2WL8A

X-ray crystal structure of pex19p
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
110
structure length
110
Chain Sequence
ILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESLPPEQFEKYQEQHSVMCKICEQFEAETPTDSETTQKARFEMVLDLMQQLQDLGHPPKELAGEMPPGLNFDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PEROXISOMAL BIOGENESIS FACTOR 19
publication title The Peroxisomal Receptor Pex19P Forms a Helical Mpts Recognition Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 36
structure length 110
sequence length 110
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-06-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.900 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2wl8A00
2WL8A
chains in the Genus database with same CATH superfamily
2C03A 3H2VA 4NCQA 1K04A 5T3WA 1G8XA 1FTSA 1GM5A 1M2VA 3C8GD 4H4KC 4CIPA 4U5FE 3UMHA 2G3VA 3HKKA 3NDBB 2J0WA 4XPXA 3HJCA 3EFOB 1OW8A 3Q7LA 2XLHA 1J8MF 3RIPA 5JS5A 3F46A 3TOLA 3U2LA 1PD1A 5T3TA 3T9OA 4ANJA 4O6YA 3U9JA 2ICWG 4IRUA 2YHSA 3O10A 2IOQA 2LFDA 4ULVA 3NYMA 1H9GA 5IY5C 2PX0A 5EGYA 1HY5A 1VK5A 3NKDA 4O7GA 4PJNA 1YYJA 3AG2C 2W9YA 3WG7C 2WVOA 4IARA 4AL1A 3NG1A 4DVZA 2R7WA 1FNTc 1J8YF 2HMQA 5L0IA 1OW6A 2GFHA 2IYLD 1KNYA 2IXPA 2Y39A 3DWWA 1ORSC 4K0DA 3U9MA 1TKNA 2J0XA 4PJMA 1UG7A 2P7VA 4CSAC 2PX3A 5L0HA 1H7IA 2IM8A 1YYXA 3CQZA 5DLJA 1EQ1A 3RVZA 4U9EA 4Z9IA 5KYNA 1NFNA 4AK9A 4MNDA 3SXMA 2OOCA 4HFFB 4LACB 4IJJA 3S0XA 3ZWIA 1E83A 2HSBA 5F5HA 2LFFA 2Q9AA 1E2XA 1LIHA 2YVKA 1O87A 2XLMA 3G4XA 3MBGA 2R7UA 3T6JA 4AE4A 3SZRA 1MNDA 4DRHB 1HMDA 2VCCA 1BZ4A 1S7ZA 1D1AA 3Q6NA 4NQFA 4RDAA 1EI7A 2YLDA 1LM3B 3ZQVA 1VMAA 5B1BC 1O3UA 1ORJA 1Q0GA 2AP3A 1LPEA 2KK1A 5DQTA 3GM3A 4BG0A 4OINF 2VH3A 1MMDA 1RJ9B 3CAXA 3U2MA 1DOWA 2EILC 3FXHA 3W8HA 3UGOA 2WVQA 2ZXRA 5CIVA 1SR2A 3O6XA 1M6TA 2H7VC 2OKUA 4Z9JA 5L0JA 2PP4A 1TWCA 2EIMC 3EHNA 3HNIA 2IXMA 4XTKA 1WASA 2CNWD 2YLIA 1SF8A 5L3QA 1RKCA 2KQ9A 4DRJB 4LERA 1YDIA 2LD6A 1U89A 2XM4A 4AL0A 3SEOA 3ABMC 3LUTB 4NTFA 1I4YA 1HMOA 3W4YA 2E87A 2HV7A 2HSQA 3K33A 3AJMA 4O6NA 4O79A 4C7OA 1QPUA 1RKEB 1VLTA 2XM0A 1Q0KA 2EPOA 2Q00A 3ZTZA 1FR0A 4K1OA 3TOMA 5E3AA 5KYXB 1OCOC 1TFOB 2XLDA 4LLEA 4YT2A 2L9JA 1Q0MA 2UUHA 1JAFA 5E2QA 3EQLF 4I1OB 1LI7A 3HNJA 1M56C 4JVSA 5E33A 1NU9C 2EINC 4JTCB 4CS8C 2R7XA 3GWNA 1LS4A 4IWBA 2XS8A 3VF0A 3A9CA 1Y6DA 3BRJA 3K1HA 4LDRA 4MS2A 3M1CB 3K7DA 1NFOA 2H7OA 3M79A 4PFOA 3AG3C 1MNEA 3J06A 1BR1A 3QTHA 4CDAA 3OWTA 4P9FA 4I3MA 4WGYA 5JSLA 1WTYA 3FMSA 1D1CA 2R05A 3GORA 5A6JA 3EPVA 3M4CA 1FAPB 2GDCA 4PR9A 3LEOA 3ZVRA 3S28A 3TK0A 3LEVA 1TFKB 3Q7GA 3B0PA 3TJ5A 3TJ6A 3ABKC 1ZHZA 3G50A 1ZU5A 1ZW2A 5D92A 1EA8A 1JRAA 2EPMX 2FFHA 1T6UA 2RSEB 2L7AA 5JRAA 4E7SA 1K40A 1W2WA 2HKVA 1SMYF 1T01A 3NRHA 1NG1A 5JLIA 3JCUQ 4Q7CA 2R25A 1M2OA 4XPYA 2KYHA 1R4TA 3C18A 3GANA 3S84A 1F1MA 4YL0A 4MVRA 3E9VA 4YK5A 3VRCA 4E0IA 1WOLA 2R7TA 4XPWA 2NSFA 3US6A 1TWHA 4NTBA 1G4WR 1YAUO 4JCZA 3EH2A 3LLKA 4CSAA 1E86A 4KNWA 3GM1A 1A7VA 4IB4A 3FVYA 1HE1A 4U5CE 2NUPA 3TD7A 3K66A 4CDYA 4J7YA 5AC5A 1HW2A 1ORYA 4MVZA 3FOPA 1A41A 4PFPA 2A6HF 1QKRA 2J8WA 3DM9B 2Y69C 1U0BB 4YN0B 3R7CA 3L1MA 4CJGA 2HJMA 2I15A 3KKBA 3GODA 4CX9A 4DBRA 2GWWA 3EGXA 5FCLA 1D0ZA 1TR2A 4KBLA 3ASOC 3KYIA 3FDQA 2XXAB 2KJGA 4EIYA 3AGUA 5KYWB 1FFHA 1LVKA 4EHPA 3C7JA 1YZCA 2CDQA 1TWGA 4PJJA 1RMVA 1JMWA 1QQ3A 3E70C 3EZHA 4JTAB 3IQCA 1E84A 4Z9HA 4ONSA 3C62A 5JT4A 5L0GA 2VASA 4XEVA 2I8BA 4QDLA 3DI5A 4U5EE 2YEVA 2FAPB 4HEAJ 2KC3A 1MMAA 2XLOA 4R32A 1RCPA 5COMA 