4B6IA

Crystal structure rap2b (sma2266) from serratia marcescens
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
100
structure length
100
Chain Sequence
MENSLNALSQEALYKNWLTSRCIGKSTDSERTKQDAFRSASAYLELSKLPMDAFEQGEKLAEQYANKNSQGSVQGTYHTLDCLSLQNASEAETIFERYSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SMA2266
publication title New Secreted Toxins and Immunity Proteins Encoded within the Type Vi Secretion System Gene Cluster of Serratia Marcescens.
pubmed doi rcsb
source organism Serratia marcescens
molecule tags Signaling protein
total genus 38
structure length 100
sequence length 100
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16695 Tai4 Type VI secretion system (T6SS), amidase immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1620 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4b6iA00
3ZIBA 4JURI 4J30B 4HFFB 4B6IA 4J32B 4HFKB 4AX2A
chains in the Genus database with same CATH superfamily
2EIKC 2YLIA 1JAFA 3B0UX 2I15A 3UR3C 1M2VA 3MYIA 1YJGA 3S90A 2XLOA 2Q9CA 2W45A 3U8VA 2ZPAA 4G7HF 4YT8A 2R7RA 3N0TA 2YL0A 3S0XA 3FHDA 3DM9B 5IY5C 1D0ZA 4U5GA 4IWBA 1H9GA 2JD3A 4I44A 2L6FA 3AQCA 3DXJF 2MHRA 4A2NB 4EHPA 2WVNA 1NFOA 2D5RB 1UG7A 3IQCA 3VRCA 4CJOA 4DBQA 2AVKA 3ZG1A 4JJFA 2A1DD 3GWLA 5TJ5E 2V26A 4FAPB 1FNTc 3AG1C 4H54A 3EPVA 4YT5A 2L6HA 3DZAA 4E17A 3S9OA 3JT1A 1G5ZA 3NDBB 1A41A 3NMKA 1QLEC 1WWPA 4BG0A 1BDJB 3DI5A 4YT4A 3CAXA 3ZWIA 3M1CB 4IB4A 4H4KC 2UUIA 4NTAA 3MFNA 2X0CA 5COGA 3C18A 2IOQA 1ZZPA 4KBLA 3U2MA 1SYQA 4CIPA 3B0VC 4IAQA 4AE4B 5DLJA 3EGXB 4MVMA 3RQEA 4YL0A 4PJJA 5CIVA 1T5OA 1E2XA 4HFFB 4BJ5C 4U5BE 2R25A 1QVXA 5BQHA 1B68A 1ZHWA 1I5NA 1HY5A 1YAUO 1E86A 2YLDA 3M4BA 5EHHA 2TMVP 3CEXA 4XPWA 2GAQA 2OQMA 4AL0A 5JRAA 2H7OA 2IXPA 3LNRA 3UMKA 5BUOA 2YL3A 3DE9A 2R7TA 3ZTZA 4IRUA 1D1AA 1KU2A 2XL6A 5L3QA 3FXHA 2PF4E 3TULA 1ZW3A 3O55A 5EK0A 3WODF 1AEPA 2CCYA 4AX2A 2AP3A 2C04A 4IARA 4I1MA 2E87A 3HJCA 1HE9A 1Z3IX 3GM3A 2EPLX 1NFNA 2J46A 2Q00A 1E85A 3QW1A 3AG4C 3ZDLA 4OIRF 2P7VA 4MTOA 4E7SA 1N1CA 1PV3A 2KW3C 5L0JA 1TWAA 5JLIA 1VYKA 3KL4A 5A69A 2X51A 1R5ID 1LIHA 3E70C 3FAPB 1TR2A 3M79A 4BEMJ 5A6BD 5JUAA 1V74B 4MVOA 4RBNA 2KJGA 1JPNA 1XZQA 4CS7A 4Q5SF 1VOMA 1GGQA 1S7ZA 3C63A 2VCCA 2QNLA 3GEIA 3W2VA 4O7GA 1Q0DA 3DE8A 3RQFA 3RF3A 1MMGA 3TD7A 2EIMC 4BPMA 3VYWA 1FAPB 4FWVA 3GEHA 2OG2A 4FX5A 3GWNA 3G4XA 3H65A 3RW0A 2ICWG 4DRJB 3J06A 4I1OB 3SZRA 5B3SC 3RKOF 2IM8A 4AE4A 4DVYP 2R02A 3EGXA 3LAYA 1FTSA 2LCHA 2CW0F 2YLGA 4G7OF 3NG1A 4NTBA 2PX0A 2XLMA 2BL2A 2GDCA 3HNKA 2O9XA 2W4MA 3MBGA 1PCXA 1AUEA 1SZIA 1OXKA 2J9UA 2WZGA 4P6IC 2XSEA 1TWCA 2EPKX 1EKYA 5K0IA 1SF8A 3U8PA 3QVZA 5KYYB 2DYRC 1GM5A 2J7PD 1W2WA 1UFBA 1OCRC 2NUPB 4XQ1A 3EQLF 5FZTA 3ABLC 1YZAA 3GM1A 1ORSC 1ST6A 3C8ZA 1RXQA 1ZVZA 2BC5A 3F47A 4JRZA 4JCZA 5T3WA 1BR2A 4MVUA 2Y3GA 4PFPA 3AGTA 1LVKA 4KNVA 2XLHA 4LDKA 4DXWA 2LP4A 2XL8A 5A6AA 3U9MA 3U5SA 4LDQA 1TFOB 1Y6DA 1ZHZA 2ZD9A 3NKEA 1WGWA 3ZTMA 4BJ6C 2DB4A 3OA1A 1GS9A 1OR3A 2HV6A 2A0UA 1LM3B 5DQTA 4CJGA 4EBJA 1C02A 2VCBA 4J30B 1YLMA 3ASNC 4CDAA 4B6IA 4OINF 4QI2A 1SMYF 2YWAA 2Z15A 2ZXOA 2R7UA 4U9EA 2CGEA 4EWCA 3O39A 1CGNA 2J0WA 5L0IA 3IEEA 3RYLA 3A9CA 4DRHB 1KNYA 4D4NA 1QZXA 3HKKA 2NUTA 4D4XA 4JC7A 1Z7Qc 4NC3A 4OIOF 4ONSA 3SNHA 2L81A 3U2LA 4XWJA 2Q4FA 2VB6A 3UGOA 2ZXWC 4IJJA 2NSFA 1T01A 4JURI 5F5FA 1VMAA 1Z5ZA 3CQZA 4PR9A 4ZLCA 3B71A 3V7OA 5AC4A 3DAGA 3DJUB 4U5FE 3VM6A 2PNOA 2OCCC 3JYHA 1RCPA 2HSBA 3B9QA 1OCOC 3EHMA 3S29A 1JPJA 1Y4CA 2VH3A 2I8BA 2Y3HA 3PCVA 3S28A 3BEHA 1BZ4A 3EZIA 