2WL8A

X-ray crystal structure of pex19p
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
110
structure length
110
Chain Sequence
ILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESLPPEQFEKYQEQHSVMCKICEQFEAETPTDSETTQKARFEMVLDLMQQLQDLGHPPKELAGEMPPGLNFDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Peroxisomal Receptor Pex19P Forms a Helical Mpts Recognition Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords PEROXISOMAL BIOGENESIS FACTOR 19
total genus 36
structure length 110
sequence length 110
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-06-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.900 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2wl8A00
2WL8A
chains in the Genus database with same CATH superfamily
4MTOA 1LI5A 2OU6A 2Q3TA 4IARA 1QZXA 3H2UA 1BBHA 2ZXPA 1LM3B 3DMDA 3LEVA 3ECSA 4XEFA 1NBBA 2OEXA 1RXQA 4JZAA 3W8HA 3PHF2 2LCHA 4PJMA 4ULWA 3G50A 2ZPAA 3KL4A 3NG1A 3V5ZA 2B0HA 4CJGA 4G0HA 1OR2A 4EBKA 1T6QA 3FOOA 1QQ3A 1CPRA 1ZVZA 2J46A 4CIHA 3ABKC 3QZCA 2G3VA 1U0BB 2ICWG 2XS8A 3RVZA 3MYFA 2EPLX 2GA0A 3GANA 3T9OA 2JPUA 3GEIA 3L1MA 4U5BE 1RJ9A 3MFNA 3S9OA 4FWVA 3L8IA 4DRJB 3ASOC 4W8KA 2HSBA 3IQCA 3HTKC 1I4YA 3VYWA 2LSEA 5L0IA 3POVA 1JPNA 4LDQA 5KYUA 3SP1A 2R7SA 1A0BA 3QMKA 1TKNA 4JJGA 3RKOF 1C02A 4FX5A 3V5YA 1VMAA 1ZHWA 2HFIA 3ZWIA 1G8XA 2C03A 3KPHA 4YL0A 4N6HA 4DJ9A 3DM9B 3NMKA 3EGXA 2WZGA 1LE2A 2P61A 2YLDA 3PDMP 2F22A 3W8IA 1RMVA 1BZ4A 1BR4A 3IQ6A 3K33A 3DXJF 3VRCA 4D4XA 2J0WA 1TWAA 1MMDA 2EINC 4IAQA 3Q6NA 5FZTA 4C7OA 3EG9A 2AU5A 2V26A 4O7GA 1XZQA 4BJ5A 3FHDA 1FAPB 4CDVA 2YZSA 1OKKA 4YL3A 3CEXA 2A68F 2Q4FA 5E33A 3SNHA 3WODF 1QSPA 2HKVA 4JCZA 1VTMP 1M56C 2J7PA 1K05A 2AWYA 1QPUA 1MQVA 2TMVP 2LD6A 4MVOA 2OJQA 4U5FE 4C3DA 2OJED 5T3TA 4GYTA 2W45A 3S27A 4MTGA 4JTDB 3A9CA 3CAXA 4DXWA 2KJGA 2H8AA 1AUEA 1K40A 2L6HA 4ULVA 1ORSC 2QY9A 2VCBA 3DJNB 3OWTA 4PJJA 1LE4A 3TJ5A 1LIHA 3KMIA 3DWWA 1I4ZA 2KW3C 4PFPA 3EGDB 4DBQA 4MVUA 3NKEA 2OCCC 2UUIA 1XZPA 3NDBB 1MMNA 2V3CC 4I3MA 3ZTMA 3G4XA 1HW1A 5F5HA 4E17A 1V74B 4NC3A 2XSEA 4PFOA 2XL6A 4DRHB 2YL3A 2BL2A 1U6HA 3IEEA 5KYXB 2NUTA 4JTAB 1G4WR 4K0DA 1J8MF 1VLSA 2HUJA 5DS4A 2XRHA 3L0IA 3SXYA 2IXOA 4NTAA 2PBEA 4YK5A 5JT4A 1CGOA 4B6IA 4YWQA 1ZZPA 1HMDA 4BJ1A 5JUAA 3FMSA 3FAJA 2ZXWC 5L0FA 3EFOB 2L9JA 4RBNA 3OEOA 1HE1A 2XLEA 2Y69C 4MVRA 1SZIA 2RD9A 3RH3A 4YT8A 1SR2A 1JR8A 3FOPA 3W4YA 3GEHA 1CGME 3DKAA 3JCUQ 1WWPA 2EPOA 1CPQA 3RF3A 2VCCA 4AK9A 2Q9BA 2W4BA 4E7ZA 1OKKD 4U5CE 2IYLD 4LERA 3DM5A 1TR2A 1L3PA 1Z3IX 2H7VC 3LS1A 2LQGA 4J7TA 3EH1A 1PD1A 3C8GA 3SXKA 2PFDA 1ZHXA 1LPEA 2EIMC 3O39A 1N1CA 2R05A 4G7OF 1D0YA 1C17M 4DVYP 1G5ZA 4DBRA 3E70C 5L0GA 3GM3A 3UGOA 3WG7C 1SMYF 1DOVA 2H7BA 2NSGA 1Q0FA 1YLMA 4MTFA 3S90A 4OD5A 4Q5SF 1VB5A 2YVKA 2L81A 4ANJA 5DS6A 1YAUO 1ZU5A 2CGEA 4BEMJ 2R7VA 2VCAA 3Q7GA 1T9KA 2OQMA 3B29A 1OR3A 1TWCA 3ABMC 1M2OA 2E87A 4WGYA 3ZG1A 5L3VA 3ZVRA 4CS7A 5A6KA 1RKCA 1H9GA 1BDJB 1Q0GA 2OOCA 3DJUB 3EHNA 3EFOA 3F47A 4I1OB 4PJLA 4XPXA 3U8PA 4EIYA 1OW8A 5JP7A 3TJ6A 5F5FA 1APCA 1LVKA 4CJOA 3GM2A 4EHPA 3A11A 2J0XA 3AG1C 2KSFA 2XL8A 2IXMA 4GQHA 1I5NA 2M4EA 3ATPA 3ASNC 4DRIB 3S28A 1WN0A 3RW0A 4K1OA 4FAPB 2YKZA 1IW7F 2NPUA 4YT5A 3U3FA 3LJBA 3JZ0A 5E2QA 4CDYA 5IY5C 3J06A 1BR1A 4BJ6A 5B3IA 1V4AA 3W2WA 1Y6DA 3LESA 4XQ1A 3CSKA 4BJTA 2H7OA 4Z9JA 4OIQF 3LS0A 4EKWA 3BRJA 3GM1A 3L8JA 4MW3A 4J7YA 1NG1A 1V54C 2J9UA 1EQ1A 1MNDA 1WTYA 3EGXB 4PACA 2DB4A 4JTCB 3T6JA 3K66A 5KYYA 4EBJA 2FFHA 1KTMA 2JD3A 4Z9HA 