4E18A 3GWLA 4OIRF 4KNVA 5E3CA 2QY9A 1U6HA 256BA 2G3KA 2MYSA 3EJNA 3LLIA 4IAQA 2L6HA 5AC4A 4D4NA 5A6BD 1APCA 2BE5F 2Q4FA 4MW8A 4OIPF 1M2VB 4MTGA 2XLEA 2R02A 3POVA 1OKKA 3MX3A 3X2QC 3FHDA 3IEEA 3HNLA 1VOMA 1ZHWA 3V7OA 2DYSC 3PHF2 2R7SA 3UMIA 2LCHA 4QI0A 3W2VA 3IHUA 4JCHA 2NPUA 4JJGA 2EIKC 1G5ZA 3DZAA 2TMVP 2UUIA 5JP7A 3DE8A 4YL3A 1T6QA 3NKEA 3RQFA 4G0HA 1JPNA 2AU5A 5DS5A 4CDVA 1CGOA 2NG1A 3DJUB 3I5QA 1ZVZA 3QMKA 4CS8A 5A69A 4P6IC 3MLGA 1KU2A 5DVWA 3SNHA 2HZ8A 4WJ0A 3UR3C 3KYJA 1HW1A 1K05A 3U8VA 4A2NB 3GM2A 5BQHA 2LP4A 3K1IC 3T4RA 3JSZA 3QVZA 2XXAA 4HE8D 4LDQA 1GS9A 1V4AA 4P9TA 4OIOF 3ZIBA 1BBHA 5COGA 4I1MA 1XZQA 1I4ZA 3FOOA 1OCZC 5TJ5E 4MTFA 2AVKA 3B29A 2NSGA 4FWVA 3RYLA 1YZAA 1D1BA 4I44A 4N06A 5COFA 3RW0A 1AEPA 4AE4B 2O9XA 3S90A 1WN0A 3ZSUA 3DM5A 3B71A 3U0CA 4W8PA 1C03A 5EK0A 5K0IA 2QNLA 3O55A 3ZTMA 2EPKX 2CGEA 2W45A 3JYHA 2JPUA 3EH1A 1ST6A 2JX0A 1AUEA 1IZMA 1OR3A 2ZD9A 1I5NA 3C8ZA 3EZIA 2P61A 3RKOF 2FGYA 2ZPAA 4IAOA 1CPQA 1D0YA 3NMJA 2XL4A 2YL3A 3QW0A 4W8KA 4JEBA 1JPJA 5KYUA 3KPHA 2YL0A 3VM6A 4BJ5C 4Q5SF 3LNRA 4M63A 3QVYA 3ZDLA 2PBEA 4JW1A 4CS9C 4K7BA 2KGOA 5BQGA 2W4BA 4ULWA 3JSEO 2OJQA 3B9QA 3WHNA 2OU6A 1G4US 4Q4ZF 3EGDA 1WWPA 1YA9A 2KSFA 2XLVA 4XQ1A 3RH3A 3VAYA 2ETSA 2GA0A 2QTVA 1Z6AA 4GQHA 3T6GB 2CYDA 2MHRA 4JEAA 3LESA 3S29A 4G7ZF 4C7OB 2EPLX 2QLAA 4C3EA 1Z7Qc 4MVMA 5L0FA 1OCRC 4BEMJ 5T1DB 1SYQA 2Y3GA 2BL2A 2CNWA 2HMZA 2M4EA 1R5ID 2W4MA 3LJBA 4DVYP 3LAYA 3ABLC 4IGGA 5KYUB 2MWQA 4MVUA 2P6VA 1MQVA 3FAJA 3ITFA 3SXZA 1JR8A 2VB6A 1OXKA 3IQ5A 4JURI 1VYKA 2EPNA 2A0BA 2QE9A 1V55C 2P0NA 2YLGA 2ASRA 2Q9BA 3DAFA 3EG9A 1NSGB 1OCCC 4NC3A 4PJLA 2G62A 3HNKA 2BC5A 2ZXWC 5D91A 2PF4E 3HLZA 1YJGA 1NBBA 1ZHXA 3CSKA 4OD4A 5L0DA 2ZXOA 3W2WA 4HFKB 2EIJC 3UMKA 4BJ6C 2YL1A 1XWJA 4BJ1A 2AWYA 2YL7A 1V54C 3L34A 1YARO 1NU7D 2R9RB 4U5DE 1A7DA 3AG4C 4F4BA 4YJWA 2DI3A 5KYYA 1H9TA 2OQMA 1VLSA 1WGWA 2WZGA 1CGME 1LS1A 1MMNA 1TWAA 2J7PA 3N0TA 3I4UA 2J45A 3KL4A 1Y4CA 4JE9A 2OCCC 3G4ZA 4MVOA 3JRMO 1YLMA 3RVYA 2RD9A 5BUOA 5DS4A 5HSWA 1N1CA 2J9BA 3X1OA 3JZ0A 3PMRA 1E85A 1OKKD 1UFBA 2LK4A 1FMWA 2KW3C 2Q3TA 2WL8A 3F47A 3OA1A 4AX2A 1PV3A 3NYLA 2H7BA 4FAPB 4ZLDA 1OW7A 5B1AC 3FAPB 4LDKA 4CBEA 2OJED 2Q7RA 3K1IA 1DOVA 3NMIA 3B0VC 2NUPB 1D0XA 2HUJA 2X51A 2XSEA 3DXJF 4MVQA 3RQGA 1FMVA 3JRTA 5KYYB 3S27A 1QZXA 1YVIA 3QW1A 3KMIA 3M15A 5FZTA 4OIQF 1Q0FA 3SYNA 3LS1A 1BR4A 3GEHA 4B6IA 1LKXA 4X0RA 1OQCA 2WB7A 3ECSA 3IPMO 3JTLO 3MYIA 4XLNF 2YKZA 3EGXB 2AWCA 3IQTA 4C3BA 4JIOA 4CS7A 2XL6A 4NTAA 4E0HA 4YWQA 1Z5ZA 4CIHA 4RBNA 4CJOA 1V74B 4D4XA 2R7VA 2YRFA 5CI9A 3IQ6A 3SP1A 1S05A 5CI8A 2L6GA 2IXOA 4JZAA 1ZHYA 2B0HA 3AOUA 2NUTA 1LI5A 3AQBA 4N4WA 3RFYA 1ZW3A 3U5SA 1RJ9A 4BJ5A 3C8GA 1T9KA 1L3PA 2YWAA 4YT4A 3BEHA 4KI2A 1KTMA 3A11A 3KH2A 4CS9A 2HFIA 4U5GA 3W8IA 3JT1A 1HE9A 3U8PA 1RXQA 3ASNC 1WATA 5F28E 2PNOA 4FESA 1ZHTA 3RQEA 3PDMP 1AVOB 1T5OA 2LSEA 4JTDB 4OD5A 2J46A 1PCXA 1Z23A 4FX5A 4G7HF 2A6EF 2B0JA 5DQZA 2GAQA 3N24A 3RF3A 4UDVA 3T6BA 4O6MA 2H8AA 2R7RA 2XL8A 3R2PA 4BJTA 1RKEA 4NY3A 4PACA 1IW7F 2DB4A 3DAGA 2V3CC 4J7TA 3L0IA 2VC9A 2NUTB 3N2ZB 3WAQA 5L0CA 5JUAA 3DD7A 5KYXA 5A6BA 3U3BA 1QSPA 3U3FA 2JD3A 3C8GB 1NLXA 2DGJA 2XRHA 2L81A 3C63A 4U9DA 1VB5A 2X0CA 2LIGA 4N6HA 3V5XA 1M57C 4H54A 2R7OA 4DRIB 4YL1A 4QI2A 1PD0A 2P1AA 4XEKA 1A0BA 4WGZA 1H6GA 2YZSA 2A68F 4JKVA 1ZYRF 4MW3A 3EHMA 5DS6A 1EKYA 3DJNB 2KNHA 1OR2A 1C02A 2J9VA 3GEIA 3H65A 4RD9A 2R03A 3HTKC 5A6KA 4BJ6A 4U5BE 4L6RA 1VTMP 4DJ9A 2C04A 3S9OA 2IBFA 4E7ZA 1LE4A 1ZU4A 3I5PA 