4B6IA

Crystal structure rap2b (sma2266) from serratia marcescens
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
100
structure length
100
Chain Sequence
MENSLNALSQEALYKNWLTSRCIGKSTDSERTKQDAFRSASAYLELSKLPMDAFEQGEKLAEQYANKNSQGSVQGTYHTLDCLSLQNASEAETIFERYSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords SMA2266
publication title New Secreted Toxins and Immunity Proteins Encoded within the Type Vi Secretion System Gene Cluster of Serratia Marcescens.
pubmed doi rcsb
source organism Serratia marcescens
total genus 38
structure length 100
sequence length 100
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16695 Tai4 Type VI secretion system (T6SS), amidase immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1620 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4b6iA00
4HFFB 4B6IA 4J30B 3ZIBA 4AX2A 4J32B 4HFKB 4JURI
chains in the Genus database with same CATH superfamily
3AGUA 4EBJA 5FCLA 1RKEA 3MYIA 3NYLA 1ORJA 4CS9A 2EIKC 2AU5A 2KQ9A 2XL4A 3ABMC 3IQ6A 3NMJA 1D1AA 3EH2A 3MBGA 5HSWA 3UMKA 2HJMA 5L0CA 3DAGA 4C7OB 2H7OA 3W8HA 2CCYA 2KGOA 4DJ9A 1U0BB 5DS4A 1C17M 1QVXA 2VCAA 3GEEA 3EGXB 2L9JA 3DJNB 1NZEA 1YDIA 4ULVA 1QKRA 2JX0A 3VM6A 3U3BA 1ZU5A 2QE9A 2FFHA 1M57C 2LSEA 4PJNA 3JTLO 2B0JA 3C7JA 2KK1A 3MFNA 3WHNA 3M4CA 1FAPB 3CAXA 1BR1A 4DXWA 1SYQA 3DE8A 4AE4B 3JZ0A 3NMKA 3BEHA 4EIYA 2HUJA 1OW8A 2YZSA 3FAPB 1T5OA 4KBLA 1ZYRF 1FNTc 1G4WR 2EINC 3I5QA 1Y6DA 3JSEO 2HFIA 3U0CA 1TR2A 3LAYA 1RMVA 2EIJC 2W45A 2VH3A 3ATPA 4IB4A 4J7YA 1Z5ZA 1K40A 5B3IA 1D1CA 5E2QA 4Z9HA 3FDQA 2J9UA 3GWNA 1EQ1A 4GQHA 1NG1A 1Q0DA 4NTBA 1KU2A 4FX5A 3POVA 4CS8A 4MVSA 2L6GA 4YL0A 3LS1A 3RQFA 4YT2A 4CBEA 4Z9JA 4YJWA 2R05A 4WGZA 3S27A 4JE9A 3DXJF 3IQCA 2CDQA 4IJJA 4Z9IA 5JP7A 3V5ZA 4JW1A 1J8YF 1LPEA 1A7VA 3PCVA 4I1MA 4YT4A 3US6A 2A69F 2E87A 3JRTA 4H4KC 4IRUA 3H2UA 3AJMA 2BL2A 3DWWA 1TKNA 3T4RA 5AC4A 1NFNA 4NC3A 1TWGA 5AC5A 2PFDA 256BA 3C8GA 4AK9A 2AVKA 5L0IA 2XXAA 3DD7A 4P9FA 1D0ZA 4W8KA 2J45A 4ZLCA 1MMDA 2AWYA 3LS0A 2Y3BA 1Z6AA 1WN0A 1D0YA 4I3MA 3RH3A 3N24A 3WG7C 3N0TA 3UMHA 3Q6MA 4G7OF 1VMAA 5KYUB 1OQCA 4PR9A 5T3WA 3UGOA 1R5ID 3LEOA 1NU9C 1A0BA 4IARA 2ZXPA 3DAFA 3U3FA 5L0DA 3AG2C 1SF8A 4XPXA 2OQMA 2WB7A 4JTCB 1VLSA 5JT4A 1MNEA 3Q6NA 2FAPB 5IY5C 2CNWA 1JAFA 1M2VB 3G4XA 3ZIBA 2Q7RA 2LD6A 4GEHA 4FAPB 4U5GA 2W4MA 1ZZPA 3X2QC 2EIMC 4XEKA 4NCQA 1PD0A 1O5HA 3AG3C 2DYRC 3GEIA 4IAOA 2WL8A 3A11A 2R02A 3FOPA 3ZVRA 2KC3A 1RXQA 1T01A 2YL0A 3O6XA 2ZXWC 5JSLA 2L81A 2IXMA 3C8ZA 3EGDB 5E33A 1WWPA 2FGYA 2P61A 3PHF2 3SXKA 3VRCA 4OIQF 2H7VC 3K1IA 5L0FA 2H8AA 4MVQA 1Q0FA 1NFOA 4JC7A 4U5FE 4NY3A 2RD9A 2L6FA 1S7ZA 2VCCA 3S28A 1QLEC 2AWCA 5E3AA 5KYNA 2LFDA 4EBBA 5L3VA 1HMOA 2MHRA 2OEXA 4U5HA 4NQFA 4EUKB 4XQ1A 4U5CE 5JRAA 4IWBA 2OU6A 1VOMA 1G4US 1QZXA 3QVYA 5JLIA 5KYYB 1HW2A 4HEAJ 4HE8D 5F5FA 4C7OA 2Q4FA 2XLHA 5T1DB 4L6RA 1QSPA 3S9OA 4I44A 4KNWA 1JR8A 2PP4A 2XRHA 5B3SC 1A41A 2ZD9A 3ABKC 3I5PA 4MVOA 1CGOA 2Q9AA 1HE1A 1VYKA 5DQTA 1Z63A 2OCCC 1SR2A 3FHDA 4YL3A 1ST6A 1VYIA 1Z7Qc 3O55A 2X51A 4CS8C 3V7OA 4LLCA 2XLMA 5K0IA 1OXBA 2PNOA 2A6HF 4AE4A 2R7OA 5COFA 1LKXA 2VB6A 3NKDA 3WAQA 2WVOA 1EKYA 2IBFA 1ZW2A 1NU7D 2JPUA 5D91A 3QW1A 4E18A 1ZHTA 3UR3C 2JD3A 4PJJA 3RVZA 3A9CA 3DM5A 4KC9A 3M1CB 2QY9A 4P9TA 2G62A 3QTHA 1KNYA 3RW0A 3S84A 3U9JA 3S90A 1JOGA 2VCBA 4J7TA 2Y3GA 3KKBA 3KPHA 3W8IA 3GM1A 3Q7GA 1FTSA 4OINF 3ZTZA 1LE2A 3EZIA 1B68A 2OOCA 3MYFA 1EA8A 4ZLDA 2MYSA 4E0HA 3AQCA 3LUTB 4JCHA 3T9OA 2R7VA 2QTVA 3LLKA 2XLOA 4QI2A 1OCZC 5JS5A 3MX3A 