2WL8A

X-ray crystal structure of pex19p
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
110
structure length
110
Chain Sequence
ILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESLPPEQFEKYQEQHSVMCKICEQFEAETPTDSETTQKARFEMVLDLMQQLQDLGHPPKELAGEMPPGLNFDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PEROXISOMAL BIOGENESIS FACTOR 19
publication title The Peroxisomal Receptor Pex19P Forms a Helical Mpts Recognition Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 36
structure length 110
sequence length 110
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-06-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.900 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2wl8A00
2WL8A
chains in the Genus database with same CATH superfamily
3KL4A 2L6FA 3QW0A 3AG4C 3KH2A 2BC5A 1WN0A 3EHMA 3FHDA 1OKKA 3SEOA 1N1CA 4IJJA 3WG7C 5KYXA 2WB7A 3O55A 3LJBA 3B0PA 4JEBA 4LERA 1QPUA 4YT5A 1MMNA 5GPGB 1FMWA 1ST6A 2HJ3A 3L8IA 4YWQA 5JUAA 1D1AA 1LVKA 1O87A 2XM0A 4XWJA 4CJOA 2E87A 1T9KA 1Q0FA 5DS5A 4FWVA 3TOMA 1FMVA 1RXQA 2XLOA 2ASRA 2EIMC 3ZIBA 4AE4B 1YVIA 2ICWG 3DE9A 3KKBA 4Q7CA 5CIVA 4JW1A 2J8WA 4O7GA 3U2MA 2B0JA 2HV6A 1FTSA 4JRZA 1F1MA 2YLIA 2R03A 5L0GA 1ZZPA 4CDVA 1NZEA 3CAXA 3J06A 2ZXRA 1G4US 3ZG1A 1HE1A 3EG9A 4W8KA 4DRIB 1GM5A 4MW8A 3TQOA 5BQIA 2R25A 5A69A 3ZQYA 2OKUA 3ZSUA 2A0UA 3VM6A 3GM1A 1TWHA 3IQ5A 1APCA 2LIGA 4PJMA 4E0HA 5B1BC 4DOZA 4E7SA 4P9FA 3Q7LA 1Z23A 3OEOA 2WL8A 2XSEA 3AJMA 2XLEA 3ABLC 2I8BA 4U9EA 2KC3A 4PACA 1Q0MA 1FR0A 5KYYA 1A7DA 3EG9B 4Z9JA 3H2UA 5B1AC 2Q4FA 4L6RA 4ZLCA 2VCBA 1BBHA 5A6JA 4W8PA 2FGYA 1YYXA 2GFHA 1RKCA 3JRTA 1K04A 4ANJA 4D4NA 2OCCC 3ECSA 2J7PA 5L3VA 3QVYA 3DXJF 2XLVA 1TKNA 2HV7A 2VASA 1ORJA 3KPHA 1IW7F 3NYMA 3QTHA 1U89A 3QZCA 3R2PA 3ZWIA 2Q9AA 3FDQA 3W4YA 2Y3GA 1RKEB 4JIOA 2YEVA 4U5CE 3GORA 1OCCC 2DB4A 4N4WA 3JTLO 4CJGA 3DZAA 4NTAA 4MVUA 4WGYA 4PR9A 5JVEA 2KSFA 4N6HA 4OIQF 1QVXA 4BJ6A 2YKZA 2LSEA 4XLPF 3OWTA 2OU6A 2KJGA 1JAFA 2MHRA 2HKVA 2RD9A 3WHNA 3PCVA 2HJMA 4MVSA 3ABKC 3GANA 1D0ZA 3UMKA 3NMKA 1ZHXA 1L3PA 2EPNA 4HFFB 3EGDB 1S7ZA 1EQ1A 3JRMO 2Q7RA 4LLEA 1IZMA 2AVKA 3IQCA 4MTOA 2W4BA 1J8YF 3F47A 3B29A 3DD7A 4G78A 4I1MA 4EBBA 4G7HF 3KYIA 1LI7A 3F46A 3AQCA 5F28E 1ORYA 4WGZA 4WABA 2IXNA 3LEOA 2IBFA 1H9TA 2DYRC 2MWQA 2H8AA 4Z9HA 1YAUO 2V26A 4JTDB 5DQZA 1Q0KA 3W2VA 2EIKC 2Q00A 2P0NA 1Q0DA 2R7TA 4OD4A 5DVWA 1NG1A 4EKWA 1T6UA 3IQTA 2JD3A 2R7UA 3DM9B 3BRJA 4N06A 3RQEA 4C3BA 2IXPA 1RJ9A 5AC4A 2R7VA 4DVYP 3C8GB 1ZHZA 1ZW3A 2H7VC 2L81A 4YL3A 3LS1A 2PBEA 3DMDA 4MVOA 4ONSA 3RIPA 3V5YA 1E86A 1R4TA 4EHPA 2OJED 2XS1A 4DJ9A 4KI2A 1LIHA 1AVOB 2IXOA 2LCHA 3M79A 4NC3A 2QE9A 1VYKA 4KNVA 3Q6MA 5JP7A 2KK1A 1W2WA 3POVA 3V5XA 2H7OA 2B0HA 2J9VA 1JMWA 2CDQA 4O6NA 1RCPA 4PJJA 3ZTZA 3M15A 4QI0A 2VC9A 2YL7A 4JZAA 2BE5F 1OR2A 1RJ9B 1BR1A 4KBLA 3U9MA 4DBRA 2Q3TA 3AG1C 4Q4ZF 1OR3A 1YYJA 3RVYA 2R9RB 4JCHA 2ZXPA 1WGWA 4NTBA 2LFDA 5EGYA 3O39A 2G62A 1AEPA 4BG0A 1OQCA 3B0UX 3PHF2 1A7EA 3GEEA 1VMAA 5L0FA 4FESA 2NUPB 3S90A 4LDQA 3ZVRA 1GS9A 5EK0A 3QMKA 5A6KA 3AQBA 3EZHA 3EFOA 5KYWA 1YZAA 4IAOA 2LD6A 2KQ9A 4A4AA 1DOVA 4J7YA 2NPUA 3EHNA 1AUEA 2AU5A 5JLIA 3GEIA 4IGGA 1K40A 3C62A 5KYWB 3PDMP 1DOWA 3H2VA 1NFNA 1O3UA 3NMIA 4K0DA 4R32A 5KYXB 3LEVA 3LNRA 1Q0GA 4BJ6C 3HNLA 1O5HA 2M64A 3DM5A 5L0CA 3IEEA 4PK4A 3TD7A 3DJUB 3T6JA 5F5HA 4MVQA 4NTFA 4OIRF 2A69F 4BJTA 3B0VC 3LUTB 4PFOA 4DBQA 4XPXA 5A6BA 2HFIA 3EGXA 2HMQA 3K1HA 2GWWA 1A7VA 1H9GA 2XM4A 3JT1A 1U0BB 3C7JA 3LLIA 4ZLDA 