2WL8A

X-ray crystal structure of pex19p
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
110
structure length
110
Chain Sequence
ILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESLPPEQFEKYQEQHSVMCKICEQFEAETPTDSETTQKARFEMVLDLMQQLQDLGHPPKELAGEMPPGLNFDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein transport
molecule keywords PEROXISOMAL BIOGENESIS FACTOR 19
publication title The Peroxisomal Receptor Pex19P Forms a Helical Mpts Recognition Domain.
pubmed doi rcsb
source organism Homo sapiens
total genus 36
structure length 110
sequence length 110
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-06-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.900 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2wl8A00
2WL8A
chains in the Genus database with same CATH superfamily
2OJED 2LFDA 2WB7A 1M2VA 1S05A 2WVQA 4YT2A 4Q4ZF 3EHMA 1FFTC 3PMRA 2G62A 3GANA 4MTGA 2QUPA 4EIYA 4IB4A 2XRHA 1T9KA 2EIJC 3DJNB 3RIPA 1ZHZA 2Y69C 2LK4A 5EK0A 1WOLA 1OR2A 3ECSA 4H54A 1ZHXA 3DZAA 4GEHA 2OQMA 2J0XA 2NUTB 3ATPA 2EPLX 1TFKB 2OG2A 4MVZA 3U5SA 5KYWB 1R5ID 2R7UA 1OQCA 1Z5ZA 2BE5F 3NMKA 1LIHA 1OXKA 3QTHA 1OR3A 1RKCA 1VK5A 3LS1A 4LLCA 2H7BA 4QI0A 4XEFA 3TOLA 3FDQA 1NU7D 4DJ9A 2HSBA 1D1CA 2Y3BA 3NKEA 4CS7A 3M15A 1FMVA 1FTSA 1Q0FA 1MQVA 2HV7A 3I4UA 3I5PA 4JC7A 3TD7A 1ORYA 1V55C 1CGME 5KYUB 3K7DA 2Q9BA 2XLWA 1LM3B 2PX0A 2XSEA 4K0DA 1C17M 2YL1A 1Z23A 1ZHTA 4OD5A 2P61A 4BPMA 2YVKA 1JPJA 4LDKA 4XWJA 1LS4A 5AC5A 3FOPA 2DB4A 1NSGB 1RKEA 3KL4A 2W45A 3TULA 4U9DA 1BBHA 2ZXRA 2R05A 1XZPA 1ZW3A 1CGOA 1G4WR 2L7AA 2R02A 3DWWA 2A0BA 4OD4A 4RBNA 5JS5A 3OWTA 3VAYA 5JVEA 3L8IA 3RKOF 4U5DE 4O6NA 2QLAA 3DI5A 1SMYF 4J7YA 4JRZA 4F4BA 1RMVA 1RJ9B 1D1BA 3HNJA 2FGYA 2YL7A 1NLXA 3EG9B 1E83A 3SYNA 3OEOA 4XEKA 3ZDLA 3GM1A 2OJQA 4ONSA 3H2VA 2CYDA 3DAGA 3ITFA 4EHPA 1MNDA 2ZXOA 4NCQA 3AOUA 4MQ9F 3N2ZB 2NUTA 2NPUA 4CJGA 3GODA 5KYWA 3S29A 2LD6A 3JTLO 4WABA 4WGZA 3EPVA 4ANJA 4WGYA 3U9MA 3UMKA 3DM9B 2X0CA 1IZMA 1T6UA 5K0IA 2RD9A 1LVKA 5HSWA 2WVNA 4CDVA 3T4RA 3U0CA 2CNWD 1Q0GA 2R7OA 3CQZA 5KYUA 1YZAA 1S7ZA 2PX3A 2XLHA 1TWAA 3SXKA 