1CPQA 4AX2A 4M63A 2Y39A 2CW0F 3FVYA 2PF4E 3F46A 3HNKA 1BDJB 1OW6A 2OKUA 4NTAA 5JVEA 3S29A 1MMGA 5E3CA 1BR2A 1LM3B 1XWJA 2XM4A 1VTMP 2B0HA 2CGEA 2OEVA 3DE9A 3SEOA 3UNGC 2C03A 1FFHA 3W2VA 5COMA 2R7QA 4JURI 2ASRA 4IAQA 3U5SA 4G78A 2R7UA 3EHMA 3U9MA 3G50A 4CJGA 2XS1A 1D0XA 2D4UA 4QDLA 3GANA 4U5BE 4O6NA 1TFOB 3IQTA 5KYUA 5BUOA 3IPMO 3B9QA 3MLGA 3UGPA 1IZMA 3V5XA 2KJGA 2M4EA 1WASA 3K1IC 2HV6A 2OG2A 2HSBA 2Z15A 3JSZA 4XPYA 4Q5SF 3ZWIA 2P6VA 4OD5A 2J7PA 1U6HA 1HMDA 3H2VA 3EHNA 2LIGA 3HNLA 3JYYA 3KYIA 2VC9A 2Y3HA 4MS2A 5AGFA 1K05A 1I5NA 5TJ5E 4CX9A 5A6BA 1M2VA 2NUTA 1FFTC 1NSGB 1ZHXA 5EGYA 1M6TA 3LESA 3TOLA 2W4BA 1EI7A 1TQGA 2HKVA 4JTAB 2G3VA 1BBHA 3SYNA 3ABLC 1MMAA 1TFKB 2I15A 1OCCC 3R7CA 1NBBA 3U8PA 5A6AA 3W2WA 1HE9A 4CSAA 1JRAA 2UUHA 4K0DA 2M64A 4DRIB 3KYJA 3AQBA 4MQ9F 3ITFA 3LLIA 5L3QA 1ZVZA 2YHSA 4LERA 2J0XA 3ZDLA 3HLZA 1T6QA 4CDYA 3EJNA 3QW0A 1I4ZA 1RKCA 1RJ9B 2XLDA 3L1MA 4PFOA 1Y4CA 1V55C 5KYYA 3RYLA 4BEMJ 4EBKA 3CQZA 1W2WA 4XEFA 4DVZA 4DOZA 2YRFA 3NMIA 4U5DE 2Y3DA 1ZHYA 3L8IA 4K1OA 1OCOC 2A68F 3WODF 1CPRA 3H65A 1V4AA 4YT5A 1ORYA 1C03A 3RF3A 4CS9C 3CSKA 3FMSA 2QNLA 3M15A 2Q9CA 3GM2A 3TK0A 4DRHB 2VASA 2YL7A 2V3CC 1LI7A 2Q3TA 4JEAA 4FWVA 1D1BA 1VB5A 2UUIA 3E70C 1RCPA 4E17A 4WABA 3Q7LA 1OKKA 1WATA 2R7TA 1H9GA 2PX3A 1H9TA 3SZRA 4C3DA 5T3TA 5KYWB 4E7ZA 1PD1A 2GWWA 3NDBB 1OCRC 4PACA 4MVRA 4FESA 3KMIA 1K04A 1GS9A 1AVOB 1E83A 4JTDB 4U5EE 2D5RB 2J9BA 4BJTA 3OA1A 3TD7A 4JKVA 4N6CA 3NKEA 3ZTMA 2OJQA 4ONSA 4N06A 2IXOA 2NUPB 3HJCA 1UG7A 1FMWA 3HNIA 5BQIA 3EG9B 1V54C 4DBRA 5L0GA 5A6BD 1TWCA 3C63A 4YN0B 1CGME 1DOWA 3T6GB 2HV7A 1O3UA 2HS5A 3K33A 2LP4A 3N2ZB 2CYDA 2HMZA 2Q00A 3EGXA 3T6JA 3EPVA 3B29A 3AOUA 4XLPF 3L34A 4U9DA 4OIPF 1YYXA 2XXAB 2L7AA 3LEVA 4LDRA 3K1HA 4BG0A 5DS5A 2YL1A 3NYMA 4X0RA 3ZC4A 1Q0KA 1M56C 3RQGA 2EPLX 4J32B 4JEBA 3FAJA 1N1CA 2IYLD 3C8GD 1YARO 2PX0A 2R7SA 1U89A 3M79A 1APCA 4BJ6A 4XTKA 2YLGA 1AEPA 1TWHA 2HSQA 2OJED 5F5HA 4GYTA 2R7WA 4YL1A 2WZGA 4B6IA 1E85A 3CEXA 2WVQA 5A6JA 2EPMX 1LS4A 2KYHA 3TOMA 4MW8A 4CJOA 4RBNA 3HTKC 4CIHA 3ECSA 3QZCA 4BJ5A 1O87A 2J9WA 4F4BA 2CNWD 1H7IA 3EQLF 5DLJA 1JPNA 4MVZA 3C62A 4MW3A 3GM3A 3O39A 4JZAA 2LK4A 2NSGA 2A1DD 2Y69C 5DS6A 3BRJA 1OKKD 5BQGA 3CZ6A 1CGNA 2W9YA 3LNRA 1QQ3A 4ULWA 1MNDA 1Q0GA 2LQGA 2Q9BA 4MVUA 3V5YA 1LS1A 2KW3C 2YKZA 2EPNA 1PCXA 4BEJA 4O79A 4IGGA 3EFOB 4BJ1A 3PDMP 1YZCA 1LE4A 1PV3A 1LIHA 2J46A 2QLAA 4E7SA 5B1AC 3OWTA 1LI5A 4EHPA 3SP1A 2IXPA 1SZIA 3HKKA 1YAUO 3JRMO 4PJLA 1OR3A 3ZSUA 1YA7O 3AG4C 3E9VA 2LCHA 5D92A 4JJGA 3DJUB 2EPKX 5KYXB 2NG1A 3EH1A 4J30B 1RJ9A 1S05A 2WZFA 3EZHA 3S0XA 3DKAA 2KSFA 4DRJB 4YWQA 4AL1A 2YL3A 2TMVP 1T6UA 2YVKA 4K7BA 2R7RA 2C04A 3RFYA 4CDVA 3U2LA 3PMRA 2XS8A 3KL4A 3K66A 1ZU4A 2XLWA 1R4TA 3B0VC 3B0UX 4U9EA 2A0BA 2NPUA 3JT1A 4MVMA 4W8PA 4LDKA 4WJ0A 1MMNA 4MNDA 1BR4A 2R03A 3U2MA 4BPMA 5CIVA 1VK5A 3DM9B 1KTMA 3SXZA 4N6HA 1RKEB 3O10A 1JMWA 2GAQA 3QMKA 1T6IA 4PK4A 5DQZA 4G0HA 4O7GA 2NSFA 4D4XA 1J8MF 2WVNA 2DYSC 1XZPA 2J9VA 4XWJA 2YEVA 3VF0A 2ICWG 2XSEA 2MWQA 3EGDA 4KI2A 4H54A 1E86A 5DVWA 1L7CA 4A2NB 5KYWA 4LDQA 3TULA 1FMVA 5L0HA 5F28E 4OD4A 4HFKB 2P7VA 1L3PA 4MTOA 5L0JA 2A6EF 4DBQA 3M4BA 3L0IA 5B1BC 3VAYA 4YT8A 4BJ6C 2R7XA 3B71A 2NUPA 4Q4ZF 2QUPA 2XM0A 4LACB 5BQHA 3IHUA 5CI8A 1ZW3A 3EG9A 2XL8A 4JJFA 3FXHA 4PJMA 4E0IA 2AP3A 2DI3A 3LJBA 2DGJA 3TJ5A 1AUEA 2G3KA 2XLVA 1WGWA 4JCZA 3NG1A 1XZQA 1MQVA 3DI5A 2P0NA 4RD9A 4CS7A 2YWAA 1YJGA 3UMIA 1H6GA 3RVYA 4BJ5C 2HZ8A 2J0WA 3L8JA 3LNMB 1NLXA 3K7DA 1TWAA 2IXNA 1JPJA 1ZHWA 4XPWA 5FZTA 