1TWGA 4NQFA 4YT4A 5F5FA 1FFHA 3KMIA 4ULVA 5E3CA 2X51A 1EA8A 3UGPA 3JYYA 5KYNA 1MMGA 4MTGA 2JPUA 3LS0A 3AG3C 2YL3A 4O6MA 2EILC 3AGUA 3ZTMA 2L6HA 2WVNA 3SP1A 4BEJA 1B68A 3U9JA 4CS8C 3EGXB 3DJNB 5DS6A 3FVYA 1LS4A 3CEXA 3QW1A 1H7IA 4BJ5A 4LACB 4J30B 2A68F 5COMA 3OA1A 2IOQA 3PMRA 5E2QA 3RKOF 2OG2A 4CSAA 2XRHA 1Z7Qc 1SR2A 4E18A 3EH1A 1YARO 4YT2A 2R05A 4QDLA 2VCCA 1S05A 2XL4A 3A9CA 2Q9BA 1VB5A 4GYTA 1Z5ZA 5L0HA 1KTMA 2X0CA 5KYYB 2EPKX 4CS9C 3E9VA 1NFOA 2KYHA 4HFKB 3U5SA 3ATPA 3U8VA 4E17A 4MVZA 4MTFA 2NG1A 2HUJA 2L9JA 2HS5A 4XEVA 4XEFA 3U0CA 4G7OF 3C8ZA 4YT8A 1NBBA 1JPJA 1MNDA 2GAQA 2R7OA 3MYIA 1I5NA 1ORSC 2CW0F 4A2NB 1E85A 1BR4A 3JSZA 1HY5A 2YL1A 1SMYF 3W8IA 2KNHA 3FAJA 4GQHA 3R7CA 2CNWA 2CYDA 3AOUA 3DAFA 1L7CA 1QZXA 1XZQA 3LLKA 3RYLA 4F4BA 3ITFA 3RF3A 5B3SC 5FCLA 1WASA 2F22A 2HSQA 3IQ6A 3LESA 4P9TA 4K7BA 2OEVA 3MYFA 3W8HA 3NG1A 3JYHA 1D1CA 1OCRC 1LKXA 2M4EA 2KW3C 2W9YA 1PV3A 2WZGA 2CGEA 4FX5A 3S27A 3X2QC 2L7AA 2Y69C 3EZIA 3HNJA 3I5PA 4ULWA 1NSGB 4EBJA 2PP4A 1VLTA 3C8GD 3CSKA 1V55C 3G50A 1D0YA 3SXZA 2R7XA 4JE9A 3JSEO 1ZYRF 1C02A 1WOLA 2J0WA 2L6GA 2LK4A 1SZIA 3MBGA 4HE8D 2WVOA 1VTMP 4U9DA 2XLHA 2OQMA 4U5FE 4MVRA 1U6HA 3DI5A 4MS2A 5CI9A 1JRAA 2WZLA 1Z6AA 3S84A 5JRAA 4Q5SF 1GQAA 3LAYA 4EUKB 1MMDA 2UUHA 3U8PA 3HTKC 4XQ1A 3K7DA 3S28A 1LE2A 3UMHA 4CDYA 2VH3A 5COGA 5HV9A 1FNTc 3GM2A 2OJQA 1TQGA 3RQGA 1CPQA 1BDJB 1YA9A 5D92A 2PX0A 2Y3HA 2VB6A 3AGTA 1VLSA 4C3EA 1D0XA 2OOCA 3CZ6A 4G0HA 1HE9A 2AP3A 1HMOA 2IYLD 3I5QA 3WODF 3V7OA 1JPNA 2JX0A 3ZC4A 4J32B 3SXMA 1GGQA 1OCOC 2J9UA 1WATA 2EPOA 1EKYA 2VCAA 4AK9A 4IRUA 2GA0A 1OW8A 3EH2A 3NKEA 4U5DE 3W2WA 1CPRA 5L0IA 4OINF 4JURI 1T01A 4CBEA 1MQVA 3DKAA 3SNHA 4YL1A 1ZHTA 2KGOA 3NKDA 2R7RA 2BL2A 2XXAA 4EIYA 4MNDA 2DI3A 2PNOA 4JC7A 4BJ5C 4C7OA 4DRJB 2O9XA 3N0TA 5D91A 2ZXOA 4CX9A 5CI8A 1CGME 2Y39A 1OKKD 5BQGA 4PJLA 4PJNA 1V4AA 3T6GB 2HZ8A 1TR2A 2IXMA 1ZHYA 2W45A 3S29A 2P61A 4JKVA 2EPLX 3FMSA 1A0BA 4H4KC 3EQLF 1OW7A 2V3CC 4IWBA 3FOOA 5JS5A 4XLNF 1HMDA 2HMZA 2J9BA 2NSGA 4J7TA 3HNKA 4U5GA 2XLWA 2J9WA 3UGOA 3C18A 4MW3A 2C03A 3L1MA 3GM3A 2NUTA 3ZQVA 5JSLA 4AL1A 1MMAA 4YJWA 4RD9A 5DS4A 2CCYA 1G8XA 2QUPA 4IB4A 3VRCA 3NDBB 4I44A 1YDIA 1E84A 2G3KA 2YWAA 4JEAA 5BUOA 3DWWA 5A6BD 1TWAA 4Z9IA 4WJ0A 2H7BA 3EFOB 2D4UA 4D4XA 4LLCA 2A1DD 2A0BA 2P7VA 3NYJA 3TK0A 2LQGA 1BR2A 1YZCA 4CIPA 4KC9A 3US6A 1LM3B 3SYNA 3MX3A 3ASNC 4M63A 3UMIA 1NU9C 3SXYA 4CS7A 5T3WA 1G5ZA 4U5HA 2NUTB 2QY9A 1PD1A 1WTYA 2J46A 2Q9CA 3K1IA 4I1OB 1QQ3A 1Y6DA 2Y3BA 2YQYA 3LNMB 4X0RA 3N2ZB 4BPMA 5EHHA 3HNIA 1D1BA 2YHSA 3RQFA 4ER9A 2C04A 1M56C 1T6QA 3E70C 3V5ZA 4XPYA 1SYQA 3O6XA 4E0IA 5COFA 1BZ4A 1V54C 3JZ0A 3TJ5A 1LPEA 1JR8A 1OCZC 2P6VA 1M2OA 3TOLA 3I4UA 2J7PD 3Q7GA 2FFHA 1NU7D 1JOGA 2A6EF 2R02A 3ASOC 3M4BA 4MQ9F 1M2VA 4IARA 4O79A 2UUIA 3T6BA 1E83A 2LP4A 4K1OA 2EIJC 2ZXWC 3BEHA 4CIHA 4LDRA 1T6IA 1Y4CA 1QSPA 4H54A 4JJFA 5KYUA 5AC5A 4RBNA 5DLJA 3L8JA 4C3DA 5K0IA 4NY3A 2XS8A 3RFYA 4OD5A 5E3AA 1ZW2A 2G3VA 1PCXA 3GWLA 3JCUQ 2YLDA 2P1AA 2J45A 1C03A 2YLGA 4JCZA 3UNGC 3IHUA 1M2VB 1RKEA 4P6IC 3VYWA 2ZD9A 2CNWD 2I15A 4JTAB 3GEHA 2PX3A 3U3BA 5KYUB 2QNLA 4LDKA 1HW1A 3QVZA 2XLDA 1WWPA 2NSFA 2PF4E 3IPMO 3L34A 5B3IA 4G7ZF 2YRFA 1ZU5A 2W4MA 3CQZA 3Q6NA 3K66A 3MLGA 4DXWA 3O10A 1A41A 1I4ZA 2HSBA 2MYSA 1C17M 1LS1A 1ZHWA 3C63A 3K6BA 3FXHA 4YL0A 3WAQA 3U2LA 3SZRA 4U5BE 1FAPB 1OW6A 1R5ID 3TJ6A 2DGJA 1I4YA 1LE4A 1G4WR 2A6HF 2EINC 2OEXA 3G4ZA 1OXKA 1XZPA 3GODA 3UR3C 4EWCA 3T9OA 3EGDA 4U5EE 5E33A 4DVZA 3RVZA 4BJ1A 1VYIA 