3IQ6A 4BJ5A 256BA 1J8YF 2Q9BA 3KKBA 1RKEA 2XLVA 3QZCA 3LLIA 1OXBA 5KYUA 5B1BC 1G8XA 2CNWD 3EZHA 3NYLA 1G4WR 2EPOA 2NUPA 2A0BA 3NYMA 3U0CA 4ULWA 5A6KA 1SR2A 3QTHA 1JMWA 1OW8A 2HKVA 4JKVA 2YRFA 5E33A 2WZLA 5KYWB 1RJ9A 3KPHA 2J9WA 4U5CE 4EBBA 3X1OA 2L6GA 2MWQA 4CX9A 2EPNA 4E0HA 1YYJA 2Y69C 3EH2A 3PDMP 1BR4A 2BE5F 1M57C 3ZQVA 4OD5A 4ER9A 2A68F 4MVRA 5T1DB 1J8MF 2AWCA 1YARO 2OEXA 2DGJA 5B3IA 3L0IA 5L0GA 1H6GA 4JCHA 2HUJA 1YA9A 4XLPF 1TWHA 2QUPA 5BQGA 3V5XA 3LS0A 4QDLA 3FAJA 1MNEA 4UDVA 2P6VA 1QSPA 4N4WA 2J9BA 5L0FA 1T6IA 4PK4A 2OU6A 2WZFA 3N24A 4MVZA 4CS8A 4J32B 3JSEO 5FCLA 1LPEA 4KNWA 4O6NA 3UMHA 3VAYA 2L9JA 3JZ0A 1T9KA 3JYYA 1RMVA 5JSLA 3I5QA 4KC9A 1FMVA 2R03A 2Y3BA 3CSKA 3HNLA 2XLEA 3IQ5A 4NY3A 4C3EA 4WJ0A 3PMRA 1JR8A 1CGOA 4PJMA 4IGGA 2Q9AA 2VCAA 4M63A 4K1OA 3HTKC 2EILC 2HZ8A 4MW8A 3EFOB 4C7OB 4U9DA 2HV7A 3AQBA 2G3VA 3EG9B 1Q0MA 4BEJA 1HE1A 5T3TA 2OKUA 3KYIA 1VLTA 4WABA 5A6BA 1DOVA 1ORYA 4GEHA 3NRHA 2D4UA 1ZHXA 3ASOC 2WL8A 5JP7A 3IHUA 2A6HF 4JJGA 2DYSC 3SXKA 2FGYA 4CS8C 4L6RA 3OWTA 1O87A 3FDQA 2CDQA 5CI8A 4EKWA 1V55C 4P9FA 4F4BA 5KYNA 3VF0A 2LD6A 4JE9A 4JW1A 1VYIA 1WASA 1I4YA 1VK5A 2NSGA 3LS1A 4GYTA 4JTAB 4OIPF 2R7QA 4LLEA 3ATPA 1Q0GA 1PD0A 1BR1A 5D91A 1VTMP 2XS1A 4BJ6A 1ZU5A 2C03A 2HMZA 4JTDB 1EA8A 1NU9C 4K0DA 1KTMA 1GQAA 3LNMB 3LLKA 3QW0A 4YJWA 4A4AA 1LS1A 3V5YA 1DOWA 1K04A 5E2QA 2GFHA 2KQ9A 3JSZA 1EQ1A 1O3UA 1Q0KA 2ZXPA 2LFDA 4G0HA 3SXMA 4W8KA 2J7PA 3T6GB 1MMAA 3IQTA 2KC3A 1H9TA 4N6HA 4MNDA 1T6QA 5COFA 4YL1A 5KYXB 5JS5A 3PHF2 2V3CC 3C8GD 3G4ZA 2FFHA 4YT2A 4G78A 3K66A 1TFKB 1M2VB 4AL1A 3GANA 4J7TA 4JEBA 2R7SA 3EH1A 3U3FA 4CSAA 3BRJA 2YVKA 1YDIA 1O5HA 3OEOA 4EBKA 4PACA 1APCA 1JRAA 2XRHA 4QI0A 3EFOA 2KNHA 4E7ZA 4C7OA 1A7EA 2P1AA 3GM2A 1I4ZA 2M4EA 3EG9A 2YEVA 4JZAA 2CYDA 1VLSA 2KGOA 3M4CA 1OW7A 2P0NA 2R05A 3DJNB 4MVSA 2LQGA 4J7YA 2OJQA 4G7ZF 1IW7F 3UNGC 1NBBA 3JRMO 3L8JA 5A6JA 1OKKA 1Q0FA 4MW3A 3MYFA 5HSWA 3Q6MA 4W8PA 2Y3DA 1D0XA 1OKKD 2KSFA 1K40A 3DKAA 3K1IC 2A69F 1U6HA 4FESA 3W8IA 2EPMX 1TQGA 2MYSA 4I3MA 4XTKA 1ZW2A 1YYXA 2DI3A 2EINC 4AK9A 3DM5A 3NKDA 2OEVA 4JTCB 3SYNA 3E9VA 2WVOA 2R9RB 1T6UA 4LERA 2L7AA 2R7OA 2LFFA 1A7DA 2AU5A 3HNIA 2Q3TA 3MX3A 3NYJA 3H2VA 5COMA 5F5HA 4EUKB 1F1MA 1ZYRF 5L0DA 3UMIA 1A7VA 3SEOA 4CSAC 1M2OA 3Q7LA 1OQCA 3L8IA 3FVYA 2H7VC 4CBEA 1MMDA 3L34A 1K05A 2CNWA 2H7BA 3ABKC 1WN0A 3H2UA 4DJ9A 1NLXA 3FOPA 2H8AA 2HSQA 2PBEA 1BBHA 3K6BA 3EHNA 4N06A 5KYXA 5KYYA 1WTYA 5L0HA 3TOLA 4Z9IA 4JEAA 1CPRA 1M56C 3N2ZB 1HW2A 1LE4A 3CZ6A 3Q7GA 3WG7C 4NQFA 2A6EF 2VASA 3IPMO 3U3BA 1OW6A 3TK0A 2LIGA 1CPQA 5EGYA 2LK4A 1MMNA 3DWWA 1L7CA 4MTFA 4PJLA 4YK5A 2XM4A 3K1HA 5B1AC 5E3AA 2YL1A 5DS5A 1M6TA 4LDRA 4Z9HA 4Q7CA 3AJMA 4O79A 1U89A 1G4US 3S84A 4CS9C 2R7XA 1RKCA 2HFIA 2HS5A 3GODA 1TKNA 2M64A 3S27A 4OD4A 3NMIA 1AVOB 4LLCA 3C8GB 3RIPA 2IXOA 4EIYA 3LJBA 4MVQA 4MS2A 4C3DA 3T4RA 4JVSA 5DS6A 1NZEA 1IZMA 1Z6AA 3FMSA 4R32A 1QQ3A 3JRTA 3O10A 1D1BA 2J0XA 3EJNA 4N6CA 4YL3A 3KYJA 1LE2A 1LI7A 3ZQYA 2QY9A 4XEKA 1LI5A 3TOMA 1WOLA 5AC5A 3EGDB 3I4UA 5L3VA 4WGZA 1YA7O 1FMWA 2YQYA 2IXNA 4X0RA 3RVYA 3V5ZA 2PP4A 1MQVA 2WVQA 3ITFA 3K7DA 1A0BA 4LACB 4CIHA 3ABMC 5AGFA 4WGYA 2QE9A 2J45A 3U9JA 3O6XA 3C7JA 4U5HA 5KYWA 3SP1A 2PX3A 3ZIBA 2LSEA 2P61A 1FFHA 1EI7A 4ULVA 2NPUA 3ECSA 3C62A 4BJ1A 4DBRA 1C03A 2NG1A 1ORJA 3W2WA 1QKRA 3R2PA 1FR0A 4HEAJ 2VC9A 4U5DE 2AWYA 3KH2A 1D0YA 3B0PA 3DD7A 2G62A 3AGUA 4K7BA 4MTGA 1XWJA 1YVIA 2ZXRA 3RFYA 5DVWA 3R7CA 2R7VA 3NMJA 2IBFA 4Z9JA 1CGME 2EIJC 3DMDA 2JPUA 1H7IA 2XXAB 1JOGA 2ASRA 2HMQA 2RSEB 