5L3QA 2A0UA 2EPKX 4I3MA 1BR2A 3AQBA 3O10A 4YL3A 2ZPAA 4AE4B 1E86A 2Q9CA 2YHSA 2XS1A 2EPMX 3JZ0A 3PCVA 4P9TA 2NSFA 2WZFA 3B0PA 4I44A 4YN0B 3RFYA 3RQFA 256BA 4XLPF 1OXBA 1J8MF 1NBBA 1R4TA 1ST6A 1M57C 4XEVA 4YL1A 2R03A 4AL0A 1YA7O 3O39A 2EPNA 5L0CA 1XWJA 1RJ9A 2HZ8A 3ABLC 3GM2A 1JMWA 1Z6AA 2R7RA 5COFA 1E85A 3QVYA 3F46A 1HE1A 1ORSC 4A4AA 3NDBB 4GYTA 1A7VA 3K6BA 2KC3A 2WVOA 3C8GB 4IAQA 4U9EA 4CIHA 5A6BA 2R7WA 1ZYRF 4JEBA 3EGDB 2R25A 5E3AA 4U5FE 4EKWA 4YWQA 2VH3A 2AWYA 3NMJA 3B0UX 4G7HF 2XM0A 1YZCA 1EA8A 1QKRA 1JOGA 1ORJA 1VLTA 2KNHA 2WZGA 3NG1A 3T6JA 2YWAA 3JRTA 3VM6A 5IY5C 5JLIA 2TMVP 1TR2A 1GQAA 1TQGA 2CCYA 2YL3A 2XS8A 1I4ZA 1SYQA 4NC3A 5AGFA 1WWPA 1SR2A 1GM5A 3ZTZA 1QLEC 3ZSUA 4C3BA 4AL1A 1OKKA 3IQCA 1G4US 1NFOA 5BQHA 2DYSC 3C7JA 4DVYP 1M56C 1BR4A 4BJ6A 2IM8A 5KYYB 3KYJA 1B68A 3L8JA 3AGUA 2DYRC 4CDYA 3T9OA 4J30B 2HJMA 3DMDA 4HFKB 2YEVA 4DBRA 4G0HA 5FZTA 5JUAA 3LLIA 4I1MA 3L34A 4J32B 4DVZA 2XLMA 1PD1A 3G4ZA 4U5GA 3EZHA 3JCUQ 1U89A 3SXZA 1AUEA 1VYIA 2IBFA 2JD3A 3M4BA 3KMIA 4HE8D 1NG1A 3MYIA 4LLEA 5D92A 4B6IA 2KYHA 2OU6A 3EZIA 3KKBA 3ZG1A 2EPOA 4Z9JA 1HE9A 2EILC 4MVSA 4PFOA 2D5RB 2XM4A 3DE9A 4XPXA 3DAFA 3IPMO 3QZCA 4YK5A 3ASNC 4BJ6C 4JKVA 3EGDA 3WHNA 4OIQF 5CI8A 2QNLA 4ULVA 4C3DA 2W4MA 1OW8A 2HFIA 3EGXB 4JTCB 2G3VA 5F28E 1WASA 3EQLF 4JJFA 1H7IA 3UGPA 2NUPB 4R32A 3SP1A 1D0ZA 3POVA 2H7VC 2J9WA 3M79A 4C3EA 1H9TA 2PNOA 3NYMA 1OW7A 1LS1A 2Q4FA 1WTYA 2ZXWC 3WAQA 5A6BD 3N0TA 4NQFA 5A69A 4AK9A 3EH2A 3LEOA 2J9BA 2LFFA 3RW0A 3RQEA 3QVZA 2AVKA 1U6HA 4G78A 4IAOA 3UMIA 5JRAA 3MX3A 3AG4C 4N4WA 4LDQA 3T6BA 5KYYA 2F22A 2RSEB 3U2LA 1BR1A 3AQCA 3DD7A 3LEVA 3RH3A 3I5QA 2VCBA 2ZXPA 3GEHA 4D4NA 2A6EF 3UNGC 1C02A 1YLMA 4YT4A 3FAPB 2GA0A 3C63A 4IWBA 1MMGA 4CBEA 2KSFA 5E3CA 5F5FA 4O79A 1QVXA 4LACB 4W8PA 2GFHA 2VB6A 5DS5A 1LE2A 3KPHA 3U8PA 2A68F 1OKKD 1QSPA 1SF8A 2IXNA 1O87A 2J7PA 2WL8A 4L6RA 1K05A 1MMNA 2HMQA 2OCCC 1TKNA 3O6XA 4GQHA 4U5BE 4OIRF 1HMDA 4U5CE 4CS9A 2H7OA 4MVRA 2OEVA 3K1IA 2L6GA 4CDAA 1L7CA 3UR3C 2AP3A 2PF4E 2Y3HA 3S90A 1M2OA 1CGNA 3EGXA 1YAUO 1Q0DA 4NTFA 4KNVA 1EI7A 1VYKA 2UUIA 2A69F 5L0DA 1Q0MA 3ZQYA 