3K33A 3GWNA 2YZSA 1QKRA 3KYJA 4XEKA 1VK5A 3M4CA 1EI7A 1NLXA 2QTVA 4RDAA 3T4RA 4JJGA 4O6YA 1TFKB 1OXBA 3S9OA 3VAYA 3DAGA 2EPMX 4MVMA 1KU2A 3TULA 2R7QA 4UDVA 5JT4A 3VF0A 5BQHA 1HW2A 3NMJA 5IY5C 2J0XA 1YJGA 1M57C 2DYSC 5A6AA 3DE8A 2AWYA 3N24A 4E7ZA 3FAPB 2LFFA 2XLMA 1PD0A 2ZPAA 4XPWA 1H6GA 5L0JA 3SXKA 3RH3A 3RW0A 1ZVZA 5FZTA 3K1IC 4N6CA 5T3TA 4JTCB 4FAPB 2WVQA 3M1CB 2GDCA 3C8GA 2WZFA 1M6TA 4YK5A 5DQTA 2XL6A 4CDAA 2AWCA 4XTKA 5T1DB 3EPVA 2RSEB 4EBKA 256BA 1Z3IX 3NYLA 3A11A 4CS8A 2R7WA 4OIPF 1Z63A 1V74B 4DRHB 3ABMC 1YA7O 1CGOA 3S0XA 4OIOF 3L0IA 3X1OA 1J8MF 3U3FA 1FFTC 1VOMA 2Y3DA 3HKKA 1SF8A 1UG7A 4CSAC 2ETSA 3G4XA 5L0DA 2TMVP 2IM8A 1KNYA 4NCQA 3FOPA 3H65A 4AL0A 2YL0A 4CS9A 4GEHA 3AG2C 1MNEA 2Z15A 1UFBA 2D5RB 4QI2A 4HEAJ 2XXAB 1YLMA 2QLAA 3ZDLA 4IAQA 4JVSA 4YN0B 4C7OB 2NUPA 3HLZA 4KNWA 1TFOB 5HSWA 2YVKA 1LI5A 1T5OA 1E2XA 1CGNA 2XL8A 3B9QA 1QLEC 5TJ5E 2PFDA 5AGFA 3MFNA 2R7SA 3B71A 3NRHA 1ZU4A 3EJNA 5L3QA 1XWJA 1RMVA 1TWCA 4I3MA 4PFPA 4B6IA 2FAPB 4AX2A 4BEMJ 1K05A 4AE4A 3HJCA
chains in the Genus database with same CATH topology
3KL4A 3AG4C 3KH2A 5KYXA 3EHMA 3FHDA 1OKKA 3SEOA 1N1CA 4IJJA 3WG7C 2WB7A 3LJBA 3B0PA 4LERA 4YT5A 1MMNA 1FMWA 1ST6A 4YWQA 1D1AA 1LVKA 1O87A 4XWJA 2E87A 5DS5A 4FWVA 1FMVA 4AE4B 2EIMC 3ZIBA 3KKBA 4Q7CA 4JW1A 4O7GA 2B0JA 2HV6A 1FTSA 1NZEA 2ZXRA 3ZG1A 3EG9A 4W8KA 3ZSUA 1TWHA 4PJMA 4DOZA 4E7SA 3Q7LA 1Z23A 3OEOA 2WL8A 2XSEA 3ABLC 2I8BA 5KYYA 3EG9B 5B1AC 4ZLCA 2FGYA 2GFHA 3JRTA 4ANJA 2OCCC 3ECSA 2J7PA 5L3VA 3DXJF 1TKNA 2HV7A 2VASA 1IW7F 3NYMA 3QZCA 3FDQA 2Q9AA 2Y3GA 2YEVA 4U5CE 1OCCC 3DZAA 4OIQF 4BJ6A 2LSEA 4XLPF 3OWTA 2KJGA 3ABKC 3GANA 1D0ZA 3UMKA 1ZHXA 4HFFB 3EGDB 1S7ZA 4LLEA 1IZMA 2W4BA 1J8YF 3F47A 3DD7A 4I1MA 4EBBA 4G7HF 3F46A 3AQCA 2IXNA 2DYRC 2MWQA 2V26A 5DQZA 3W2VA 2EIKC 2R7TA 4OD4A 5DVWA 1NG1A 2JD3A 2R7UA 3DM9B 4N06A 4C3BA 2IXPA 1RJ9A 2R7VA 4DVYP 1ZHZA 2H7VC 2L81A 3LS1A 3RIPA 3DMDA 4KI2A 2IXOA 4KNVA 1VYKA 3Q6MA 1W2WA 3POVA 2H7OA 2J9VA 2CDQA 4O6NA 4PJJA 4QI0A 4JZAA 2BE5F 1RJ9B 1BR1A 4KBLA 4DBRA 2Q3TA 3AG1C 4Q4ZF 4JCHA 2ZXPA 1WGWA 5EGYA 3O39A 2G62A 4BG0A 3B0UX 3PHF2 1VMAA 4FESA 2NUPB 3ZVRA 3QMKA 3AQBA 3EZHA 3EFOA 5KYWA 4IAOA 2KQ9A 3EHNA 4K0DA 5KYXB 3LEVA 3LNRA 4BJ6C 1O5HA 3DM5A 3IEEA 4PK4A 3TD7A 3DJUB 3T6JA 5F5HA 4OIRF 2A69F 4BJTA 3B0VC 4PFOA 4DBQA 3EGXA 3K1HA 3JT1A 3LLIA 4ZLDA 1TWGA 4YT4A 5F5FA 1FFHA 3KMIA 5E3CA 2X51A 3UGPA 5KYNA 1MMGA 3LS0A 3AG3C 4O6MA 2EILC 4BEJA 2WVNA 3SP1A 4CS8C 3EGXB 3DJNB 5DS6A 3FVYA 4BJ5A 4LACB 4J30B 2A68F 5E2QA 3OA1A 2IOQA 3PMRA 3RKOF 4CSAA 2OG2A 2XRHA 3EH1A 4YT2A 4QDLA 2XL4A 2Q9BA 4GYTA 1Z5ZA 5KYYB 4CS9C 3E9VA 4HFKB 2NG1A 2L9JA 4G7OF 4YT8A 1JPJA 1MNDA 2R7OA 2CW0F 4A2NB 1BR4A 3JSZA 1SMYF 3W8IA 2KNHA 3FAJA 2CNWA 3DAFA 1QZXA 3LLKA 3RYLA 4F4BA 3ITFA 5B3SC 5FCLA 3LESA 4K7BA 3W8HA 3NG1A 3JYHA 1D1CA 1OCRC 1LKXA 2M4EA 2KW3C 2W9YA 2WZGA 2CGEA 4FX5A 3S27A 3X2QC 2Y69C 3EZIA 3I5PA 4ULWA 2PP4A 3CSKA 1V55C 1D0YA 2R7XA 1ZYRF 2J0WA 4HE8D 1SZIA 2WVOA 4U5FE 5CI9A 2WZLA 1Z6AA 4Q5SF 3LAYA 1MMDA 3HTKC 3K7DA 3S28A 3UMHA 2VH3A 5D92A 2PX0A 2Y3HA 2VB6A 4C3EA 1D0XA 3CZ6A 4G0HA 2IYLD 3I5QA 3WODF 3V7OA 1JPNA 3ZC4A 4J32B 1OCOC 2J9UA 4AK9A 4IRUA 3EH2A 3NKEA 3W2WA 4U5DE 4OINF 4JURI 4CBEA 3SNHA 1ZHTA 2KGOA 3NKDA 2R7RA 2XXAA 4MNDA 4C7OA 4BJ5C 2O9XA 3N0TA 5D91A 2ZXOA 5CI8A 2Y39A 1OKKD 4PJLA 4PJNA 2W45A 1TR2A 2IXMA 1ZHYA 3S29A 4H4KC 3EQLF 2V3CC 4IWBA 4XLNF 4U5GA 2J9WA 3UGOA 2C03A 2NUTA 1MMAA 4YJWA 4RD9A 5DS4A 1G8XA 3NDBB 4I44A 2G3KA 5BUOA 1TWAA 4WJ0A 2H7BA 