4GYTA 3H2UA 4JJFA 1XZPA 3Q6MA 3QZCA 3OEOA 4XEFA 3DE9A 1VYIA 4MTOA 3LNMB 1BR2A 2IXNA 2J9WA 2VCAA 4J30B 4KC9A 3B0UX 2Y3HA 4EWCA 2R7QA 3WODF 1QLEC 2A0UA 3SXYA 1T6IA 2WVNA 2OEXA 2QUPA 4JC7A 2Y3DA 1BDJB 3TQOA 1CPRA 3CEXA 2HS5A 2J9UA 3AGTA 3ATPA 4LLCA 3ZG1A 2J7PD 2WZLA 2D5RB 2PFDA 3CZ6A 5L3VA 2OG2A 1A7EA 3LS0A 3DMDA 3ZC4A 3GEEA 4EBBA 1O5HA 3UGPA 1Z63A 1B68A 4ZLCA 3TULA 2DYRC 1LE2A 3EGDB 2Q9CA 4DOZA 4A4AA 5A6AA 5JVEA 4XWJA 4G7OF 3UNGC 4DBQA 3L8IA 2OEVA 2Y3BA 3NMKA 4YT8A 2ZXPA 3K6BA 4WABA 4YT5A 4BEJA 5F5FA 3M4BA 2VCBA 5B3IA 4JRZA 1JOGA 4G78A 4E17A 5HV9A 4EUKB 2XS1A 3L8JA 1GGQA 4N6CA 3JYYA 3MFNA 4MVSA 2A69F 1TQGA 2CW0F 3MYFA 5EHHA 2HV6A 3AG1C 3EFOA 3V5ZA 4DXWA 1ZZPA 4EBKA 4BPMA 4ER9A 5BQIA 1Q0DA 5KYWA 3VYWA 2XLWA 2A1DD 1SZIA 2YQYA 2Z15A 1C17M 3PCVA 3NYJA 2LQGA 4GEHA 1L7CA 2F22A 2CCYA 3AQCA 1YA7O 3EG9B 3O39A 4PK4A 1QVXA 1NZEA 5GPGB 5B3SC 4EKWA 3V5YA 2D4UA 4EBJA 2WZFA 3ZQYA 5AGFA 2V26A 2HJ3A 2M64A 1MMGA 4J32B 2L6FA 4C3DA 1GQAA 4U5HA 3DKAA 4MQ9F 3SXKA 1CGNA 1Z3IX 1FFTC 4XLPF 1OXBA
chains in the Genus database with same CATH topology
2C03A 5T3WA 1G8XA 1FTSA 1M2VA 4H4KC 4U5FE 3UMHA 2G3VA 3NDBB 2J0WA 3HJCA 3EFOB 3Q7LA 3RIPA 1J8MF 3F46A 1PD1A 5T3TA 4ANJA 4O6YA 4IRUA 2YHSA 5IY5C 2IOQA 3NYMA 2PX0A 5EGYA 1VK5A 3NKDA 4O7GA 4PJNA 3AG2C 2W9YA 2WVOA 3NG1A 4DVZA 2R7WA 1J8YF 2GFHA 2IYLD 2Y39A 2IXPA 4K0DA 1TKNA 2J0XA 4PJMA 2P7VA 4CSAC 2PX3A 3CQZA 5DLJA 5KYNA 4AK9A 4MNDA 4HFFB 4LACB 4IJJA 3S0XA 5F5HA 2Q9AA 1O87A 2R7UA 3T6JA 4AE4A 3SZRA 1MNDA 1S7ZA 1D1AA 3Q6NA 4RDAA 1VMAA 5B1BC 5DQTA 4BG0A 4OINF 2VH3A 1RJ9B 1MMDA 3W8HA 2EILC 3UGOA 2WVQA 2ZXRA 3O6XA 2H7VC 2PP4A 1TWCA 2EIMC 3EHNA 4XTKA 2IXMA 2CNWD 1SF8A 5L3QA 2KQ9A 4LERA 3SEOA 3ABMC 2E87A 2HV7A 3K33A 4O6NA 4O79A 4C7OA 5E3AA 5KYXB 1OCOC 4LLEA 4YT2A 2L9JA 5E2QA 3EQLF 4I1OB 1M56C 4JVSA 5E33A 1NU9C 2EINC 4CS8C 2R7XA 4IWBA 3K1HA 4PFOA 3M1CB 3K7DA 2H7OA 3AG3C 1MNEA 1BR1A 3OWTA 4I3MA 1D1CA 3EPVA 3ZVRA 3S28A 3LEVA 3Q7GA 3B0PA 3ABKC 1ZHZA 1ZU5A 5D92A 2FFHA 4E7SA 1W2WA 1SMYF 3NRHA 1NG1A 3JCUQ 4Q7CA 1M2OA 3GANA 3E9VA 2R7TA 1TWHA 4CSAA 3EH2A 3LLKA 4KNWA 3TD7A 3FVYA 4U5CE 2NUPA 3K66A 4PFPA 2A6HF 3DM9B 2Y69C 4YN0B 4DBRA 3KKBA 3GODA 3EGXA 5FCLA 1D0ZA 1TR2A 4KBLA 3ASOC 3FDQA 2XXAB 2KJGA 5KYWB 1FFHA 1LVKA 2CDQA 1TWGA 4PJJA 3E70C 3EZHA 2VASA 2I8BA 4QDLA 4U5EE 2YEVA 4HEAJ 1MMAA 4OIRF 4KNVA 5E3CA 2QY9A 2MYSA 3EJNA 2G3KA 3LLIA 2BE5F 4OIPF 1M2VB 3POVA 1OKKA 3MX3A 3X2QC 3FHDA 3IEEA 1VOMA 1ZHWA 3PHF2 2DYSC 2R7SA 3UMIA 4QI0A 3W2VA 4JCHA 4JJGA 2EIKC 3DZAA 3NKEA 4G0HA 1JPNA 5DS5A 2NG1A 3DJUB 3I5QA 3QMKA 4CS8A 4P6IC 3MLGA 1KU2A 5DVWA 3SNHA 4WJ0A 3UR3C 5EHHA 4A2NB 3K1IC 3T4RA 3JSZA 4HE8D 4OIOF 3ZIBA 4I1MA 1OCZC 4FWVA 3RYLA 4N06A 1D1BA 4I44A 4AE4B 2O9XA 3ZSUA 3DM5A 2W45A 3JYHA 2CGEA 3EH1A 1ST6A 1IZMA 3RKOF 4DVYP 3EZIA 3WG7C 2FGYA 2ZPAA 4IAOA 3V7OA 1D0YA 2XL4A 4W8KA 1JPJA 5KYUA 4Q5SF 4BJ5C 3LNRA 4M63A 4JW1A 4CS9C 4K7BA 2KGOA 2W4BA 4ULWA 3B9QA 4Q4ZF 3EGDA 3RH3A 3VAYA 2QTVA 1Z6AA 4G7ZF 4C7OB 3LESA 3S29A 4C3EA 1OCRC 5T1DB 2Y3GA 2CNWA 2M4EA 2W4MA 3LJBA 3LAYA 3ABLC 5KYUB 2MWQA 2P6VA 3FAJA 3ITFA 2VB6A 4JURI 1VYKA 1V55C 3DAFA 3EG9A 2Q9BA 1OCCC 4PJLA 2G62A 2ZXWC 5D91A 2PF4E 3HLZA 1ZHXA 3CSKA 4OD4A 2ZXOA 3W2WA 4HFKB 2EIJC 3UMKA 4BJ6C 4BJ1A 3L34A 1V54C 4U5DE 1NU7D 3AG4C 4F4BA 4YJWA 5KYYA 1WGWA 2WZGA 1LS1A 1MMNA 1TWAA 2J7PA 3N0TA 3I4UA 2J45A 3KL4A 2OCCC 5BUOA 5DS4A 5HSWA 1N1CA 3X1OA 3PMRA 1OKKD 1FMWA 2KW3C 2Q3TA 2WL8A 3F47A 3OA1A 4AX2A 3NYLA 2H7BA 4ZLDA 5B1AC 4CBEA 3B0VC 2NUPB 1D0XA 