4EUKB

Crystal structure
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
152
structure length
152
Chain Sequence
MDLVQKQKSLQDYTKSLFLEGILDSQFLQLQQLQDESNPDFVSQVVTLFFQDSDRILNDLSLSLDQQVVDFKKVDPHVHQLKGSSSSIGAQRVKNACVVFRSFCEQQNVEACHRCLQQVKQEYYLVKNRLETLFKLEQQIVASGGMIPAVEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histidine kinase 5
publication title Structure-Function Analysis of Arabidopsis thaliana Histidine Kinase AHK5 Bound to Its Cognate Phosphotransfer Protein AHP1.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Signaling protein
total genus 66
structure length 152
sequence length 152
ec nomenclature
pdb deposition date 2012-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01627 Hpt Hpt domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.160 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) HPT domain 4eukB00
3IQTA 1YVIA 2LD6A 1C02A 1TQGA 3KYJA 3US6A 2LCHA 3KYIA 1WN0A 1OXBA 2Q4FA 2A0BA 1I5NA 4EUKB 3MYFA 3U3BA 1FR0A 2LP4A 1Y6DA 2OOCA 2R25A 4PACA 1BDJB 1C03A 1QSPA 1A0BA 1OXKA 4G78A 1SR2A
chains in the Genus database with same CATH superfamily
1D0ZA 1Z23A 2EPOA 3B29A 3NYMA 4O6MA 4P6IC 3RYLA 4ER9A 5L0HA 4HE8D 3KYJA 1RKEA 2OQMA 1LI7A 2LFFA 2ZXWC 4LACB 5BQIA 4N06A 1OXBA 5D92A 4DVZA 4YT4A 4K7BA 5COMA 1ZW2A 2ZXPA 3AGTA 3I5PA 1EA8A 1MMNA 1RJ9B 4I44A 1VOMA 2M4EA 2AU5A 2P61A 1OCRC 5B1BC 2R7XA 4DRHB 2NSGA 1Z3IX 2OOCA 2HV6A 3C62A 5DQTA 4YL0A 4OIRF 3O10A 4CJGA 1YA7O 2YHSA 3L8IA 2PX0A 3OEOA 2ZXOA 5EGYA 1FTSA 1XZQA 2KW3C 2R7TA 1M2OA 5DS4A 1E85A 3VF0A 3PDMP 4HFFB 1BZ4A 4CDAA 4IRUA 2R9RB 2A6EF 1OQCA 1VK5A 1H7IA 2W4MA 1JPNA 1U0BB 1TQGA 4MQ9F 2JPUA 2VH3A 3PCVA 1CPRA 3SXZA 2UUIA 3C63A 3DD7A 1FMVA 3FVYA 4I1MA 3ZG1A 1JPJA 3RKOF 2DYSC 2OCCC 1DOVA 1CGOA 3MFNA 1MMAA 5KYWA 4LLEA 3LNMB 2DB4A 3W8HA 3LUTB 5KYNA 2PX3A 3MYIA 5JSLA 4ZLDA 4I3MA 2QNLA 3WODF 1LIHA 1T6IA 5AGFA 1W2WA 1TR2A 3EG9A 4PJNA 4U5EE 1BDJB 4EBKA 5BQHA 3TK0A 1ZZPA 1JMWA 2KK1A 1YARO 2R05A 4U5DE 4XEVA 2J45A 3UNGC 2KGOA 5B1AC 1EKYA 2G62A 1S05A 1NFNA 3U2LA 2X0CA 4G0HA 3G50A 4CS8A 2GWWA 3AG4C 3K6BA 2GAQA 4PK4A 2HUJA 4BJ6C 3R2PA 3GANA 2R7RA 1M6TA 1SYQA 1A7DA 3DZAA 1NFOA 1CPQA 1K40A 2L6HA 3QZCA 1TFKB 2HKVA 4MNDA 4OINF 3T4RA 1SZIA 3LJBA 4A2NB 1ORYA 1ZVZA 4MTGA 3KPHA 2YVKA 4JURI 3V7OA 5B3IA 2YQYA 5KYUB 3FOOA 2YRFA 2KNHA 2XRHA 1VYKA 1FR0A 3SXYA 3C8GD 4DXWA 4BEJA 2J9UA 2YZSA 1G8XA 3JTLO 4EHPA 1HW2A 4YT8A 3PHF2 3TOMA 4YWQA 1JOGA 2IBFA 3DM9B 1O87A 3IQCA 2A68F 3SYNA 4CDVA 2Y69C 5E33A 1ST6A 4HFKB 1RMVA 5JUAA 