2QLAA 1YZCA 3GORA 1MNDA 3TQOA 1NSGB 2UUHA 1HMDA 2F22A 2W9YA 2FAPB 4HE8D 4JIOA 5CI9A 2XL4A 5D92A 2B0JA 3B29A 5BQIA 4OIQF 3LESA 3M15A 3WAQA 5HV9A 3C8GA 3UGPA 1D1CA 3K1IA 2XM0A 3K33A 4PFOA 2NUTB 3RVZA 4MQ9F 3T6BA 2Y39A 5JT4A 2YKZA 2HJ3A 1ZU4A 1NG1A 1S05A 3HNJA 3QMKA 1U0BB 4RD9A 2W4BA 3LEVA 4IAOA 4P9TA 1C17M 3RQGA 2KYHA 4XEVA 1V54C 3ZC4A 2IYLD 1OR2A 3I5PA 1ZHTA 4DOZA 4E0IA 1Z23A 2JX0A 4XLNF 1XZPA 4DRIB 1E83A 2HJMA 2XLWA 3US6A 4DVZA 3EGDA 3QVYA 2YHSA 2XS8A 4U5EE 2B0HA 3TJ6A 3AOUA 3F46A 4NCQA 1V4AA 4ZLDA 5F28E 4PJNA 4KI2A 1ZHYA 1RKEB 1VB5A 4C3BA 3W4YA 5KYUB 3HLZA 1WATA 1OCCC 3G50A 3MLGA 4XEFA 2QTVA 4BJTA 4E18A 4YWQA 3POVA 3LUTB 4RDAA 4XPXA 2GWWA 1TWGA 2R7WA 3JCUQ 2GA0A 3JTLO 5DS4A 1RJ9B 1PD1A 2YL7A 1E84A 4GQHA 3SXYA 2J9VA 3SXZA 3KMIA 1HW1A 3AG2C 3T9OA 4Q4ZF 2OOCA 1QPUA 5L0CA 3ZVRA 4CDYA 3A11A 3T6JA 2PFDA 4CDVA 2XXAA 1LS4A 1LKXA 1L3PA 1HMOA 2ETSA 2YZSA 3DAFA 4NTFA 2IXMA 2RD9A 4XPYA 4YN0B 3RH3A 3LEOA 1R4TA 1NU7D 2G3KA 3ZSUA 2WB7A 1Z63A 3Q6NA 3WHNA 2J8WA 2XLDA 4O6MA 1OCZC 4O6YA 5JVEA 3TJ5A 3GEEA 3FOOA 1FFTC 4CS9A 5GPGB 3W8HA 5E3CA 4ANJA 5DQZA 2KK1A 3L1MA 2Q7RA 2OJED 4HFKB 3X2QC 3AG3C
chains in the Genus database with same CATH topology
2EIKC 3B0UX 3UR3C 1M2VA 2Q9CA 2W45A 2ZPAA 4G7HF 4YT8A 2R7RA 3N0TA 3S0XA 3FHDA 3DM9B 5IY5C 1D0ZA 4U5GA 4IWBA 2JD3A 4I44A 3DXJF 3AQCA 4A2NB 2WVNA 2D5RB 4DBQA 3ZG1A 4JJFA 2A1DD 2V26A 3AG1C 3EPVA 4YT5A 3DZAA 3JT1A 3NDBB 1QLEC 4BG0A 4YT4A 3M1CB 4H4KC 3B0VC 2IOQA 4KBLA 4AE4B 5DLJA 3EGXB 4PJJA 4HFFB 4BJ5C 4U5BE 1ZHWA 5EHHA 2H7OA 2IXPA 3LNRA 3UMKA 5BUOA 2R7TA 4IRUA 1D1AA 1KU2A 5L3QA 2PF4E 3WODF 4AX2A 2C04A 4I1MA 2E87A 3HJCA 1Z3IX 2J46A 3AG4C 4OIRF 2P7VA 4E7SA 1N1CA 2KW3C 1TWAA 1VYKA 3KL4A 2X51A 3E70C 1TR2A 4RBNA 2KJGA 1JPNA 4CS7A 4Q5SF 1VOMA 1S7ZA 3W2VA 4O7GA 1MMGA 3TD7A 2EIMC 3VYWA 4FWVA 2OG2A 4FX5A 3H65A 4I1OB 3SZRA 5B3SC 3RKOF 4DVYP 4AE4A 3LAYA 3EGXA 1FTSA 2CW0F 4G7OF 3NG1A 2PX0A 2O9XA 2W4MA 1PCXA 1SZIA 2WZGA 2J9UA 4P6IC 2XSEA 1TWCA 1SF8A 5KYYB 2DYRC 2J7PD 1W2WA 1OCRC 2NUPB 3EQLF 3ABLC 1ST6A 3F47A 5T3WA 1BR2A 4PFPA 1LVKA 4KNVA 3NKEA 1ZHZA 1WGWA 4BJ6C 3OA1A 2HV6A 5DQTA 4J30B 3ASNC 4B6IA 4OINF 4QI2A 1SMYF 2Z15A 2ZXOA 2R7UA 2CGEA 4EWCA 3O39A 2J0WA 3IEEA 3RYLA 1QZXA 2NUTA 4OIOF 3SNHA 2L81A 4XWJA 2VB6A 3UGOA 2ZXWC 4IJJA 4JURI 5F5FA 1VMAA 1Z5ZA 3CQZA 4ZLCA 3V7OA 3DAGA 3DJUB 2OCCC 3JYHA 3B9QA 1OCOC 3EHMA 3S29A 1JPJA 2VH3A 2Y3HA 2I8BA 3S28A 3EZIA 4BJ5A 2Q9BA 1J8YF 3QZCA 3KKBA 5KYUA 3LLIA 5B1BC 1G8XA 2CNWD 3EZHA 3NYLA 2NUPA 3NYMA 4ULWA 5E33A 5KYWB 2WZLA 1RJ9A 2J9WA 4U5CE 4EBBA 3X1OA 2MWQA 2Y69C 3EH2A 1BR4A 2BE5F 1M57C 4OD5A 2A68F 5T1DB 1J8MF 2DGJA 3L0IA 4JCHA 4XLPF 1TWHA 3LS0A 4QDLA 3FAJA 1MNEA 2P6VA 4PK4A 3N24A 2WZFA 4CS8A 4J32B 5FCLA 4KNWA 4O6NA 3UMHA 3VAYA 2L9JA 3I5QA 4KC9A 1FMVA 2Y3BA 3CSKA 4NY3A 4C3EA 4WJ0A 3PMRA 4PJMA 2Q9AA 4M63A 3HTKC 2EILC 3EFOB 4C7OB 2HV7A 3AQBA 2G3VA 3EG9B 4BEJA 5T3TA 4GEHA 3NRHA 1ZHXA 3ASOC 2WL8A 2A6HF 4JJGA 2DYSC 4CS8C 2FGYA 3OWTA 1O87A 3FDQA 2CDQA 5CI8A 1V55C 4F4BA 5KYNA 4U5FE 4JW1A 1VYIA 1VK5A 3LS1A 4GYTA 4OIPF 2R7QA 4LLEA 1PD0A 1BR1A 5D91A 4BJ6A 1ZU5A 2C03A 4K0DA 1NU9C 3LLKA 4YJWA 1LS1A 5E2QA 2GFHA 2KQ9A 3JSZA 2ZXPA 4G0HA 4W8KA 2J7PA 1MMAA 5KYXB 4MNDA 3PHF2 2V3CC 2FFHA 4YT2A 3K66A 1M2VB 3GANA 2R7SA 3EH1A 4CSAA 3OEOA 1O5HA 2XRHA 4QI0A 3EFOA 2KNHA 4E7ZA 4C7OA 2M4EA 3EG9A 2YEVA 4JZAA 2KGOA 3DJNB 4G7ZF 1IW7F 3UNGC 1OKKA 5HSWA 3Q6MA 2Y3DA 1D0XA 1OKKD 3K1IC 2A69F 4FESA 3W8IA 2MYSA 4I3MA 4XTKA 2EINC 3DM5A 3NKDA 3SYNA 3E9VA 2WVOA 4LERA 4CSAC 2R7OA 3NYJA 3MX3A 