2XLEA 1IW7F 3JCUQ 2IM8A 1V74B 4XLNF 4N4WA 1M2OA 4ANJA 1ZHZA 1WTYA 2DB4A 3F47A 3X1OA 2ZPAA 4AL0A 4O6MA 4D4NA 1GM5A 2BC5A 2RSEB 2LFFA 3R2PA 4QI0A 4C3BA 4CDAA 4CIPA 1Z3IX 3HNJA 4JRZA 4EKWA 4WGYA 4LLEA 4O6YA 4C3EA 1YVIA 3J06A 2HMQA 3I4UA 4DVYP 2YQYA 2R25A 2P1AA 2NUTB 5JUAA 1I4YA 2EILC 1F1MA 2J7PD 1Q0MA 1G5ZA 2GFHA 3AGTA 1Z23A 3DZAA 2L6HA 3G4ZA 4MTFA 3ZQYA 2A0UA 5A69A 1E84A 2R9RB 5A6KA 3TJ6A 2XL6A 2WZLA 2J8WA 1QPUA 1LVKA 2O9XA 4KNVA 3GEHA 4OIRF 5HV9A 2GDCA 2KNHA 1C02A 2HJ3A 2YLDA 3C8GB 3GORA 3K6BA 4XEVA 1OXKA 3NYJA 3U8VA 3W4YA 1E2XA 3ZQVA 4OIOF 1FR0A 1A7DA 1A7EA 1BZ4A 2X0CA 4A4AA 4G7HF 3ASOC 1YYJA 4R32A 3DMDA 4P6IC 4Q7CA 2IOQA 3B0PA 1GGQA 1OR2A 4JVSA 1T9KA 2BE5F 3C18A 5COGA 5GPGB 4ER9A 3TQOA 1GQAA 3EFOA 3SXYA 1HW1A 4RDAA 2V26A 4JIOA 5CI9A 3RKOF 3IEEA 1ORSC 4NTFA 3RQEA 3GWLA 3FOOA 3JYHA 3KH2A 1OW7A 4G7ZF 3GODA 4PFPA 2EPOA 5EK0A 1HY5A 3ASNC 2GA0A 5EHHA 5KYXA 3IQ5A 1UFBA 2F22A 4HFFB 1VLTA 3SXMA 4CSAC 1YA9A 1WOLA 2YLIA 4MTGA 3AG1C 2PBEA 4EWCA 3SNHA 1DOVA 3OEOA 3RIPA 1YZAA 2ZXOA 3ZG1A 1YLMA 2I8BA 3VYWA 3NRHA 3QVZA 4YK5A 4UDVA 2H7BA 2ETSA 4I1OB 3T6BA 2ZXRA 1G8XA 1SMYF
chains in the Genus database with same CATH topology
5FCLA 3NYLA 4CS9A 2EIKC 2KQ9A 2XL4A 3ABMC 1D1AA 3EH2A 5HSWA 3UMKA 3DAGA 4C7OB 2H7OA 3W8HA 2KGOA 5DS4A 3EGXB 2L9JA 3DJNB 1NZEA 1ZU5A 2FFHA 1M57C 2LSEA 4PJNA 2B0JA 1BR1A 4AE4B 2YZSA 4KBLA 1ZYRF 2EINC 3I5QA 1TR2A 3LAYA 2EIJC 2W45A 2VH3A 1Z5ZA 1D1CA 5E2QA 3FDQA 2J9UA 1NG1A 1KU2A 4FX5A 3POVA 4CS8A 3LS1A 4YT2A 4CBEA 4YJWA 3S27A 3DXJF 4IJJA 2CDQA 4JW1A 1J8YF 4I1MA 4YT4A 2A69F 2E87A 3JRTA 4H4KC 4IRUA 1TKNA 3T4RA 1TWGA 2PFDA 4AK9A 2XXAA 3DD7A 4ZLCA 1D0ZA 4W8KA 2J45A 1MMDA 3LS0A 2Y3BA 1Z6AA 4I3MA 1D0YA 3WG7C 3RH3A 3N24A 3N0TA 3UMHA 3Q6MA 4G7OF 1VMAA 5KYUB 3UGOA 5T3WA 1NU9C 2ZXPA 3DAFA 3AG2C 1SF8A 2WB7A 1MNEA 3Q6NA 5IY5C 2CNWA 1M2VB 3ZIBA 4GEHA 4U5GA 2W4MA 3X2QC 2EIMC 1PD0A 1O5HA 3AG3C 2DYRC 4BEJA 4IAOA 2WL8A 4ZLDA 3ZVRA 3O6XA 2ZXWC 2L81A 2IXMA 3EGDB 5E33A 2FGYA 3PHF2 4OIQF 2H7VC 4U5FE 4NY3A 1S7ZA 3S28A 1QLEC 5E3AA 5KYNA 4EBBA 5L3VA 4U5HA 4U5CE 4IWBA 1VOMA 5KYYB 1QZXA 4HEAJ 4HE8D 4C7OA 5T1DB 4I44A 4KNWA 2PP4A 2XRHA 5B3SC 3ABKC 3I5PA 2Q9AA 1VYKA 5DQTA 2OCCC 3FHDA 1ST6A 1VYIA 2X51A 4CS8C 3V7OA 4LLCA 2A6HF 4AE4A 2R7OA 1LKXA 2VB6A 3NKDA 2WVOA 1NU7D 5D91A 1ZHTA 3UR3C 2JD3A 4PJJA 5F5FA 3DM5A 4KC9A 3M1CB 2QY9A 2G62A 2Y3GA 3KKBA 3W8IA 3Q7GA 1FTSA 4OINF 3EZIA 2MYSA 3AQCA 4JCHA 2R7VA 2QTVA 3LLKA 4QI2A 1OCZC 3MX3A 4AX2A 4M63A 2Y39A 2CW0F 3FVYA 2PF4E 3F46A 3S29A 1MMGA 5E3CA 1BR2A 2CGEA 3UNGC 3SEOA 2C03A 1FFHA 3W2VA 2R7QA 4JURI 2R7UA 3EHMA 1D0XA 4QDLA 3GANA 4U5BE 4O6NA 5KYUA 5BUOA 3B9QA 3MLGA 3UGPA 1IZMA 2KJGA 2M4EA 3K1IC 2HV6A 2OG2A 2Z15A 3JSZA 4Q5SF 2P6VA 4OD5A 2J7PA 3EHNA 2Y3HA 1M2VA 2NUTA 1FFTC 1ZHXA 5EGYA 3LESA 2W4BA 2G3VA 3SYNA 3ABLC 1MMAA 1OCCC 3W2WA 4CSAA 4K0DA 3AQBA 4MQ9F 3ITFA 3LLIA 5L3QA 2YHSA 4LERA 2J0XA 3HLZA 3EJNA 4PFOA 1RJ9B 1V55C 5KYYA 3RYLA 3CQZA 1W2WA 4DVZA 4DOZA 4U5DE 2Y3DA 1ZHYA 1OCOC 2A68F 3WODF 3H65A 4YT5A 4CS9C 3CSKA 2Q9CA 2VASA 2V3CC 2Q3TA 4FWVA 1D1BA 3E70C 3Q7LA 1OKKA 2R7TA 2PX3A 3SZRA 4C3DA 5T3TA 5KYWB 3NDBB 1PD1A 1OCRC 4FESA 3KMIA 4U5EE 2D5RB 4BJTA 3OA1A 3TD7A 3NKEA 4N06A 2IXOA 2NUPB 3HJCA 1FMWA 3EG9B 1V54C 4DBRA 1TWCA 4YN0B 2HV7A 3K33A 1Z63A 3N2ZB 3EGXA 3T6JA 3EPVA 4XLPF 3L34A 4OIPF 2XXAB 3LEVA 5DS5A 3K1HA 4BG0A 3NYMA 4X0RA 3ZC4A 1M56C 4J32B 3FAJA 1N1CA 2IYLD 2R7SA 2PX0A 4BJ6A 4XTKA 1TWHA 5F5HA 4GYTA 2R7WA 2WZGA 4B6IA 2WVQA 4RBNA 3HTKC 4CIHA 3ECSA 3QZCA 4BJ5A 1O87A 2J9WA 4F4BA 2CNWD 