4G7OF 4CS7A 4FAPB 4E7ZA 3MLGA 1SR2A 1WOLA 2TMVP 1B68A 4QI2A 2XM4A 1RKEB 2IXOA 1JAFA 3SZRA 4LERA 2XXAA 3US6A 3GEHA 3LLIA 1BR4A 3B0UX 3GEIA 2CCYA 2KQ9A 3DAGA 5HV9A 1I4ZA 3W4YA 1VLSA 4EUKB 2AWYA 3UMHA 5KYXA 3FDQA 2VCCA 3F46A 2GA0A 3LNRA 4P9TA 1OW6A 1PD1A 1Q0FA 2R7SA 3B9QA 3C8GA 3KL4A 2HSBA 4YL1A 4U5GA 4CS9C 5L0IA 3HNJA 1QKRA 3L34A 1NU9C 2A1DD 3U3FA 2ETSA 2BC5A 4JCHA 4XQ1A 2KJGA 4G78A 1G5ZA 2ZD9A 4JC7A 4O7GA 2NPUA 5L0CA 1WATA 3JCUQ 1YZCA 3GM1A 1R4TA 1TFOB 2I8BA 3X2QC 5KYWB 5KYYA 4Z9IA 4JJFA 4K1OA 3U0CA 4O6YA 4U5CE 1WGWA 2IYLD 2VCBA 2XL4A 3DI5A 1Y6DA 3K1IC 1HMDA 2Z15A 5E3AA 1H9GA 2YEVA 3EG9B 3LAYA 3NMKA 4W8PA 4YJWA 3ZIBA 3ZQYA 4CS9A 1APCA 2C03A 3FXHA 4QDLA 5A6AA 2D4UA 3ZVRA 4OD4A 3M15A 3VM6A 4YK5A 1OXKA 2A6HF 1E83A 1QPUA 2XL6A 4W8KA 4PR9A 2GDCA 2CDQA 3UR3C 4OIQF 2OKUA 5F5HA 3AQCA 3NYJA 3RVZA 2B0HA 3I4UA 3H65A 4DRJB 2XLHA 1CGME 2XM0A 1MNEA 3AJMA 4KBLA 5L0FA 1K05A 2OU6A 1V4AA 1LE4A 3AG1C 3DJUB 2J46A 3I5QA 4JIOA 1Q0KA 3Q6MA 1T5OA 2BL2A 2OEXA 3K1IA 4DBQA 1BBHA 1OCCC 1Y4CA 2EINC 3HLZA 1OCZC 2PNOA 1WASA 2AP3A 3AG3C 3EHMA 2Q9AA 4LLCA 4XPXA 3T6JA 4D4NA 3CQZA 2WZFA 3ABLC 4PFPA 5BQGA 2Y3BA 4G7ZF 4ULVA 3Q7LA 5E3CA 4E0HA 4U5FE 2A69F 1YYJA 3TJ5A 3EPVA 4JZAA 4AE4A 4XLPF 3WHNA 3UGPA 1HE9A 4EBJA 4YT5A 1ZU4A 1ORJA 4LDRA 5AC4A 5B3SC 4DBRA 1UFBA 3UGOA 3ASOC 2KYHA 2LD6A 2NUTA 1TWAA 2VC9A 3ZTMA 4PJLA 1YZAA 1GGQA 4MVZA 3S84A 2YL0A 3LS1A 4NQFA 3ZWIA 5BUOA 2L9JA 2HFIA 2LIGA 2J9WA 3CZ6A 3OWTA 4JEAA 3SXKA 4JEBA 1KTMA 1HW1A 5KYXB 1TKNA 1RKCA 3R7CA 4YT2A 2CGEA 5EHHA 4JJGA 4MVSA 1EQ1A 1YJGA 3C8GB 3JZ0A 2DYRC 3U9MA 3E70C 3GWLA 3HKKA 2H8AA 4ANJA 2YLDA 1IW7F 4FWVA 5DS5A 4IARA 3M79A 2NG1A 3DM5A 4MS2A 3Q6NA 4EIYA 3QW1A 4RD9A 3DAFA 4DJ9A 2XLOA 2MHRA 3NDBB 3FAPB 2XLWA 1RCPA 3K7DA 4Z9JA 4IWBA 1WN0A 1FAPB 1DOWA 2Q3TA 1VLTA 2Q4FA 3JRMO 5KYYB 2R7VA 2XLVA 1LM3B 4R32A 1AVOB 4CIPA 3HJCA 4EBBA 3HNIA 3NRHA 2QY9A 1ZHZA 4LDQA 4NC3A 3ZDLA 4C7OA 4E7SA 1VB5A 2J9VA 3EGDA 3IQ5A 4XWJA 2XS8A 4BEMJ 5L0JA 3EGXA 3U8PA 3ATPA 3TQOA 4ZLCA 5A6KA 3HNLA 5FCLA 1KNYA 1A0BA 2EIMC 4NY3A 4XTKA 4BJ6A 5JVEA 1FFTC 3UMIA 4CSAC 3AG2C 3RQEA 3QMKA 3CSKA 2EIKC 4JRZA 2BE5F 4BJ5C 3DMDA 5A6BD 3LLKA 2Q00A 2L6FA 4GYTA 1T6UA 5EK0A 4X0RA 3T9OA 3TOLA 1MQVA 3HNKA 3NG1A 1A41A 1C17M 1MMGA 2PP4A 3DJNB 4U9DA 3EZHA 4E0IA 1L7CA 2I15A 2A0UA 3EH1A 3IQ6A 2IOQA 4YN0B 2P1AA 2IXMA 3WAQA 4J7YA 3VAYA 2YKZA 3DWWA 1A7EA 3LEOA 4PJMA 3RVYA 3VRCA 3W2WA 2ZPAA 4AE4B 5L3QA 3ECSA 3W2VA 2O9XA 3JSZA 2R02A 2WL8A 1D1BA 1AUEA 2QE9A 4JTAB 4ONSA 4BJ5A 2HMQA 1LVKA 4M63A 2NUTB 3UMKA 