3EFOB 5KYWB 4LLCA 2A1DD 2P7VA 3NYJA 1BR2A 4KC9A 3SYNA 3MX3A 3ASNC 4M63A 3UMIA 1NU9C 4CS7A 5T3WA 4U5HA 2NUTB 2QY9A 1PD1A 4I1OB 2J46A 2Q9CA 2Y3BA 4X0RA 3N2ZB 5EHHA 1D1BA 2YHSA 2C04A 1M56C 3E70C 3O6XA 1V54C 2P6VA 1OCZC 1M2OA 3I4UA 2J7PD 3Q7GA 2FFHA 1NU7D 3ASOC 2A6EF 4O79A 5B1BC 4MQ9F 1M2VA 3T6BA 2EIJC 2ZXWC 4CIHA 4JJFA 5KYUA 4RBNA 5DLJA 4C3DA 4NY3A 3RFYA 4OD5A 5E3AA 2G3VA 1PCXA 3JCUQ 2J45A 3UNGC 1M2VB 4P6IC 3VYWA 2CNWD 2PX3A 5KYUB 3L34A 4G7ZF 2PF4E 3Q6NA 1ZU5A 2W4MA 3CQZA 3K66A 3MLGA 2MYSA 1LS1A 1ZHWA 3K6BA 3SZRA 4U5BE 2DGJA 3GODA 2A6HF 2EINC 3UR3C 4EWCA 3EGDA 4U5EE 5E33A 4DVZA 4BJ1A 1VYIA 3K33A 2YZSA 1VK5A 2QTVA 4RDAA 3T4RA 4JJGA 4O6YA 3VAYA 3DAGA 1KU2A 2R7QA 5IY5C 2J0XA 1M57C 2DYSC 3N24A 4E7ZA 1PD0A 2ZPAA 3RH3A 3K1IC 5T3TA 2WVQA 3M1CB 2WZFA 5DQTA 4XTKA 5T1DB 3EPVA 1Z3IX 3NYLA 2R7WA 4CS8A 4OIPF 1Z63A 3ABMC 3S0XA 4OIOF 3L0IA 3X1OA 1J8MF 1FFTC 1VOMA 2Y3DA 1SF8A 4CSAC 3H65A 4CS9A 4GEHA 3AG2C 1MNEA 2Z15A 2D5RB 4QI2A 4HEAJ 2XXAB 4YN0B 4JVSA 4C7OB 2NUPA 3HLZA 4KNWA 5HSWA 3B9QA 1QLEC 2PFDA 2R7SA 3NRHA 1ZU4A 3EJNA 5L3QA 1TWCA 4I3MA 4PFPA 4B6IA 4AX2A 4AE4A 3HJCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WL8 A; 
#chains in the Genus database with same CATH topology
 3KL4 A;  2L6F A;  3QW0 A;  3AG4 C;  3KH2 A;  2BC5 A;  1WN0 A;  3EHM A;  3FHD A;  1OKK A;  3SEO A;  1N1C A;  4IJJ A;  3WG7 C;  5KYX A;  2WB7 A;  3O55 A;  3LJB A;  3B0P A;  4JEB A;  4LER A;  1QPU A;  4YT5 A;  1MMN A;  5GPG B;  1FMW A;  1ST6 A;  2HJ3 A;  3L8I A;  4YWQ A;  5JUA A;  1D1A A;  1LVK A;  1O87 A;  2XM0 A;  4XWJ A;  4CJO A;  2E87 A;  1T9K A;  1Q0F A;  5DS5 A;  4FWV A;  3TOM A;  1FMV A;  1RXQ A;  2XLO A;  2ASR A;  2EIM C;  3ZIB A;  4AE4 B;  1YVI A;  2ICW G;  3DE9 A;  3KKB A;  4Q7C A;  5CIV A;  4JW1 A;  2J8W A;  4O7G A;  3U2M A;  2B0J A;  2HV6 A;  1FTS A;  4JRZ A;  1F1M A;  2YLI A;  2R03 A;  5L0G A;  1ZZP A;  4CDV A;  1NZE A;  3CAX A;  3J06 A;  2ZXR A;  1G4U S;  3ZG1 A;  1HE1 A;  3EG9 A;  4W8K A;  4DRI B;  1GM5 A;  4MW8 A;  3TQO A;  5BQI A;  2R25 A;  5A69 A;  3ZQY A;  2OKU A;  3ZSU A;  2A0U A;  3VM6 A;  3GM1 A;  1TWH A;  3IQ5 A;  1APC A;  2LIG A;  4PJM A;  4E0H A;  5B1B C;  4DOZ A;  4E7S A;  4P9F A;  3Q7L A;  1Z23 A;  3OEO A;  2WL8 A;  2XSE A;  3AJM A;  2XLE A;  3ABL C;  2I8B A;  4U9E A;  2KC3 A;  4PAC A;  1Q0M A;  1FR0 A;  5KYY A;  1A7D A;  3EG9 B;  4Z9J A;  3H2U A;  5B1A C;  2Q4F A;  4L6R A;  4ZLC A;  2VCB A;  1BBH A;  5A6J A;  4W8P A;  2FGY A;  1YYX A;  2GFH A;  1RKC A;  3JRT A;  1K04 A;  4ANJ A;  4D4N A;  2OCC C;  3ECS A;  2J7P A;  5L3V A;  3QVY A;  3DXJ F;  2XLV A;  1TKN A;  2HV7 A;  2VAS A;  1ORJ A;  3KPH A;  1IW7 F;  3NYM A;  3QTH A;  1U89 A;  3QZC A;  3R2P A;  3ZWI A;  2Q9A A;  3FDQ A;  3W4Y A;  2Y3G A;  1RKE B;  4JIO A;  2YEV A;  4U5C E;  3GOR A;  1OCC C;  2DB4 A;  4N4W A;  3JTL O;  4CJG A;  3DZA A;  4NTA A;  4MVU A;  4WGY A;  4PR9 A;  5JVE A;  2KSF A;  4N6H A;  4OIQ F;  1QVX A;  4BJ6 A;  2YKZ A;  2LSE A;  4XLP F;  3OWT A;  2OU6 A;  2KJG A;  1JAF A;  2MHR A;  2HKV A;  2RD9 A;  3WHN A;  3PCV A;  2HJM A;  4MVS A;  3ABK C;  3GAN A;  1D0Z A;  3UMK A;  3NMK A;  1ZHX A;  1L3P A;  2EPN A;  4HFF B;  3EGD B;  1S7Z A;  1EQ1 A;  3JRM O;  2Q7R A;  4LLE A;  1IZM A;  2AVK A;  3IQC A;  4MTO A;  2W4B A;  1J8Y F;  3F47 A;  3B29 A;  3DD7 A;  4G78 A;  4I1M A;  4EBB A;  4G7H F;  3KYI A;  1LI7 A;  3F46 A;  3AQC A;  5F28 E;  1ORY A;  4WGZ A;  4WAB A;  2IXN A;  3LEO A;  2IBF A;  1H9T A;  2DYR C;  2MWQ A;  2H8A A;  