3EQLF 5DLJA 1JPNA 3O39A 4JZAA 2A1DD 2Y69C 1OKKD 3CZ6A 2W9YA 3LNRA 4ULWA 1MNDA 2Q9BA 1LS1A 2KW3C 1PCXA 4O79A 3EFOB 4BJ1A 2J46A 4E7SA 5B1AC 3OWTA 3SP1A 2IXPA 1SZIA 4PJLA 3ZSUA 3AG4C 3E9VA 5D92A 4JJGA 3DJUB 5KYXB 2NG1A 3EH1A 4J30B 1RJ9A 2WZFA 3EZHA 3S0XA 4YWQA 4K7BA 2R7RA 2C04A 3RFYA 3PMRA 3KL4A 3K66A 1ZU4A 3B0VC 3B0UX 3JT1A 4E7ZA 4WJ0A 1MMNA 4MNDA 1BR4A 1VK5A 3DM9B 3QMKA 4PK4A 5DQZA 4G0HA 4O7GA 5DS6A 1J8MF 2WVNA 2DYSC 4XWJA 2J9VA 2YEVA 2XSEA 2MWQA 3EGDA 4KI2A 5DVWA 4A2NB 5KYWA 1FMVA 4OD4A 4HFKB 2P7VA 2A6EF 4DBQA 3L0IA 5B1BC 3VAYA 4YT8A 4BJ6C 2R7XA 2NUPA 4Q4ZF 4LACB 5CI8A 3EG9A 4JJFA 4PJMA 3LJBA 2DGJA 2G3KA 1WGWA 3NG1A 4RD9A 4CS7A 3UMIA 4BJ5C 2J0WA 3K7DA 1TWAA 2IXNA 1JPJA 1ZHWA 1IW7F 3JCUQ 4XLNF 1M2OA 4ANJA 1ZHZA 3X1OA 3F47A 2ZPAA 4O6MA 4QI0A 4C3BA 1Z3IX 4LLEA 4O6YA 4C3EA 4DVYP 3I4UA 2NUTB 2EILC 2J7PD 2GFHA 1Z23A 3DZAA 2WZLA 1LVKA 2O9XA 4KNVA 4OIRF 2KNHA 3K6BA 4OIOF 3NYJA 4G7HF 3ASOC 3DMDA 4P6IC 4Q7CA 2IOQA 3B0PA 4JVSA 2BE5F 3EFOA 4RDAA 2V26A 5CI9A 3RKOF 3IEEA 4G7ZF 3JYHA 3KH2A 3GODA 4PFPA 3ASNC 5EHHA 5KYXA 4HFFB 4CSAC 3AG1C 4EWCA 3SNHA 3OEOA 3RIPA 2ZXOA 3ZG1A 2I8BA 3VYWA 3NRHA 2H7BA 4I1OB 3T6BA 2ZXRA 1G8XA 1SMYF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HFF B;  4B6I A;  4J30 B;  3ZIB A;  4AX2 A;  4J32 B;  4HFK B;  4JUR I; 
#chains in the Genus database with same CATH topology
 3AGU A;  4EBJ A;  5FCL A;  1RKE A;  3MYI A;  3NYL A;  1ORJ A;  4CS9 A;  2EIK C;  2AU5 A;  2KQ9 A;  2XL4 A;  3ABM C;  3IQ6 A;  3NMJ A;  1D1A A;  3EH2 A;  3MBG A;  5HSW A;  3UMK A;  2HJM A;  5L0C A;  3DAG A;  4C7O B;  2H7O A;  3W8H A;  2CCY A;  2KGO A;  4DJ9 A;  1U0B B;  5DS4 A;  1C17 M;  1QVX A;  2VCA A;  3GEE A;  3EGX B;  2L9J A;  3DJN B;  1NZE A;  1YDI A;  4ULV A;  1QKR A;  2JX0 A;  3VM6 A;  3U3B A;  1ZU5 A;  2QE9 A;  2FFH A;  1M57 C;  2LSE A;  4PJN A;  3JTL O;  2B0J A;  3C7J A;  2KK1 A;  3MFN A;  3WHN A;  3M4C A;  1FAP B;  3CAX A;  1BR1 A;  4DXW A;  1SYQ A;  3DE8 A;  4AE4 B;  3JZ0 A;  3NMK A;  3BEH A;  4EIY A;  2HUJ A;  1OW8 A;  2YZS A;  3FAP B;  1T5O A;  4KBL A;  1ZYR F;  1FNT c;  1G4W R;  2EIN C;  3I5Q A;  1Y6D A;  3JSE O;  2HFI A;  3U0C A;  1TR2 A;  3LAY A;  1RMV A;  2EIJ C;  2W45 A;  2VH3 A;  3ATP A;  4IB4 A;  4J7Y A;  1Z5Z A;  1K40 A;  5B3I A;  1D1C A;  5E2Q A;  4Z9H A;  3FDQ A;  2J9U A;  3GWN A;  1EQ1 A;  4GQH A;  1NG1 A;  1Q0D A;  4NTB A;  1KU2 A;  4FX5 A;  3POV A;  4CS8 A;  4MVS A;  2L6G A;  4YL0 A;  3LS1 A;  3RQF A;  4YT2 A;  4CBE A;  4Z9J A;  4YJW A;  2R05 A;  4WGZ A;  3S27 A;  4JE9 A;  3DXJ F;  3IQC A;  2CDQ A;  4IJJ A;  4Z9I A;  5JP7 A;  3V5Z A;  4JW1 A;  1J8Y F;  1LPE A;  1A7V A;  3PCV A;  4I1M A;  4YT4 A;  3US6 A;  2A69 F;  2E87 A;  3JRT A;  4H4K C;  4IRU A;  3H2U A;  3AJM A;  2BL2 A;  3DWW A;  1TKN A;  3T4R A;  5AC4 A;  1NFN A;  4NC3 A;  1TWG A;  5AC5 A;  2PFD A;  256B A;  3C8G A;  4AK9 A;  2AVK A;  5L0I A;  2XXA A;  3DD7 A;  4P9F A;  1D0Z A;  4W8K A;  2J45 A;  4ZLC A;  1MMD A;  2AWY A;  3LS0 A;  2Y3B A;  1Z6A A;  1WN0 A;  1D0Y A;  4I3M A;  3RH3 A;  3N24 A;  3WG7 C;  3N0T A;  3UMH A;  3Q6M A;  4G7O F;  1VMA A;  5KYU B;  1OQC A;  4PR9 A;  5T3W A;  3UGO A;  1R5I D;  3LEO A;  1NU9 C;  1A0B A;  4IAR A;  2ZXP A;  3DAF A;  3U3F A;  5L0D A;  3AG2 C;  1SF8 A;  4XPX A;  2OQM A;  2WB7 A;  4JTC B;  1VLS A;  5JT4 A;  1MNE A;  3Q6N A;  2FAP B;  5IY5 C;  2CNW A;  1JAF A;  1M2V B;  3G4X A;  3ZIB A;  2Q7R A;  2LD6 A;  4GEH A;  4FAP B;  4U5G A;  2W4M A;  1ZZP A;  3X2Q C;  2EIM C;  4XEK A;  4NCQ A;  1PD0 