1YVIA 2C04A 2QLAA 4XPWA 5CI8A 1E2XA 3S9OA 3ASNC 2VASA 3Q7GA 4JCZA 4C3BA 4E17A 4O79A 2XL8A 3KYIA 1L3PA 2HMZA 2EILC 3EH2A 5A6BA 5TJ5E 4IAQA 4JTDB 2B0JA 3IHUA 1TWGA 2WZGA 1HY5A 4A4AA 4D4XA 2LP4A 2FFHA 2MWQA 2P0NA 2OEVA 3HTKC 4KNVA 4XLNF 1RXQA 1T01A 4DRIB 3A9CA 3BEHA 4BG0A 2OJED 5F5FA 2X51A 1Q0MA 3V5ZA 3DE9A 4WGZA 2GFHA 4WJ0A 3SP1A 4XEFA 2Q7RA 1QSPA 2D5RB 2AVKA 3FAJA 2IXNA 3M4CA 3QTHA 1TWHA 3SEOA 3U5SA 4DVYP 1AEPA 1VYIA 1V54C 1EI7A 2CW0F 4BPMA 1ZW3A 1JR8A 2P6VA 2OJQA 4NCQA 1D1CA 4CIHA 3X1OA 1OKKD 4O6NA 3J06A 1LPEA 2LFDA 2RSEB 3DXJF 2XLMA 3QVYA 2CNWD 2IXPA 3ZTZA 1O3UA 3JSEO 3VYWA 2A0BA 2R7UA 2NUPA 3T6GB 5DLJA 3DKAA 1PCXA 2XLEA 5T3WA 2Q9BA 2VB6A 1M56C 4L6RA 2WVNA 4P9FA 5DQZA 4C7OB 3LESA 3C8ZA 3EGDB 1T9KA 3MX3A 4PFOA 4EWCA 1Z5ZA 2AWCA 1NG1A 2KSFA 2NSFA 2WVOA 2QTVA 1IZMA 3B71A 2R7OA 3K66A 4QI0A 1NZEA 3EGXB 3S29A 4RBNA 1E84A 2H7OA 3EFOA 1XWJA 3FOPA 3N2ZB 3QVZA 4NTFA 3SXMA 3RQFA 1NU7D 1MNDA 1Q0DA 3MBGA 3OA1A 3H2UA 4G7HF 1D0YA 1ZHWA 2DI3A 1K04A 1FFHA 1N1CA 2LSEA 2XSEA 2YLIA 4Q7CA 1BR1A 3EJNA 5CI9A 3RW0A 1QZXA 1V55C 1NBBA 5CIVA 3S90A 1HE1A 5JLIA 3S27A 3CAXA 1Z7Qc 4Q4ZF 4AK9A 4E18A 1WTYA 3JYHA 1SF8A 2XXAB 4MW3A 3ZSUA 1F1MA 2W4BA 3GM3A 3NKDA 3ABKC 3JRTA 3E9VA 3N0TA 1GQAA 3O39A 3V5XA 3H2VA 2FGYA 3NMIA 3U9JA 1HMOA 2JX0A 4C3EA 1E86A 1OKKA 4K0DA 3DE8A 2WB7A 2YLGA 2CNWA 2J0WA 1H6GA 4KNWA 1U6HA 4MVMA 4YL3A 2R25A 3GEEA 1LE2A 4JTCB 2EPLX 2R03A 1ZU5A 2ICWG 1C03A 2HS5A 2M64A 2PBEA 1MMDA 2Q9CA 2Y3HA 3AOUA 3PMRA 5L0DA 2H7BA 4IGGA 4U9EA 5E2QA 4Z9HA 1YYXA 4LDKA 1NSGB 5IY5C 4FESA 1M2VA 1QVXA 1R5ID 4CS8C 4N6HA 4F4BA 4U5BE 1ORSC 2WZLA 5DVWA 2EPKX 3RF3A 3RFYA 4GQHA 4UDVA 4J30B 4H4KC 2LK4A 3EHNA 2G3KA 4CX9A 3AGUA 3KH2A 1CGNA 2IM8A 1ZHTA 2HSQA 1GS9A 3K33A 2J7PD 4RDAA 5JP7A 3U3BA 1D1AA 1SMYF 1Z6AA 1BR2A 2YWAA 4MTOA 5A69A 2QUPA 1U89A 3M1CB 5D91A 2J9BA 3K1HA 3RQGA 4IAOA 5FZTA 1G4WR 4OD5A 1YLMA 3ITFA 4WABA 1YA9A 3L0IA 1LS4A 1UG7A 1TWCA 2YL1A 2HV7A 2Y3DA 5HSWA 4Q5SF 4ULWA 1FMWA 3U8VA 4DOZA 2F22A 1VMAA 1C02A 256BA 2W9YA 2R7QA 2JD3A 3JT1A 4B6IA 1H9TA 2V3CC 3U2MA 3S0XA 2XS1A 3GWNA 4JKVA 2LCHA 2CYDA 3NYLA 3T6BA 2FAPB 4JVSA 5DS6A 5COGA 4MVQA 2NUPB 4XPYA 1OW7A 3L1MA 1LS1A 5F28E 3B0PA 1RJ9A 3A11A 3LS0A 4NTBA 3TD7A 1LKXA 2G3VA 3TJ6A 1YDIA 2ZXRA 5A6JA 2YL7A 4IJJA 4PACA 2J7PA 5T1DB 3V5YA 4N4WA 1PD0A 2PF4E 3SNHA 3EFOB 1O5HA 3EZIA 4CDYA 3W8IA 4EKWA 1LI5A 4CSAA 1JRAA 1OW8A 3GORA 4H54A 4MTFA 4KC9A 3EQLF 3F47A 1T6QA 2H7VC 3GM2A 2UUHA 3RH3A 5K0IA 4KI2A 3M4BA 4MVRA 2W45A 2EIJC 2EPMX 1G4US 3IQTA 2E87A 4BJ1A 3IEEA 