5DLJA 1MNEA 4BJ6C 3HLZA 2KYHA 5HSWA 3B0UX 2J45A 3C8GB 1A7VA 1D0ZA 2HZ8A 2Y3DA 3HKKA 1PD0A 4RDAA 2R7UA 4KNWA 2CDQA 3DD7A 1KU2A 1VLTA 2WB7A 2WVQA 3RVYA 5EGYA 2QLAA 2A6HF 2XLVA 5F28E 5T3WA 4YT2A 3DAFA 4AL0A 2ZD9A 4QI0A 3TQOA 3IQTA 3DZAA 4N06A 4XPYA 4C3BA 4LLCA 1GQAA 2EPKX 2R7QA 4CS9A 3NMIA 4PK4A 3VM6A 3FDQA 1NU9C 1YJGA 3B0VC 4IGGA 3HNJA 3UMHA 3IQ5A 1ZHYA 3RYLA 2J9VA 3EZIA 3LNRA 1S05A 1LI7A 3HJCA 1WATA 1NFOA 1J8YF 2Y39A 4NQFA 1SF8A 3GODA 3AJMA 3C63A 2Q9CA 1OCZC 1MMAA 3AOUA 2IXNA 5CI9A 2Q7RA 5KYXA 2CNWA 4U9EA 3EJNA 4KI2A 4U5EE 1U89A 2A6EF 1VK5A 3I4UA 5FCLA 3RQFA 1ZW2A 2KK1A 4OIOF 1R5ID 3L34A 1Q0MA 5GPGB 5CI8A 4HFFB 2D4UA 3O6XA 3UR3C 4JEAA 2L7AA 3I5PA 4GEHA 4PJNA 5EK0A 1OXBA 1C03A 1W2WA 2KC3A 3N0TA 4F4BA 5A6AA 4EUKB 1LS4A 2W4MA 4Q7CA 1WASA 4PR9A 3TOMA 256BA 1YZCA 4CIPA 2HS5A 3U9JA 2YQYA 2P1AA 3JYHA 2NG1A 1YDIA 3MYIA 4P9TA 4NCQA 5TJ5E 3U5SA 4H4KC 2X0CA 1M6TA 1H9TA 2M64A 2DYRC 1EA8A 2CW0F 2I8BA 2XLMA 1YA7O 2A0BA 2YL1A 1L7CA 5A6JA 5L0JA 4U5HA 1K04A 2XLDA 4U9DA 1E85A 2Q9AA 4O79A 3K1HA 2HSQA 1NU7D 1UG7A 1TFOB 2R7TA 3E9VA 1JOGA 1BR2A 2VB6A 2R7WA 3AGUA 4NTBA 3O10A 4CSAC 3K7DA 4IRUA 2EPMX 3H2VA 1A41A 2EPNA 4MVSA 3UMKA 1AEPA 2GFHA 1YA9A 4LACB 4EBBA 1QLEC 4ZLDA 3QW1A 1OCOC 3SXMA 3ZQYA 2LK4A 5JSLA 1PV3A 1O3UA 2IOQA 3O55A 1R4TA 2XL4A 1B68A 3EQLF 5CIVA 3LUTB 2KGOA 1Z6AA 3DE8A 4YT4A 5BQIA 3AQBA 1HE9A 3EZHA 3IHUA 4KNVA 4G7HF 3M79A 2XM4A 4E7SA 1YZAA 3BEHA 2HMQA 2OEVA 4KBLA 3WAQA 2CYDA 3QVYA 2JX0A 4CS8A 2LIGA 4DOZA 1E86A 2A69F 2BE5F 3JRMO 3TD7A 3U3BA 1JPJA 1FR0A 2DGJA 4X0RA 1D1CA 4JE9A 5L0CA 5BQGA 2PX3A 2FAPB 3NYJA 1JAFA 3HNKA 3IPMO 4J30B 4XTKA 4JW1A 4O6MA 1HW2A 5L0DA 1OXKA 1DOWA 4DVZA 2R02A 3PMRA 5L3QA 4H54A 2PP4A 3DI5A 1ZU4A 1M57C 3HNLA 3ZIBA 1FTSA 2YL7A 1RCPA 4RD9A 3WHNA 3U2MA 1PCXA 3US6A 1TQGA 4QI2A 2Z15A 3MX3A 5JLIA 4CSAA 4M63A 2BC5A 1V55C 4HE8D 5D91A 3JRTA 4MNDA 3PCVA 3N2ZB 1QKRA 4MS2A 3AG4C 1VYIA 4U5DE 3V5XA 4OD4A 5B1BC 2FGYA 3U9MA 4MW8A 4NY3A 3AQCA 4CX9A 4OIPF 1TFKB 2LFDA 2W9YA 2ETSA 2GAQA 1YYJA 2HJMA 3EGDA 3KH2A 4XEKA 3G4ZA 3M4BA 4O6NA 3CZ6A 5D92A 3Q7LA 3VAYA 2LP4A 2KQ9A 1D1BA 2HMZA 3FXHA 5AGFA 4ZLCA 1YARO 3RIPA 1FFHA 2R03A 2NUPB 3UNGC 2ZXOA 2ASRA 2DYSC 3LAYA 3B9QA 3EH2A 3MLGA 3SYNA 2QE9A 4YL1A 3TOLA 2GWWA 1IZMA 1G4US 2OKUA 4UDVA 4JEBA 4JURI 4LLEA 4MVZA 1A7EA 1WGWA 4P9FA 2D5RB 4EWCA 2DI3A 2KNHA 2NUPA 4E0IA 4R32A 2J9WA 2MYSA 4YJWA 2XLWA 5AC4A 2YRFA 4JKVA 2A0UA 2Y3BA 4BG0A 2X51A 3R2PA 3JYYA 5E3AA 1YYXA 4JIOA 3SXZA 3VF0A 2QUPA 2XM0A 3EG9B 3DAGA 3K1IC 4NTFA 4P6IC 3FVYA 3T6GB 4AL1A 2YL0A 4HFKB 4G7ZF 4XPWA 4MVMA 2YWAA 3C8GD 3QVZA 2L6GA 1D0XA 2CCYA 2VH3A 4XLNF 1VYKA 2IXPA 2VASA 2YEVA 2Y3GA 1ST6A 3T6BA 3N24A 3U2LA 5BQHA 1NSGB 3TULA 4XWJA 4MVQA 3LLIA 3ZDLA 3R7CA 3KYJA 2EIJC 3ABLC 2WZLA 2LFFA 3W2VA 1D1AA 5DQZA 2A1DD 4J32B 4BPMA 3K6BA 4BEJA 3MBGA 1T01A 4YN0B 1HMOA 4JJFA 3JTLO 5B1AC 3ZQVA 2YLGA 3ZSUA 3NKDA 1FMVA 2AVKA 1Z5ZA 3T4RA 2C04A 3C7JA 4JCHA 3X2QC 3TK0A 3JSEO 5HV9A 2GDCA 3HNIA 4LDKA 2VC9A 1MMGA 2QTVA 1M2VB 3M4CA 2I15A 5KYNA 1ZW3A 1E83A 2NUTB 4U5GA 1JMWA 2O9XA 1RKEA 2MWQA 3B0PA 1GM5A 4CS8C 2ZXRA 1EI7A 1OW6A 4Q4ZF 3LNMB 4MQ9F 2L6FA 2R7XA 3K1IA 4K7BA 2Y3HA 4A2NB 1AVOB 1VOMA 3CQZA 3NRHA 3JSZA 1TWHA 2WVNA 1JRAA 3GORA 3S84A 2HJ3A 4KC9A 1NZEA 4A4AA 1H6GA 3GEEA 2WZFA 3AGTA 3UMIA 1TWGA 1NLXA 1ZHTA 4JC7A 5JS5A 5EHHA 3EPVA 2G62A 1Z63A 2YLIA 5COMA 1H7IA 3ZC4A 1WOLA 4D4NA 3LEOA 1YVIA 5JRAA 4N4WA 4JRZA 1M2VA 3M1CB 5DQTA 2R9RB 4IWBA 3GWNA 2XLOA 2UUHA 3UGPA 3S29A 2J7PD 5A69A 1T5OA 2WVOA 4QDLA 5COFA 