3K66A 1Q0KA 2A1DD 2NUPA 3X2QC 1ZHYA 4I1OB 1KTMA 2C04A 2P6VA 4PJJA 3V5YA 1ZW2A 3S0XA 1A7DA 3EH1A 4BJTA 3UGOA 1FMWA 5BQGA 5DS6A 1ZZPA 2M4EA 2FFHA 1VMAA 1A0BA 4CS9C 4JCHA 3HNLA 4YT5A 3K1IC 3SEOA 1IW7F 4MVUA 3RVZA 3LLKA 2R9RB 4U5EE 4MVQA 3ZQVA 3KYIA 4E18A 3MFNA 2AU5A 3RQGA 3JYHA 4NTBA 5DQTA 3TJ6A 2HUJA 2FAPB 3HLZA 1O3UA 4ULWA 5B1BC 4N6HA 3QW1A 3EHNA 1G5ZA 2IXMA 3ZC4A 3B71A 3FVYA 1JAFA 3KH2A 4BJ1A 1A41A 4KBLA 1HW1A 2JX0A 4D4XA 5A6KA 5L0JA 1M6TA 5JP7A 2G3KA 4EUKB 2C03A 2VCAA 5EHHA 1TWHA 3L0IA 1C03A 2YLIA 1W2WA 2J8WA 4DOZA 3GEIA 2DI3A 3EG9A 4N06A 4CS8A 3GWNA 1ZU4A 3S27A 2HKVA 3DKAA 2P7VA 1D1AA 1PCXA 1FNTc 3DM5A 5A6JA 2D4UA 1G8XA 2XLDA 1V54C 3JYYA 1YDIA 1BDJB 2J7PD 2XXAB 2Y3DA 3NKDA 3PHF2 1T01A 2J45A 3QW0A 4M63A 5CI9A 5FCLA 1E2XA 4YT8A 3J06A 1T6QA 4KC9A 2DGJA 2IXPA 3TOMA 3U2MA 3LNRA 4KNWA 1FR0A 2XL6A 2ASRA 4LDRA 4YL0A 4MW8A 2PBEA 3S28A 3Q6NA 3ZWIA 2AWCA 2P1AA 1LI7A 3ASOC 2LSEA 4CS8C 5KYNA 4PK4A 4KI2A 1UG7A 5BUOA 1NU9C 2HV6A 2KJGA 3B9QA 4AE4A 4A2NB 3RVYA 1HW2A 1VB5A 2R7XA 4K7BA 1OW6A 2NSGA 2CW0F 3AG1C 3LS0A 1QPUA 1D0XA 2WZLA 3B29A 3DXJF 3NRHA 2B0JA 1DOVA 4P6IC 5E2QA 1YA9A 2ZD9A 3TQOA 4PFPA 3IQ6A 2UUHA 4IJJA 4MW3A 2YKZA 3LJBA 4Q7CA 1EQ1A 3V5XA 1FAPB 2M64A 2IOQA 1APCA 1NFNA 2R7QA 3HKKA 3LNMB 5B3IA 3ABMC 3FAJA 1N1CA 1HMOA 3OA1A 3C8GA 4ZLCA 3BRJA 5EGYA 3IHUA 1F1MA 2HMZA 2YL0A 2YZSA 4FX5A 4W8KA 4E7SA 3DE8A 1UFBA 2XXAA 3W8IA 4JCZA 4BJ5A 1WATA 2QE9A 4JTDB 1DOWA 3JRMO 5DS4A 3JT1A 3M4CA 3AG3C 1YJGA 2NG1A 3B0VC 4JVSA 2QY9A 2KGOA 3LUTB 3NYLA 3IQ5A 5COGA 3Q7GA 3SXYA 4O7GA 2ICWG 4DRHB 1V4AA 2L6HA 2VASA 3IEEA 4OIOF 4WJ0A 1TWCA 2VCCA 3EFOB 2J0WA 4JTAB 3K1HA 1TWGA 2OEXA 2KK1A 3R7CA 4O6YA 5T3TA 4JIOA 3JSEO 4H4KC 3QMKA 4YJWA 2Q7RA 5A6AA 2CNWA 4BJ5C 3CSKA 4EBJA 3US6A 5GPGB 3DJUB 4PJMA 2QTVA 4MTOA 4ZLDA 1T6IA 3CAXA 1O5HA 3C8ZA 3CEXA 2CDQA 2ETSA 1I4YA 3HNIA 4K1OA 4LERA 2LP4A 2P0NA 4X0RA 2XL8A 4Z9HA 2W9YA 5TJ5E 2XLOA 4AX2A 1LE4A 4RDAA 1EKYA 3W2WA 3V7OA 4MS2A 4BG0A 5BQIA 4JEAA 1VTMP 1LPEA 3U3FA 3UMHA 3WG7C 3TJ5A 5JT4A 1OCRC 2HS5A 3R2PA 3GORA 4PJNA 1WGWA 2IXOA 1V74B 2YLGA 5L0HA 1YYJA 4PR9A 1KNYA 4OINF 1KU2A 2CGEA 1PD0A 1GS9A 