2Q3TA 5F5HA 1ZYRF 3UMIA 3SEOA 1M2OA 3Q7LA 3FVYA 2H7VC 4CBEA 1MMDA 3L34A 2CNWA 2H7BA 3ABKC 4N06A 3K6BA 5KYXA 5KYYA 3EHNA 3N2ZB 1M56C 3Q7GA 3CZ6A 3WG7C 2A6EF 2VASA 5EGYA 1MMNA 4PJLA 3K1HA 5B1AC 5E3AA 5DS5A 4Q7CA 4O79A 4CS9C 2R7XA 3GODA 3S27A 1TKNA 4OD4A 4LLCA 3RIPA 2IXOA 3LJBA 4C3DA 3T4RA 4JVSA 5DS6A 1NZEA 1IZMA 1Z6AA 3JRTA 1D1BA 2J0XA 3EJNA 2QY9A 3EGDB 3I4UA 5L3VA 4X0RA 1FMWA 2IXNA 2PP4A 3ITFA 2WVQA 3K7DA 4LACB 4CIHA 3ABMC 2J45A 3O6XA 4U5HA 5KYWA 3SP1A 2PX3A 3ZIBA 2LSEA 1FFHA 3ECSA 4DBRA 4BJ1A 2NG1A 3W2WA 4HEAJ 4U5DE 3KH2A 4K7BA 1D0YA 3B0PA 3DD7A 2G62A 2ZXRA 3RFYA 5DVWA 2R7VA 2XXAB 2EIJC 3DMDA 1MNDA 2W9YA 4HE8D 5CI9A 5D92A 2XL4A 2B0JA 4OIQF 3LESA 3UGPA 1D1CA 4PFOA 3K33A 2NUTB 4MQ9F 3T6BA 2Y39A 3QMKA 1ZU4A 1NG1A 4RD9A 2W4BA 3LEVA 4IAOA 4AK9A 4DOZA 1V54C 3ZC4A 2IYLD 3I5PA 1ZHTA 1Z23A 4XLNF 4DVZA 3EGDA 2YHSA 4U5EE 3F46A 4ZLDA 4PJNA 4KI2A 1ZHYA 4C3BA 5KYUB 3HLZA 3MLGA 1OCCC 4BJTA 4YWQA 3POVA 2QTVA 4RDAA 1TWGA 2R7WA 3JCUQ 5DS4A 1RJ9B 1PD1A 2J9VA 3KMIA 3AG2C 4Q4ZF 3ZVRA 3T6JA 2PFDA 2XXAA 1LKXA 2YZSA 3DAFA 2IXMA 4YN0B 3RH3A 1Z63A 1NU7D 2G3KA 3ZSUA 2WB7A 3Q6NA 4O6MA 1OCZC 4O6YA 4CS9A 1FFTC 3W8HA 5E3CA 4ANJA 5DQZA 2Y3GA 4HFKB 3X2QC 3AG3C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZIB A;  4JUR I;  4J30 B;  4HFF B;  4B6I A;  4J32 B;  4HFK B;  4AX2 A; 
#chains in the Genus database with same CATH topology
 2EIK C;  2YLI A;  1JAF A;  3B0U X;  2I15 A;  3UR3 C;  1M2V A;  3MYI A;  1YJG A;  3S90 A;  2XLO A;  2Q9C A;  2W45 A;  3U8V A;  2ZPA A;  4G7H F;  4YT8 A;  2R7R A;  3N0T A;  2YL0 A;  3S0X A;  3FHD A;  3DM9 B;  5IY5 C;  1D0Z A;  4U5G A;  4IWB A;  1H9G A;  2JD3 A;  4I44 A;  2L6F A;  3AQC A;  3DXJ F;  2MHR A;  4A2N B;  4EHP A;  2WVN A;  1NFO A;  2D5R B;  1UG7 A;  3IQC A;  3VRC A;  4CJO A;  4DBQ A;  2AVK A;  3ZG1 A;  4JJF A;  2A1D D;  3GWL A;  5TJ5 E;  2V26 A;  4FAP B;  1FNT c;  3AG1 C;  4H54 A;  3EPV A;  4YT5 A;  2L6H A;  3DZA A;  4E17 A;  3S9O A;  3JT1 A;  1G5Z A;  3NDB B;  1A41 A;  3NMK A;  1QLE C;  1WWP A;  4BG0 A;  1BDJ B;  3DI5 A;  4YT4 A;  3CAX A;  3ZWI A;  3M1C B;  4IB4 A;  4H4K C;  2UUI A;  4NTA A;  3MFN A;  2X0C A;  5COG A;  3C18 A;  2IOQ A;  1ZZP A;  4KBL A;  3U2M A;  1SYQ A;  4CIP A;  3B0V C;  4IAQ A;  4AE4 B;  5DLJ A;  3EGX B;  4MVM A;  3RQE A;  4YL0 A;  4PJJ A;  5CIV A;  1T5O A;  1E2X A;  4HFF B;  4BJ5 C;  4U5B E;  2R25 A;  1QVX A;  5BQH A;  1B68 A;  1ZHW A;  1I5N A;  1HY5 A;  1YAU O;  1E86 A;  2YLD A;  3M4B A;  5EHH A;  2TMV P;  3CEX A;  4XPW A;  2GAQ A;  2OQM A;  4AL0 A;  5JRA A;  2H7O A;  2IXP A;  3LNR A;  3UMK A;  5BUO A;  2YL3 A;  3DE9 A;  2R7T A;  3ZTZ A;  4IRU A;  1D1A A;  1KU2 A;  2XL6 A;  5L3Q A;  3FXH A;  2PF4 E;  3TUL A;  1ZW3 A;  3O55 A;  5EK0 A;  3WOD F;  1AEP A;  2CCY A;  4AX2 A;  2AP3 A;  2C04 A;  4IAR A;  4I1M A;  2E87 A;  3HJC A;  1HE9 A;  1Z3I X;  3GM3 A;  2EPL X;  1NFN A;  2J46 A;  2Q00 A;  1E85 A;  3QW1 A;  3AG4 C;  3ZDL A;  4OIR F;  2P7V A;  4MTO A;  4E7S A;  1N1C A;  1PV3 A;  2KW3 C;  5L0J A;  1TWA A;  5JLI A;  1VYK A;  3KL4 A;  5A69 A;  2X51 A;  1R5I D;  1LIH A;  3E70 C;  3FAP B;  1TR2 A;  3M79 A;  4BEM J;  5A6B D;  5JUA A;  1V74 B;  4MVO A;  4RBN A;  2KJG A;  1JPN A;  1XZQ A;  4CS7 A;  4Q5S F;  1VOM A;  1GGQ A;  1S7Z A;  3C63 A;  2VCC A;  2QNL A;  3GEI A;  3W2V A;  4O7G A;  1Q0D A;  3DE8 A;  3RQF A;  3RF3 A;  1MMG A;  3TD7 A;  2EIM C;  4BPM A;  3VYW A;  1FAP B;  4FWV A;  3GEH A;  2OG2 A;  4FX5 A;  3GWN A;  3G4X A;  3H65 A;  3RW0 A;  2ICW G;  4DRJ B;  3J06 A;  