2X51A 2XSEA 3DXJF 1FMVA 3JRTA 5KYYB 3S27A 1QZXA 3KMIA 4OIQF 3SYNA 3LS1A 1BR4A 4B6IA 1LKXA 4X0RA 2WB7A 3ECSA 4XLNF 3EGXB 4C3BA 4CS7A 4YWQA 1Z5ZA 4CIHA 4RBNA 2R7VA 5CI9A 3SP1A 5CI8A 2IXOA 4JZAA 1ZHYA 3RFYA 2NUTA 3AQBA 1RJ9A 4BJ5A 4YT4A 4KI2A 3KH2A 4CS9A 3W8IA 4U5GA 3JT1A 3ASNC 4FESA 1ZHTA 2LSEA 4OD5A 2J46A 1PCXA 1Z23A 4FX5A 4G7HF 2A6EF 2B0JA 5DQZA 3N24A 3T6BA 4O6MA 2R7RA 4BJTA 4NY3A 1IW7F 3DAGA 2V3CC 3L0IA 2NUTB 3N2ZB 5KYXA 3DD7A 2JD3A 2XRHA 2DGJA 2L81A 1M57C 2R7OA 4QI2A 1PD0A 2YZSA 2A68F 5DS6A 1ZYRF 3EHMA 3DJNB 2KNHA 2J9VA 4RD9A 3H65A 3HTKC 4BJ6A 4U5BE 2C04A 4E7ZA 1ZU4A 3I5PA 4GYTA 4JJFA 3Q6MA 3QZCA 3OEOA 1VYIA 4J30B 1BR2A 2IXNA 2J9WA 4KC9A 3B0UX 2Y3HA 4EWCA 2R7QA 3WODF 1QLEC 2WVNA 2Y3DA 2J9UA 4LLCA 3ZG1A 2J7PD 2WZLA 2D5RB 2PFDA 3CZ6A 5L3VA 2OG2A 3LS0A 3DMDA 3ZC4A 4EBBA 3UGPA 1O5HA 1Z63A 4ZLCA 2DYRC 3EGDB 2Q9CA 4DOZA 4G7OF 4XWJA 3UNGC 4DBQA 2Y3BA 4YT8A 2ZXPA 3K6BA 4YT5A 4BEJA 5F5FA 2A69F 2CW0F 2HV6A 3AG1C 3EFOA 2XXAA 5KYWA 3VYWA 2A1DD 1SZIA 2Z15A 3NYJA 4GEHA 3AQCA 3EG9B 3O39A 4PK4A 5B3SC 1NZEA 2WZFA 2V26A 1MMGA 4J32B 4C3DA 4U5HA 4MQ9F 1Z3IX 1FFTC 4XLPF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WL8 A; 
#chains in the Genus database with same CATH topology
 2C03 A;  3H2V A;  4NCQ A;  1K04 A;  5T3W A;  1G8X A;  1FTS A;  1GM5 A;  1M2V A;  3C8G D;  4H4K C;  4CIP A;  4U5F E;  3UMH A;  2G3V A;  3HKK A;  3NDB B;  2J0W A;  4XPX A;  3HJC A;  3EFO B;  1OW8 A;  3Q7L A;  2XLH A;  1J8M F;  3RIP A;  5JS5 A;  3F46 A;  3TOL A;  3U2L A;  1PD1 A;  5T3T A;  3T9O A;  4ANJ A;  4O6Y A;  3U9J A;  2ICW G;  4IRU A;  2YHS A;  3O10 A;  2IOQ A;  2LFD A;  4ULV A;  3NYM A;  1H9G A;  5IY5 C;  2PX0 A;  5EGY A;  1HY5 A;  1VK5 A;  3NKD A;  4O7G A;  4PJN A;  1YYJ A;  3AG2 C;  2W9Y A;  3WG7 C;  2WVO A;  4IAR A;  4AL1 A;  3NG1 A;  4DVZ A;  2R7W A;  1FNT c;  1J8Y F;  2HMQ A;  5L0I A;  1OW6 A;  2GFH A;  2IYL D;  1KNY A;  2IXP A;  2Y39 A;  3DWW A;  1ORS C;  4K0D A;  3U9M A;  1TKN A;  2J0X A;  4PJM A;  1UG7 A;  2P7V A;  4CSA C;  2PX3 A;  5L0H A;  1H7I A;  2IM8 A;  1YYX A;  3CQZ A;  5DLJ A;  1EQ1 A;  3RVZ A;  4U9E A;  4Z9I A;  5KYN A;  1NFN A;  4AK9 A;  4MND A;  3SXM A;  2OOC A;  4HFF B;  4LAC B;  4IJJ A;  3S0X A;  3ZWI A;  1E83 A;  2HSB A;  5F5H A;  2LFF A;  2Q9A A;  1E2X A;  1LIH A;  2YVK A;  1O87 A;  2XLM A;  3G4X A;  3MBG A;  2R7U A;  3T6J A;  4AE4 A;  3SZR A;  1MND A;  4DRH B;  1HMD A;  2VCC A;  1BZ4 A;  1S7Z A;  1D1A A;  3Q6N A;  4NQF A;  4RDA A;  1EI7 A;  2YLD A;  1LM3 B;  3ZQV A;  1VMA A;  5B1B C;  1O3U A;  1ORJ A;  1Q0G A;  2AP3 A;  1LPE A;  2KK1 A;  5DQT A;  3GM3 A;  4BG0 A;  4OIN F;  2VH3 A;  1MMD A;  1RJ9 B;  3CAX A;  3U2M A;  1DOW A;  2EIL C;  3FXH A;  3W8H A;  3UGO A;  2WVQ A;  2ZXR A;  5CIV A;  1SR2 A;  3O6X A;  1M6T A;  2H7V C;  2OKU A;  4Z9J A;  5L0J A;  2PP4 A;  1TWC A;  2EIM C;  3EHN A;  3HNI A;  2IXM A;  4XTK A;  1WAS A;  2CNW D;  2YLI A;  1SF8 A;  5L3Q A;  1RKC A;  2KQ9 A;  4DRJ B;  4LER A;  1YDI A;  2LD6 A;  1U89 A;  2XM4 A;  4AL0 A;  3SEO A;  3ABM C;  3LUT B;  4NTF A;  1I4Y A;  1HMO A;  3W4Y A;  2E87 A;  2HV7 A;  2HSQ A;  3K33 A;  3AJM A;  4O6N A;  4O79 A;  4C7O A;  1QPU A;  1RKE B;  1VLT A;  2XM0 A;  1Q0K A;  2EPO A;  2Q00 A;  3ZTZ A;  1FR0 A;  4K1O A;  3TOM A;  5E3A A;  5KYX B;  1OCO C;  1TFO B;  2XLD A;  4LLE A;  4YT2 A;  2L9J A;  1Q0M A;  2UUH A;  1JAF A;  5E2Q A;  3EQL F;  4I1O B;  1LI7 A;  3HNJ A;  1M56 C;  4JVS A;  5E33 A;  1NU9 C;  2EIN C;  4JTC B;  4CS8 C;  2R7X A;  