4XLPF 5KYUB 5COGA 3NMJA 1FFTC 4Z9IA 3C8ZA 1T6UA 5JVEA 1CGNA 4LDRA 3KKBA 3NYMA 5L0HA 2PF4E 5KYYB 3ITFA 1OQCA 4FESA 1HY5A 5K0IA 1OW7A 2PX0A 3C18A 4IJJA 4W8PA 3RQEA 2P0NA 5A6BA 3NYLA 2IM8A 1XWJA 4WJ0A 2AP3A 1Q0DA 2PNOA 2B0JA 2R25A 5AC5A 3SZRA 1T6IA 5KYWA 4CS9C 4IAOA 3ZTZA 4IB4A 1LKXA 4AE4B 4G78A 4E0HA 1NFNA 1Q0KA 2R7OA 2YHSA 3LLKA 5KYWB 3FAPB 3H65A 4JVSA 1S7ZA 4AX2A 1E84A 5DVWA 3Q6MA 4E18A 1GS9A 1ZYRF 1ZHZA 3F46A 5B3SC 2CNWD 2P7VA 1GGQA 2HV7A 1RKEB 3KYIA 4ER9A 2IBFA 5BUOA 4L6RA 1A7DA 3SEOA 3QTHA 4OINF 2G3KA 4I1MA 1Y4CA 3OA1A 3JT1A 5DS5A 3X1OA 3EHMA 2XS1A 2NSFA 1O5HA 4OIRF 2J8WA 1ORYA 2XLHA 2EIKC 2EILC 1QVXA 3M15A 1F1MA 3QW0A 4HEAJ 3U8VA 3DE9A 3RQGA 1SYQA 3RFYA 3S0XA 2R7RA 2P6VA 4BJ5C 1RJ9B 2Q00A 3GWLA 4XEVA 1Z7Qc 1FMWA 2OG2A 3V7OA 2J9BA 4C3EA 4CBEA 1LS1A 2HV6A 2RSEB 3C62A 3AG3C 4ONSA 4WABA 3AG2C 3I5QA 4C7OB 4I44A 4WGZA 2XXAA 1UFBA 5E3CA 5A6BD 1FNTc 2QNLA 2MHRA 1ORJA 4O6YA 1OCRC 1Z23A 1EKYA 1E2XA 4N6CA 4AE4A 3B71A 1KNYA 1OCCC 5T1DB 2AWCA 3U0CA 1O87A 2XXAB 4CDAA 2WL8A
chains in the Genus database with same CATH topology
2Q3TA 1QZXA 2ZXPA 3DMDA 3LEVA 3PHF2 3ECSA 3W8HA 4JZAA 4G7HF 4PJMA 4ULWA 3NG1A 2ZPAA 3KL4A 4G0HA 2J46A 4CIHA 3ABKC 3QZCA 2G3VA 3GANA 4U5BE 1RJ9A 4FWVA 3ASOC 4W8KA 3HTKC 3VYWA 3POVA 2LSEA 1JPNA 3SP1A 5KYUA 2R7SA 3QMKA 1TKNA 4JJGA 3RKOF 4FX5A 1VMAA 1ZHWA 1G8XA 2C03A 3DM9B 3EGXA 2WZGA 3W8IA 1BR4A 3K33A 3DXJF 2J0WA 1TWAA 1MMDA 2EINC 3Q6NA 4C7OA 3EG9A 2V26A 4O7GA 4BJ5A 3FHDA 2YZSA 1OKKA 2A68F 5E33A 3SNHA 3WODF 1M56C 2J7PA 4U5FE 4C3DA 5T3TA 4GYTA 2W45A 3S27A 2KJGA 2QY9A 3OWTA 3DJNB 4PJJA 3KMIA 4PFPA 2KW3C 3EGDB 4DBQA 3NKEA 2OCCC 3NDBB 1MMNA 2V3CC 4I3MA 5F5HA 2XSEA 4PFOA 3IEEA 5KYXB 2NUTA 4K0DA 1J8MF 5DS4A 2XRHA 3L0IA 2IXOA 4B6IA 4YWQA 4BJ1A 3FAJA 2ZXWC 3EFOB 2L9JA 4RBNA 3OEOA 2Y69C 3RH3A 1SZIA 4YT8A 2R7UA 3JCUQ 4AK9A 2Q9BA 2W4BA 4E7ZA 1OKKD 4U5CE 2IYLD 4LERA 3DM5A 1TR2A 1Z3IX 3LS1A 2H7VC 3EH1A 1PD1A 2PFDA 1ZHXA 2EIMC 3O39A 1N1CA 4G7OF 1D0YA 4DVYP 4DBRA 3E70C 3WG7C 1SMYF 2H7BA 4Q5SF 4OD5A 2L81A 4ANJA 5DS6A 1ZU5A 2CGEA 2R7VA 3Q7GA 5L3VA 1TWCA 3ABMC 1M2OA 2E87A 3ZG1A 3ZVRA 4CS7A 3DJUB 3EHNA 3EFOA 3F47A 4I1OB 4PJLA 3UGOA 5F5FA 1LVKA 2J0XA 3AG1C 2IXMA 2M4EA 3ASNC 3S28A 4YT5A 1IW7F 3LJBA 5E2QA 5IY5C 1BR1A 4BJ6A 3W2WA 3LESA 3CSKA 4BJTA 2H7OA 4OIQF 3LS0A 1NG1A 1V54C 2J9UA 1MNDA 3EGXB 3T6JA 3K66A 5KYYA 2FFHA 2JD3A 5DLJA 1MNEA 4BJ6C 3HLZA 5HSWA 3B0UX 2J45A 2Y3DA 1D0ZA 1PD0A 4RDAA 4KNWA 2CDQA 3DD7A 1KU2A 2WB7A 2WVQA 5EGYA 2A6HF 5T3WA 4YT2A 3DAFA 4QI0A 3DZAA 4N06A 4C3BA 4LLCA 2R7QA 4CS9A 3FDQA 4PK4A 1NU9C 3B0VC 3UMHA 1ZHYA 3RYLA 2J9VA 3EZIA 3LNRA 3HJCA 1J8YF 2Y39A 1SF8A 3GODA 2Q9CA 1OCZC 1MMAA 2IXNA 5CI9A 5KYXA 2CNWA 4KI2A 3EJNA 4U5EE 2A6EF 1VK5A 3I4UA 5FCLA 4OIOF 3L34A 5CI8A 4HFFB 3O6XA 3UR3C 3I5PA 4GEHA 4PJNA 1W2WA 3N0TA 4F4BA 4Q7CA 2W4MA 3JYHA 2NG1A 4H4KC 2DYRC 2CW0F 2I8BA 4U5HA 2Q9AA 4O79A 3K1HA 1NU7D 2R7TA 3E9VA 1BR2A 2VB6A 2R7WA 4CSAC 3K7DA 4IRUA 3UMKA 2GFHA 4LACB 4EBBA 1QLEC 4ZLDA 1OCOC 2IOQA 2XL4A 3EQLF 2KGOA 1Z6AA 4YT4A 3AQBA 3EZHA 4KNVA 4E7SA 4KBLA 4CS8A 4DOZA 2A69F 2BE5F 3TD7A 1JPJA 2DGJA 4X0RA 1D1CA 2PX3A 3NYJA 4XTKA 4J30B 4JW1A 4O6MA 4DVZA 5L3QA 3PMRA 2PP4A 1ZU4A 1M57C 3ZIBA 1FTSA 4RD9A 1PCXA 4QI2A 2Z15A 3MX3A 4CSAA 4M63A 5D91A 1V55C 4HE8D 3JRTA 4MNDA 3N2ZB 3AG4C 1VYIA 4U5DE 4OD4A 5B1BC 2FGYA 4NY3A 3AQCA 4OIPF 2W9YA 3EGDA 3KH2A 4O6NA 3CZ6A 5D92A 3Q7LA 3VAYA 2KQ9A 1D1BA 4ZLCA 3RIPA 1FFHA 2NUPB 3UNGC 2ZXOA 3LAYA 2DYSC 3B9QA 3EH2A 3MLGA 3SYNA 1IZMA 4JURI 4LLEA 