4I1O B;  3SZR A;  5B3S C;  3RKO F;  2IM8 A;  4AE4 A;  4DVY P;  2R02 A;  3EGX A;  3LAY A;  1FTS A;  2LCH A;  2CW0 F;  2YLG A;  4G7O F;  3NG1 A;  4NTB A;  2PX0 A;  2XLM A;  2BL2 A;  2GDC A;  3HNK A;  2O9X A;  2W4M A;  3MBG A;  1PCX A;  1AUE A;  1SZI A;  1OXK A;  2J9U A;  2WZG A;  4P6I C;  2XSE A;  1TWC A;  2EPK X;  1EKY A;  5K0I A;  1SF8 A;  3U8P A;  3QVZ A;  5KYY B;  2DYR C;  1GM5 A;  2J7P D;  1W2W A;  1UFB A;  1OCR C;  2NUP B;  4XQ1 A;  3EQL F;  5FZT A;  3ABL C;  1YZA A;  3GM1 A;  1ORS C;  1ST6 A;  3C8Z A;  1RXQ A;  1ZVZ A;  2BC5 A;  3F47 A;  4JRZ A;  4JCZ A;  5T3W A;  1BR2 A;  4MVU A;  2Y3G A;  4PFP A;  3AGT A;  1LVK A;  4KNV A;  2XLH A;  4LDK A;  4DXW A;  2LP4 A;  2XL8 A;  5A6A A;  3U9M A;  3U5S A;  4LDQ A;  1TFO B;  1Y6D A;  1ZHZ A;  2ZD9 A;  3NKE A;  1WGW A;  3ZTM A;  4BJ6 C;  2DB4 A;  3OA1 A;  1GS9 A;  1OR3 A;  2HV6 A;  2A0U A;  1LM3 B;  5DQT A;  4CJG A;  4EBJ A;  1C02 A;  2VCB A;  4J30 B;  1YLM A;  3ASN C;  4CDA A;  4B6I A;  4OIN F;  4QI2 A;  1SMY F;  2YWA A;  2Z15 A;  2ZXO A;  2R7U A;  4U9E A;  2CGE A;  4EWC A;  3O39 A;  1CGN A;  2J0W A;  5L0I A;  3IEE A;  3RYL A;  3A9C A;  4DRH B;  1KNY A;  4D4N A;  1QZX A;  3HKK A;  2NUT A;  4D4X A;  4JC7 A;  1Z7Q c;  4NC3 A;  4OIO F;  4ONS A;  3SNH A;  2L81 A;  3U2L A;  4XWJ A;  2Q4F A;  2VB6 A;  3UGO A;  2ZXW C;  4IJJ A;  2NSF A;  1T01 A;  4JUR I;  5F5F A;  1VMA A;  1Z5Z A;  3CQZ A;  4PR9 A;  4ZLC A;  3B71 A;  3V7O A;  5AC4 A;  3DAG A;  3DJU B;  4U5F E;  3VM6 A;  2PNO A;  2OCC C;  3JYH A;  1RCP A;  2HSB A;  3B9Q A;  1OCO C;  3EHM A;  3S29 A;  1JPJ A;  1Y4C A;  2VH3 A;  2I8B A;  2Y3H A;  3PCV A;  3S28 A;  3BEH A;  1BZ4 A;  3EZI A;  3IQ6 A;  4BJ5 A;  256B A;  1J8Y F;  2Q9B A;  3KKB A;  1RKE A;  2XLV A;  3QZC A;  3LLI A;  1OXB A;  5KYU A;  5B1B C;  1G8X A;  2CNW D;  3EZH A;  3NYL A;  1G4W R;  2EPO A;  2NUP A;  2A0B A;  3NYM A;  3U0C A;  4ULW A;  5A6K A;  1SR2 A;  3QTH A;  1JMW A;  1OW8 A;  2HKV A;  4JKV A;  2YRF A;  5E33 A;  2WZL A;  5KYW B;  1RJ9 A;  3KPH A;  2J9W A;  4U5C E;  4EBB A;  3X1O A;  2L6G A;  2MWQ A;  4CX9 A;  2EPN A;  4E0H A;  1YYJ A;  2Y69 C;  3EH2 A;  3PDM P;  1BR4 A;  2BE5 F;  1M57 C;  3ZQV A;  4OD5 A;  4ER9 A;  2A68 F;  4MVR A;  5T1D B;  1J8M F;  2AWC A;  1YAR O;  2OEX A;  2DGJ A;  5B3I A;  3L0I A;  5L0G A;  1H6G A;  4JCH A;  2HUJ A;  1YA9 A;  4XLP F;  1TWH A;  2QUP A;  5BQG A;  3V5X A;  3LS0 A;  4QDL A;  3FAJ A;  1MNE A;  4UDV A;  2P6V A;  1QSP A;  4N4W A;  2J9B A;  5L0F A;  1T6I A;  4PK4 A;  2OU6 A;  2WZF A;  3N24 A;  4MVZ A;  4CS8 A;  4J32 B;  3JSE O;  5FCL A;  1LPE A;  4KNW A;  4O6N A;  3UMH A;  3VAY A;  2L9J A;  3JZ0 A;  1T9K A;  3JYY A;  1RMV A;  5JSL A;  3I5Q A;  4KC9 A;  1FMV A;  2R03 A;  2Y3B A;  3CSK A;  3HNL A;  2XLE A;  3IQ5 A;  4NY3 A;  4C3E A;  4WJ0 A;  3PMR A;  1JR8 A;  1CGO A;  4PJM A;  4IGG A;  2Q9A A;  2VCA A;  4M63 A;  4K1O A;  3HTK C;  2EIL C;  2HZ8 A;  4MW8 A;  3EFO B;  4C7O B;  4U9D A;  2HV7 A;  3AQB A;  2G3V A;  3EG9 B;  1Q0M A;  4BEJ A;  1HE1 A;  5T3T A;  2OKU A;  3KYI A;  1VLT A;  4WAB A;  5A6B A;  1DOV A;  1ORY A;  4GEH A;  3NRH A;  2D4U A;  1ZHX A;  3ASO C;  2WL8 A;  5JP7 A;  3IHU A;  2A6H F;  4JJG A;  2DYS C;  3SXK A;  2FGY A;  4CS8 C;  4L6R A;  3OWT A;  1O87 A;  3FDQ A;  2CDQ A;  5CI8 A;  4EKW A;  1V55 C;  4P9F A;  4F4B A;  5KYN A;  3VF0 A;  2LD6 A;  4JE9 A;  4JW1 A;  1VYI A;  1WAS A;  1I4Y A;  1VK5 A;  2NSG A;  3LS1 A;  4GYT A;  4JTA B;  4OIP F;  2R7Q A;  4LLE A;  3ATP A;  1Q0G A;  1PD0 A;  1BR1 A;  5D91 