3GWN A;  1LS4 A;  4IWB A;  2XS8 A;  3VF0 A;  3A9C A;  1Y6D A;  3BRJ A;  3K1H A;  4LDR A;  4MS2 A;  3M1C B;  3K7D A;  1NFO A;  2H7O A;  3M79 A;  4PFO A;  3AG3 C;  1MNE A;  3J06 A;  1BR1 A;  3QTH A;  4CDA A;  3OWT A;  4P9F A;  4I3M A;  4WGY A;  5JSL A;  1WTY A;  3FMS A;  1D1C A;  2R05 A;  3GOR A;  5A6J A;  3EPV A;  3M4C A;  1FAP B;  2GDC A;  4PR9 A;  3LEO A;  3ZVR A;  3S28 A;  3TK0 A;  3LEV A;  1TFK B;  3Q7G A;  3B0P A;  3TJ5 A;  3TJ6 A;  3ABK C;  1ZHZ A;  3G50 A;  1ZU5 A;  1ZW2 A;  5D92 A;  1EA8 A;  1JRA A;  2EPM X;  2FFH A;  1T6U A;  2RSE B;  2L7A A;  5JRA A;  4E7S A;  1K40 A;  1W2W A;  2HKV A;  1SMY F;  1T01 A;  3NRH A;  1NG1 A;  5JLI A;  3JCU Q;  4Q7C A;  2R25 A;  1M2O A;  4XPY A;  2KYH A;  1R4T A;  3C18 A;  3GAN A;  3S84 A;  1F1M A;  4YL0 A;  4MVR A;  3E9V A;  4YK5 A;  3VRC A;  4E0I A;  1WOL A;  2R7T A;  4XPW A;  2NSF A;  3US6 A;  1TWH A;  4NTB A;  1G4W R;  1YAU O;  4JCZ A;  3EH2 A;  3LLK A;  4CSA A;  1E86 A;  4KNW A;  3GM1 A;  1A7V A;  4IB4 A;  3FVY A;  1HE1 A;  4U5C E;  2NUP A;  3TD7 A;  3K66 A;  4CDY A;  4J7Y A;  5AC5 A;  1HW2 A;  1ORY A;  4MVZ A;  3FOP A;  1A41 A;  4PFP A;  2A6H F;  1QKR A;  2J8W A;  3DM9 B;  2Y69 C;  1U0B B;  4YN0 B;  3R7C A;  3L1M A;  4CJG A;  2HJM A;  2I15 A;  3KKB A;  3GOD A;  4CX9 A;  4DBR A;  2GWW A;  3EGX A;  5FCL A;  1D0Z A;  1TR2 A;  4KBL A;  3ASO C;  3KYI A;  3FDQ A;  2XXA B;  2KJG A;  4EIY A;  3AGU A;  5KYW B;  1FFH A;  1LVK A;  4EHP A;  3C7J A;  1YZC A;  2CDQ A;  1TWG A;  4PJJ A;  1RMV A;  1JMW A;  1QQ3 A;  3E70 C;  3EZH A;  4JTA B;  3IQC A;  1E84 A;  4Z9H A;  4ONS A;  3C62 A;  5JT4 A;  5L0G A;  2VAS A;  4XEV A;  2I8B A;  4QDL A;  3DI5 A;  4U5E E;  2YEV A;  2FAP B;  4HEA J;  2KC3 A;  1MMA A;  2XLO A;  4R32 A;  1RCP A;  5COM A;  4E18 A;  3GWL A;  4OIR F;  4KNV A;  5E3C A;  2QY9 A;  1U6H A;  256B A;  2G3K A;  2MYS A;  3EJN A;  3LLI A;  4IAQ A;  2L6H A;  5AC4 A;  4D4N A;  5A6B D;  1APC A;  2BE5 F;  2Q4F A;  4MW8 A;  4OIP F;  1M2V B;  4MTG A;  2XLE A;  2R02 A;  3POV A;  1OKK A;  3MX3 A;  3X2Q C;  3FHD A;  3IEE A;  3HNL A;  1VOM A;  1ZHW A;  3V7O A;  2DYS C;  3PHF 2;  2R7S A;  3UMI A;  2LCH A;  4QI0 A;  3W2V A;  3IHU A;  4JCH A;  2NPU A;  4JJG A;  2EIK C;  1G5Z A;  3DZA A;  2TMV P;  2UUI A;  5JP7 A;  3DE8 A;  4YL3 A;  1T6Q A;  3NKE A;  3RQF A;  4G0H A;  1JPN A;  2AU5 A;  5DS5 A;  4CDV A;  1CGO A;  2NG1 A;  3DJU B;  3I5Q A;  1ZVZ A;  3QMK A;  4CS8 A;  5A69 A;  4P6I C;  3MLG A;  1KU2 A;  5DVW A;  3SNH A;  2HZ8 A;  4WJ0 A;  3UR3 C;  3KYJ A;  1HW1 A;  1K05 A;  3U8V A;  4A2N B;  3GM2 A;  5BQH A;  2LP4 A;  3K1I C;  3T4R A;  3JSZ A;  3QVZ A;  2XXA A;  4HE8 D;  4LDQ A;  1GS9 A;  1V4A A;  4P9T A;  4OIO F;  3ZIB A;  1BBH A;  5COG A;  4I1M A;  1XZQ A;  1I4Z A;  3FOO A;  1OCZ C;  5TJ5 E;  4MTF A;  2AVK A;  3B29 A;  2NSG A;  4FWV A;  3RYL A;  1YZA A;  1D1B A;  4I44 A;  4N06 A;  5COF A;  3RW0 A;  1AEP A;  4AE4 B;  2O9X A;  3S90 A;  1WN0 A;  3ZSU A;  3DM5 A;  3B71 A;  3U0C A;  4W8P A;  1C03 A;  5EK0 A;  5K0I A;  2QNL A;  3O55 A;  3ZTM A;  2EPK X;  2CGE A;  2W45 A;  3JYH A;  2JPU A;  3EH1 A;  1ST6 A;  2JX0 A;  1AUE A;  1IZM A;  1OR3 A;  2ZD9 A;  1I5N A;  3C8Z A;  3EZI A;  2P61 A;  3RKO F;  2FGY A;  2ZPA A;  4IAO A;  1CPQ A;  1D0Y A;  3NMJ A;  2XL4 A;  2YL3 A;  3QW0 A;  4W8K A;  4JEB A;  1JPJ A;  5KYU A;  3KPH A;  2YL0 A;  3VM6 A;  4BJ5 C;  4Q5S F;  3LNR A;  4M63 A;  3QVY A;  3ZDL A;  2PBE A;  4JW1 A;  4CS9 C;  4K7B A;  2KGO A;  5BQG A;  2W4B A;  