A;  1O5H A;  3AG3 C;  2DYR C;  3GEI A;  4IAO A;  2WL8 A;  3A11 A;  2R02 A;  3FOP A;  3ZVR A;  2KC3 A;  1RXQ A;  1T01 A;  2YL0 A;  3O6X A;  2ZXW C;  5JSL A;  2L81 A;  2IXM A;  3C8Z A;  3EGD B;  5E33 A;  1WWP A;  2FGY A;  2P61 A;  3PHF 2;  3SXK A;  3VRC A;  4OIQ F;  2H7V C;  3K1I A;  5L0F A;  2H8A A;  4MVQ A;  1Q0F A;  1NFO A;  4JC7 A;  4U5F E;  4NY3 A;  2RD9 A;  2L6F A;  1S7Z A;  2VCC A;  3S28 A;  1QLE C;  2AWC A;  5E3A A;  5KYN A;  2LFD A;  4EBB A;  5L3V A;  1HMO A;  2MHR A;  2OEX A;  4U5H A;  4NQF A;  4EUK B;  4XQ1 A;  4U5C E;  5JRA A;  4IWB A;  2OU6 A;  1VOM A;  1G4U S;  1QZX A;  3QVY A;  5JLI A;  5KYY B;  1HW2 A;  4HEA J;  4HE8 D;  5F5F A;  4C7O A;  2Q4F A;  2XLH A;  5T1D B;  4L6R A;  1QSP A;  3S9O A;  4I44 A;  4KNW A;  1JR8 A;  2PP4 A;  2XRH A;  5B3S C;  1A41 A;  2ZD9 A;  3ABK C;  3I5P A;  4MVO A;  1CGO A;  2Q9A A;  1HE1 A;  1VYK A;  5DQT A;  1Z63 A;  2OCC C;  1SR2 A;  3FHD A;  4YL3 A;  1ST6 A;  1VYI A;  1Z7Q c;  3O55 A;  2X51 A;  4CS8 C;  3V7O A;  4LLC A;  2XLM A;  5K0I A;  1OXB A;  2PNO A;  2A6H F;  4AE4 A;  2R7O A;  5COF A;  1LKX A;  2VB6 A;  3NKD A;  3WAQ A;  2WVO A;  1EKY A;  2IBF A;  1ZW2 A;  1NU7 D;  2JPU A;  5D91 A;  3QW1 A;  4E18 A;  1ZHT A;  3UR3 C;  2JD3 A;  4PJJ A;  3RVZ A;  3A9C A;  3DM5 A;  4KC9 A;  3M1C B;  2QY9 A;  4P9T A;  2G62 A;  3QTH A;  1KNY A;  3RW0 A;  3S84 A;  3U9J A;  3S90 A;  1JOG A;  2VCB A;  4J7T A;  2Y3G A;  3KKB A;  3KPH A;  3W8I A;  3GM1 A;  3Q7G A;  1FTS A;  4OIN F;  3ZTZ A;  1LE2 A;  3EZI A;  1B68 A;  2OOC A;  3MYF A;  1EA8 A;  4ZLD A;  2MYS A;  4E0H A;  3AQC A;  3LUT B;  4JCH A;  3T9O A;  2R7V A;  2QTV A;  3LLK A;  2XLO A;  4QI2 A;  1OCZ C;  5JS5 A;  3MX3 A;  1CPQ A;  4AX2 A;  4M63 A;  2Y39 A;  2CW0 F;  3FVY A;  2PF4 E;  3F46 A;  3HNK A;  1BDJ B;  1OW6 A;  2OKU A;  4NTA A;  5JVE A;  3S29 A;  1MMG A;  5E3C A;  1BR2 A;  1LM3 B;  1XWJ A;  2XM4 A;  1VTM P;  2B0H A;  2CGE A;  2OEV A;  3DE9 A;  3SEO A;  3UNG C;  2C03 A;  1FFH A;  3W2V A;  5COM A;  2R7Q A;  4JUR I;  2ASR A;  4IAQ A;  3U5S A;  4G78 A;  2R7U A;  3EHM A;  3U9M A;  3G50 A;  4CJG A;  2XS1 A;  1D0X A;  2D4U A;  4QDL A;  3GAN A;  4U5B E;  4O6N A;  1TFO B;  3IQT A;  5KYU A;  5BUO A;  3IPM O;  3B9Q A;  3MLG A;  3UGP A;  1IZM A;  3V5X A;  2KJG A;  2M4E A;  1WAS A;  3K1I C;  2HV6 A;  2OG2 A;  2HSB A;  2Z15 A;  3JSZ A;  4XPY A;  4Q5S F;  3ZWI A;  2P6V A;  4OD5 A;  2J7P A;  1U6H A;  1HMD A;  3H2V A;  3EHN A;  2LIG A;  3HNL A;  3JYY A;  3KYI A;  2VC9 A;  2Y3H A;  4MS2 A;  5AGF A;  1K05 A;  1I5N A;  5TJ5 E;  4CX9 A;  5A6B A;  1M2V A;  2NUT A;  1FFT C;  1NSG B;  1ZHX A;  5EGY A;  1M6T A;  3LES A;  3TOL A;  2W4B A;  1EI7 A;  1TQG A;  2HKV A;  4JTA B;  2G3V A;  1BBH A;  3SYN A;  3ABL C;  1MMA A;  1TFK B;  2I15 A;  1OCC C;  3R7C A;  1NBB A;  3U8P A;  5A6A A;  3W2W A;  1HE9 A;  4CSA A;  1JRA A;  2UUH A;  4K0D A;  2M64 A;  4DRI B;  3KYJ A;  3AQB A;  4MQ9 F;  3ITF A;  3LLI A;  5L3Q A;  1ZVZ A;  2YHS A;  4LER A;  2J0X A;  3ZDL A;  3HLZ A;  1T6Q A;  4CDY A;  3EJN A;  3QW0 A;  1I4Z A;  1RKC A;  1RJ9 B;  2XLD A;  3L1M A;  4PFO A;  1Y4C A;  1V55 C;  5KYY A;  3RYL A;  4BEM J;  4EBK A;  3CQZ A;  1W2W A;  4XEF A;  4DVZ A;  4DOZ A;  2YRF A;  3NMI A;  4U5D E;  2Y3D A;  1ZHY A;  3L8I A;  4K1O A;  1OCO C;  2A68 F;  3WOD F;  1CPR A;  3H65 A;  1V4A A;  4YT5 A;  1ORY A;  1C03 A;  3RF3 A;  4CS9 C;  3CSK A;  3FMS A;  2QNL A;  3M15 A;  2Q9C A;  3GM2 A;  3TK0 A;  4DRH B;  2VAS A;  2YL7 A;  2V3C C;  1LI7 A;  2Q3T A;  4JEA A;  4FWV A;  