A;  1VTM P;  2XS1 A;  4BJ6 A;  1ZU5 A;  2C03 A;  2HMZ A;  4JTD B;  1EA8 A;  1NU9 C;  4K0D A;  1KTM A;  1GQA A;  3LNM B;  3LLK A;  3QW0 A;  4YJW A;  4A4A A;  1LS1 A;  3V5Y A;  1DOW A;  1K04 A;  5E2Q A;  2GFH A;  2KQ9 A;  3JSZ A;  1EQ1 A;  1O3U A;  1Q0K A;  2ZXP A;  2LFD A;  4G0H A;  3SXM A;  4W8K A;  2J7P A;  3T6G B;  1MMA A;  3IQT A;  2KC3 A;  1H9T A;  4N6H A;  4MND A;  1T6Q A;  5COF A;  4YL1 A;  5KYX B;  5JS5 A;  3PHF 2;  2V3C C;  3C8G D;  3G4Z A;  2FFH A;  4YT2 A;  4G78 A;  3K66 A;  1TFK B;  1M2V B;  4AL1 A;  3GAN A;  4J7T A;  4JEB A;  2R7S A;  3EH1 A;  3U3F A;  4CSA A;  3BRJ A;  2YVK A;  1YDI A;  1O5H A;  3OEO A;  4EBK A;  4PAC A;  1APC A;  1JRA A;  2XRH A;  4QI0 A;  3EFO A;  2KNH A;  4E7Z A;  4C7O A;  1A7E A;  2P1A A;  3GM2 A;  1I4Z A;  2M4E A;  3EG9 A;  2YEV A;  4JZA A;  2CYD A;  1VLS A;  2KGO A;  3M4C A;  1OW7 A;  2P0N A;  2R05 A;  3DJN B;  4MVS A;  2LQG A;  4J7Y A;  2OJQ A;  4G7Z F;  1IW7 F;  3UNG C;  1NBB A;  3JRM O;  3L8J A;  5A6J A;  1OKK A;  1Q0F A;  4MW3 A;  3MYF A;  5HSW A;  3Q6M A;  4W8P A;  2Y3D A;  1D0X A;  1OKK D;  2KSF A;  1K40 A;  3DKA A;  3K1I C;  2A69 F;  1U6H A;  4FES A;  3W8I A;  2EPM X;  1TQG A;  2MYS A;  4I3M A;  4XTK A;  1ZW2 A;  1YYX A;  2DI3 A;  2EIN C;  4AK9 A;  3DM5 A;  3NKD A;  2OEV A;  4JTC B;  3SYN A;  3E9V A;  2WVO A;  2R9R B;  1T6U A;  4LER A;  2L7A A;  2R7O A;  2LFF A;  1A7D A;  2AU5 A;  3HNI A;  2Q3T A;  3MX3 A;  3NYJ A;  3H2V A;  5COM A;  5F5H A;  4EUK B;  1F1M A;  1ZYR F;  5L0D A;  3UMI A;  1A7V A;  3SEO A;  4CSA C;  1M2O A;  3Q7L A;  1OQC A;  3L8I A;  3FVY A;  2H7V C;  4CBE A;  1MMD A;  3L34 A;  1K05 A;  2CNW A;  2H7B A;  3ABK C;  1WN0 A;  3H2U A;  4DJ9 A;  1NLX A;  3FOP A;  2H8A A;  2HSQ A;  2PBE A;  1BBH A;  3K6B A;  3EHN A;  4N06 A;  5KYX A;  5KYY A;  1WTY A;  5L0H A;  3TOL A;  4Z9I A;  4JEA A;  1CPR A;  1M56 C;  3N2Z B;  1HW2 A;  1LE4 A;  3CZ6 A;  3Q7G A;  3WG7 C;  4NQF A;  2A6E F;  2VAS A;  3IPM O;  3U3B A;  1OW6 A;  3TK0 A;  2LIG A;  1CPQ A;  5EGY A;  2LK4 A;  1MMN A;  3DWW A;  1L7C A;  4MTF A;  4PJL A;  4YK5 A;  2XM4 A;  3K1H A;  5B1A C;  5E3A A;  2YL1 A;  5DS5 A;  1M6T A;  4LDR A;  4Z9H A;  4Q7C A;  3AJM A;  4O79 A;  1U89 A;  1G4U S;  3S84 A;  4CS9 C;  2R7X A;  1RKC A;  2HFI A;  2HS5 A;  3GOD A;  1TKN A;  2M64 A;  3S27 A;  4OD4 A;  3NMI A;  1AVO B;  4LLC A;  3C8G B;  3RIP A;  2IXO A;  4EIY A;  3LJB A;  4MVQ A;  4MS2 A;  4C3D A;  3T4R A;  4JVS A;  5DS6 A;  1NZE A;  1IZM A;  1Z6A A;  3FMS A;  4R32 A;  1QQ3 A;  3JRT A;  3O10 A;  1D1B A;  2J0X A;  3EJN A;  4N6C A;  4YL3 A;  3KYJ A;  1LE2 A;  1LI7 A;  3ZQY A;  2QY9 A;  4XEK A;  1LI5 A;  3TOM A;  1WOL A;  5AC5 A;  3EGD B;  3I4U A;  5L3V A;  4WGZ A;  1YA7 O;  1FMW A;  2YQY A;  2IXN A;  4X0R A;  3RVY A;  3V5Z A;  2PP4 A;  1MQV A;  2WVQ A;  3ITF A;  3K7D A;  1A0B A;  4LAC B;  4CIH A;  3ABM C;  5AGF A;  4WGY A;  2QE9 A;  2J45 A;  3U9J A;  3O6X A;  3C7J A;  4U5H A;  5KYW A;  3SP1 A;  2PX3 A;  3ZIB A;  2LSE A;  2P61 A;  1FFH A;  1EI7 A;  4ULV A;  2NPU A;  3ECS A;  3C62 A;  4BJ1 A;  4DBR A;  1C03 A;  2NG1 A;  1ORJ A;  3W2W A;  1QKR A;  3R2P A;  1FR0 A;  4HEA J;  2VC9 A;  4U5D E;  2AWY A;  3KH2 A;  1D0Y A;  3B0P A;  3DD7 A;  2G62 A;  3AGU A;  4K7B A;  4MTG A;  1XWJ A;  1YVI A;  2ZXR A;  3RFY A;  5DVW A;  3R7C A;  2R7V A;  3NMJ A;  2IBF A;  4Z9J A;  1CGM E;  2EIJ C;  3DMD A;  2JPU A;  1H7I A;  2XXA B;  1JOG A;  2ASR A;  2HMQ A;  2RSE B;  2QLA A;  1YZC A;  3GOR A;  1MND A;  3TQO A;  1NSG B;  2UUH A;  1HMD A;  