2O9XA 2YRFA 3A9CA 4JURI 1FFHA 4XLNF 1H9GA 3ZIBA 1I5NA 4MNDA 4XPWA 4IGGA 4PACA 4Q5SF 2J46A 4C7OB 1ZVZA 3C8GD 4HFFB 3C62A 3FOOA 3EFOA 1PV3A 2XLEA 3IQTA 4MVOA 3S84A 5DLJA 1CPQA 2OKUA 1BZ4A 1U0BB 4DBQA 2EINC 1JRAA 3H2UA 3M1CB 4ER9A 2R7SA 1RXQA 2GAQA 4FWVA 3U9JA 4P9FA 4QDLA 5KYXB 3O55A 2L81A 4BEJA 4UDVA 1RCPA 3G4XA 5E33A 4JJGA 4U5HA 1NZEA 4CIPA 3A11A 2EIMC 2I8BA 5D91A 3U3BA 4CSAA 2PP4A 2XLVA 2Y3GA 3LAYA 3VYWA 3W2VA 2V3CC 4G7ZF 3HJCA 4EBKA 5KYXA 2JPUA 2H8AA 4MVMA 1SZIA 3JSZA 4O6MA 1E84A 3BEHA 1OCOC 2LCHA 1GGQA 2GDCA 5F5HA 3AG2C 4XQ1A 4DXWA 4DRJB 1H6GA 3E9VA 2MHRA 2LIGA 2KW3C 1XZQA 3SZRA 4CJOA 5AC4A 3AJMA 4NTAA 1Y4CA 2E87A 1QQ3A 2Q9AA 4Z9IA 3CZ6A 3RF3A 3RYLA 5L0GA 2A6HF 3AGTA 5JSLA 4OIPF 2V26A 2Y39A 3FXHA 4NY3A 3GWLA 1TFOB 3MYFA 4FAPB 2R7TA 3N24A 1VLSA 2W4BA 5L0FA 3L1MA 4CSAC 3EJNA 1ZHWA 5T3WA 3SNHA 2R7VA 3MLGA 2KQ9A 1L3PA 3GM3A 4JE9A 4C7OA 1QZXA 5T1DB 4IARA 1YVIA 2OOCA 1JR8A 1MNEA 2Z15A 3Q6MA 1Z7Qc 2L9JA 3U8VA 4IRUA 4PJLA 3WODF 2J9UA 1AEPA 4JZAA 4E0IA 1J8YF 3E70C 5CIVA 2B0HA 4RD9A 3HTKC 3HNKA 1OCZC 3W8HA 3X1OA 3C18A 2VC9A 3NMIA 3TK0A 1M2VB 1K04A 3SXMA 2GWWA 1CPRA 3FMSA 5HV9A 4DRIB 3VF0A 5DQZA 1MMAA 4EBBA 1K40A 3VRCA 5COMA 1Z3IX 4E7ZA 1MMDA 2YLDA 3ZVRA 4E17A 3PDMP 2MWQA 3V5ZA 1T5OA 2I15A 3T6GB 4G7OF 1AVOB 1HY5A 4HEAJ 2LQGA 3GEEA 2HSQA 2Q3TA 2X51A 2BL2A 2MYSA 2XL4A 5DVWA 2EIKC 1ZU5A 4BEMJ 4CX9A 2Q00A 1A7EA 3W4YA 1Y6DA 4FESA 1JPNA 5L0IA 1YARO 3H65A 3MBGA 1VOMA 1YYXA 3FHDA 2J9VA 4N6CA 3K33A 1LI5A 3LESA 5L3VA 4EWCA 3G50A 1LKXA 2L6FA 5B1AC 5B3SC 4J7TA 2YQYA 4XTKA 3Q7LA 2BC5A 3NYJA 1Z63A 1RKEB 4JW1A 2PFDA 1OCCC 3S9OA 2IYLD 4E0HA 4QI2A 3F47A 4XPYA 3ZTMA 4MTFA 1D0YA 2HJ3A 3ABKC 1WN0A
chains in the Genus database with same CATH topology
2WB7A 2WVQA 1M2VA 4YT2A 4Q4ZF 3EHMA 1FFTC 3PMRA 2G62A 3GANA 2XRHA 2EIJC 3DJNB 3RIPA 1ZHZA 2Y69C 3ECSA 1ZHXA 3DZAA 4GEHA 2J0XA 2NUTB 2R7UA 2OG2A 5KYWB 1Z5ZA 2BE5F 4N06A 3LS1A 1VK5A 3FDQA 4LLCA 2H7BA 4QI0A 1NU7D 1D1CA 2Y3BA 3NKEA 4CS7A 1FMVA 1FTSA 2HV7A 3I4UA 3I5PA 3TD7A 1V55C 5KYUB 3K7DA 2Q9BA 2XSEA 2PX0A 4K0DA 1Z23A 1ZHTA 4OD5A 1JPJA 4XWJA 3KL4A 2W45A 2ZXRA 4OD4A 5KYNA 4RBNA 