4ULW A;  3JSE O;  2OJQ A;  3B9Q A;  3WHN A;  2OU6 A;  1G4U S;  4Q4Z F;  3EGD A;  1WWP A;  1YA9 A;  2KSF A;  2XLV A;  4XQ1 A;  3RH3 A;  3VAY A;  2ETS A;  2GA0 A;  2QTV A;  1Z6A A;  4GQH A;  3T6G B;  2CYD A;  2MHR A;  4JEA A;  3LES A;  3S29 A;  4G7Z F;  4C7O B;  2EPL X;  2QLA A;  4C3E A;  1Z7Q c;  4MVM A;  5L0F A;  1OCR C;  4BEM J;  5T1D B;  1SYQ A;  2Y3G A;  2BL2 A;  2CNW A;  2HMZ A;  2M4E A;  1R5I D;  2W4M A;  3LJB A;  4DVY P;  3LAY A;  3ABL C;  4IGG A;  5KYU B;  2MWQ A;  4MVU A;  2P6V A;  1MQV A;  3FAJ A;  3ITF A;  3SXZ A;  1JR8 A;  2VB6 A;  1OXK A;  3IQ5 A;  4JUR I;  1VYK A;  2EPN A;  2A0B A;  2QE9 A;  1V55 C;  2P0N A;  2YLG A;  2ASR A;  2Q9B A;  3DAF A;  3EG9 A;  1NSG B;  1OCC C;  4NC3 A;  4PJL A;  2G62 A;  3HNK A;  2BC5 A;  2ZXW C;  5D91 A;  2PF4 E;  3HLZ A;  1YJG A;  1NBB A;  1ZHX A;  3CSK A;  4OD4 A;  5L0D A;  2ZXO A;  3W2W A;  4HFK B;  2EIJ C;  3UMK A;  4BJ6 C;  2YL1 A;  1XWJ A;  4BJ1 A;  2AWY A;  2YL7 A;  1V54 C;  3L34 A;  1YAR O;  1NU7 D;  2R9R B;  4U5D E;  1A7D A;  3AG4 C;  4F4B A;  4YJW A;  2DI3 A;  5KYY A;  1H9T A;  2OQM A;  1VLS A;  1WGW A;  2WZG A;  1CGM E;  1LS1 A;  1MMN A;  1TWA A;  2J7P A;  3N0T A;  3I4U A;  2J45 A;  3KL4 A;  1Y4C A;  4JE9 A;  2OCC C;  3G4Z A;  4MVO A;  3JRM O;  1YLM A;  3RVY A;  2RD9 A;  5BUO A;  5DS4 A;  5HSW A;  1N1C A;  2J9B A;  3X1O A;  3JZ0 A;  3PMR A;  1E85 A;  1OKK D;  1UFB A;  2LK4 A;  1FMW A;  2KW3 C;  2Q3T A;  2WL8 A;  3F47 A;  3OA1 A;  4AX2 A;  1PV3 A;  3NYL A;  2H7B A;  4FAP B;  4ZLD A;  1OW7 A;  5B1A C;  3FAP B;  4LDK A;  4CBE A;  2OJE D;  2Q7R A;  3K1I A;  1DOV A;  3NMI A;  3B0V C;  2NUP B;  1D0X A;  2HUJ A;  2X51 A;  2XSE A;  3DXJ F;  4MVQ A;  3RQG A;  1FMV A;  3JRT A;  5KYY B;  3S27 A;  1QZX A;  1YVI A;  3QW1 A;  3KMI A;  3M15 A;  5FZT A;  4OIQ F;  1Q0F A;  3SYN A;  3LS1 A;  1BR4 A;  3GEH A;  4B6I A;  1LKX A;  4X0R A;  1OQC A;  2WB7 A;  3ECS A;  3IPM O;  3JTL O;  3MYI A;  4XLN F;  2YKZ A;  3EGX B;  2AWC A;  3IQT A;  4C3B A;  4JIO A;  4CS7 A;  2XL6 A;  4NTA A;  4E0H A;  4YWQ A;  1Z5Z A;  4CIH A;  4RBN A;  4CJO A;  1V74 B;  4D4X A;  2R7V A;  2YRF A;  5CI9 A;  3IQ6 A;  3SP1 A;  1S05 A;  5CI8 A;  2L6G A;  2IXO A;  4JZA A;  1ZHY A;  2B0H A;  3AOU A;  2NUT A;  1LI5 A;  3AQB A;  4N4W A;  3RFY A;  1ZW3 A;  3U5S A;  1RJ9 A;  4BJ5 A;  3C8G A;  1T9K A;  1L3P A;  2YWA A;  4YT4 A;  3BEH A;  4KI2 A;  1KTM A;  3A11 A;  3KH2 A;  4CS9 A;  2HFI A;  4U5G A;  3W8I A;  3JT1 A;  1HE9 A;  3U8P A;  1RXQ A;  3ASN C;  1WAT A;  5F28 E;  2PNO A;  4FES A;  1ZHT A;  3RQE A;  3PDM P;  1AVO B;  1T5O A;  2LSE A;  4JTD B;  4OD5 A;  2J46 A;  1PCX A;  1Z23 A;  4FX5 A;  4G7H F;  2A6E F;  2B0J A;  5DQZ A;  2GAQ A;  3N24 A;  3RF3 A;  4UDV A;  3T6B A;  4O6M A;  2H8A A;  2R7R A;  2XL8 A;  3R2P A;  4BJT A;  1RKE A;  4NY3 A;  4PAC A;  1IW7 F;  2DB4 A;  3DAG A;  2V3C C;  4J7T A;  3L0I A;  2VC9 A;  2NUT B;  3N2Z B;  3WAQ A;  5L0C A;  5JUA A;  3DD7 A;  5KYX A;  5A6B A;  3U3B A;  1QSP A;  3U3F A;  2JD3 A;  3C8G B;  1NLX A;  2DGJ A;  2XRH A;  2L81 A;  3C63 A;  4U9D A;  1VB5 A;  2X0C A;  2LIG A;  4N6H A;  3V5X A;  1M57 C;  4H54 A;  2R7O A;  4DRI B;  4YL1 A;  4QI2 A;  1PD0 A;  2P1A A;  4XEK A;  1A0B A;  4WGZ A;  1H6G A;  2YZS A;  2A68 F;  4JKV A;  1ZYR F;  4MW3 A;  3EHM A;  5DS6 A;  1EKY A;  3DJN B;  2KNH A;  1OR2 A;  1C02 A;  2J9V A;  3GEI A;  3H65 A;  4RD9 A;  2R03 A;  3HTK C;  5A6K A;  4BJ6 A;  4U5B E;  4L6R A;  1VTM P;  4DJ9 A;  2C04 A;  3S9O A;  2IBF A;  4E7Z