1D1B A;  1VB5 A;  2UUI A;  3E70 C;  1RCP A;  4E17 A;  4WAB A;  3Q7L A;  1OKK A;  1WAT A;  2R7T A;  1H9G A;  2PX3 A;  1H9T A;  3SZR A;  4C3D A;  5T3T A;  5KYW B;  4E7Z A;  1PD1 A;  2GWW A;  3NDB B;  1OCR C;  4PAC A;  4MVR A;  4FES A;  3KMI A;  1K04 A;  1GS9 A;  1AVO B;  1E83 A;  4JTD B;  4U5E E;  2D5R B;  2J9B A;  4BJT A;  3OA1 A;  3TD7 A;  4JKV A;  4N6C A;  3NKE A;  3ZTM A;  2OJQ A;  4ONS A;  4N06 A;  2IXO A;  2NUP B;  3HJC A;  1UG7 A;  1FMW A;  3HNI A;  5BQI A;  3EG9 B;  1V54 C;  4DBR A;  5L0G A;  5A6B D;  1TWC A;  3C63 A;  4YN0 B;  1CGM E;  1DOW A;  3T6G B;  2HV7 A;  1O3U A;  2HS5 A;  3K33 A;  2LP4 A;  3N2Z B;  2CYD A;  2HMZ A;  2Q00 A;  3EGX A;  3T6J A;  3EPV A;  3B29 A;  3AOU A;  4XLP F;  3L34 A;  4U9D A;  4OIP F;  1YYX A;  2XXA B;  2L7A A;  3LEV A;  4LDR A;  3K1H A;  4BG0 A;  5DS5 A;  2YL1 A;  3NYM A;  4X0R A;  3ZC4 A;  1Q0K A;  1M56 C;  3RQG A;  2EPL X;  4J32 B;  4JEB A;  3FAJ A;  1N1C A;  2IYL D;  3C8G D;  1YAR O;  2PX0 A;  2R7S A;  1U89 A;  3M79 A;  1APC A;  4BJ6 A;  4XTK A;  2YLG A;  1AEP A;  1TWH A;  2HSQ A;  2OJE D;  5F5H A;  4GYT A;  2R7W A;  4YL1 A;  2WZG A;  4B6I A;  1E85 A;  3CEX A;  2WVQ A;  5A6J A;  2EPM X;  1LS4 A;  2KYH A;  3TOM A;  4MW8 A;  4CJO A;  4RBN A;  3HTK C;  4CIH A;  3ECS A;  3QZC A;  4BJ5 A;  1O87 A;  2J9W A;  4F4B A;  2CNW D;  1H7I A;  3EQL F;  5DLJ A;  1JPN A;  4MVZ A;  3C62 A;  4MW3 A;  3GM3 A;  3O39 A;  4JZA A;  2LK4 A;  2NSG A;  2A1D D;  2Y69 C;  5DS6 A;  3BRJ A;  1OKK D;  5BQG A;  3CZ6 A;  1CGN A;  2W9Y A;  3LNR A;  1QQ3 A;  4ULW A;  1MND A;  1Q0G A;  2LQG A;  2Q9B A;  4MVU A;  3V5Y A;  1LS1 A;  2KW3 C;  2YKZ A;  2EPN A;  1PCX A;  4BEJ A;  4O79 A;  4IGG A;  3EFO B;  4BJ1 A;  3PDM P;  1YZC A;  1LE4 A;  1PV3 A;  1LIH A;  2J46 A;  2QLA A;  4E7S A;  5B1A C;  3OWT A;  1LI5 A;  4EHP A;  3SP1 A;  2IXP A;  1SZI A;  3HKK A;  1YAU O;  3JRM O;  4PJL A;  1OR3 A;  3ZSU A;  1YA7 O;  3AG4 C;  3E9V A;  2LCH A;  5D92 A;  4JJG A;  3DJU B;  2EPK X;  5KYX B;  2NG1 A;  3EH1 A;  4J30 B;  1RJ9 A;  1S05 A;  2WZF A;  3EZH A;  3S0X A;  3DKA A;  2KSF A;  4DRJ B;  4YWQ A;  4AL1 A;  2YL3 A;  2TMV P;  1T6U A;  2YVK A;  4K7B A;  2R7R A;  2C04 A;  3RFY A;  4CDV A;  3U2L A;  3PMR A;  2XS8 A;  3KL4 A;  3K66 A;  1ZU4 A;  2XLW A;  1R4T A;  3B0V C;  3B0U X;  4U9E A;  2A0B A;  2NPU A;  3JT1 A;  4MVM A;  4W8P A;  4LDK A;  4WJ0 A;  1MMN A;  4MND A;  1BR4 A;  2R03 A;  3U2M A;  4BPM A;  5CIV A;  1VK5 A;  3DM9 B;  1KTM A;  3SXZ A;  4N6H A;  1RKE B;  3O10 A;  1JMW A;  2GAQ A;  3QMK A;  1T6I A;  4PK4 A;  5DQZ A;  4G0H A;  4O7G A;  2NSF A;  4D4X A;  1J8M F;  2WVN A;  2DYS C;  1XZP A;  2J9V A;  4XWJ A;  2YEV A;  3VF0 A;  2ICW G;  2XSE A;  2MWQ A;  3EGD A;  4KI2 A;  4H54 A;  1E86 A;  5DVW A;  1L7C A;  4A2N B;  5KYW A;  4LDQ A;  3TUL A;  1FMV A;  5L0H A;  5F28 E;  4OD4 A;  4HFK B;  2P7V A;  1L3P A;  4MTO A;  5L0J A;  2A6E F;  4DBQ A;  3M4B A;  3L0I A;  5B1B C;  3VAY A;  4YT8 A;  4BJ6 C;  2R7X A;  3B71 A;  2NUP A;  4Q4Z F;  2QUP A;  2XM0 A;  4LAC B;  5BQH A;  3IHU A;  5CI8 A;  1ZW3 A;  3EG9 A;  2XL8 A;  4JJF A;  3FXH A;  4PJM A;  4E0I A;  2AP3 A;  2DI3 A;  3LJB A;  2DGJ A;  3TJ5 A;  1AUE A;  2G3K A;  2XLV A;  1WGW A;  4JCZ A;  3NG1 A;  1XZQ A;  1MQV A;  3DI5 A;  2P0N A;  4RD9 A;  4CS7 A;  2YWA A;  1YJG A;  3UMI A;  1H6G A;  3RVY A;  4BJ5 C;  2HZ8 A;  2J0W A;  3L8J A;  3LNM B;  1NLX A;  3K7D A;  1TWA A;  2IXN A;  1JPJ A;  1ZHW A;  4XPW A;  5FZT A;  2XLE A;  1IW7 F;  3JCU Q;  2IM8 A;  1V74 B;  4XLN F;  