3OWTA 3VAYA 3RKOF 4U5DE 4O6NA 1SMYF 4F4BA 1RJ9B 1D1BA 2FGYA 3EG9B 3SYNA 3OEOA 3DAGA 3ITFA 1MNDA 2ZXOA 4MQ9F 2NUTA 3N2ZB 3GODA 5KYWA 3S29A 3EPVA 4ANJA 3UMKA 3DM9B 1IZMA 1LVKA 5HSWA 2WVNA 3T4RA 2CNWD 2R7OA 3CQZA 5KYUA 1S7ZA 2PX3A 1TWAA 5L3QA 4I3MA 1BR2A 3AQBA 2ZPAA 4AE4B 2Q9CA 2YHSA 4YN0B 3RFYA 2WZFA 3B0PA 4I44A 4XLPF 1J8MF 1ST6A 1M57C 3O39A 1RJ9A 3ABLC 1Z6AA 2R7RA 3F46A 3NDBB 4GYTA 3K6BA 2R7WA 2WVOA 4CIHA 1ZYRF 3EGDB 5E3AA 4U5FE 4YWQA 3B0UX 2VH3A 4G7HF 2KNHA 2WZGA 5IY5C 3NG1A 3T6JA 3JRTA 1TR2A 1QLEC 3ZSUA 4C3BA 1OKKA 2DYSC 4DVYP 1M56C 1BR4A 4BJ6A 5KYYB 2DYRC 4J30B 3DMDA 4HFKB 2YEVA 4DBRA 4G0HA 3LLIA 4I1MA 3L34A 4J32B 4DVZA 1PD1A 4U5GA 3EZHA 3JCUQ 1VYIA 2JD3A 3KMIA 4HE8D 1NG1A 5D92A 4LLEA 4B6IA 3EZIA 3KKBA 3ZG1A 2EILC 4PFOA 2D5RB 3DAFA 3QZCA 3ASNC 4BJ6C 3EGDA 4OIQF 5CI8A 4C3DA 2W4MA 3EGXB 2G3VA 3EQLF 4JJFA 3UGPA 2NUPB 3SP1A 1D0ZA 3POVA 2H7VC 2J9WA 4C3EA 3NYMA 1LS1A 2ZXWC 3N0TA 4AK9A 3EH2A 4IAOA 3UMIA 3MX3A 3AG4C 5KYYA 3T6BA 1BR1A 3AQCA 3DD7A 3LEVA 3RH3A 3I5QA 2ZXPA 2A6EF 3UNGC 4YT4A 4IWBA 1MMGA 4CBEA 5F5FA 5E3CA 4O79A 4LACB 2GFHA 2VB6A 5DS5A 2A68F 1OKKD 1SF8A 2IXNA 1O87A 2J7PA 2WL8A 4U5BE 1MMNA 4OIRF 2OCCC 1TKNA 3O6XA 4U5CE 4CS9A 2H7OA 3UR3C 2PF4E 2Y3HA 1M2OA 3EGXA 4KNVA 1VYKA 2A69F 3K66A 2A1DD 2NUPA 3X2QC 1ZHYA 4I1OB 2C04A 2P6VA 4PJJA 3S0XA 4BJTA 3EH1A 3UGOA 1FMWA 5DS6A 2M4EA 2FFHA 1VMAA 4CS9C 4JCHA 4YT5A 3K1IC 3SEOA 1IW7F 3LLKA 4U5EE 3JYHA 5DQTA 3HLZA 4ULWA 5B1BC 3EHNA 2IXMA 3ZC4A 3FVYA 3KH2A 4BJ1A 4KBLA 2G3KA 2C03A 5EHHA 1TWHA 3L0IA 1W2WA 4DOZA 3EG9A 4CS8A 1ZU4A 3S27A 2P7VA 1D1AA 1PCXA 3DM5A 1G8XA 1V54C 2J7PD 2XXAB 2Y3DA 3NKDA 3PHF2 2J45A 4M63A 5CI9A 5FCLA 4YT8A 4KC9A 2DGJA 2IXPA 3LNRA 4KNWA 3S28A 3Q6NA 4CS8C 3ASOC 4KI2A 4G7OF 2LSEA 4PK4A 5BUOA 1NU9C 2HV6A 2KJGA 3B9QA 4AE4A 4A2NB 2R7XA 4K7BA 2CW0F 3AG1C 3LS0A 2WZLA 1D0XA 3NRHA 3DXJF 5E2QA 2B0JA 4P6IC 4PFPA 4IJJA 3LJBA 4Q7CA 2IOQA 2R7QA 3ABMC 3FAJA 1N1CA 3OA1A 4ZLCA 5EGYA 2YZSA 4FX5A 4W8KA 4E7SA 2XXAA 3W8IA 4BJ5A 5DS4A 3JT1A 3AG3C 2NG1A 3B0VC 4JVSA 2QY9A 2KGOA 3NYLA 3Q7GA 4O7GA 2VASA 3IEEA 4OIOF 4WJ0A 1TWCA 3EFOB 2J0WA 3K1HA 1TWGA 4O6YA 