 1OXKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YVI A;  2A0B A;  1A0B A;  2LP4 A;  3IQT A;  3KYI A;  3KYJ A;  4EUK B;  1QSP A;  1OXB A;  1BDJ B;  1WN0 A;  1FR0 A;  2LCH A;  4PAC A;  1Y6D A;  3MYF A;  3US6 A;  1TQG A;  4G78 A;  1C02 A;  2Q4F A;  1I5N A;  1C03 A;  2LD6 A;  1SR2 A;  2R25 A;  2OOC A;  3U3B A;  1OXK A; 
#chains in the Genus database with same CATH topology
 2PX3 A;  3ZTZ A;  2NSG A;  3JRM O;  3QW1 A;  1NU9 C;  2L6F A;  2C03 A;  4NC3 A;  5E2Q A;  2KSF A;  3FAP B;  3IQT A;  2VB6 A;  3CAX A;  3U3F A;  4EWC A;  2J9V A;  4DVZ A;  3C7J A;  2RSE B;  4YWQ A;  5K0I A;  1MMD A;  3GOR A;  4IAQ A;  4LDK A;  4PFO A;  3X2Q C;  1FFT C;  2OCC C;  4ONS A;  4EKW A;  5KYY B;  2UUI A;  2WZF A;  2XLO A;  1ZW3 A;  5HV9 A;  3H2V A;  4KI2 A;  1A7D A;  3M4B A;  2L7A A;  2AVK A;  2HJM A;  4BEJ A;  3EZI A;  1RKE A;  3EGD A;  3US6 A;  4U5H A;  4EBK A;  5JVE A;  2VCC A;  3IHU A;  4NTF A;  2H7B A;  5JUA A;  3AQC A;  1ORJ A;  1GS9 A;  1WTY A;  2VCB A;  2WVN A;  1UFB A;  2Y69 C;  3S27 A;  3FVY A;  4JUR I;  1HW1 A;  1K04 A;  4CS9 A;  5L0H A;  3AJM A;  1XZP A;  3NYJ A;  4YL3 A;  2YL1 A;  4C3E A;  3W2V A;  2ETS A;  1VK5 A;  2FGY A;  1T6U A;  3NKD A;  4U5C E;  3S28 A;  1OCR C;  2JX0 A;  2EPK X;  4U5F E;  2LFD A;  2FAP B;  1HMO A;  2R02 A;  3JYY A;  1N1C A;  1S05 A;  3K66 A;  4WGZ A;  4E0H A;  3PDM P;  2EPM X;  4DXW A;  2XM0 A;  2IBF A;  1NFO A;  1OW6 A;  1LIH A;  3GWL A;  2HFI A;  1MNE A;  1CGN A;  4IJJ A;  4MTF A;  4U9E A;  2M4E A;  4I3M A;  4D4X A;  2J7P D;  2NG1 A;  3NKE A;  4O79 A;  2IXN A;  4JE9 A;  1OR3 A;  1LVK A;  3DAF A;  1ZVZ A;  5AGF A;  5COM A;  4PJJ A;  3B0U X;  4JKV A;  1LI5 A;  2LK4 A;  2V3C C;  4IWB A;  4MVS A;  3F47 A;  4YL0 A;  2Z15 A;  3E70 C;  3O39 A;  1W2W A;  2QY9 A;  3OEO A;  4HFK B;  3TOL A;  3WHN A;  4MND A;  1U0B B;  3NRH A;  2R03 A;  4AX2 A;  2Q4F A;  1VLT A;  4M63 A;  3ASN C;  1VLS A;  3FOP A;  3NYM A;  1FMV A;  1OW7 A;  1WAS A;  3MFN A;  4DRH B;  4CSA A;  2YL7 A;  4D4N A;  2ZXP A;  3LJB A;  2LSE A;  2Y3G A;  4K7B A;  2XSE A;  5DLJ A;  1NU7 D;  4MVZ A;  2KQ9 A;  1FAP B;  2HZ8 A;  1Q0D A;  3TQO A;  3JRT A;  2NSF A;  3UMH A;  256B A;  3A9C A;  3VYW A;  4OD5 A;  2KNH A;  2KYH A;  3KH2 A;  2XS8 A;  1M2V A;  3FXH A;  3AGT A;  1U6H A;  3HTK C;  3LNR A;  5L3V A;  