2F22 A;  2W9Y A;  2FAP B;  4HE8 D;  4JIO A;  5CI9 A;  2XL4 A;  5D92 A;  2B0J A;  3B29 A;  5BQI A;  4OIQ F;  3LES A;  3M15 A;  3WAQ A;  5HV9 A;  3C8G A;  3UGP A;  1D1C A;  3K1I A;  2XM0 A;  3K33 A;  4PFO A;  2NUT B;  3RVZ A;  4MQ9 F;  3T6B A;  2Y39 A;  5JT4 A;  2YKZ A;  2HJ3 A;  1ZU4 A;  1NG1 A;  1S05 A;  3HNJ A;  3QMK A;  1U0B B;  4RD9 A;  2W4B A;  3LEV A;  4IAO A;  4P9T A;  1C17 M;  3RQG A;  2KYH A;  4XEV A;  1V54 C;  3ZC4 A;  2IYL D;  1OR2 A;  3I5P A;  1ZHT A;  4DOZ A;  4E0I A;  1Z23 A;  2JX0 A;  4XLN F;  1XZP A;  4DRI B;  1E83 A;  2HJM A;  2XLW A;  3US6 A;  4DVZ A;  3EGD A;  3QVY A;  2YHS A;  2XS8 A;  4U5E E;  2B0H A;  3TJ6 A;  3AOU A;  3F46 A;  4NCQ A;  1V4A A;  4ZLD A;  5F28 E;  4PJN A;  4KI2 A;  1ZHY A;  1RKE B;  1VB5 A;  4C3B A;  3W4Y A;  5KYU B;  3HLZ A;  1WAT A;  1OCC C;  3G50 A;  3MLG A;  4XEF A;  2QTV A;  4BJT A;  4E18 A;  4YWQ A;  3POV A;  3LUT B;  4RDA A;  4XPX A;  2GWW A;  1TWG A;  2R7W A;  3JCU Q;  2GA0 A;  3JTL O;  5DS4 A;  1RJ9 B;  1PD1 A;  2YL7 A;  1E84 A;  4GQH A;  3SXY A;  2J9V A;  3SXZ A;  3KMI A;  1HW1 A;  3AG2 C;  3T9O A;  4Q4Z F;  2OOC A;  1QPU A;  5L0C A;  3ZVR A;  4CDY A;  3A11 A;  3T6J A;  2PFD A;  4CDV A;  2XXA A;  1LS4 A;  1LKX A;  1L3P A;  1HMO A;  2ETS A;  2YZS A;  3DAF A;  4NTF A;  2IXM A;  2RD9 A;  4XPY A;  4YN0 B;  3RH3 A;  3LEO A;  1R4T A;  1NU7 D;  2G3K A;  3ZSU A;  2WB7 A;  1Z63 A;  3Q6N A;  3WHN A;  2J8W A;  2XLD A;  4O6M A;  1OCZ C;  4O6Y A;  5JVE A;  3TJ5 A;  3GEE A;  3FOO A;  1FFT C;  4CS9 A;  5GPG B;  3W8H A;  5E3C A;  4ANJ A;  5DQZ A;  2KK1 A;  3L1M A;  2Q7R A;  2OJE D;  4HFK B;  3X2Q C;  3AG3 C; 
#chains in the Genus database with same CATH homology
 2EIK C;  3B0U X;  3UR3 C;  1M2V A;  2Q9C A;  2W45 A;  2ZPA A;  4G7H F;  4YT8 A;  2R7R A;  3N0T A;  3S0X A;  3FHD A;  3DM9 B;  5IY5 C;  1D0Z A;  4U5G A;  4IWB A;  2JD3 A;  4I44 A;  3DXJ F;  3AQC A;  4A2N B;  2WVN A;  2D5R B;  4DBQ A;  3ZG1 A;  4JJF A;  2A1D D;  2V26 A;  3AG1 C;  3EPV A;  4YT5 A;  3DZA A;  3JT1 A;  3NDB B;  1QLE C;  4BG0 A;  4YT4 A;  3M1C B;  4H4K C;  3B0V C;  2IOQ A;  4KBL A;  4AE4 B;  5DLJ A;  3EGX B;  4PJJ A;  4HFF B;  4BJ5 C;  4U5B E;  1ZHW A;  5EHH A;  2H7O A;  2IXP A;  3LNR A;  3UMK A;  5BUO A;  2R7T A;  4IRU A;  1D1A A;  1KU2 A;  5L3Q A;  2PF4 E;  3WOD F;  4AX2 A;  2C04 A;  4I1M A;  2E87 A;  3HJC A;  1Z3I X;  2J46 A;  3AG4 C;  4OIR F;  2P7V A;  4E7S A;  1N1C A;  2KW3 C;  1TWA A;  1VYK A;  3KL4 A;  2X51 A;  3E70 C;  1TR2 A;  4RBN A;  2KJG A;  1JPN A;  4CS7 A;  4Q5S F;  1VOM A;  1S7Z A;  3W2V A;  4O7G A;  1MMG A;  3TD7 A;  2EIM C;  3VYW A;  4FWV A;  2OG2 A;  4FX5 A;  3H65 A;  4I1O B;  3SZR A;  5B3S C;  3RKO F;  4DVY P;  4AE4 A;  3LAY A;  3EGX A;  1FTS A;  2CW0 F;  4G7O F;  3NG1 A;  2PX0 A;  2O9X A;  2W4M A;  1PCX A;  1SZI A;  2WZG A;  2J9U A;  4P6I C;  2XSE A;  1TWC A;  1SF8 A;  5KYY B;  2DYR C;  2J7P D;  1W2W A;  1OCR C;  2NUP B;  3EQL F;  3ABL C;  1ST6 A;  3F47 A;  5T3W A;  1BR2 A;  4PFP A;  1LVK A;  4KNV A;  3NKE A;  1ZHZ A;  1WGW A;  4BJ6 C;  3OA1 A;  2HV6 A;  5DQT A;  4J30 B;  3ASN C;  4B6I A;  4OIN F;  4QI2 A;  1SMY F;  2Z15 A;  2ZXO A;  2R7U A;  2CGE A;  4EWC A;  3O39 A;  2J0W A;  3IEE A;  3RYL A;  1QZX A;  2NUT A;  4OIO F;  3SNH A;  2L81 A;  4XWJ A;  2VB6 A;  3UGO A;  2ZXW C;  4IJJ A;  4JUR I;  5F5F A;  1VMA A;  1Z5Z A;  3CQZ A;  4ZLC A;  3V7O A;  3DAG A;  3DJU B;  2OCC C;  3JYH A;  3B9Q A;  1OCO C;  3EHM A;  3S29 A;  1JPJ A;  2VH3 A;  2Y3H A;  2I8B A;  3S28 A;  3EZI A;  4BJ5 