1WGWA 2D5RB 4EWCA 2NUPA 2KNHA 2J9WA 2MYSA 4YJWA 2Y3BA 4BG0A 2X51A 5E3AA 3EG9B 3K1IC 3DAGA 4P6IC 3FVYA 4HFKB 4G7ZF 4XLNF 1D0XA 2VH3A 1VYKA 2IXPA 2VASA 2YEVA 2Y3GA 1ST6A 3T6BA 3N24A 4XWJA 3LLIA 2EIJC 3ABLC 2WZLA 3W2VA 1D1AA 5DQZA 2A1DD 4J32B 3K6BA 4BEJA 4YN0B 4JJFA 5B1AC 3ZSUA 3NKDA 1FMVA 1Z5ZA 3T4RA 2C04A 4JCHA 3X2QC 1MMGA 2QTVA 1M2VB 5KYNA 2NUTB 4U5GA 2O9XA 2MWQA 3B0PA 4CS8C 2ZXRA 4Q4ZF 4MQ9F 2R7XA 4K7BA 4A2NB 2Y3HA 1VOMA 3CQZA 3NRHA 3JSZA 1TWHA 2WVNA 4KC9A 1NZEA 2WZFA 3UMIA 1TWGA 1ZHTA 5EHHA 3EPVA 2G62A 1Z63A 3ZC4A 1M2VA 3M1CB 5DQTA 4IWBA 3UGPA 3S29A 2J7PD 2WVOA 4QDLA 4XLPF 5KYUB 1FFTC 3KKBA 3NYMA 2PF4E 5KYYB 3ITFA 4FESA 2PX0A 4IJJA 3NYLA 4WJ0A 2B0JA 3SZRA 5KYWA 4CS9C 4IAOA 4AE4B 1LKXA 2R7OA 2YHSA 3LLKA 5KYWB 3H65A 4JVSA 4AX2A 1S7ZA 5DVWA 3Q6MA 1ZYRF 1ZHZA 3F46A 5B3SC 2CNWD 2P7VA 2HV7A 5BUOA 3SEOA 4OINF 2G3KA 4I1MA 3OA1A 3JT1A 5DS5A 3X1OA 3EHMA 1O5HA 4OIRF 2EIKC 2EILC 4HEAJ 3S0XA 3RFYA 2R7RA 2P6VA 4BJ5C 1RJ9B 1FMWA 2OG2A 3V7OA 4C3EA 4CBEA 1LS1A 2HV6A 3AG3C 3AG2C 3I5QA 4C7OB 4I44A 2XXAA 5E3CA 4O6YA 1OCRC 1Z23A 4AE4A 1OCCC 5T1DB 1O87A 2XXAB 2WL8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WL8 A; 
#chains in the Genus database with same CATH topology
 4MTO A;  1LI5 A;  2OU6 A;  2Q3T A;  4IAR A;  1QZX A;  3H2U A;  1BBH A;  2ZXP A;  1LM3 B;  3DMD A;  3LEV A;  3ECS A;  4XEF A;  1NBB A;  2OEX A;  1RXQ A;  4JZA A;  3W8H A;  3PHF 2;  2LCH A;  4PJM A;  4ULW A;  3G50 A;  2ZPA A;  3KL4 A;  3NG1 A;  3V5Z A;  2B0H A;  4CJG A;  4G0H A;  1OR2 A;  4EBK A;  1T6Q A;  3FOO A;  1QQ3 A;  1CPR A;  1ZVZ A;  2J46 A;  4CIH A;  3ABK C;  3QZC A;  2G3V A;  1U0B B;  2ICW G;  2XS8 A;  3RVZ A;  3MYF A;  2EPL X;  2GA0 A;  3GAN A;  3T9O A;  2JPU A;  3GEI A;  3L1M A;  4U5B E;  1RJ9 A;  3MFN A;  3S9O A;  4FWV A;  3L8I A;  4DRJ B;  3ASO C;  4W8K A;  2HSB A;  3IQC A;  3HTK C;  1I4Y A;  3VYW A;  2LSE A;  5L0I A;  3POV A;  1JPN A;  4LDQ A;  5KYU A;  3SP1 A;  2R7S A;  1A0B A;  3QMK A;  1TKN A;  4JJG A;  3RKO F;  1C02 A;  4FX5 A;  3V5Y A;  1VMA A;  1ZHW A;  2HFI A;  3ZWI A;  1G8X A;  2C03 A;  3KPH A;  4YL0 A;  4N6H A;  4DJ9 A;  3DM9 B;  3NMK A;  3EGX A;  2WZG A;  1LE2 A;  2P61 A;  2YLD A;  3PDM P;  2F22 A;  3W8I A;  1RMV A;  1BZ4 A;  1BR4 A;  3IQ6 A;  3K33 A;  3DXJ F;  3VRC A;  4D4X A;  2J0W A;  1TWA A;  1MMD A;  2EIN C;  4IAQ A;  3Q6N A;  5FZT A;  4C7O A;  3EG9 A;  2AU5 A;  2V26 A;  4O7G A;  1XZQ A;  4BJ5 A;  3FHD A;  1FAP B;  4CDV A;  2YZS A;  1OKK A;  4YL3 A;  3CEX A;  2A68 F;  2Q4F A;  5E33 A;  3SNH A;  3WOD F;  1QSP A;  2HKV A;  4JCZ A;  1VTM P;  1M56 C;  2J7P A;  1K05 A;  2AWY A;  1QPU A;  1MQV A;  2TMV P;  2LD6 A;  4MVO A;  2OJQ A;  4U5F E;  4C3D A;  2OJE D;  5T3T A;  4GYT A;  2W45 A;  3S27 A;  4MTG A;  4JTD B;  3A9C A;  3CAX A;  4DXW A;  2KJG A;  2H8A A;  1AUE A;  1K40 A;  2L6H A;  4ULV A;  1ORS C;  2QY9 A;  2VCB A;  3DJN B;  3OWT A;  4PJJ A;  1LE4 A;  3TJ5 A;  1LIH A;  3KMI A;  3DWW A;  1I4Z A;  2KW3 C;  4PFP A;  3EGD B;  4DBQ A;  4MVU A;  3NKE A;  2OCC C;  2UUI A;  1XZP A;  3NDB B;  1MMN A;  2V3C C;  4I3M A;  3ZTM A;  3G4X A;  1HW1 A;  5F5H A;  4E17 A;  1V74 B;  4NC3 A;  2XSE A;  4PFO A;  2XL6 A;  4DRH B;  2YL3 A;  2BL2 A;  1U6H A;  3IEE A;  5KYX B;  2NUT A;  4JTA B;  1G4W R;  4K0D A;  1J8M F;  1VLS A;  2HUJ A;  5DS4 A;  2XRH A;  3L0I A;  3SXY A;  2IXO A;  4NTA A;  2PBE A;  4YK5 A;  5JT4 A;  1CGO A;  4B6I A;  4YWQ A;  1ZZP A;  1HMD A;  4BJ1 A;  5JUA A;  3FMS A;  3FAJ A;  2ZXW C;  