4Z9H A;  1YAU O;  2V26 A;  4JTD B;  5DQZ A;  1Q0K A;  3W2V A;  2EIK C;  2Q00 A;  2P0N A;  1Q0D A;  2R7T A;  4OD4 A;  5DVW A;  1NG1 A;  4EKW A;  1T6U A;  3IQT A;  2JD3 A;  2R7U A;  3DM9 B;  3BRJ A;  4N06 A;  3RQE A;  4C3B A;  2IXP A;  1RJ9 A;  5AC4 A;  2R7V A;  4DVY P;  3C8G B;  1ZHZ A;  1ZW3 A;  2H7V C;  2L81 A;  4YL3 A;  3LS1 A;  2PBE A;  3DMD A;  4MVO A;  4ONS A;  3RIP A;  3V5Y A;  1E86 A;  1R4T A;  4EHP A;  2OJE D;  2XS1 A;  4DJ9 A;  4KI2 A;  1LIH A;  1AVO B;  2IXO A;  2LCH A;  3M79 A;  4NC3 A;  2QE9 A;  1VYK A;  4KNV A;  3Q6M A;  5JP7 A;  2KK1 A;  1W2W A;  3POV A;  3V5X A;  2H7O A;  2B0H A;  2J9V A;  1JMW A;  2CDQ A;  4O6N A;  1RCP A;  4PJJ A;  3ZTZ A;  3M15 A;  4QI0 A;  2VC9 A;  2YL7 A;  4JZA A;  2BE5 F;  1OR2 A;  1RJ9 B;  1BR1 A;  4KBL A;  3U9M A;  4DBR A;  2Q3T A;  3AG1 C;  4Q4Z F;  1OR3 A;  1YYJ A;  3RVY A;  2R9R B;  4JCH A;  2ZXP A;  1WGW A;  4NTB A;  2LFD A;  5EGY A;  3O39 A;  2G62 A;  1AEP A;  4BG0 A;  1OQC A;  3B0U X;  3PHF 2;  1A7E A;  3GEE A;  1VMA A;  5L0F A;  4FES A;  2NUP B;  3S90 A;  4LDQ A;  3ZVR A;  1GS9 A;  5EK0 A;  3QMK A;  5A6K A;  3AQB A;  3EZH A;  3EFO A;  5KYW A;  1YZA A;  4IAO A;  2LD6 A;  2KQ9 A;  4A4A A;  1DOV A;  4J7Y A;  2NPU A;  3EHN A;  1AUE A;  2AU5 A;  5JLI A;  3GEI A;  4IGG A;  1K40 A;  3C62 A;  5KYW B;  3PDM P;  1DOW A;  3H2V A;  1NFN A;  1O3U A;  3NMI A;  4K0D A;  4R32 A;  5KYX B;  3LEV A;  3LNR A;  1Q0G A;  4BJ6 C;  3HNL A;  1O5H A;  2M64 A;  3DM5 A;  5L0C A;  3IEE A;  4PK4 A;  3TD7 A;  3DJU B;  3T6J A;  5F5H A;  4MVQ A;  4NTF A;  4OIR F;  2A69 F;  4BJT A;  3B0V C;  3LUT B;  4PFO A;  4DBQ A;  4XPX A;  5A6B A;  2HFI A;  3EGX A;  2HMQ A;  3K1H A;  2GWW A;  1A7V A;  1H9G A;  2XM4 A;  3JT1 A;  1U0B B;  3C7J A;  3LLI A;  4ZLD A;  1TWG A;  4NQF A;  4YT4 A;  5F5F A;  1FFH A;  3KMI A;  4ULV A;  5E3C A;  2X51 A;  1EA8 A;  3UGP A;  3JYY A;  5KYN A;  1MMG A;  4MTG A;  2JPU A;  3LS0 A;  3AG3 C;  2YL3 A;  4O6M A;  2EIL C;  3AGU A;  3ZTM A;  2L6H A;  2WVN A;  3SP1 A;  4BEJ A;  1B68 A;  3U9J A;  4CS8 C;  3EGX B;  3DJN B;  5DS6 A;  3FVY A;  1LS4 A;  3CEX A;  3QW1 A;  1H7I A;  4BJ5 A;  4LAC B;  4J30 B;  2A68 F;  5COM A;  3OA1 A;  2IOQ A;  3PMR A;  5E2Q A;  3RKO F;  2OG2 A;  4CSA A;  2XRH A;  1Z7Q c;  1SR2 A;  4E18 A;  3EH1 A;  1YAR O;  4YT2 A;  2R05 A;  4QDL A;  2VCC A;  1S05 A;  2XL4 A;  3A9C A;  2Q9B A;  1VB5 A;  4GYT A;  1Z5Z A;  5L0H A;  1KTM A;  2X0C A;  5KYY B;  2EPK X;  4CS9 C;  3E9V A;  1NFO A;  2KYH A;  4HFK B;  3U5S A;  3ATP A;  3U8V A;  4E17 A;  4MVZ A;  4MTF A;  2NG1 A;  2HUJ A;  2L9J A;  2HS5 A;  4XEV A;  4XEF A;  3U0C A;  4G7O F;  3C8Z A;  4YT8 A;  1NBB A;  1JPJ A;  1MND A;  2GAQ A;  2R7O A;  3MYI A;  1I5N A;  1ORS C;  2CW0 F;  4A2N B;  1E85 A;  1BR4 A;  3JSZ A;  1HY5 A;  2YL1 A;  1SMY F;  3W8I A;  2KNH A;  3FAJ A;  4GQH A;  3R7C A;  2CNW A;  2CYD A;  3AOU A;  3DAF A;  1L7C A;  1QZX A;  1XZQ A;  3LLK A;  3RYL A;  4F4B A;  3ITF A;  3RF3 A;  5B3S C;  5FCL A;  1WAS A;  2F22 A;  2HSQ A;  3IQ6 A;  3LES A;  4P9T A;  4K7B A;  2OEV A;  3MYF A;  3W8H A;  3NG1 A;  3JYH A;  1D1C A;  1OCR C;  1LKX A;  2M4E A;  2KW3 C;  2W9Y A;  1PV3 A;  2WZG A;  2CGE A;  4FX5 A;  3S27 A;  3X2Q C;  2L7A A;  2Y69 C;  3EZI A;  3HNJ A;  3I5P A;  4ULW A;  1NSG B;  4EBJ A;  2PP4 A;  1VLT A;  3C8G D;  3CSK A;  1V55 C;  3G50 A;  1D0Y A;  3SXZ A;  2R7X A;  4JE9 A;  3JSE O;  1ZYR F;  1C02 A;  1WOL A;  2J0W A;  2L6G A;  2LK4 A;  1SZI A;  3MBG A;  4HE8 D;  2WVO A;  