5T3TA 4H4KC 3QMKA 4YJWA 2CNWA 4BJ5C 3CSKA 3DJUB 4PJMA 2QTVA 4ZLDA 1O5HA 2CDQA 4X0RA 5KYXB 4LERA 2W9YA 4AX2A 4RDAA 3W2WA 3V7OA 4BG0A 3WG7C 3UMHA 1OCRC 4PJNA 1WGWA 2IXOA 4OINF 1KU2A 2CGEA 1PD0A 2O9XA 4XLNF 4JURI 1FFHA 3ZIBA 4MNDA 4Q5SF 2J46A 4C7OB 4HFFB 3EFOA 5DLJA 4DBQA 2EINC 3M1CB 2R7SA 4FWVA 4QDLA 2L81A 4BEJA 5E33A 4JJGA 4U5HA 1NZEA 2EIMC 2I8BA 5D91A 4CSAA 2PP4A 2Y3GA 3LAYA 3VYWA 3W2VA 2V3CC 4G7ZF 3HJCA 5KYXA 4O6MA 1SZIA 3JSZA 1OCOC 5F5HA 3AG2C 3E9VA 3SZRA 2KW3C 2E87A 2Q9AA 3RYLA 3CZ6A 2A6HF 4OIPF 2V26A 2Y39A 4NY3A 2R7TA 3N24A 2W4BA 4CSAC 3EJNA 1ZHWA 5T3WA 3SNHA 2R7VA 3MLGA 2KQ9A 4C7OA 1QZXA 5T1DB 2Z15A 1MNEA 3WODF 3Q6MA 2L9JA 4IRUA 4PJLA 2J9UA 4JZAA 1J8YF 3E70C 4RD9A 3HTKC 1OCZC 3W8HA 3X1OA 1M2VB 5DQZA 4EBBA 1MMAA 1Z3IX 4E7ZA 1MMDA 3ZVRA 2MWQA 4HEAJ 2Q3TA 2X51A 2MYSA 2XL4A 5DVWA 2EIKC 1ZU5A 4FESA 1JPNA 3H65A 1VOMA 3FHDA 2J9VA 3K33A 3LESA 5L3VA 4EWCA 5B1AC 1LKXA 5B3SC 4XTKA 3Q7LA 3NYJA 1Z63A 4JW1A 2PFDA 1OCCC 4QI2A 2IYLD 3F47A 1D0YA 3ABKC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WL8 A; 
#chains in the Genus database with same CATH topology
 2OJE D;  2LFD A;  2WB7 A;  1M2V A;  1S05 A;  2WVQ A;  4YT2 A;  4Q4Z F;  3EHM A;  1FFT C;  3PMR A;  2G62 A;  3GAN A;  4MTG A;  2QUP A;  4EIY A;  4IB4 A;  2XRH A;  1T9K A;  2EIJ C;  3DJN B;  3RIP A;  1ZHZ A;  2Y69 C;  2LK4 A;  5EK0 A;  1WOL A;  1OR2 A;  3ECS A;  4H54 A;  1ZHX A;  3DZA A;  4GEH A;  2OQM A;  2J0X A;  2NUT B;  3ATP A;  2EPL X;  1TFK B;  2OG2 A;  4MVZ A;  3U5S A;  5KYW B;  1R5I D;  2R7U A;  1OQC A;  1Z5Z A;  2BE5 F;  3NMK A;  1LIH A;  1OXK A;  3QTH A;  1OR3 A;  1RKC A;  1VK5 A;  3LS1 A;  4LLC A;  2H7B A;  4QI0 A;  4XEF A;  3TOL A;  3FDQ A;  1NU7 D;  4DJ9 A;  2HSB A;  1D1C A;  2Y3B A;  3NKE A;  4CS7 A;  3M15 A;  1FMV A;  1FTS A;  1Q0F A;  1MQV A;  2HV7 A;  3I4U A;  3I5P A;  4JC7 A;  3TD7 A;  1ORY A;  1V55 C;  1CGM E;  5KYU B;  3K7D A;  2Q9B A;  2XLW A;  1LM3 B;  2PX0 A;  2XSE A;  4K0D A;  1C17 M;  2YL1 A;  1Z23 A;  1ZHT A;  4OD5 A;  2P61 A;  4BPM A;  2YVK A;  1JPJ A;  4LDK A;  4XWJ A;  1LS4 A;  5AC5 A;  3FOP A;  2DB4 A;  1NSG B;  1RKE