1FFH A;  4RD9 A;  1D1A A;  2XLH A;  3C18 A;  1BDJ B;  2XS1 A;  3VM6 A;  2AP3 A;  4A2N B;  5A6K A;  1AEP A;  3LLK A;  4E7S A;  1RJ9 A;  3QZC A;  2CNW A;  3HNL A;  1YLM A;  3JT1 A;  4P9T A;  3DM5 A;  3AG2 C;  1FMW A;  4U5G A;  4OIP F;  2OKU A;  4XPX A;  1VOM A;  1H6G A;  1PCX A;  2QLA A;  1Z7Q c;  2PNO A;  3U9M A;  3U8P A;  2H7V C;  4WAB A;  3HNJ A;  1MND A;  2MWQ A;  3B9Q A;  3OA1 A;  1J8Y F;  1RKC A;  1KTM A;  2J45 A;  4JTC B;  1OR2 A;  3L8J A;  3M15 A;  3L34 A;  3EH1 A;  3U9J A;  1CPQ A;  2HJ3 A;  3W4Y A;  1WN0 A;  5T3W A;  3EGX B;  1FR0 A;  1Q0M A;  2ZXO A;  4JJG A;  3MLG A;  4C3B A;  1QLE C;  3RQE A;  3MYF A;  2B0J A;  2OEV A;  4XEF A;  1M57 C;  2ZXR A;  4E17 A;  1YA7 O;  2QNL A;  3ZQY A;  4C7O A;  2G62 A;  1LS1 A;  2A69 F;  2R05 A;  1OKK D;  3OWT A;  3SZR A;  3RF3 A;  3SP1 A;  2LQG A;  4JVS A;  4NTA A;  1SZI A;  3X1O A;  4YT5 A;  3CQZ A;  3TJ5 A;  3LS1 A;  1C17 M;  3RYL A;  4ZLC A;  2L6G A;  2OQM A;  4DBR A;  5BUO A;  5KYN A;  5F28 E;  1Z3I X;  2W4B A;  3EFO B;  5A6A A;  4MVR A;  2PF4 E;  5DVW A;  5B3S C;  3C8Z A;  3HNI A;  5B1A C;  4IAR A;  2WB7 A;  2A0U A;  4CS9 C;  1BR2 A;  1QVX A;  2H8A A;  3S0X A;  4DJ9 A;  1Y6D A;  1GQA A;  1DOW A;  2IYL D;  3GOD A;  2QE9 A;  1OCZ C;  3EH2 A;  5KYW B;  2J46 A;  1V54 C;  2YLI A;  3C8G A;  4A4A A;  4I44 A;  1WGW A;  3U3B A;  1LKX A;  2YZS A;  4AE4 A;  1D1C A;  2R7U A;  3ABL C;  2X0C A;  3RFY A;  4EBB A;  4CIP A;  2LIG A;  3DI5 A;  3ECS A;  5JS5 A;  1IZM A;  2O9X A;  4Z9H A;  3ZVR A;  1CGM E;  5DS6 A;  1T6I A;  3LAY A;  3LES A;  4FES A;  2LP4 A;  4J7T A;  3RH3 A;  3KYI A;  2ZXW C;  3KYJ A;  3ZDL A;  2Q7R A;  1E83 A;  3ABK C;  2XL6 A;  3O6X A;  3S84 A;  3K33 A;  1SMY F;  3UGO A;  1Y4C A;  1H7I A;  4E7Z A;  2YRF A;  1EQ1 A;  1YYJ A;  3GEH A;  2M64 A;  2P6V A;  1HY5 A;  3FOO A;  3ITF A;  4O6M A;  4W8P A;  1QPU A;  5DS4 A;  4BJ5 A;  5F5F A;  3T6G B;  1GGQ A;  2DB4 A;  1ZU4 A;  3AQB A;  2BC5 A;  2A6E F;  2YL3 A;  4ULV A;  2NPU A;  5CIV A;  3MYI A;  3U8V A;  1XZQ A;  2AU5 A;  5KYX B;  3WOD F;  1OCO C;  5A6B A;  2WVQ A;  3NYL A;  3SXM A;  4L6R A;  4WJ0 A;  3H65 A;  1SYQ A;  2ZPA A;  3G50 A;  4JRZ A;  4RDA A;  4ANJ A;  5DS5 A;  1R5I D;  2R7V A;  2I15 A;  1OW8 A;  1RMV A;  1I4Y A;  3ZQV A;  1E86 A;  4G0H A;  2NUP B;  3ZC4 A;  3LUT B;  4PR9 A;  4CX9 A;  1UG7 A;  3K1H A;  3DE8 A;  4H4K C;  4JJF A;  1ZHY A;  2YEV A;  2DYR C;  4JTA B;  3S9O A;  4FAP B;  1Q0G A;  3V7O A;  3H2U A;  1BBH A;  4JCZ A;  2V26 A;  4JTD B;  4AE4 B;  2WZG A;  4CS7 A;  4DRJ B;  2D4U A;  2AWY A;  2F22 A;  2YKZ A;  5B1B C;  2HV7 A;  2MYS A;  2XXA A;  2KW3 C;  4YT8 A;  1D0X A;  1I4Z A;  3N2Z B;  4HFF B;  1JPN A;  5EK0 A;  2Y39 A;  2OOC A;  3K1I C;  3L8I A;  1ZZP A;  3EHN A;  4AL0 A;  4CS8 A;  3DD7 A;  1VMA A;  3AGU A;  3GM3 A;  1YVI A;  1JMW A;  4QI0 A;  1EI7 A;  2JD3 A;  3C63 A;  1AVO B;  3SEO A;  1EA8 A;  3DZA A;  4MVU A;  4N6H A;  3T6J A;  3UNG C;  2EIN C;  3V5Z A;  1RKE B;  3EGD B;  1T6Q A;  3B29 A;  1U89 A;  4I1O B;  4C3D A;  1KU2 A;  2R7T A;  2Q9C A;  3FAJ A;  3K7D A;  1NZE A;  3GAN A;  3KKB A;  1NSG B;  1LS4 A;  5AC5 A;  2EIJ C;  1GM5 A;  4BJT A;  5L3Q A;  1V4A A;  3VF0 A;  4CDA A;  4J30 B;  4QI2 A;  1MMN A;  2CGE A;  1G5Z A;  3ZWI A;  1ZHW A;  2RD9 A;  4CDY A;  1A7V A;  1JAF A;  1YJG A;  3MBG A;  3AG3 C;  2UUH A;  1I5N A;  1C03 A;  2BE5 F;  2LD6 A;  4B6I A;  2BL2 A;  1M6T A;  1MMG A;  3PHF 2;  3ASO C;  5JRA A;  4IB4 A;  3KPH A;  4MVM A;  3DXJ F;  4XWJ A;  4G7Z F;  3BRJ A;  4MW8 A;  5IY5 C;  3UMI A;  1ZW2 A;  2HUJ A;  2YQY A;  4FWV A;  3W2W A;  1T5O A;  1HMD A;  3HKK A;  1A0B A;  2XLW A;  4K0D A;  4XEK A;  5T3T A;  1OQC A;  2I8B A;  1YA9 A;  2GDC A;  2LFF A;  3AOU A;  3TOM A;  3VAY A;  1OXB A;  2HSQ A;  3GEI A;  2L6H A;  1PD1 A;  2E87 A;  4FX5 A;  5EGY A;  1B68 A;  1MMA A;  2LCH A;  4W8K A;  4I1M A;  4KNV A;  2MHR A;  3QW0 A;  3J06 A;  4JC7 A;  2W4M A;  2R7W A;  4OIO F;  5L0D A;  2J7P A;  1LI7 A;  3Q7L A;  3HNK A;  4J7Y A;  2H7O A;  3RKO F;  4CJO A;  2G3K A;  5L0G A;  4PK4 A;  3S90 A;  1M2V B;  1RCP A;  2YVK A;  5CI9 A;  3ZIB A;  2IXP A;  1LE4 A;  2B0H A;  4IAO A;  2ASR A;  4ULW A;  1O5H A;  1OXK A;  3NMJ A;  5E3A A;  2YHS A;  4LLC A;  4NCQ A;  4YK5 A;  3RW0 A;  2TMV P;  1O87 A;  5BQH A;  2XLE A;  4JEA A;  2EIK C;  2OU6 A;  3E9V A;  2WZL A;  3FHD A;  4KNW A;  2DI3 A;  4JZA A;  3B71 A;  2J9W A;  1BR1 A;  1RJ9 B;  2PFD A;  2NUT A;  4K1O A;  5DQT A;  2J8W A;  4BJ5 C;  1TWG A;  1RXQ A;  3AG4 C;  4PJM A;  1YZC A;  1QSP A;  1YDI A;  4DBQ A;  1PV3 A;  1F1M A;  1D1B A;  3TJ6 A;  2VAS A;  1XWJ A;  2YLG A;  1G4U S;  1J8M F;  5JP7 A;  4U5B E;  1OCC