5L0F A;  3EFO B;  2L9J A;  4RBN A;  3OEO A;  1HE1 A;  2XLE A;  2Y69 C;  4MVR A;  1SZI A;  2RD9 A;  3RH3 A;  4YT8 A;  1SR2 A;  1JR8 A;  3FOP A;  3W4Y A;  3GEH A;  1CGM E;  3DKA A;  3JCU Q;  1WWP A;  2EPO A;  1CPQ A;  3RF3 A;  2VCC A;  4AK9 A;  2Q9B A;  2W4B A;  4E7Z A;  1OKK D;  4U5C E;  2IYL D;  4LER A;  3DM5 A;  1TR2 A;  1L3P A;  1Z3I X;  2H7V C;  3LS1 A;  2LQG A;  4J7T A;  3EH1 A;  1PD1 A;  3C8G A;  3SXK A;  2PFD A;  1ZHX A;  1LPE A;  2EIM C;  3O39 A;  1N1C A;  2R05 A;  4G7O F;  1D0Y A;  1C17 M;  4DVY P;  1G5Z A;  4DBR A;  3E70 C;  5L0G A;  3GM3 A;  3UGO A;  3WG7 C;  1SMY F;  1DOV A;  2H7B A;  2NSG A;  1Q0F A;  1YLM A;  4MTF A;  3S90 A;  4OD5 A;  4Q5S F;  1VB5 A;  2YVK A;  2L81 A;  4ANJ A;  5DS6 A;  1YAU O;  1ZU5 A;  2CGE A;  4BEM J;  2R7V A;  2VCA A;  3Q7G A;  1T9K A;  2OQM A;  3B29 A;  1OR3 A;  1TWC A;  3ABM C;  1M2O A;  2E87 A;  4WGY A;  3ZG1 A;  5L3V A;  3ZVR A;  4CS7 A;  5A6K A;  1RKC A;  1H9G A;  1BDJ B;  1Q0G A;  2OOC A;  3DJU B;  3EHN A;  3EFO A;  3F47 A;  4I1O B;  4PJL A;  4XPX A;  3U8P A;  4EIY A;  1OW8 A;  5JP7 A;  3TJ6 A;  5F5F A;  1APC A;  1LVK A;  4CJO A;  3GM2 A;  4EHP A;  3A11 A;  2J0X A;  3AG1 C;  2KSF A;  2XL8 A;  2IXM A;  4GQH A;  1I5N A;  2M4E A;  3ATP A;  3ASN C;  4DRI B;  3S28 A;  1WN0 A;  3RW0 A;  4K1O A;  4FAP B;  2YKZ A;  1IW7 F;  2NPU A;  4YT5 A;  3U3F A;  3LJB A;  3JZ0 A;  5E2Q A;  4CDY A;  5IY5 C;  3J06 A;  1BR1 A;  4BJ6 A;  5B3I A;  1V4A A;  3W2W A;  1Y6D A;  3LES A;  4XQ1 A;  3CSK A;  4BJT A;  2H7O A;  4Z9J A;  4OIQ F;  3LS0 A;  4EKW A;  3BRJ A;  3GM1 A;  3L8J A;  4MW3 A;  4J7Y A;  1NG1 A;  1V54 C;  2J9U A;  1EQ1 A;  1MND A;  1WTY A;  3EGX B;  4PAC A;  2DB4 A;  4JTC B;  3T6J A;  3K66 A;  5KYY A;  4EBJ A;  2FFH A;  1KTM A;  2JD3 A;  4Z9H A;  5DLJ A;  1MNE A;  4BJ6 C;  3HLZ A;  2KYH A;  5HSW A;  3B0U X;  2J45 A;  3C8G B;  1A7V A;  1D0Z A;  2HZ8 A;  2Y3D A;  3HKK A;  1PD0 A;  4RDA A;  2R7U A;  4KNW A;  2CDQ A;  3DD7 A;  1KU2 A;  1VLT A;  2WB7 A;  2WVQ A;  3RVY A;  5EGY A;  2QLA A;  2A6H F;  2XLV A;  5F28 E;  5T3W A;  4YT2 A;  3DAF A;  4AL0 A;  2ZD9 A;  4QI0 A;  3TQO A;  3IQT A;  3DZA A;  4N06 A;  4XPY A;  4C3B A;  4LLC A;  1GQA A;  2EPK X;  2R7Q A;  4CS9 A;  3NMI A;  4PK4 A;  3VM6 A;  3FDQ A;  1NU9 C;  1YJG A;  3B0V C;  4IGG A;  3HNJ A;  3UMH A;  3IQ5 A;  1ZHY A;  3RYL A;  2J9V A;  3EZI A;  3LNR A;  1S05 A;  1LI7 A;  3HJC A;  1WAT A;  1NFO A;  1J8Y F;  2Y39 A;  4NQF A;  1SF8 A;  3GOD A;  3AJM A;  3C63 A;  2Q9C A;  1OCZ C;  1MMA A;  3AOU A;  2IXN A;  5CI9 A;  2Q7R A;  5KYX A;  2CNW A;  4U9E A;  3EJN A;  4KI2 A;  4U5E E;  1U89 A;  2A6E F;  1VK5 A;  3I4U A;  5FCL A;  3RQF A;  1ZW2 A;  2KK1 A;  4OIO F;  1R5I D;  3L34 A;  1Q0M A;  5GPG B;  5CI8 A;  4HFF B;  2D4U A;  3O6X A;  3UR3 C;  4JEA A;  2L7A A;  3I5P A;  4GEH A;  4PJN A;  5EK0 A;  1OXB A;  1C03 A;  1W2W A;  2KC3 A;  3N0T A;  4F4B A;  5A6A A;  4EUK B;  1LS4 A;  2W4M A;  4Q7C A;  1WAS A;  4PR9 A;  3TOM A;  256B A;  1YZC A;  4CIP A;  2HS5 A;  3U9J A;  2YQY A;  2P1A A;  3JYH A;  2NG1 A;  1YDI A;  3MYI A;  4P9T A;  4NCQ A;  5TJ5 E;  3U5S A;  4H4K C;  2X0C A;  1M6T A;  1H9T A;  2M64 A;  2DYR C;  1EA8 A;  2CW0 F;  2I8B A;  2XLM A;  1YA7 O;  2A0B A;  2YL1 A;  1L7C A;  5A6J A;  5L0J A;  4U5H A;  1K04 A;  2XLD A;  4U9D A;  1E85 A;  2Q9A A;  4O79 A;  3K1H A;  2HSQ A;  1NU7 D;  1UG7 A;  1TFO B;  2R7T A;  3E9V A;  1JOG A;  1BR2 A;  2VB6 A;  2R7W A;  3AGU A;  4NTB A;  3O10 A;  4CSA C;  3K7D A;  4IRU