2OG2A 3JYYA 2RD9A 1QLEC 4CBEA 3G4XA 1A7VA 2WVQA 3NMJA 4MVOA 1Z63A 3FHDA 2PFDA 3POVA 3KMIA 3RIPA 2LQGA 1QQ3A 1ZHXA 4CJOA 1NLXA 2L6GA 3O55A 4JW1A 2HJ3A 3QW0A 5AC5A 1Q0GA 2Y39A 1ZHYA 4JE9A 3B0VC 4OIPF 1OR3A 2V26A 3G4ZA 3IPMO 2ASRA 4I1OB 3S28A 1J8YF 4U5HA 2HZ8A 2J8WA 3ABMC 1D0XA 1ZYRF 5GPGB 3WG7C 1FNTc 2MYSA 3C7JA 3CEXA 1M2VB 1S7ZA 4N6CA 4AX2A 4J7TA 3N24A 5JRAA 1V74B 4BJTA 4C3DA 5T3TA 5L0GA 4GEHA 4WGYA 3NKEA 1VTMP 1PV3A 1XZPA 3AQBA 4MVUA 4AL0A 4OIOF 3LEVA 1KU2A 2L7AA 1YAUO 1J8MF 2VCAA 3KKBA 3L8JA 4HEAJ 1I5NA 3O6XA 5COFA 2DGJA 5KYUA 1GM5A 3MYFA 5L3VA 2HJMA 5JS5A 5JT4A 2Y3GA 3FMSA 3GODA 2KC3A 1M57C 4FX5A 4J32B 1OCOC 1OR2A 4AL1A 3C18A 3ZC4A 2EPNA 2YL3A 4IB4A 2R7WA 4PJJA 2XLDA 2L81A 3BRJA 3ZQVA 1I4YA 4XEKA 2J0XA 2P7VA 1WWPA 3TULA 4NTAA 4MW8A
chains in the Genus database with same CATH topology
3IQTA 1YVIA 2LD6A 1C02A 1TQGA 3KYJA 3US6A 2LCHA 3KYIA 1WN0A 1OXBA 2Q4FA 2A0BA 1I5NA 4EUKB 3MYFA 3U3BA 1FR0A 2LP4A 1Y6DA 2OOCA 2R25A 4PACA 1BDJB 1C03A 1QSPA 1A0BA 1OXKA 4G78A 1SR2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IQT A;  1YVI A;  2LD6 A;  1C02 A;  1TQG A;  3KYJ A;  3US6 A;  2LCH A;  3KYI A;  1WN0 A;  1OXB A;  2Q4F A;  2A0B A;  1I5N A;  4EUK B;  3MYF A;  3U3B A;  1FR0 A;  2LP4 A;  1Y6D A;  2OOC A;  2R25 A;  4PAC A;  1BDJ B;  1C03 A;  1QSP A;  1A0B A;  1OXK A;  4G78 A;  1SR2 A; 
#chains in the Genus database with same CATH topology
 1D0Z A;  1Z23 A;  2EPO A;  3B29 A;  3NYM A;  4O6M A;  4P6I C;  3RYL A;  4ER9 A;  5L0H A;  4HE8 D;  3KYJ A;  1RKE A;  2OQM A;  1LI7 A;  2LFF A;  2ZXW C;  4LAC B;  5BQI A;  4N06 A;  1OXB A;  5D92 A;  4DVZ A;  4YT4 A;  4K7B A;  5COM A;  1ZW2 A;  2ZXP A;  3AGT A;  3I5P A;  1EA8 A;  1MMN A;  1RJ9 B;  4I44 A;  1VOM A;  2M4E A;  2AU5 A;  2P61 A;  1OCR C;  5B1B C;  2R7X A;  4DRH B;  2NSG A;  1Z3I X;  2OOC A;  2HV6 A;  3C62 A;  5DQT A;  4YL0 A;  4OIR F;  3O10 A;  4CJG A;  1YA7 O;  2YHS A;  3L8I A;  2PX0 A;  3OEO A;  2ZXO A;  5EGY A;  1FTS A;  1XZQ A;  2KW3 C;  2R7T A;  1M2O A;  5DS4 A;  1E85 A;  3VF0 A;  3PDM P;  4HFF B;  1BZ4 A;  4CDA A;  4IRU A;  2R9R B;  2A6E F;  1OQC A;  1VK5 A;  1H7I A;  2W4M A;  1JPN A;  1U0B B;  1TQG A;  4MQ9 F;  2JPU A;  2VH3 A;  3PCV A;  1CPR A;  3SXZ A;  2UUI A;  3C63 A;  3DD7 A;  1FMV A;  3FVY A;  4I1M A;  3ZG1 A;  1JPJ A;  3RKO F;  2DYS C;  2OCC C;  1DOV A;  1CGO A;  3MFN A;  1MMA A;  5KYW A;  4LLE A;  3LNM B;  2DB4 A;  3W8H A;  3LUT B;  5KYN A;  2PX3 A;  3MYI A;  5JSL A;  4ZLD A;  4I3M A;  2QNL A;  3WOD F;  1LIH A;  