4N4W A;  1M2O A;  4ANJ A;  1ZHZ A;  1WTY A;  2DB4 A;  3F47 A;  3X1O A;  2ZPA A;  4AL0 A;  4O6M A;  4D4N A;  1GM5 A;  2BC5 A;  2RSE B;  2LFF A;  3R2P A;  4QI0 A;  4C3B A;  4CDA A;  4CIP A;  1Z3I X;  3HNJ A;  4JRZ A;  4EKW A;  4WGY A;  4LLE A;  4O6Y A;  4C3E A;  1YVI A;  3J06 A;  2HMQ A;  3I4U A;  4DVY P;  2YQY A;  2R25 A;  2P1A A;  2NUT B;  5JUA A;  1I4Y A;  2EIL C;  1F1M A;  2J7P D;  1Q0M A;  1G5Z A;  2GFH A;  3AGT A;  1Z23 A;  3DZA A;  2L6H A;  3G4Z A;  4MTF A;  3ZQY A;  2A0U A;  5A69 A;  1E84 A;  2R9R B;  5A6K A;  3TJ6 A;  2XL6 A;  2WZL A;  2J8W A;  1QPU A;  1LVK A;  2O9X A;  4KNV A;  3GEH A;  4OIR F;  5HV9 A;  2GDC A;  2KNH A;  1C02 A;  2HJ3 A;  2YLD A;  3C8G B;  3GOR A;  3K6B A;  4XEV A;  1OXK A;  3NYJ A;  3U8V A;  3W4Y A;  1E2X A;  3ZQV A;  4OIO F;  1FR0 A;  1A7D A;  1A7E A;  1BZ4 A;  2X0C A;  4A4A A;  4G7H F;  3ASO C;  1YYJ A;  4R32 A;  3DMD A;  4P6I C;  4Q7C A;  2IOQ A;  3B0P A;  1GGQ A;  1OR2 A;  4JVS A;  1T9K A;  2BE5 F;  3C18 A;  5COG A;  5GPG B;  4ER9 A;  3TQO A;  1GQA A;  3EFO A;  3SXY A;  1HW1 A;  4RDA A;  2V26 A;  4JIO A;  5CI9 A;  3RKO F;  3IEE A;  1ORS C;  4NTF A;  3RQE A;  3GWL A;  3FOO A;  3JYH A;  3KH2 A;  1OW7 A;  4G7Z F;  3GOD A;  4PFP A;  2EPO A;  5EK0 A;  1HY5 A;  3ASN C;  2GA0 A;  5EHH A;  5KYX A;  3IQ5 A;  1UFB A;  2F22 A;  4HFF B;  1VLT A;  3SXM A;  4CSA C;  1YA9 A;  1WOL A;  2YLI A;  4MTG A;  3AG1 C;  2PBE A;  4EWC A;  3SNH A;  1DOV A;  3OEO A;  3RIP A;  1YZA A;  2ZXO A;  3ZG1 A;  1YLM A;  2I8B A;  3VYW A;  3NRH A;  3QVZ A;  4YK5 A;  4UDV A;  2H7B A;  2ETS A;  4I1O B;  3T6B A;  2ZXR A;  1G8X A;  1SMY F; 
#chains in the Genus database with same CATH homology
 5FCL A;  3NYL A;  4CS9 A;  2EIK C;  2KQ9 A;  2XL4 A;  3ABM C;  1D1A A;  3EH2 A;  5HSW A;  3UMK A;  3DAG A;  4C7O B;  2H7O A;  3W8H A;  2KGO A;  5DS4 A;  3EGX B;  2L9J A;  3DJN B;  1NZE A;  1ZU5 A;  2FFH A;  1M57 C;  2LSE A;  4PJN A;  2B0J A;  1BR1 A;  4AE4 B;  2YZS A;  4KBL A;  1ZYR F;  2EIN C;  3I5Q A;  1TR2 A;  3LAY A;  2EIJ C;  2W45 A;  2VH3 A;  1Z5Z A;  1D1C A;  5E2Q A;  3FDQ A;  2J9U A;  1NG1 A;  1KU2 A;  4FX5 A;  3POV A;  4CS8 A;  3LS1 A;  4YT2 A;  4CBE A;  4YJW A;  3S27 A;  3DXJ F;  4IJJ A;  2CDQ A;  4JW1 A;  1J8Y F;  4I1M A;  4YT4 A;  2A69 F;  2E87 A;  3JRT A;  4H4K C;  4IRU A;  1TKN A;  3T4R A;  1TWG A;  2PFD A;  4AK9 A;  2XXA A;  3DD7 A;  4ZLC A;  1D0Z A;  4W8K A;  2J45 A;  1MMD A;  3LS0 A;  2Y3B A;  1Z6A A;  4I3M A;  1D0Y A;  3WG7 C;  3RH3 A;  3N24 A;  3N0T A;  3UMH A;  3Q6M A;  4G7O F;  1VMA A;  5KYU B;  3UGO A;  5T3W A;  1NU9 C;  2ZXP A;  3DAF A;  3AG2 C;  1SF8 A;  2WB7 A;  1MNE A;  3Q6N A;  5IY5 C;  2CNW A;  1M2V B;  3ZIB A;  4GEH A;  4U5G A;  2W4M A;  3X2Q C;  2EIM C;  1PD0 A;  1O5H A;  3AG3 C;  2DYR C;  4BEJ A;  4IAO A;  2WL8 A;  4ZLD A;  3ZVR A;  3O6X A;  2ZXW C;  2L81 A;  2IXM A;  3EGD B;  5E33 A;  2FGY A;  3PHF 2;  4OIQ F;  2H7V C;  4U5F E;  4NY3 A;  1S7Z A;  3S28 A;  1QLE C;  5E3A A;  5KYN A;  4EBB A;  5L3V A;  4U5H A;  4U5C E;  4IWB A;  1VOM A;  5KYY B;  1QZX A;  4HEA J;  4HE8 D;  4C7O A;  5T1D B;  4I44 A;  4KNW A;  2PP4 A;  2XRH A;  5B3S C;  3ABK C;  3I5P A;  2Q9A A;  1VYK A;  5DQT A;  2OCC C;  3FHD A;  1ST6 A;  1VYI A;  2X51 A;  4CS8 C;  3V7O A;  4LLC A;  2A6H F;  4AE4 A;  2R7O A;  1LKX A;  2VB6 A;  3NKD A;  2WVO A;  1NU7 D;  5D91 A;  1ZHT A;  3UR3 C;  2JD3 A;  4PJJ A;  5F5F A;  3DM5 A;  4KC9 A;  3M1C B;  2QY9 A;  2G62 A;  2Y3G A;  3KKB A;  3W8I A;  3Q7G A;  1FTS A;  4OIN F;  3EZI A;  2MYS A;  3AQC A;  4JCH A;  2R7V A;  2QTV A;  3LLK A;  4QI2 A;  1OCZ C;  3MX3 A;  4AX2 A;  4M63 A;  2Y39 A;  2CW0 F;  3FVY A;  2PF4 E;  3F46 A;  3S29 A;  1MMG A;  5E3C A;  1BR2 A;  2CGE A;  3UNG C;  3SEO A;  2C03 A;  1FFH A;  3W2V A;  2R7Q A;  4JUR I;  2R7U A;  3EHM A;  1D0X A;  4QDL A;  3GAN A;  4U5B E;  4O6N A;  5KYU A;  5BUO A;  3B9Q A;  3MLG A;  3UGP A;  1IZM A;  2KJG A;  2M4E A;  3K1I C;  2HV6 A;  2OG2 A;  2Z15 A;  3JSZ A;  4Q5S F;  2P6V A;  4OD5 A;  2J7P A;  3EHN A;  2Y3H A;  1M2V A;  2NUT A;  1FFT C;  1ZHX A;  5EGY A;  3LES A;  2W4B A;  2G3V A;  3SYN A;  3ABL C;  1MMA A;  1OCC C;  3W2W A;  4CSA A;  4K0D A;  3AQB A;  4MQ9 F;  3ITF A;  3LLI A;  5L3Q A;  2YHS A;  4LER A;  2J0X A;  3HLZ A;  3EJN A;  4PFO A;  1RJ9 B;  1V55 C;  5KYY A;  3RYL A;  3CQZ A;  1W2W A;  4DVZ A;  4DOZ A;  4U5D E;  2Y3D A;  1ZHY A;  1OCO C;  2A68 F;  3WOD F;  3H65 A;  4YT5 A;  4CS9 C;  3CSK A;  2Q9C A;  2VAS A;  2V3C C;  2Q3T A;  4FWV A;  1D1B A;  3E70 C;  3Q7L A;  1OKK A;  2R7T A;  2PX3 A;  3SZR A;  4C3D A;  5T3T A;  5KYW B;  3NDB B;  1PD1 A;  1OCR C;  4FES A;  3KMI A;  4U5E E;  2D5R B;  4BJT A;  3OA1 A;  3TD7 A;  3NKE A;  4N06 A;  2IXO A;  2NUP B;  3HJC A;  1FMW A;  3EG9 B;  1V54 C;  4DBR A;  1TWC A;  4YN0 B;  2HV7 A;  3K33 A;  1Z63 A;  3N2Z B;  3EGX A;  3T6J A;  3EPV A;  4XLP F;  3L34 A;  4OIP F;  2XXA B;  3LEV A;  5DS5 A;  3K1H A;  4BG0 A;  3NYM A;  4X0R A;  3ZC4 A;  1M56 C;  4J32 B;  3FAJ A;  1N1C A;  2IYL D;  2R7S A;  2PX0 A;  4BJ6 A;  4XTK A;  1TWH A;  5F5H A;  4GYT A;  2R7W A;  2WZG A;  4B6I A;  2WVQ A;  4RBN A;  3HTK C;  4CIH A;  3ECS A;  3QZC A;  4BJ5 A;  1O87 A;  2J9W A;  4F4B A;  2CNW D;  3EQL F;  5DLJ A;  1JPN A;  3O39 A;  4JZA A;  2A1D D;  2Y69 C;  1OKK D;  3CZ6 A;  2W9Y A;  3LNR A;  4ULW A;  1MND A;  2Q9B A;  1LS1 A;  2KW3 C;  1PCX A;  4O79 A;  3EFO B;  4BJ1 A;  2J46 A;  4E7S A;  5B1A C;  3OWT A;  3SP1 A;  2IXP A;  1SZI A;  4PJL A;  3ZSU A;  3AG4 C;  3E9V A;  5D92 A;  4JJG A;  3DJU B;  5KYX B;  2NG1 A;  3EH1 A;  4J30 B;  1RJ9 A;  2WZF A;  3EZH A;  3S0X A;  4YWQ A;  4K7B A;  2R7R A;  2C04 A;  3RFY A;  3PMR A;  3KL4 A;  3K66 A;  1ZU4 A;  3B0V C;  3B0U X;  3JT1 A;  4E7Z A;  4WJ0 A;  1MMN A;  4MND A;  1BR4 A;  1VK5 A;  3DM9 B;  3QMK A;  4PK4 A;  5DQZ A;  4G0H A;  4O7G A;  5DS6 A;  1J8M F;  2WVN A;  2DYS C;  4XWJ A;  2J9V A;  2YEV A;  2XSE A;  2MWQ A;  3EGD A;  4KI2 A;  5DVW A;  4A2N B;  5KYW A;  1FMV A;  4OD4 A;  4HFK B;  2P7V A;  2A6E F;  4DBQ A;  3L0I A;  5B1B C;  3VAY A;  4YT8 A;  4BJ6 C;  2R7X A;  2NUP A;  4Q4Z F;  4LAC B;  5CI8 A;  3EG9 A;  4JJF A;  4PJM A;  3LJB A;  2DGJ A;  2G3K A;  1WGW A;  3NG1 A;  4RD9 A;  4CS7 A;  3UMI A;  4BJ5 C;  2J0W A;  3K7D A;  1TWA A;  2IXN A;  1JPJ A;  1ZHW A;  1IW7 F;  3JCU Q;  4XLN F;  1M2O A;  4ANJ A;  1ZHZ A;  3X1O A;  3F47 A;  2ZPA A;  4O6M A;  4QI0 A;  4C3B A;  1Z3I X;  4LLE A;  4O6Y A;  4C3E A;  4DVY P;  3I4U A;  2NUT B;  2EIL C;  2J7P D;  2GFH A;  1Z23 A;  3DZA A;  2WZL A;  1LVK A;  2O9X A;  4KNV A;  4OIR F;  2KNH A;  3K6B A;  4OIO F;  3NYJ A;  4G7H F;  3ASO C;  3DMD A;  4P6I C;  4Q7C A;  2IOQ A;  3B0P A;  4JVS A;  2BE5 F;  3EFO A;  4RDA A;  2V26 A;  5CI9 A;  3RKO F;  3IEE A;  4G7Z F;  3JYH A;  3KH2 A;  3GOD A;  4PFP A;  3ASN C;  5EHH A;  5KYX A;  4HFF B;  4CSA C;  3AG1 C;  4EWC A;  3SNH A;  3OEO A;  3RIP A;  2ZXO A;  3ZG1 A;  2I8B A;  3VYW A;  3NRH A;  2H7B A;  4I1O B;  3T6B A;  2ZXR A;  1G8X A;  1SMY F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...