C;  3JTL O;  2Q3T A;  3TK0 A;  5DQZ A;  2Q00 A;  2HKV A;  3EQL F;  4LDR A;  2KJG A;  3V5X A;  4XTK A;  1TKN A;  2PX0 A;  1KNY A;  3EJN A;  2R7Q A;  3NDB B;  2HV6 A;  3SXZ A;  4E18 A;  5KYY A;  4YJW A;  3EZH A;  4NTB A;  1YAR O;  1E84 A;  4XLP F;  2VCA A;  1HE9 A;  1LPE A;  3O10 A;  3NG1 A;  4N06 A;  4JW1 A;  4U5D E;  3L0I A;  4PJN A;  2L81 A;  3V5Y A;  2IOQ A;  3BEH A;  3SNH A;  3R7C A;  3W8H A;  2Q9A A;  4MS2 A;  1TFO B;  1ZHX A;  2P1A A;  2P61 A;  1H9G A;  4C7O B;  2GWW A;  2GA0 A;  4WGY A;  1G8X A;  2XRH A;  1BR4 A;  2Y3H A;  4DOZ A;  3FMS A;  5TJ5 E;  3JYH A;  2P0N A;  3DJN B;  4PAC A;  4O6Y A;  1T01 A;  4XEV A;  2ICW G;  4CSA C;  4G7O F;  5L0C A;  1ZHT A;  2IXO A;  3U2M A;  3M4C A;  1V74 B;  3M79 A;  4ZLD A;  4R32 A;  3M1C B;  4G78 A;  4HEA J;  1C02 A;  1K40 A;  2HS5 A;  4EBJ A;  2D5R B;  2OJQ A;  3EHM A;  1ST6 A;  4MQ9 F;  1CPR A;  3QMK A;  3RVY A;  4YT4 A;  5A69 A;  3U5S A;  1ZHZ A;  5GPG B;  1TR2 A;  3FDQ A;  2L9J A;  5JT4 A;  1VTM P;  1ZU5 A;  4MW3 A;  2XM4 A;  5FZT A;  3K6B A;  2CNW D;  2W9Y A;  1A7E A;  4XLN F;  3UMK A;  4O7G A;  1D0Z A;  1OKK A;  3QTH A;  4PFP A;  4AL1 A;  2PBE A;  3A11 A;  3C8G B;  3CEX A;  1TWA A;  3DJU B;  3GM2 A;  4P9F A;  3T4R A;  4CDV A;  4CIH A;  5EHH A;  4Q5S F;  4F4B A;  2QUP A;  1JPJ A;  4MVQ A;  3WG7 C;  1R4T A;  3W8I A;  1LE2 A;  3EPV A;  2GFH A;  2EPL X;  3R2P A;  2Q9B A;  4BJ6 A;  5B3I A;  4J32 B;  2KK1 A;  1K05 A;  4KC9 A;  3GEE A;  2CCY A;  1SF8 A;  1TWC A;  3HJC A;  3IQC A;  2R7R A;  3B0P A;  2YLD A;  4MTG A;  1Z6A A;  3QVZ A;  4NQF A;  4LAC B;  3SXY A;  5F5H A;  2XL4 A;  3N24 A;  5BQG A;  1E85 A;  4JEB A;  3CSK A;  5T1D B;  4GYT A;  3RVZ A;  2EIM C;  3T9O A;  3UGP A;  3ATP A;  4MVO A;  3IQ5 A;  1HE1 A;  2IM8 A;  3ZG1 A;  3TD7 A;  1V55 C;  2KGO A;  5FCL A;  4OIN F;  2DYS C;  1ZYR F;  2J9U A;  3JSE O;  2OEX A;  3ZSU A;  1JOG A;  1L7C A;  3LS0 A;  2EPN A;  3KL4 A;  3LEV A;  1WOL A;  3TUL A;  3I4U A;  1Q0F A;  1TQG A;  2C04 A;  1FNT c;  3WAQ A;  4ER9 A;  1QKR A;  2G3V A;  4DVY P;  1QZX A;  5HSW A;  2ZD9 A;  3GM1 A;  4XPY A;  3F46 A;  1QQ3 A;  2CYD A;  2R9R B;  2R7S A;  4OD4 A;  3EGX A;  4RBN A;  2J9B A;  4U9D A;  4LDQ A;  4EHP A;  1O3U A;  3Q6N A;  1YZA A;  1YYX A;  1Z5Z A;  5D92 A;  3SYN A;  4BG0 A;  3JCU Q;  1BZ4 A;  2A0B A;  