A;  3KL4 A;  2W45 A;  3TUL A;  4U9D A;  1BBH A;  2ZXR A;  2R05 A;  1XZP A;  1ZW3 A;  1CGO A;  1G4W R;  2L7A A;  2R02 A;  3DWW A;  2A0B A;  4OD4 A;  4RBN A;  5JS5 A;  3OWT A;  3VAY A;  5JVE A;  3L8I A;  3RKO F;  4U5D E;  4O6N A;  2QLA A;  3DI5 A;  1SMY F;  4J7Y A;  4JRZ A;  4F4B A;  1RMV A;  1RJ9 B;  1D1B A;  3HNJ A;  2FGY A;  2YL7 A;  1NLX A;  3EG9 B;  1E83 A;  3SYN A;  3OEO A;  4XEK A;  3ZDL A;  3GM1 A;  2OJQ A;  4ONS A;  3H2V A;  2CYD A;  3DAG A;  3ITF A;  4EHP A;  1MND A;  2ZXO A;  4NCQ A;  3AOU A;  4MQ9 F;  3N2Z B;  2NUT A;  2NPU A;  4CJG A;  3GOD A;  5KYW A;  3S29 A;  2LD6 A;  3JTL O;  4WAB A;  4WGZ A;  3EPV A;  4ANJ A;  4WGY A;  3U9M A;  3UMK A;  3DM9 B;  2X0C A;  1IZM A;  1T6U A;  5K0I A;  2RD9 A;  1LVK A;  5HSW A;  2WVN A;  4CDV A;  3T4R A;  3U0C A;  2CNW D;  1Q0G A;  2R7O A;  3CQZ A;  5KYU A;  1YZA A;  1S7Z A;  2PX3 A;  2XLH A;  1TWA A;  3SXK A;  5L3Q A;  2A0U A;  2EPK X;  4I3M A;  1BR2 A;  3AQB A;  3O10 A;  4YL3 A;  2ZPA A;  4AE4 B;  1E86 A;  2Q9C A;  2YHS A;  2XS1 A;  2EPM X;  3JZ0 A;  3PCV A;  4P9T A;  2NSF A;  2WZF A;  3B0P A;  4I44 A;  4YN0 B;  3RFY A;  3RQF A;  256B A;  4XLP F;  1OXB A;  1J8M F;  1NBB A;  1R4T A;  1ST6 A;  1M57 C;  4XEV A;  4YL1 A;  2R03 A;  4AL0 A;  1YA7 O;  3O39 A;  2EPN A;  5L0C A;  1XWJ A;  1RJ9 A;  2HZ8 A;  3ABL C;  3GM2 A;  1JMW A;  1Z6A A;  2R7R A;  5COF A;  1E85 A;  3QVY A;  3F46 A;  1HE1 A;  1ORS C;  4A4A A;  3NDB B;  4GYT A;  1A7V A;  3K6B A;  2KC3 A;  2WVO A;  3C8G B;  4IAQ A;  4U9E A;  4CIH A;  5A6B A;  2R7W A;  1ZYR F;  4JEB A;  3EGD B;  2R25 A;  5E3A A;  4U5F E;  4EKW A;  4YWQ A;  2VH3 A;  2AWY A;  3NMJ A;  3B0U X;  4G7H F;  2XM0 A;  1YZC A;  1EA8 A;  1QKR A;  1JOG A;  1ORJ A;  1VLT A;  2KNH A;  2WZG A;  3NG1 A;  3T6J A;  2YWA A;  3JRT A;  3VM6 A;  5IY5 C;  5JLI A;  2TMV P;  1TR2 A;  1GQA A;  1TQG A;  2CCY A;  2YL3 A;  2XS8 A;  1I4Z A;  1SYQ A;  4NC3 A;  5AGF A;  1WWP A;  1SR2 A;  1GM5 A;  3ZTZ A;  1QLE C;  3ZSU A;  4C3B A;  4AL1 A;  1OKK A;  3IQC A;  1G4U S;  1NFO A;  5BQH A;  2DYS C;  3C7J A;  4DVY P;  1M56 C;  1BR4 A;  4BJ6 A;  2IM8 A;  5KYY