1VTM P;  4U9D A;  2XLH A;  2OQM A;  4U5F E;  4MVR A;  1U6H A;  3DI5 A;  4MS2 A;  5CI9 A;  1JRA A;  2WZL A;  1Z6A A;  3S84 A;  5JRA A;  4Q5S F;  1GQA A;  3LAY A;  4EUK B;  1MMD A;  2UUH A;  3U8P A;  3HTK C;  4XQ1 A;  3K7D A;  3S28 A;  1LE2 A;  3UMH A;  4CDY A;  2VH3 A;  5COG A;  5HV9 A;  1FNT c;  3GM2 A;  2OJQ A;  1TQG A;  3RQG A;  1CPQ A;  1BDJ B;  1YA9 A;  5D92 A;  2PX0 A;  2Y3H A;  2VB6 A;  3AGT A;  1VLS A;  4C3E A;  1D0X A;  2OOC A;  3CZ6 A;  4G0H A;  1HE9 A;  2AP3 A;  1HMO A;  2IYL D;  3I5Q A;  3WOD F;  3V7O A;  1JPN A;  2JX0 A;  3ZC4 A;  4J32 B;  3SXM A;  1GGQ A;  1OCO C;  2J9U A;  1WAT A;  2EPO A;  1EKY A;  2VCA A;  4AK9 A;  4IRU A;  2GA0 A;  1OW8 A;  3EH2 A;  3NKE A;  4U5D E;  3W2W A;  1CPR A;  5L0I A;  4OIN F;  4JUR I;  1T01 A;  4CBE A;  1MQV A;  3DKA A;  3SNH A;  4YL1 A;  1ZHT A;  2KGO A;  3NKD A;  2R7R A;  2BL2 A;  2XXA A;  4EIY A;  4MND A;  2DI3 A;  2PNO A;  4JC7 A;  4BJ5 C;  4C7O A;  4DRJ B;  2O9X A;  3N0T A;  5D91 A;  2ZXO A;  4CX9 A;  5CI8 A;  1CGM E;  2Y39 A;  1OKK D;  5BQG A;  4PJL A;  4PJN A;  1V4A A;  3T6G B;  2HZ8 A;  1TR2 A;  2IXM A;  1ZHY A;  2W45 A;  3S29 A;  2P61 A;  4JKV A;  2EPL X;  3FMS A;  1A0B A;  4H4K C;  3EQL F;  1OW7 A;  2V3C C;  4IWB A;  3FOO A;  5JS5 A;  4XLN F;  1HMD A;  2HMZ A;  2J9B A;  2NSG A;  4J7T A;  3HNK A;  4U5G A;  2XLW A;  2J9W A;  3UGO A;  3C18 A;  4MW3 A;  2C03 A;  3L1M A;  3GM3 A;  2NUT A;  3ZQV A;  5JSL A;  4AL1 A;  1MMA A;  4YJW A;  4RD9 A;  5DS4 A;  2CCY A;  1G8X A;  2QUP A;  4IB4 A;  3VRC A;  3NDB B;  4I44 A;  1YDI A;  1E84 A;  2G3K A;  2YWA A;  4JEA A;  5BUO A;  3DWW A;  5A6B D;  1TWA A;  4Z9I A;  4WJ0 A;  2H7B A;  3EFO B;  2D4U A;  4D4X A;  4LLC A;  2A1D D;  2A0B A;  2P7V A;  3NYJ A;  3TK0 A;  2LQG A;  1BR2 A;  1YZC A;  4CIP A;  4KC9 A;  3US6 A;  1LM3 B;  3SYN A;  3MX3 A;  3ASN C;  4M63 A;  3UMI A;  1NU9 C;  3SXY A;  4CS7 A;  5T3W A;  1G5Z A;  4U5H A;  2NUT B;  2QY9 A;  1PD1 A;  1WTY A;  2J46 A;  2Q9C A;  3K1I A;  4I1O B;  1QQ3 A;  1Y6D A;  2Y3B A;  2YQY A;  3LNM B;  4X0R A;  3N2Z B;  4BPM A;  5EHH A;  3HNI A;  1D1B A;  2YHS A;  3RQF A;  4ER9 A;  2C04 A;  1M56 C;  1T6Q A;  3E70 C;  3V5Z A;  4XPY A;  1SYQ A;  3O6X A;  4E0I A;  5COF A;  1BZ4 A;  1V54 C;  3JZ0 A;  3TJ5 A;  1LPE A;  1JR8 A;  1OCZ C;  2P6V A;  1M2O A;  3TOL A;  3I4U A;  2J7P D;  3Q7G A;  2FFH A;  1NU7 D;  1JOG A;  2A6E F;  2R02 A;  3ASO C;  3M4B A;  4MQ9 F;  1M2V A;  4IAR A;  4O79 A;  2UUI A;  3T6B A;  1E83 A;  2LP4 A;  4K1O A;  2EIJ C;  2ZXW C;  3BEH A;  4CIH A;  4LDR A;  1T6I A;  1Y4C A;  1QSP A;  4H54 A;  4JJF A;  5KYU A;  5AC5 A;  4RBN A;  5DLJ A;  3L8J A;  4C3D A;  5K0I A;  4NY3 A;  2XS8 A;  3RFY A;  4OD5 A;  5E3A A;  1ZW2 A;  2G3V A;  1PCX A;  3GWL A;  3JCU Q;  2YLD A;  2P1A A;  2J45 A;  1C03 A;  2YLG A;  4JCZ A;  3UNG C;  3IHU A;  1M2V B;  1RKE A;  4P6I C;  3VYW A;  2ZD9 A;  2CNW D;  2I15 A;  4JTA B;  3GEH A;  2PX3 A;  3U3B A;  5KYU B;  2QNL A;  4LDK A;  1HW1 A;  3QVZ A;  2XLD A;  1WWP A;  2NSF A;  2PF4 E;  3IPM O;  3L34 A;  5B3I A;  4G7Z F;  2YRF A;  1ZU5 A;  2W4M A;  3CQZ A;  3Q6N A;  3K66 A;  3MLG A;  4DXW A;  3O10 A;  1A41 A;  1I4Z A;  2HSB A;  2MYS A;  1C17 M;  1LS1 A;  1ZHW A;  3C63 A;  3K6B A;  3FXH A;  4YL0 A;  3WAQ A;  3U2L A;  3SZR A;  4U5B E;  1FAP B;  1OW6 A;  1R5I D;  3TJ6 A;  2DGJ A;  1I4Y A;  1LE4 A;  1G4W R;  2A6H F;  2EIN C;  2OEX A;  3G4Z A;  1OXK A;  1XZP A;  3GOD A;  3UR3 C;  4EWC A;  3T9O A;  3EGD A;  4U5E E;  5E33 A;  4DVZ A;  3RVZ A;  4BJ1 A;  1VYI A;  3K33 A;  3GWN A;  2YZS A;  1QKR A;  3KYJ A;  4XEK A;  1VK5 A;  3M4C A;  1EI7 A;  1NLX A;  2QTV A;  4RDA A;  3T4R A;  4JJG A;  4O6Y A;  1TFK B;  1OXB A;  3S9O A;  3VAY A;  3DAG A;  2EPM X;  4MVM A;  1KU2 A;  3TUL A;  2R7Q A;  4UDV A;  5JT4 A;  3VF0 A;  5BQH A;  1HW2 A;  3NMJ A;  5IY5 C;  2J0X A;  1YJG A;  1M57 C;  2DYS C;  5A6A A;  3DE8 A;  2AWY A;  3N24 A;  4E7Z A;  3FAP B;  2LFF A;  2XLM A;  1PD0 A;  2ZPA A;  4XPW A;  1H6G A;  5L0J A;  3SXK A;  3RH3 A;  3RW0 A;  1ZVZ A;  5FZT A;  3K1I C;  4N6C A;  5T3T A;  4JTC B;  4FAP B;  2WVQ A;  3M1C B;  2GDC A;  3C8G A;  2WZF A;  1M6T A;  4YK5 A;  5DQT A;  2XL6 A;  4CDA A;  2AWC A;  4XTK A;  5T1D B;  3EPV A;  2RSE B;  4EBK A;  256B A;  1Z3I X;  3NYL A;  3A11 A;  4CS8 A;  2R7W A;  4OIP F;  1Z63 A;  1V74 B;  4DRH B;  3ABM C;  1YA7 O;  1CGO A;  3S0X A;  4OIO F;  3L0I A;  3X1O A;  1J8M F;  3U3F A;  1FFT C;  1VOM A;  2Y3D A;  3HKK A;  1SF8 A;  1UG7 A;  4CSA C;  2ETS A;  3G4X A;  5L0D A;  2TMV P;  2IM8 A;  1KNY A;  4NCQ A;  3FOP A;  3H65 A;  4AL0 A;  2YL0 A;  4CS9 A;  4GEH A;  3AG2 C;  1MNE A;  2Z15 A;  1UFB A;  2D5R B;  4QI2 A;  4HEA J;  2XXA B;  1YLM A;  2QLA A;  3ZDL A;  4IAQ A;  4JVS A;  4YN0 B;  4C7O B;  2NUP A;  3HLZ A;  4KNW A;  1TFO B;  5HSW A;  2YVK A;  1LI5 A;  1T5O A;  1E2X A;  1CGN A;  2XL8 A;  3B9Q A;  1QLE C;  5TJ5 E;  2PFD A;  5AGF A;  3MFN A;  2R7S A;  3B71 A;  3NRH A;  1ZU4 A;  3EJN A;  5L3Q A;  1XWJ A;  1RMV A;  1TWC A;  4I3M A;  4PFP A;  4B6I A;  2FAP B;  4AX2 A;  4BEM J;  1K05 A;  4AE4 A;  3HJC A; 
#chains in the Genus database with same CATH homology
 3KL4 A;  3AG4 C;  3KH2 A;  5KYX A;  3EHM A;  3FHD A;  1OKK A;  3SEO A;  1N1C A;  4IJJ A;  3WG7 C;  2WB7 A;  3LJB A;  3B0P A;  4LER A;  4YT5 A;  1MMN A;  1FMW A;  1ST6 A;  4YWQ A;  1D1A A;  1LVK A;  1O87 A;  4XWJ A;  2E87 A;  5DS5 A;  4FWV A;  1FMV A;  4AE4 B;  2EIM C;  3ZIB A;  3KKB A;  4Q7C A;  4JW1 A;  4O7G A;  2B0J A;  2HV6 A;  1FTS A;  1NZE A;  2ZXR A;  3ZG1 A;  3EG9 A;  4W8K A;  3ZSU A;  1TWH A;  4PJM A;  4DOZ A;  4E7S A;  3Q7L A;  1Z23 A;  3OEO A;  2WL8 A;  2XSE A;  3ABL C;  2I8B A;  5KYY A;  3EG9 B;  5B1A C;  4ZLC A;  2FGY A;  2GFH A;  3JRT A;  4ANJ A;  2OCC C;  3ECS A;  2J7P A;  5L3V A;  3DXJ F;  1TKN A;  2HV7 A;  2VAS A;  1IW7 F;  3NYM A;  3QZC A;  3FDQ A;  2Q9A A;  2Y3G A;  2YEV A;  4U5C E;  1OCC C;  3DZA A;  4OIQ F;  4BJ6 A;  2LSE A;  4XLP F;  3OWT A;  2KJG A;  3ABK C;  3GAN A;  1D0Z A;  3UMK A;  1ZHX A;  4HFF B;  3EGD B;  1S7Z A;  4LLE A;  1IZM A;  2W4B A;  1J8Y F;  3F47 A;  3DD7 A;  4I1M A;  4EBB A;  4G7H F;  3F46 A;  3AQC A;  2IXN A;  2DYR C;  2MWQ A;  2V26 A;  5DQZ A;  3W2V A;  2EIK C;  2R7T A;  4OD4 A;  5DVW A;  1NG1 A;  2JD3 A;  2R7U A;  3DM9 B;  4N06 A;  4C3B A;  2IXP A;  1RJ9 A;  2R7V A;  4DVY P;  1ZHZ A;  2H7V C;  2L81 A;  3LS1 A;  3RIP A;  3DMD A;  4KI2 A;  2IXO A;  4KNV A;  1VYK A;  3Q6M A;  1W2W A;  3POV A;  2H7O A;  2J9V A;  2CDQ A;  4O6N A;  4PJJ A;  4QI0 A;  4JZA A;  2BE5 F;  1RJ9 B;  1BR1 A;  4KBL A;  4DBR A;  2Q3T A;  3AG1 C;  4Q4Z F;  4JCH A;  2ZXP A;  1WGW A;  5EGY A;  3O39 A;  2G62 A;  4BG0 A;  3B0U X;  3PHF 2;  1VMA A;  4FES A;  2NUP B;  3ZVR A;  3QMK A;  3AQB A;  3EZH A;  3EFO A;  5KYW A;  4IAO A;  2KQ9 A;  3EHN A;  4K0D A;  5KYX B;  3LEV A;  3LNR A;  4BJ6 C;  1O5H A;  3DM5 A;  3IEE A;  4PK4 A;  3TD7 A;  3DJU B;  3T6J A;  5F5H A;  4OIR F;  2A69 F;  4BJT A;  3B0V C;  4PFO A;  4DBQ A;  3EGX A;  3K1H