1T6I A;  5AGF A;  1W2W A;  1TR2 A;  3EG9 A;  4PJN A;  4U5E E;  1BDJ B;  4EBK A;  5BQH A;  3TK0 A;  1ZZP A;  1JMW A;  2KK1 A;  1YAR O;  2R05 A;  4U5D E;  4XEV A;  2J45 A;  3UNG C;  2KGO A;  5B1A C;  1EKY A;  2G62 A;  1S05 A;  1NFN A;  3U2L A;  2X0C A;  4G0H A;  3G50 A;  4CS8 A;  2GWW A;  3AG4 C;  3K6B A;  2GAQ A;  4PK4 A;  2HUJ A;  4BJ6 C;  3R2P A;  3GAN A;  2R7R A;  1M6T A;  1SYQ A;  1A7D A;  3DZA A;  1NFO A;  1CPQ A;  1K40 A;  2L6H A;  3QZC A;  1TFK B;  2HKV A;  4MND A;  4OIN F;  3T4R A;  1SZI A;  3LJB A;  4A2N B;  1ORY A;  1ZVZ A;  4MTG A;  3KPH A;  2YVK A;  4JUR I;  3V7O A;  5B3I A;  2YQY A;  5KYU B;  3FOO A;  2YRF A;  2KNH A;  2XRH A;  1VYK A;  1FR0 A;  3SXY A;  3C8G D;  4DXW A;  4BEJ A;  2J9U A;  2YZS A;  1G8X A;  3JTL O;  4EHP A;  1HW2 A;  4YT8 A;  3PHF 2;  3TOM A;  4YWQ A;  1JOG A;  2IBF A;  3DM9 B;  1O87 A;  3IQC A;  2A68 F;  3SYN A;  4CDV A;  2Y69 C;  5E33 A;  1ST6 A;  4HFK B;  1RMV A;  5JUA A;  4G7O F;  4CS7 A;  4FAP B;  4E7Z A;  3MLG A;  1SR2 A;  1WOL A;  2TMV P;  1B68 A;  4QI2 A;  2XM4 A;  1RKE B;  2IXO A;  1JAF A;  3SZR A;  4LER A;  2XXA A;  3US6 A;  3GEH A;  3LLI A;  1BR4 A;  3B0U X;  3GEI A;  2CCY A;  2KQ9 A;  3DAG A;  5HV9 A;  1I4Z A;  3W4Y A;  1VLS A;  4EUK B;  2AWY A;  3UMH A;  5KYX A;  3FDQ A;  2VCC A;  3F46 A;  2GA0 A;  3LNR A;  4P9T A;  1OW6 A;  1PD1 A;  1Q0F A;  2R7S A;  3B9Q A;  3C8G A;  3KL4 A;  2HSB A;  4YL1 A;  4U5G A;  4CS9 C;  5L0I A;  3HNJ A;  1QKR A;  3L34 A;  1NU9 C;  2A1D D;  3U3F A;  2ETS A;  2BC5 A;  4JCH A;  4XQ1 A;  2KJG A;  4G78 A;  1G5Z A;  2ZD9 A;  4JC7 A;  4O7G A;  2NPU A;  5L0C A;  1WAT A;  3JCU Q;  1YZC A;  3GM1 A;  1R4T A;  1TFO B;  2I8B A;  3X2Q C;  5KYW B;  5KYY A;  4Z9I A;  4JJF A;  4K1O A;  3U0C A;  4O6Y A;  4U5C E;  1WGW A;  2IYL D;  2VCB A;  2XL4 A;  3DI5 A;  1Y6D A;  3K1I C;  1HMD A;  2Z15 A;  5E3A A;  1H9G A;  2YEV A;  3EG9 B;  3LAY A;  3NMK A;  4W8P A;  4YJW A;  3ZIB A;  3ZQY A;  4CS9 A;  1APC A;  2C03 A;  3FXH A;  4QDL A;  5A6A A;  2D4U A;  3ZVR A;  4OD4 A;  3M15 A;  3VM6 A;  4YK5 A;  1OXK A;  2A6H F;  1E83 A;  1QPU A;  2XL6 A;  4W8K A;  4PR9 A;  2GDC A;  2CDQ A;  3UR3 C;  4OIQ F;  2OKU A;  5F5H A;  3AQC A;  3NYJ A;  3RVZ A;  2B0H A;  3I4U A;  3H65 A;  4DRJ B;  2XLH A;  1CGM E;  2XM0 A;  1MNE A;  3AJM A;  4KBL A;  5L0F A;  1K05 A;  2OU6 A;  1V4A A;  1LE4 A;  3AG1 C;  3DJU B;  2J46 A;  3I5Q A;  4JIO A;  1Q0K A;  3Q6M A;  1T5O A;  2BL2 A;  2OEX A;  3K1I A;  4DBQ A;  1BBH A;  1OCC C;  1Y4C A;  2EIN C;  3HLZ A;  1OCZ C;  2PNO A;  1WAS A;  2AP3 A;  3AG3 C;  3EHM A;  2Q9A A;  4LLC A;  4XPX A;  3T6J A;  4D4N A;  3CQZ A;  2WZF A;  3ABL C;  4PFP A;  5BQG A;  2Y3B A;  4G7Z F;  4ULV A;  3Q7L A;  5E3C A;  4E0H A;  4U5F E;  2A69 F;  1YYJ A;  3TJ5 A;  3EPV A;  4JZA A;  4AE4 A;  4XLP F;  3WHN A;  3UGP A;  1HE9 A;  4EBJ A;  4YT5 A;  1ZU4 A;  1ORJ A;  4LDR A;  5AC4 A;  5B3S C;  4DBR A;  1UFB A;  3UGO A;  3ASO C;  2KYH A;  2LD6 A;  2NUT A;  1TWA A;  2VC9 A;  3ZTM A;  4PJL A;  1YZA A;  1GGQ A;  4MVZ A;  3S84 A;  2YL0 A;  3LS1 A;  4NQF A;  3ZWI A;  5BUO A;  2L9J A;  2HFI A;  2LIG A;  2J9W A;  3CZ6 A;  3OWT A;  4JEA A;  3SXK A;  4JEB A;  1KTM A;  1HW1 A;  5KYX B;  1TKN A;  1RKC A;  3R7C A;  4YT2 A;  2CGE A;  5EHH A;  4JJG A;  4MVS A;  1EQ1 A;  1YJG A;  3C8G B;  3JZ0 A;  2DYR C;  3U9M A;  3E70 C;  3GWL A;  3HKK A;  2H8A A;  4ANJ A;  2YLD A;  1IW7 F;  4FWV A;  5DS5 A;  4IAR A;  3M79 A;  2NG1 A;  3DM5 A;  4MS2 A;  3Q6N A;  4EIY A;  3QW1 A;  4RD9 A;  3DAF A;  4DJ9 A;  2XLO A;  2MHR A;  3NDB B;  3FAP B;  2XLW A;  1RCP A;  3K7D A;  4Z9J A;  4IWB A;  1WN0 A;  1FAP B;  1DOW A;  2Q3T A;  1VLT A;  2Q4F A;  3JRM O;  5KYY B;  2R7V A;  2XLV A;  1LM3 B;  4R32 A;  1AVO B;  4CIP A;  3HJC A;  4EBB A;  3HNI A;  3NRH A;  2QY9 A;  1ZHZ A;  4LDQ A;  4NC3 A;  3ZDL A;  4C7O A;  4E7S A;  1VB5 A;  2J9V A;  3EGD A;  3IQ5 A;  4XWJ A;  2XS8 A;  4BEM J;  5L0J A;  3EGX A;  3U8P A;  3ATP A;  3TQO A;  4ZLC A;  5A6K A;  3HNL A;  5FCL A;  1KNY A;  1A0B A;  2EIM C;  4NY3 A;  4XTK A;  4BJ6 A;  5JVE A;  1FFT C;  3UMI A;  4CSA C;  3AG2 C;  3RQE A;  3QMK A;  3CSK A;  2EIK C;  4JRZ A;  2BE5 F;  4BJ5 C;  3DMD A;  5A6B D;  3LLK A;  2Q00 A;  2L6F A;  4GYT A;  1T6U A;  5EK0 A;  4X0R A;  3T9O A;  3TOL A;  1MQV A;  3HNK A;  3NG1 A;  1A41 A;  1C17 M;  1MMG A;  2PP4 A;  3DJN B;  4U9D A;  3EZH A;  4E0I A;  1L7C A;  2I15 A;  2A0U A;  3EH1 A;  3IQ6 A;  2IOQ A;  4YN0 B;  2P1A A;  2IXM A;  3WAQ A;  4J7Y A;  3VAY A;  2YKZ A;  3DWW A;  1A7E A;  3LEO A;  4PJM A;  3RVY A;  3VRC A;  3W2W A;  2ZPA A;  4AE4 B;  5L3Q A;  3ECS A;  3W2V A;  2O9X A;  3JSZ A;  2R02 A;  2WL8 A;  1D1B A;  1AUE A;  2QE9 A;  4JTA B;  4ONS A;  4BJ5 A;  2HMQ A;  1LVK A;  4M63 A;  2NUT B;  3UMK A;  1YVI A;  2C04 A;  2QLA A;  4XPW A;  5CI8 A;  1E2X A;  3S9O A;  3ASN C;  2VAS A;  3Q7G A;  4JCZ A;  4C3B A;  4E17 A;  4O79 A;  2XL8 A;  3KYI A;  1L3P A;  2HMZ A;  2EIL C;  3EH2 A;  5A6B A;  5TJ5 E;  4IAQ A;  4JTD B;  2B0J A;  3IHU A;  1TWG A;  2WZG A;  1HY5 A;  4A4A A;  4D4X A;  2LP4 