A;  2EPM X;  3H2V A;  1A41 A;  2EPN A;  4MVS A;  3UMK A;  1AEP A;  2GFH A;  1YA9 A;  4LAC B;  4EBB A;  1QLE C;  4ZLD A;  3QW1 A;  1OCO C;  3SXM A;  3ZQY A;  2LK4 A;  5JSL A;  1PV3 A;  1O3U A;  2IOQ A;  3O55 A;  1R4T A;  2XL4 A;  1B68 A;  3EQL F;  5CIV A;  3LUT B;  2KGO A;  1Z6A A;  3DE8 A;  4YT4 A;  5BQI A;  3AQB A;  1HE9 A;  3EZH A;  3IHU A;  4KNV A;  4G7H F;  3M79 A;  2XM4 A;  4E7S A;  1YZA A;  3BEH A;  2HMQ A;  2OEV A;  4KBL A;  3WAQ A;  2CYD A;  3QVY A;  2JX0 A;  4CS8 A;  2LIG A;  4DOZ A;  1E86 A;  2A69 F;  2BE5 F;  3JRM O;  3TD7 A;  3U3B A;  1JPJ A;  1FR0 A;  2DGJ A;  4X0R A;  1D1C A;  4JE9 A;  5L0C A;  5BQG A;  2PX3 A;  2FAP B;  3NYJ A;  1JAF A;  3HNK A;  3IPM O;  4J30 B;  4XTK A;  4JW1 A;  4O6M A;  1HW2 A;  5L0D A;  1OXK A;  1DOW A;  4DVZ A;  2R02 A;  3PMR A;  5L3Q A;  4H54 A;  2PP4 A;  3DI5 A;  1ZU4 A;  1M57 C;  3HNL A;  3ZIB A;  1FTS A;  2YL7 A;  1RCP A;  4RD9 A;  3WHN A;  3U2M A;  1PCX A;  3US6 A;  1TQG A;  4QI2 A;  2Z15 A;  3MX3 A;  5JLI A;  4CSA A;  4M63 A;  2BC5 A;  1V55 C;  4HE8 D;  5D91 A;  3JRT A;  4MND A;  3PCV A;  3N2Z B;  1QKR A;  4MS2 A;  3AG4 C;  1VYI A;  4U5D E;  3V5X A;  4OD4 A;  5B1B C;  2FGY A;  3U9M A;  4MW8 A;  4NY3 A;  3AQC A;  4CX9 A;  4OIP F;  1TFK B;  2LFD A;  2W9Y A;  2ETS A;  2GAQ A;  1YYJ A;  2HJM A;  3EGD A;  3KH2 A;  4XEK A;  3G4Z A;  3M4B A;  4O6N A;  3CZ6 A;  5D92 A;  3Q7L A;  3VAY A;  2LP4 A;  2KQ9 A;  1D1B A;  2HMZ A;  3FXH A;  5AGF A;  4ZLC A;  1YAR O;  3RIP A;  1FFH A;  2R03 A;  2NUP B;  3UNG C;  2ZXO A;  2ASR A;  2DYS C;  3LAY A;  3B9Q A;  3EH2 A;  3MLG A;  3SYN A;  2QE9 A;  4YL1 A;  3TOL A;  2GWW A;  1IZM A;  1G4U S;  2OKU A;  4UDV A;  4JEB A;  4JUR I;  4LLE A;  4MVZ A;  1A7E A;  1WGW A;  4P9F A;  2D5R B;  4EWC A;  2DI3 A;  2KNH A;  2NUP A;  4E0I A;  4R32 A;  2J9W A;  2MYS A;  4YJW A;  2XLW A;  5AC4 A;  2YRF A;  4JKV A;  2A0U A;  2Y3B A;  4BG0 A;  2X51 A;  3R2P A;  3JYY A;  5E3A A;  1YYX A;  4JIO A;  3SXZ A;  3VF0 A;  2QUP A;  2XM0 A;  3EG9 B;  3DAG A;  3K1I C;  4NTF A;  4P6I C;  3FVY A;  3T6G B;  4AL1 A;  2YL0 A;  4HFK B;  4G7Z F;  4XPW A;  4MVM A;  2YWA A;  3C8G D;  3QVZ A;  2L6G A;  1D0X A;  2CCY A;  2VH3 A;  4XLN F;  1VYK A;  2IXP A;  2VAS A;  2YEV A;  2Y3G A;  1ST6 A;  3T6B A;  3N24 A;  3U2L A;  5BQH A;  1NSG B;  3TUL A;  4XWJ A;  4MVQ A;  3LLI A;  3ZDL A;  3R7C A;  3KYJ A;  2EIJ C;  3ABL C;  2WZL A;  2LFF A;  3W2V A;  1D1A A;  5DQZ A;  2A1D D;  4J32 B;  4BPM A;  3K6B A;  4BEJ A;  3MBG A;  1T01 A;  4YN0 B;  1HMO A;  4JJF A;  3JTL O;  5B1A C;  3ZQV A;  2YLG A;  3ZSU A;  3NKD A;  1FMV A;  2AVK A;  1Z5Z A;  3T4R A;  2C04 A;  3C7J A;  4JCH A;  3X2Q C;  3TK0 A;  3JSE O;  5HV9 A;  2GDC A;  3HNI A;  4LDK A;  2VC9 A;  1MMG A;  2QTV A;  1M2V B;  3M4C A;  2I15 A;  5KYN A;  1ZW3 A;  1E83 A;  2NUT B;  4U5G A;  1JMW A;  2O9X A;  1RKE A;  2MWQ A;  3B0P A;  1GM5 A;  4CS8 C;  2ZXR A;  1EI7 A;  1OW6 A;  4Q4Z F;  3LNM B;  4MQ9 F;  2L6F A;  2R7X A;  3K1I A;  4K7B A;  2Y3H A;  4A2N B;  1AVO B;  1VOM A;  3CQZ A;  3NRH A;  3JSZ A;  1TWH A;  2WVN A;  1JRA A;  3GOR A;  3S84 A;  2HJ3 A;  4KC9 A;  1NZE A;  4A4A A;  1H6G A;  3GEE A;  2WZF A;  3AGT A;  3UMI A;  1TWG A;  1NLX A;  1ZHT A;  4JC7 A;  5JS5 A;  5EHH A;  3EPV A;  2G62 A;  1Z63 A;  2YLI A;  5COM A;  1H7I A;  3ZC4 A;  1WOL A;  4D4N A;  3LEO A;  1YVI A;  5JRA A;  4N4W A;  4JRZ A;  1M2V A;  3M1C B;  5DQT A;  2R9R B;  4IWB A;  3GWN A;  2XLO A;  2UUH A;  3UGP A;  3S29 A;  2J7P D;  5A69 