A;  1LE4 A;  1ZU4 A;  3I5P A;  4GYT A;  3H2U A;  4JJF A;  1XZP A;  3Q6M A;  3QZC A;  3OEO A;  4XEF A;  3DE9 A;  1VYI A;  4MTO A;  3LNM B;  1BR2 A;  2IXN A;  2J9W A;  2VCA A;  4J30 B;  4KC9 A;  3B0U X;  2Y3H A;  4EWC A;  2R7Q A;  3WOD F;  1QLE C;  2A0U A;  3SXY A;  1T6I A;  2WVN A;  2OEX A;  2QUP A;  4JC7 A;  2Y3D A;  1BDJ B;  3TQO A;  1CPR A;  3CEX A;  2HS5 A;  2J9U A;  3AGT A;  3ATP A;  4LLC A;  3ZG1 A;  2J7P D;  2WZL A;  2D5R B;  2PFD A;  3CZ6 A;  5L3V A;  2OG2 A;  1A7E A;  3LS0 A;  3DMD A;  3ZC4 A;  3GEE A;  4EBB A;  1O5H A;  3UGP A;  1Z63 A;  1B68 A;  4ZLC A;  3TUL A;  2DYR C;  1LE2 A;  3EGD B;  2Q9C A;  4DOZ A;  4A4A A;  5A6A A;  5JVE A;  4XWJ A;  4G7O F;  3UNG C;  4DBQ A;  3L8I A;  2OEV A;  2Y3B A;  3NMK A;  4YT8 A;  2ZXP A;  3K6B A;  4WAB A;  4YT5 A;  4BEJ A;  5F5F A;  3M4B A;  2VCB A;  5B3I A;  4JRZ A;  1JOG A;  4G78 A;  4E17 A;  5HV9 A;  4EUK B;  2XS1 A;  3L8J A;  1GGQ A;  4N6C A;  3JYY A;  3MFN A;  4MVS A;  2A69 F;  1TQG A;  2CW0 F;  3MYF A;  5EHH A;  2HV6 A;  3AG1 C;  3EFO A;  3V5Z A;  4DXW A;  1ZZP A;  4EBK A;  4BPM A;  4ER9 A;  5BQI A;  1Q0D A;  5KYW A;  3VYW A;  2XLW A;  2A1D D;  1SZI A;  2YQY A;  2Z15 A;  1C17 M;  3PCV A;  3NYJ A;  2LQG A;  4GEH A;  1L7C A;  2F22 A;  2CCY A;  3AQC A;  1YA7 O;  3EG9 B;  3O39 A;  4PK4 A;  1QVX A;  1NZE A;  5GPG B;  5B3S C;  4EKW A;  3V5Y A;  2D4U A;  4EBJ A;  2WZF A;  3ZQY A;  5AGF A;  2V26 A;  2HJ3 A;  2M64 A;  1MMG A;  4J32 B;  2L6F A;  4C3D A;  1GQA A;  4U5H A;  3DKA A;  4MQ9 F;  3SXK A;  1CGN A;  1Z3I X;  1FFT C;  4XLP F;  1OXB A; 
#chains in the Genus database with same CATH homology
 2C03 A;  5T3W A;  1G8X A;  1FTS A;  1M2V A;  4H4K C;  4U5F E;  3UMH A;  2G3V A;  3NDB B;  2J0W A;  3HJC A;  3EFO B;  3Q7L A;  3RIP A;  1J8M F;  3F46 A;  1PD1 A;  5T3T A;  4ANJ A;  4O6Y A;  4IRU A;  2YHS A;  5IY5 C;  2IOQ A;  3NYM A;  2PX0 A;  5EGY A;  1VK5 A;  3NKD A;  4O7G A;  4PJN A;  3AG2 C;  2W9Y A;  2WVO A;  3NG1 A;  4DVZ A;  2R7W A;  1J8Y F;  2GFH A;  2IYL D;  2Y39 A;  2IXP A;  4K0D A;  1TKN A;  2J0X A;  4PJM A;  2P7V A;  4CSA C;  2PX3 A;  3CQZ A;  5DLJ A;  5KYN A;  4AK9 A;  4MND A;  4HFF B;  4LAC B;  4IJJ A;  3S0X A;  5F5H A;  2Q9A A;  1O87 A;  2R7U A;  3T6J A;  4AE4 A;  3SZR A;  1MND A;  1S7Z A;  1D1A A;  3Q6N A;  4RDA A;  1VMA A;  5B1B C;  5DQT A;  4BG0 A;  4OIN F;  2VH3 A;  1RJ9 B;  1MMD A;  3W8H A;  2EIL C;  3UGO A;  2WVQ A;  2ZXR A;  3O6X A;  2H7V C;  2PP4 A;  1TWC A;  2EIM C;  3EHN A;  4XTK A;  2IXM A;  2CNW D;  1SF8 A;  5L3Q A;  2KQ9 A;  4LER A;  3SEO A;  3ABM C;  2E87 A;  2HV7 A;  3K33 A;  4O6N A;  4O79 A;  4C7O A;  5E3A A;  5KYX B;  1OCO C;  4LLE A;  4YT2 A;  2L9J A;  5E2Q A;  3EQL F;  4I1O B;  1M56 C;  4JVS A;  5E33 A;  1NU9 C;  2EIN C;  4CS8 C;  2R7X A;  4IWB A;  3K1H A;  4PFO A;  3M1C B;  3K7D A;  2H7O A;  3AG3 C;  1MNE A;  1BR1 A;  3OWT A;  4I3M A;  1D1C A;  3EPV A;  3ZVR A;  3S28 A;  3LEV A;  3Q7G A;  3B0P A;  3ABK C;  1ZHZ A;  1ZU5 A;  5D92 A;  2FFH A;  4E7S A;  1W2W A;  1SMY F;  3NRH A;  1NG1 A;  3JCU Q;  4Q7C A;  1M2O A;  3GAN A;  3E9V A;  2R7T A;  1TWH A;  4CSA A;  3EH2 A;  3LLK A;  4KNW A;  3TD7 A;  3FVY A;  4U5C E;  2NUP A;  3K66 A;  4PFP A;  2A6H F;  3DM9 B;  2Y69 C;  4YN0 B;  4DBR A;  3KKB A;  3GOD A;  3EGX A;  5FCL A;  1D0Z A;  1TR2 A;  4KBL A;  3ASO C;  3FDQ A;  2XXA B;  2KJG A;  5KYW B;  1FFH A;  1LVK A;  2CDQ A;  1TWG A;  4PJJ A;  3E70 C;  3EZH A;  2VAS A;  2I8B A;  4QDL A;  4U5E E;  2YEV A;  4HEA