A;  2FFH A;  2MWQ A;  2P0N A;  2OEV A;  3HTK C;  4KNV A;  4XLN F;  1RXQ A;  1T01 A;  4DRI B;  3A9C A;  3BEH A;  4BG0 A;  2OJE D;  5F5F A;  2X51 A;  1Q0M A;  3V5Z A;  3DE9 A;  4WGZ A;  2GFH A;  4WJ0 A;  3SP1 A;  4XEF A;  2Q7R A;  1QSP A;  2D5R B;  2AVK A;  3FAJ A;  2IXN A;  3M4C A;  3QTH A;  1TWH A;  3SEO A;  3U5S A;  4DVY P;  1AEP A;  1VYI A;  1V54 C;  1EI7 A;  2CW0 F;  4BPM A;  1ZW3 A;  1JR8 A;  2P6V A;  2OJQ A;  4NCQ A;  1D1C A;  4CIH A;  3X1O A;  1OKK D;  4O6N A;  3J06 A;  1LPE A;  2LFD A;  2RSE B;  3DXJ F;  2XLM A;  3QVY A;  2CNW D;  2IXP A;  3ZTZ A;  1O3U A;  3JSE O;  3VYW A;  2A0B A;  2R7U A;  2NUP A;  3T6G B;  5DLJ A;  3DKA A;  1PCX A;  2XLE A;  5T3W A;  2Q9B A;  2VB6 A;  1M56 C;  4L6R A;  2WVN A;  4P9F A;  5DQZ A;  4C7O B;  3LES A;  3C8Z A;  3EGD B;  1T9K A;  3MX3 A;  4PFO A;  4EWC A;  1Z5Z A;  2AWC A;  1NG1 A;  2KSF A;  2NSF A;  2WVO A;  2QTV A;  1IZM A;  3B71 A;  2R7O A;  3K66 A;  4QI0 A;  1NZE A;  3EGX B;  3S29 A;  4RBN A;  1E84 A;  2H7O A;  3EFO A;  1XWJ A;  3FOP A;  3N2Z B;  3QVZ A;  4NTF A;  3SXM A;  3RQF A;  1NU7 D;  1MND A;  1Q0D A;  3MBG A;  3OA1 A;  3H2U A;  4G7H F;  1D0Y A;  1ZHW A;  2DI3 A;  1K04 A;  1FFH A;  1N1C A;  2LSE A;  2XSE A;  2YLI A;  4Q7C A;  1BR1 A;  3EJN A;  5CI9 A;  3RW0 A;  1QZX A;  1V55 C;  1NBB A;  5CIV A;  3S90 A;  1HE1 A;  5JLI A;  3S27 A;  3CAX A;  1Z7Q c;  4Q4Z F;  4AK9 A;  4E18 A;  1WTY A;  3JYH A;  1SF8 A;  2XXA B;  4MW3 A;  3ZSU A;  1F1M A;  2W4B A;  3GM3 A;  3NKD A;  3ABK C;  3JRT A;  3E9V A;  3N0T A;  1GQA A;  3O39 A;  3V5X A;  3H2V A;  2FGY A;  3NMI A;  3U9J A;  1HMO A;  2JX0 A;  4C3E A;  1E86 A;  1OKK A;  4K0D A;  3DE8 A;  2WB7 A;  2YLG A;  2CNW A;  2J0W A;  1H6G A;  4KNW A;  1U6H A;  4MVM A;  4YL3 A;  2R25 A;  3GEE A;  1LE2 A;  4JTC B;  2EPL X;  2R03 A;  1ZU5 A;  2ICW G;  1C03 A;  2HS5 A;  2M64 A;  2PBE A;  1MMD A;  2Q9C A;  2Y3H A;  3AOU A;  3PMR A;  5L0D A;  2H7B A;  4IGG A;  4U9E A;  5E2Q A;  4Z9H A;  1YYX A;  4LDK A;  1NSG B;  5IY5 C;  4FES A;  1M2V A;  1QVX A;  1R5I D;  4CS8 C;  4N6H A;  4F4B A;  4U5B E;  1ORS C;  2WZL A;  5DVW A;  2EPK X;  3RF3 A;  3RFY A;  4GQH A;  4UDV A;  4J30 B;  4H4K C;  2LK4 A;  3EHN A;  2G3K A;  4CX9 A;  3AGU A;  3KH2 A;  1CGN A;  2IM8 A;  1ZHT A;  2HSQ A;  1GS9 A;  3K33 A;  2J7P D;  4RDA A;  5JP7 A;  3U3B A;  1D1A A;  1SMY F;  1Z6A A;  1BR2 A;  2YWA A;  4MTO A;  5A69 A;  2QUP A;  1U89 A;  3M1C B;  5D91 A;  2J9B A;  3K1H A;  3RQG A;  4IAO A;  5FZT A;  1G4W R;  4OD5 A;  1YLM A;  3ITF