A;  3JT1 A;  3LLI A;  4ZLD A;  1TWG A;  4YT4 A;  5F5F A;  1FFH A;  3KMI A;  5E3C A;  2X51 A;  3UGP A;  5KYN A;  1MMG A;  3LS0 A;  3AG3 C;  4O6M A;  2EIL C;  4BEJ A;  2WVN A;  3SP1 A;  4CS8 C;  3EGX B;  3DJN B;  5DS6 A;  3FVY A;  4BJ5 A;  4LAC B;  4J30 B;  2A68 F;  5E2Q A;  3OA1 A;  2IOQ A;  3PMR A;  3RKO F;  4CSA A;  2OG2 A;  2XRH A;  3EH1 A;  4YT2 A;  4QDL A;  2XL4 A;  2Q9B A;  4GYT A;  1Z5Z A;  5KYY B;  4CS9 C;  3E9V A;  4HFK B;  2NG1 A;  2L9J A;  4G7O F;  4YT8 A;  1JPJ A;  1MND A;  2R7O A;  2CW0 F;  4A2N B;  1BR4 A;  3JSZ A;  1SMY F;  3W8I A;  2KNH A;  3FAJ A;  2CNW A;  3DAF A;  1QZX A;  3LLK A;  3RYL A;  4F4B A;  3ITF A;  5B3S C;  5FCL A;  3LES A;  4K7B A;  3W8H A;  3NG1 A;  3JYH A;  1D1C A;  1OCR C;  1LKX A;  2M4E A;  2KW3 C;  2W9Y A;  2WZG A;  2CGE A;  4FX5 A;  3S27 A;  3X2Q C;  2Y69 C;  3EZI A;  3I5P A;  4ULW A;  2PP4 A;  3CSK A;  1V55 C;  1D0Y A;  2R7X A;  1ZYR F;  2J0W A;  4HE8 D;  1SZI A;  2WVO A;  4U5F E;  5CI9 A;  2WZL A;  1Z6A A;  4Q5S F;  3LAY A;  1MMD A;  3HTK C;  3K7D A;  3S28 A;  3UMH A;  2VH3 A;  5D92 A;  2PX0 A;  2Y3H A;  2VB6 A;  4C3E A;  1D0X A;  3CZ6 A;  4G0H A;  2IYL D;  3I5Q A;  3WOD F;  3V7O A;  1JPN A;  3ZC4 A;  4J32 B;  1OCO C;  2J9U A;  4AK9 A;  4IRU A;  3EH2 A;  3NKE A;  3W2W A;  4U5D E;  4OIN F;  4JUR I;  4CBE A;  3SNH A;  1ZHT A;  2KGO A;  3NKD A;  2R7R A;  2XXA A;  4MND A;  4C7O A;  4BJ5 C;  2O9X A;  3N0T A;  5D91 A;  2ZXO A;  5CI8 A;  2Y39 A;  1OKK D;  4PJL A;  4PJN A;  2W45 A;  1TR2 A;  2IXM A;  1ZHY A;  3S29 A;  4H4K C;  3EQL F;  2V3C C;  4IWB A;  4XLN F;  4U5G A;  2J9W A;  3UGO A;  2C03 A;  2NUT A;  1MMA A;  4YJW A;  4RD9 A;  5DS4 A;  1G8X A;  3NDB B;  4I44 A;  2G3K A;  5BUO A;  1TWA A;  4WJ0 A;  2H7B A;  3EFO B;  5KYW B;  4LLC A;  2A1D D;  2P7V A;  3NYJ A;  1BR2 A;  4KC9 A;  3SYN A;  3MX3 A;  3ASN C;  4M63 A;  3UMI A;  1NU9 C;  4CS7 A;  5T3W A;  4U5H A;  2NUT B;  2QY9 A;  1PD1 A;  4I1O B;  2J46 A;  2Q9C A;  2Y3B A;  4X0R A;  3N2Z B;  5EHH A;  1D1B A;  2YHS A;  2C04 A;  1M56 C;  3E70 C;  3O6X A;  1V54 C;  2P6V A;  1OCZ C;  1M2O A;  3I4U A;  2J7P D;  3Q7G A;  2FFH A;  1NU7 D;  3ASO C;  2A6E F;  4O79 A;  5B1B C;  4MQ9 F;  1M2V A;  3T6B A;  2EIJ C;  2ZXW C;  4CIH A;  4JJF A;  5KYU A;  4RBN A;  5DLJ A;  4C3D A;  4NY3 A;  3RFY A;  4OD5 A;  5E3A A;  2G3V A;  1PCX A;  3JCU Q;  2J45 A;  3UNG C;  1M2V B;  4P6I C;  3VYW A;  2CNW D;  2PX3 A;  5KYU B;  3L34 A;  4G7Z F;  2PF4 E;  3Q6N A;  1ZU5 A;  2W4M A;  3CQZ A;  3K66 A;  3MLG A;  2MYS A;  1LS1 A;  1ZHW A;  3K6B A;  3SZR A;  4U5B E;  2DGJ A;  3GOD A;  2A6H F;  2EIN C;  3UR3 C;  4EWC A;  3EGD A;  4U5E E;  5E33 A;  4DVZ A;  4BJ1 A;  1VYI A;  3K33 A;  2YZS A;  1VK5 A;  2QTV A;  4RDA A;  3T4R A;  4JJG A;  4O6Y A;  3VAY A;  3DAG A;  1KU2 A;  2R7Q A;  5IY5 C;  2J0X A;  1M57 C;  2DYS C;  3N24 A;  4E7Z A;  1PD0 A;  2ZPA A;  3RH3 A;  3K1I C;  5T3T A;  2WVQ A;  3M1C B;  2WZF A;  5DQT A;  4XTK A;  5T1D B;  3EPV A;  1Z3I X;  3NYL A;  2R7W A;  4CS8 A;  4OIP F;  1Z63 A;  3ABM C;  3S0X A;  4OIO F;  3L0I A;  3X1O A;  1J8M F;  1FFT C;  1VOM A;  2Y3D A;  1SF8 A;  4CSA C;  3H65 A;  4CS9 A;  4GEH A;  3AG2 C;  1MNE A;  2Z15 A;  2D5R B;  4QI2 A;  4HEA J;  2XXA B;  4YN0 B;  4JVS A;  4C7O B;  2NUP A;  3HLZ A;  4KNW A;  5HSW A;  3B9Q A;  1QLE C;  2PFD A;  2R7S A;  3NRH A;  1ZU4 A;  3EJN A;  5L3Q A;  1TWC A;  4I3M A;  4PFP A;  4B6I A;  4AX2 A;  4AE4 A;  3HJC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...