J;  1MMA A;  4OIR F;  4KNV A;  5E3C A;  2QY9 A;  2MYS A;  3EJN A;  2G3K A;  3LLI A;  2BE5 F;  4OIP F;  1M2V B;  3POV A;  1OKK A;  3MX3 A;  3X2Q C;  3FHD A;  3IEE A;  1VOM A;  1ZHW A;  3PHF 2;  2DYS C;  2R7S A;  3UMI A;  4QI0 A;  3W2V A;  4JCH A;  4JJG A;  2EIK C;  3DZA A;  3NKE A;  4G0H A;  1JPN A;  5DS5 A;  2NG1 A;  3DJU B;  3I5Q A;  3QMK A;  4CS8 A;  4P6I C;  3MLG A;  1KU2 A;  5DVW A;  3SNH A;  4WJ0 A;  3UR3 C;  5EHH A;  4A2N B;  3K1I C;  3T4R A;  3JSZ A;  4HE8 D;  4OIO F;  3ZIB A;  4I1M A;  1OCZ C;  4FWV A;  3RYL A;  4N06 A;  1D1B A;  4I44 A;  4AE4 B;  2O9X A;  3ZSU A;  3DM5 A;  2W45 A;  3JYH A;  2CGE A;  3EH1 A;  1ST6 A;  1IZM A;  3RKO F;  4DVY P;  3EZI A;  3WG7 C;  2FGY A;  2ZPA A;  4IAO A;  3V7O A;  1D0Y A;  2XL4 A;  4W8K A;  1JPJ A;  5KYU A;  4Q5S F;  4BJ5 C;  3LNR A;  4M63 A;  4JW1 A;  4CS9 C;  4K7B A;  2KGO A;  2W4B A;  4ULW A;  3B9Q A;  4Q4Z F;  3EGD A;  3RH3 A;  3VAY A;  2QTV A;  1Z6A A;  4G7Z F;  4C7O B;  3LES A;  3S29 A;  4C3E A;  1OCR C;  5T1D B;  2Y3G A;  2CNW A;  2M4E A;  2W4M A;  3LJB A;  3LAY A;  3ABL C;  5KYU B;  2MWQ A;  2P6V A;  3FAJ A;  3ITF A;  2VB6 A;  4JUR I;  1VYK A;  1V55 C;  3DAF A;  3EG9 A;  2Q9B A;  1OCC C;  4PJL A;  2G62 A;  2ZXW C;  5D91 A;  2PF4 E;  3HLZ A;  1ZHX A;  3CSK A;  4OD4 A;  2ZXO A;  3W2W A;  4HFK B;  2EIJ C;  3UMK A;  4BJ6 C;  4BJ1 A;  3L34 A;  1V54 C;  4U5D E;  1NU7 D;  3AG4 C;  4F4B A;  4YJW A;  5KYY A;  1WGW A;  2WZG A;  1LS1 A;  1MMN A;  1TWA A;  2J7P A;  3N0T A;  3I4U A;  2J45 A;  3KL4 A;  2OCC C;  5BUO A;  5DS4 A;  5HSW A;  1N1C A;  3X1O A;  3PMR A;  1OKK D;  1FMW A;  2KW3 C;  2Q3T A;  2WL8 A;  3F47 A;  3OA1 A;  4AX2 A;  3NYL A;  2H7B A;  4ZLD A;  5B1A C;  4CBE A;  3B0V C;  2NUP B;  1D0X A;  2X51 A;  2XSE A;  3DXJ F;  1FMV A;  3JRT A;  5KYY B;  3S27 A;  1QZX A;  3KMI A;  4OIQ F;  3SYN A;  3LS1 A;  1BR4 A;  4B6I A;  1LKX A;  4X0R A;  2WB7 A;  3ECS A;  4XLN F;  3EGX B;  4C3B A;  4CS7 A;  4YWQ A;  1Z5Z A;  4CIH A;  4RBN A;  2R7V A;  5CI9 A;  3SP1 A;  5CI8 A;  2IXO A;  4JZA A;  1ZHY A;  3RFY A;  2NUT A;  3AQB A;  1RJ9 A;  4BJ5 A;  4YT4 A;  4KI2 A;  3KH2 A;  4CS9 A;  3W8I A;  4U5G A;  3JT1 A;  3ASN C;  4FES A;  1ZHT A;  2LSE A;  4OD5 A;  2J46 A;  1PCX A;  1Z23 A;  4FX5 A;  4G7H F;  2A6E F;  2B0J A;  5DQZ A;  3N24 A;  3T6B A;  4O6M A;  2R7R A;  4BJT A;  4NY3 A;  1IW7 F;  3DAG A;  2V3C C;  3L0I A;  2NUT B;  3N2Z B;  5KYX A;  3DD7 A;  2JD3 A;  2XRH A;  2DGJ A;  2L81 A;  1M57 C;  2R7O A;  4QI2 A;  1PD0 A;  2YZS A;  2A68 F;  5DS6 A;  1ZYR F;  3EHM A;  3DJN B;  2KNH A;  2J9V A;  4RD9 A;  3H65 A;  3HTK C;  4BJ6 A;  4U5B E;  2C04 A;  4E7Z A;  1ZU4 A;  3I5P A;  4GYT A;  4JJF A;  3Q6M A;  3QZC A;  3OEO A;  1VYI A;  4J30 B;  1BR2 A;  2IXN A;  2J9W A;  4KC9 A;  3B0U X;  2Y3H A;  4EWC A;  2R7Q A;  3WOD F;  1QLE C;  2WVN A;  2Y3D A;  2J9U A;  4LLC A;  3ZG1 A;  2J7P D;  2WZL A;  2D5R B;  2PFD A;  3CZ6 A;  5L3V A;  2OG2 A;  3LS0 A;  3DMD A;  3ZC4 A;  4EBB A;  3UGP A;  1O5H A;  1Z63 A;  4ZLC A;  2DYR C;  3EGD B;  2Q9C A;  4DOZ A;  4G7O F;  4XWJ A;  3UNG C;  4DBQ A;  2Y3B A;  4YT8 A;  2ZXP A;  3K6B A;  4YT5 A;  4BEJ A;  5F5F A;  2A69 F;  2CW0 F;  2HV6 A;  3AG1 C;  3EFO A;  2XXA A;  5KYW A;  3VYW A;  2A1D D;  1SZI A;  2Z15 A;  3NYJ A;  4GEH A;  3AQC A;  3EG9 B;  3O39 A;  4PK4 A;  5B3S C;  1NZE A;  2WZF A;  2V26 A;  1MMG A;  4J32 B;  4C3D A;  4U5H A;  4MQ9 F;  1Z3I X;  1FFT C;  4XLP F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...