A;  2Q9B A;  1J8Y F;  3QZC A;  3KKB A;  5KYU A;  3LLI A;  5B1B C;  1G8X A;  2CNW D;  3EZH A;  3NYL A;  2NUP A;  3NYM A;  4ULW A;  5E33 A;  5KYW B;  2WZL A;  1RJ9 A;  2J9W A;  4U5C E;  4EBB A;  3X1O A;  2MWQ A;  2Y69 C;  3EH2 A;  1BR4 A;  2BE5 F;  1M57 C;  4OD5 A;  2A68 F;  5T1D B;  1J8M F;  2DGJ A;  3L0I A;  4JCH A;  4XLP F;  1TWH A;  3LS0 A;  4QDL A;  3FAJ A;  1MNE A;  2P6V A;  4PK4 A;  3N24 A;  2WZF A;  4CS8 A;  4J32 B;  5FCL A;  4KNW A;  4O6N A;  3UMH A;  3VAY A;  2L9J A;  3I5Q A;  4KC9 A;  1FMV A;  2Y3B A;  3CSK A;  4NY3 A;  4C3E A;  4WJ0 A;  3PMR A;  4PJM A;  2Q9A A;  4M63 A;  3HTK C;  2EIL C;  3EFO B;  4C7O B;  2HV7 A;  3AQB A;  2G3V A;  3EG9 B;  4BEJ A;  5T3T A;  4GEH A;  3NRH A;  1ZHX A;  3ASO C;  2WL8 A;  2A6H F;  4JJG A;  2DYS C;  4CS8 C;  2FGY A;  3OWT A;  1O87 A;  3FDQ A;  2CDQ A;  5CI8 A;  1V55 C;  4F4B A;  5KYN A;  4U5F E;  4JW1 A;  1VYI A;  1VK5 A;  3LS1 A;  4GYT A;  4OIP F;  2R7Q A;  4LLE A;  1PD0 A;  1BR1 A;  5D91 A;  4BJ6 A;  1ZU5 A;  2C03 A;  4K0D A;  1NU9 C;  3LLK A;  4YJW A;  1LS1 A;  5E2Q A;  2GFH A;  2KQ9 A;  3JSZ A;  2ZXP A;  4G0H A;  4W8K A;  2J7P A;  1MMA A;  5KYX B;  4MND A;  3PHF 2;  2V3C C;  2FFH A;  4YT2 A;  3K66 A;  1M2V B;  3GAN A;  2R7S A;  3EH1 A;  4CSA A;  3OEO A;  1O5H A;  2XRH A;  4QI0 A;  3EFO A;  2KNH A;  4E7Z A;  4C7O A;  2M4E A;  3EG9 A;  2YEV A;  4JZA A;  2KGO A;  3DJN B;  4G7Z F;  1IW7 F;  3UNG C;  1OKK A;  5HSW A;  3Q6M A;  2Y3D A;  1D0X A;  1OKK D;  3K1I C;  2A69 F;  4FES A;  3W8I A;  2MYS A;  4I3M A;  4XTK A;  2EIN C;  3DM5 A;  3NKD A;  3SYN A;  3E9V A;  2WVO A;  4LER A;  4CSA C;  2R7O A;  3NYJ A;  3MX3 A;  2Q3T A;  5F5H A;  1ZYR F;  3UMI A;  3SEO A;  1M2O A;  3Q7L A;  3FVY A;  2H7V C;  4CBE A;  1MMD A;  3L34 A;  2CNW A;  2H7B A;  3ABK C;  4N06 A;  3K6B A;  5KYX A;  5KYY A;  3EHN A;  3N2Z B;  1M56 C;  3Q7G A;  3CZ6 A;  3WG7 C;  2A6E F;  2VAS A;  5EGY A;  1MMN A;  4PJL A;  3K1H A;  5B1A C;  5E3A A;  5DS5 A;  4Q7C A;  4O79 A;  4CS9 C;  2R7X A;  3GOD A;  3S27 A;  1TKN A;  4OD4 A;  4LLC A;  3RIP A;  2IXO A;  3LJB A;  4C3D A;  3T4R A;  4JVS A;  5DS6 A;  1NZE A;  1IZM A;  1Z6A A;  3JRT A;  1D1B A;  2J0X A;  3EJN A;  2QY9 A;  3EGD B;  3I4U A;  5L3V A;  4X0R A;  1FMW A;  2IXN A;  2PP4 A;  3ITF A;  2WVQ A;  3K7D A;  4LAC B;  4CIH A;  3ABM C;  2J45 A;  3O6X A;  4U5H A;  5KYW A;  3SP1 A;  2PX3 A;  3ZIB A;  2LSE A;  1FFH A;  3ECS A;  4DBR A;  4BJ1 A;  2NG1 A;  3W2W A;  4HEA J;  4U5D E;  3KH2 A;  4K7B A;  1D0Y A;  3B0P A;  3DD7 A;  2G62 A;  2ZXR A;  3RFY A;  5DVW A;  2R7V A;  2XXA B;  2EIJ C;  3DMD A;  1MND A;  2W9Y A;  4HE8 D;  5CI9 A;  5D92 A;  2XL4 A;  2B0J A;  4OIQ F;  3LES A;  3UGP A;  1D1C A;  4PFO A;  3K33 A;  2NUT B;  4MQ9 F;  3T6B A;  2Y39 A;  3QMK A;  1ZU4 A;  1NG1 A;  4RD9 A;  2W4B A;  3LEV A;  4IAO A;  4AK9 A;  4DOZ A;  1V54 C;  3ZC4 A;  2IYL D;  3I5P A;  1ZHT A;  1Z23 A;  4XLN F;  4DVZ A;  3EGD A;  2YHS A;  4U5E E;  3F46 A;  4ZLD A;  4PJN A;  4KI2 A;  1ZHY A;  4C3B A;  5KYU B;  3HLZ A;  3MLG A;  1OCC C;  4BJT A;  4YWQ A;  3POV A;  2QTV A;  4RDA A;  1TWG A;  2R7W A;  3JCU Q;  5DS4 A;  1RJ9 B;  1PD1 A;  2J9V A;  3KMI A;  3AG2 C;  4Q4Z F;  3ZVR A;  3T6J A;  2PFD A;  2XXA A;  1LKX A;  2YZS A;  3DAF A;  2IXM A;  4YN0 B;  3RH3 A;  1Z63 A;  1NU7 D;  2G3K A;  3ZSU A;  2WB7 A;  3Q6N A;  4O6M A;  1OCZ C;  4O6Y A;  4CS9 A;  1FFT C;  3W8H A;  5E3C A;  4ANJ A;  5DQZ A;  2Y3G A;  4HFK B;  3X2Q C;  3AG3 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...