2XLD A;  4XQ1 A;  2WL8 A;  2CDQ A;  2YWA A;  2VH3 A;  4IGG A;  2OG2 A;  2EIL C;  2WVO A;  3LEO A;  4NY3 A;  3CZ6 A;  2XXA B;  4X0R A;  5L0F A;  5COF A;  4EUK B;  1NFN A;  5JLI A;  4BPM A;  3JSZ A;  3RIP A;  2QTV A;  2VC9 A;  3C8G D;  2XLV A;  4AK9 A;  1CGO A;  1T9K A;  3IPM O;  3B0V C;  5L0I A;  3NMK A;  4KBL A;  5COG A;  5CI8 A;  2FFH A;  2GAQ A;  2P7V A;  1E2X A;  3EG9 A;  4OIR F;  4O6N A;  4CBE A;  4LER A;  5E3C A;  4Z9J A;  3S29 A;  3UR3 C;  3KMI A;  3DKA A;  3EFO A;  3Q6M A;  1LM3 B;  1WWP A;  5KYU A;  4DRI B;  3I5Q A;  1ORS C;  1NBB A;  2W45 A;  3VRC A;  2A68 F;  4U5E E;  1TFK B;  3DM9 B;  3GWN A;  2X51 A;  2Y3D A;  1NLX A;  3I5P A;  5D91 A;  1HW2 A;  4JIO A;  4H54 A;  3K1I A;  5KYW A;  3AG1 C;  3LNM B;  3PCV A;  3RQF A;  3DE9 A;  2PP4 A;  1JR8 A;  4YT2 A;  3IEE A;  3NMI A;  4BJ1 A;  3DWW A;  5BQI A;  2DGJ A;  3HLZ A;  3POV A;  2CW0 F;  4PJL A;  5A6B D;  4IRU A;  1G4W R;  2XLM A;  4BEM J;  3Q7G A;  1IW7 F;  3QVY A;  1AUE A;  5E33 A;  5L0J A;  4Q7C A;  4QDL A;  3ZTM A;  4JCH A;  4E0I A;  2A6H F;  1M56 C;  1VB5 A;  1FTS A;  4YL1 A;  3PMR A;  2Y3B A;  4EIY A;  1H9T A;  1APC A;  1S7Z A;  3N0T A;  3G4X A;  4G7H F;  2YL0 A;  4OIQ F;  2XL8 A;  1YAU O;  2HMZ A;  3LLI A;  2HSB A;  1Z63 A;  3IQ6 A;  4XPW A;  4Z9I A;  3SXK A;  1Z23 A;  3O55 A;  2R7X A;  3DAG A;  2IXM A;  1D0Y A;  1VYI A;  3EG9 B;  3MX3 A;  1VYK A;  4N4W A;  1TWH A;  5KYX A;  3ABM C;  3DMD A;  1A41 A;  4BJ6 C;  5KYU B;  1JRA A;  4GEH A;  2AWC A;  2HMQ A;  3C62 A;  4CJG A;  3JZ0 A;  1DOV A;  2JPU A;  1Q0K A;  4P6I C;  1WAT A;  3T6B A;  4Q4Z F;  1MQV A;  2EPO A;  3L1M A;  4UDV A;  2KC3 A;  1PD0 A;  3RQG A;  5AC4 A;  4CS8 C;  1EKY A;  2J0W A;  1NG1 A;  2NUP A;  4GQH A;  3G4Z A;  4N6C A;  2NUT B;  2R7O A;  5A6J A;  1ORY A;  1L3P A;  2J0X A;  3U0C A;  1M2O A;  4MTO A;  2OJE D;  4LLE A;  1SR2 A;  5JSL A;  2A1D D;  2R25 A;  3U2L A;  4YN0 B;  4HE8 D; 
#chains in the Genus database with same CATH homology
 1YVI A;  2A0B A;  1A0B A;  2LP4 A;  3IQT A;  3KYI A;  3KYJ A;  4EUK B;  1QSP A;  1OXB A;  1BDJ B;  1WN0 A;  1FR0 A;  2LCH A;  4PAC A;  1Y6D A;  3MYF A;  3US6 A;  1TQG A;  4G78 A;  1C02 A;  2Q4F A;  1I5N A;  1C03 A;  2LD6 A;  1SR2 A;  2R25 A;  2OOC A;  3U3B A;  1OXK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...