A;  1T5O A;  2WVO A;  4QDL A;  5COF A;  4XLP F;  5KYU B;  5COG A;  3NMJ A;  1FFT C;  4Z9I A;  3C8Z A;  1T6U A;  5JVE A;  1CGN A;  4LDR A;  3KKB A;  3NYM A;  5L0H A;  2PF4 E;  5KYY B;  3ITF A;  1OQC A;  4FES A;  1HY5 A;  5K0I A;  1OW7 A;  2PX0 A;  3C18 A;  4IJJ A;  4W8P A;  3RQE A;  2P0N A;  5A6B A;  3NYL A;  2IM8 A;  1XWJ A;  4WJ0 A;  2AP3 A;  1Q0D A;  2PNO A;  2B0J A;  2R25 A;  5AC5 A;  3SZR A;  1T6I A;  5KYW A;  4CS9 C;  4IAO A;  3ZTZ A;  4IB4 A;  1LKX A;  4AE4 B;  4G78 A;  4E0H A;  1NFN A;  1Q0K A;  2R7O A;  2YHS A;  3LLK A;  5KYW B;  3FAP B;  3H65 A;  4JVS A;  1S7Z A;  4AX2 A;  1E84 A;  5DVW A;  3Q6M A;  4E18 A;  1GS9 A;  1ZYR F;  1ZHZ A;  3F46 A;  5B3S C;  2CNW D;  2P7V A;  1GGQ A;  2HV7 A;  1RKE B;  3KYI A;  4ER9 A;  2IBF A;  5BUO A;  4L6R A;  1A7D A;  3SEO A;  3QTH A;  4OIN F;  2G3K A;  4I1M A;  1Y4C A;  3OA1 A;  3JT1 A;  5DS5 A;  3X1O A;  3EHM A;  2XS1 A;  2NSF A;  1O5H A;  4OIR F;  2J8W A;  1ORY A;  2XLH A;  2EIK C;  2EIL C;  1QVX A;  3M15 A;  1F1M A;  3QW0 A;  4HEA J;  3U8V A;  3DE9 A;  3RQG A;  1SYQ A;  3RFY A;  3S0X A;  2R7R A;  2P6V A;  4BJ5 C;  1RJ9 B;  2Q00 A;  3GWL A;  4XEV A;  1Z7Q c;  1FMW A;  2OG2 A;  3V7O A;  2J9B A;  4C3E A;  4CBE A;  1LS1 A;  2HV6 A;  2RSE B;  3C62 A;  3AG3 C;  4ONS A;  4WAB A;  3AG2 C;  3I5Q A;  4C7O B;  4I44 A;  4WGZ A;  2XXA A;  1UFB A;  5E3C A;  5A6B D;  1FNT c;  2QNL A;  2MHR A;  1ORJ A;  4O6Y A;  1OCR C;  1Z23 A;  1EKY A;  1E2X A;  4N6C A;  4AE4 A;  3B71 A;  1KNY A;  1OCC C;  5T1D B;  2AWC A;  3U0C A;  1O87 A;  2XXA B;  4CDA A;  2WL8 A; 
#chains in the Genus database with same CATH homology
 2Q3T A;  1QZX A;  2ZXP A;  3DMD A;  3LEV A;  3PHF 2;  3ECS A;  3W8H A;  4JZA A;  4G7H F;  4PJM A;  4ULW A;  3NG1 A;  2ZPA A;  3KL4 A;  4G0H A;  2J46 A;  4CIH A;  3ABK C;  3QZC A;  2G3V A;  3GAN A;  4U5B E;  1RJ9 A;  4FWV A;  3ASO C;  4W8K A;  3HTK C;  3VYW A;  3POV A;  2LSE A;  1JPN A;  3SP1 A;  5KYU A;  2R7S A;  3QMK A;  1TKN A;  4JJG A;  3RKO F;  4FX5 A;  1VMA A;  1ZHW A;  1G8X A;  2C03 A;  3DM9 B;  3EGX A;  2WZG A;  3W8I A;  1BR4 A;  3K33 A;  3DXJ F;  2J0W A;  1TWA A;  1MMD A;  2EIN C;  3Q6N A;  4C7O A;  3EG9 A;  2V26 A;  4O7G A;  4BJ5 A;  3FHD A;  2YZS A;  1OKK A;  2A68 F;  5E33 A;  3SNH A;  3WOD F;  1M56 C;  2J7P A;  4U5F E;  4C3D A;  5T3T A;  4GYT A;  2W45 A;  3S27 A;  2KJG A;  2QY9 A;  3OWT A;  3DJN B;  4PJJ A;  3KMI A;  4PFP A;  2KW3 C;  3EGD B;  4DBQ A;  3NKE A;  2OCC C;  3NDB B;  1MMN A;  2V3C C;  4I3M A;  5F5H A;  2XSE A;  4PFO A;  3IEE A;  5KYX B;  2NUT A;  4K0D A;  1J8M F;  5DS4 A;  2XRH A;  3L0I A;  2IXO A;  4B6I A;  4YWQ A;  4BJ1 A;  3FAJ A;  2ZXW C;  3EFO B;  2L9J A;  4RBN A;  3OEO A;  2Y69 C;  3RH3 A;  1SZI A;  4YT8 A;  2R7U A;  3JCU Q;  4AK9 A;  2Q9B A;  2W4B A;  4E7Z A;  1OKK D;  4U5C E;  2IYL D;  4LER A;  3DM5 A;  1TR2 A;  1Z3I X;  3LS1 A;  2H7V C;  3EH1 A;  1PD1 A;  2PFD A;  1ZHX A;  2EIM C;  3O39 A;  1N1C A;  4G7O F;  1D0Y A;  4DVY P;  4DBR A;  3E70 C;  3WG7 C;  1SMY F;  2H7B A;  4Q5S F;  4OD5 A;  2L81 A;  4ANJ A;  5DS6 A;  1ZU5 A;  2CGE A;  2R7V A;  3Q7G A;  5L3V A;  1TWC A;  3ABM C;  1M2O A;  2E87 A;  3ZG1 A;  3ZVR A;  4CS7 A;  3DJU B;  3EHN A;  3EFO A;  3F47 A;  4I1O B;  4PJL A;  3UGO A;  5F5F A;  1LVK A;  2J0X A;  3AG1 C;  2IXM A;  2M4E A;  3ASN C;  3S28 A;  4YT5 A;  1IW7 F;  3LJB A;  5E2Q A;  5IY5 C;  1BR1 A;  4BJ6 A;  3W2W A;  3LES A;  3CSK A;  4BJT A;  2H7O A;  4OIQ F;  3LS0 A;  1NG1 A;  1V54 C;  2J9U