A;  4WAB A;  1YA9 A;  3L0I A;  1LS4 A;  1UG7 A;  1TWC A;  2YL1 A;  2HV7 A;  2Y3D A;  5HSW A;  4Q5S F;  4ULW A;  1FMW A;  3U8V A;  4DOZ A;  2F22 A;  1VMA A;  1C02 A;  256B A;  2W9Y A;  2R7Q A;  2JD3 A;  3JT1 A;  4B6I A;  1H9T A;  2V3C C;  3U2M A;  3S0X A;  2XS1 A;  3GWN A;  4JKV A;  2LCH A;  2CYD A;  3NYL A;  3T6B A;  2FAP B;  4JVS A;  5DS6 A;  5COG A;  4MVQ A;  2NUP B;  4XPY A;  1OW7 A;  3L1M A;  1LS1 A;  5F28 E;  3B0P A;  1RJ9 A;  3A11 A;  3LS0 A;  4NTB A;  3TD7 A;  1LKX A;  2G3V A;  3TJ6 A;  1YDI A;  2ZXR A;  5A6J A;  2YL7 A;  4IJJ A;  4PAC A;  2J7P A;  5T1D B;  3V5Y A;  4N4W A;  1PD0 A;  2PF4 E;  3SNH A;  3EFO B;  1O5H A;  3EZI A;  4CDY A;  3W8I A;  4EKW A;  1LI5 A;  4CSA A;  1JRA A;  1OW8 A;  3GOR A;  4H54 A;  4MTF A;  4KC9 A;  3EQL F;  3F47 A;  1T6Q A;  2H7V C;  3GM2 A;  2UUH A;  3RH3 A;  5K0I A;  4KI2 A;  3M4B A;  4MVR A;  2W45 A;  2EIJ C;  2EPM X;  1G4U S;  3IQT A;  2E87 A;  4BJ1 A;  3IEE A;  2OG2 A;  3JYY A;  2RD9 A;  1QLE C;  4CBE A;  3G4X A;  1A7V A;  2WVQ A;  3NMJ A;  4MVO A;  1Z63 A;  3FHD A;  2PFD A;  3POV A;  3KMI A;  3RIP A;  2LQG A;  1QQ3 A;  1ZHX A;  4CJO A;  1NLX A;  2L6G A;  3O55 A;  4JW1 A;  2HJ3 A;  3QW0 A;  5AC5 A;  1Q0G A;  2Y39 A;  1ZHY A;  4JE9 A;  3B0V C;  4OIP F;  1OR3 A;  2V26 A;  3G4Z A;  3IPM O;  2ASR A;  4I1O B;  3S28 A;  1J8Y F;  4U5H A;  2HZ8 A;  2J8W A;  3ABM C;  1D0X A;  1ZYR F;  5GPG B;  3WG7 C;  1FNT c;  2MYS A;  3C7J A;  3CEX A;  1M2V B;  1S7Z A;  4N6C A;  4AX2 A;  4J7T A;  3N24 A;  5JRA A;  1V74 B;  4BJT A;  4C3D A;  5T3T A;  5L0G A;  4GEH A;  4WGY A;  3NKE A;  1VTM P;  1PV3 A;  1XZP A;  3AQB A;  4MVU A;  4AL0 A;  4OIO F;  3LEV A;  1KU2 A;  2L7A A;  1YAU O;  1J8M F;  2VCA A;  3KKB A;  3L8J A;  4HEA J;  1I5N A;  3O6X A;  5COF A;  2DGJ A;  5KYU A;  1GM5 A;  3MYF A;  5L3V A;  2HJM A;  5JS5 A;  5JT4 A;  2Y3G A;  3FMS A;  3GOD A;  2KC3 A;  1M57 C;  4FX5 A;  4J32 B;  1OCO C;  1OR2 A;  4AL1 A;  3C18 A;  3ZC4 A;  2EPN A;  2YL3 A;  4IB4 A;  2R7W A;  4PJJ A;  2XLD A;  2L81 A;  3BRJ A;  3ZQV A;  1I4Y A;  4XEK A;  2J0X A;  2P7V A;  1WWP A;  3TUL A;  4NTA A;  4MW8 A; 
#chains in the Genus database with same CATH homology
 3IQT A;  1YVI A;  2LD6 A;  1C02 A;  1TQG A;  3KYJ A;  3US6 A;  2LCH A;  3KYI A;  1WN0 A;  1OXB A;  2Q4F A;  2A0B A;  1I5N A;  4EUK B;  3MYF A;  3U3B A;  1FR0 A;  2LP4 A;  1Y6D A;  2OOC A;  2R25 A;  4PAC A;  1BDJ B;  1C03 A;  1QSP A;  1A0B A;  1OXK A;  4G78 A;  1SR2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...