A;  1MND A;  3EGX B;  3T6J A;  3K66 A;  5KYY A;  2FFH A;  2JD3 A;  5DLJ A;  1MNE A;  4BJ6 C;  3HLZ A;  5HSW A;  3B0U X;  2J45 A;  2Y3D A;  1D0Z A;  1PD0 A;  4RDA A;  4KNW A;  2CDQ A;  3DD7 A;  1KU2 A;  2WB7 A;  2WVQ A;  5EGY A;  2A6H F;  5T3W A;  4YT2 A;  3DAF A;  4QI0 A;  3DZA A;  4N06 A;  4C3B A;  4LLC A;  2R7Q A;  4CS9 A;  3FDQ A;  4PK4 A;  1NU9 C;  3B0V C;  3UMH A;  1ZHY A;  3RYL A;  2J9V A;  3EZI A;  3LNR A;  3HJC A;  1J8Y F;  2Y39 A;  1SF8 A;  3GOD A;  2Q9C A;  1OCZ C;  1MMA A;  2IXN A;  5CI9 A;  5KYX A;  2CNW A;  4KI2 A;  3EJN A;  4U5E E;  2A6E F;  1VK5 A;  3I4U A;  5FCL A;  4OIO F;  3L34 A;  5CI8 A;  4HFF B;  3O6X A;  3UR3 C;  3I5P A;  4GEH A;  4PJN A;  1W2W A;  3N0T A;  4F4B A;  4Q7C A;  2W4M A;  3JYH A;  2NG1 A;  4H4K C;  2DYR C;  2CW0 F;  2I8B A;  4U5H A;  2Q9A A;  4O79 A;  3K1H A;  1NU7 D;  2R7T A;  3E9V A;  1BR2 A;  2VB6 A;  2R7W A;  4CSA C;  3K7D A;  4IRU A;  3UMK A;  2GFH A;  4LAC B;  4EBB A;  1QLE C;  4ZLD A;  1OCO C;  2IOQ A;  2XL4 A;  3EQL F;  2KGO A;  1Z6A A;  4YT4 A;  3AQB A;  3EZH A;  4KNV A;  4E7S A;  4KBL A;  4CS8 A;  4DOZ A;  2A69 F;  2BE5 F;  3TD7 A;  1JPJ A;  2DGJ A;  4X0R A;  1D1C A;  2PX3 A;  3NYJ A;  4XTK A;  4J30 B;  4JW1 A;  4O6M A;  4DVZ A;  5L3Q A;  3PMR A;  2PP4 A;  1ZU4 A;  1M57 C;  3ZIB A;  1FTS A;  4RD9 A;  1PCX A;  4QI2 A;  2Z15 A;  3MX3 A;  4CSA A;  4M63 A;  5D91 A;  1V55 C;  4HE8 D;  3JRT A;  4MND A;  3N2Z B;  3AG4 C;  1VYI A;  4U5D E;  4OD4 A;  5B1B C;  2FGY A;  4NY3 A;  3AQC A;  4OIP F;  2W9Y A;  3EGD A;  3KH2 A;  4O6N A;  3CZ6 A;  5D92 A;  3Q7L A;  3VAY A;  2KQ9 A;  1D1B A;  4ZLC A;  3RIP A;  1FFH A;  2NUP B;  3UNG C;  2ZXO A;  3LAY A;  2DYS C;  3B9Q A;  3EH2 A;  3MLG A;  3SYN A;  1IZM A;  4JUR I;  4LLE A;  1WGW A;  2D5R B;  4EWC A;  2NUP A;  2KNH A;  2J9W A;  2MYS A;  4YJW A;  2Y3B A;  4BG0 A;  2X51 A;  5E3A A;  3EG9 B;  3K1I C;  3DAG A;  4P6I C;  3FVY A;  4HFK B;  4G7Z F;  4XLN F;  1D0X A;  2VH3 A;  1VYK A;  2IXP A;  2VAS A;  2YEV A;  2Y3G A;  1ST6 A;  3T6B A;  3N24 A;  4XWJ A;  3LLI A;  2EIJ C;  3ABL C;  2WZL A;  3W2V A;  1D1A A;  5DQZ A;  2A1D D;  4J32 B;  3K6B A;  4BEJ A;  4YN0 B;  4JJF A;  5B1A C;  3ZSU A;  3NKD A;  1FMV A;  1Z5Z A;  3T4R A;  2C04 A;  4JCH A;  3X2Q C;  1MMG A;  2QTV A;  1M2V B;  5KYN A;  2NUT B;  4U5G A;  2O9X A;  2MWQ A;  3B0P A;  4CS8 C;  2ZXR A;  4Q4Z F;  4MQ9 F;  2R7X A;  4K7B A;  4A2N B;  2Y3H A;  1VOM A;  3CQZ A;  3NRH A;  3JSZ A;  1TWH A;  2WVN A;  4KC9 A;  1NZE A;  2WZF A;  3UMI A;  1TWG A;  1ZHT A;  5EHH A;  3EPV A;  2G62 A;  1Z63 A;  3ZC4 A;  1M2V A;  3M1C B;  5DQT A;  4IWB A;  3UGP A;  3S29 A;  2J7P D;  2WVO A;  4QDL A;  4XLP F;  5KYU B;  1FFT C;  3KKB A;  3NYM A;  2PF4 E;  5KYY B;  3ITF A;  4FES A;  2PX0 A;  4IJJ A;  3NYL A;  4WJ0 A;  2B0J A;  3SZR A;  5KYW A;  4CS9 C;  4IAO A;  4AE4 B;  1LKX A;  2R7O A;  2YHS A;  3LLK A;  5KYW B;  3H65 A;  4JVS A;  4AX2 A;  1S7Z A;  5DVW A;  3Q6M A;  1ZYR F;  1ZHZ A;  3F46 A;  5B3S C;  2CNW D;  2P7V A;  2HV7 A;  5BUO A;  3SEO A;  4OIN F;  2G3K A;  4I1M A;  3OA1 A;  3JT1 A;  5DS5 A;  3X1O A;  3EHM A;  1O5H A;  4OIR F;  2EIK C;  2EIL C;  4HEA J;  3S0X A;  3RFY A;  2R7R A;  2P6V A;  4BJ5 C;  1RJ9 B;  1FMW A;  2OG2 A;  3V7O A;  4C3E A;  4CBE A;  1LS1 A;  2HV6 A;  3AG3 C;  3AG2 C;  3I5Q A;  4C7O B;  4I44 A;  2XXA A;  5E3C A;  4O6Y A;  1OCR C;  1Z23 A;  4AE4 A;  1OCC C;  5T1D B;  1O87 A;  2XXA B;  2WL8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...