B;  3KYJ A;  1B68 A;  3L8J A;  3AGU A;  2DYR C;  4CDY A;  3T9O A;  4J30 B;  2HJM A;  3DMD A;  4HFK B;  2YEV A;  4DBR A;  4G0H A;  5FZT A;  5JUA A;  3LLI A;  4I1M A;  3L34 A;  4J32 B;  4DVZ A;  2XLM A;  1PD1 A;  3G4Z A;  4U5G A;  3EZH A;  3JCU Q;  1U89 A;  3SXZ A;  1AUE A;  1VYI A;  2IBF A;  2JD3 A;  3M4B A;  3KMI A;  4HE8 D;  1NG1 A;  3MYI A;  4LLE A;  5D92 A;  4B6I A;  2KYH A;  2OU6 A;  3EZI A;  3KKB A;  3ZG1 A;  2EPO A;  4Z9J A;  1HE9 A;  2EIL C;  4MVS A;  4PFO A;  2D5R B;  2XM4 A;  3DE9 A;  4XPX A;  3DAF A;  3IPM O;  3QZC A;  4YK5 A;  3ASN C;  4BJ6 C;  4JKV A;  3EGD A;  3WHN A;  4OIQ F;  5CI8 A;  2QNL A;  4ULV A;  4C3D A;  2W4M A;  1OW8 A;  2HFI A;  3EGX B;  4JTC B;  2G3V A;  5F28 E;  1WAS A;  3EQL F;  4JJF A;  1H7I A;  3UGP A;  2NUP B;  4R32 A;  3SP1 A;  1D0Z A;  3POV A;  2H7V C;  2J9W A;  3M79 A;  4C3E A;  1H9T A;  2PNO A;  3NYM A;  1OW7 A;  1LS1 A;  2Q4F A;  1WTY A;  2ZXW C;  3WAQ A;  5A6B D;  3N0T A;  4NQF A;  5A69 A;  4AK9 A;  3EH2 A;  3LEO A;  2J9B A;  2LFF A;  3RW0 A;  3RQE A;  3QVZ A;  2AVK A;  1U6H A;  4G78 A;  4IAO A;  3UMI A;  5JRA A;  3MX3 A;  3AG4 C;  4N4W A;  4LDQ A;  3T6B A;  5KYY A;  2F22 A;  2RSE B;  3U2L A;  1BR1 A;  3AQC A;  3DD7 A;  3LEV A;  3RH3 A;  3I5Q A;  2VCB A;  2ZXP A;  3GEH A;  4D4N A;  2A6E F;  3UNG C;  1C02 A;  1YLM A;  4YT4 A;  3FAP B;  2GA0 A;  3C63 A;  4IWB A;  1MMG A;  4CBE A;  2KSF A;  5E3C A;  5F5F A;  4O79 A;  1QVX A;  4LAC B;  4W8P A;  2GFH A;  2VB6 A;  5DS5 A;  1LE2 A;  3KPH A;  3U8P A;  2A68 F;  1OKK D;  1QSP A;  1SF8 A;  2IXN A;  1O87 A;  2J7P A;  2WL8 A;  4L6R A;  1K05 A;  1MMN A;  2HMQ A;  2OCC C;  1TKN A;  3O6X A;  4GQH A;  4U5B E;  4OIR F;  1HMD A;  4U5C E;  4CS9 A;  2H7O A;  4MVR A;  2OEV A;  3K1I A;  2L6G A;  4CDA A;  1L7C A;  3UR3 C;  2AP3 A;  2PF4 E;  2Y3H A;  3S90 A;  1M2O A;  1CGN A;  3EGX A;  1YAU O;  1Q0D A;  4NTF A;  4KNV A;  1EI7 A;  1VYK A;  2UUI A;  2A69 F;  5L0D A;  1Q0M A;  3ZQY A;  3K66 A;  1Q0K A;  2A1D D;  2NUP A;  3X2Q C;  1ZHY A;  4I1O B;  1KTM A;  2C04 A;  2P6V A;  4PJJ A;  3V5Y A;  1ZW2 A;  3S0X A;  1A7D A;  3EH1 A;  4BJT A;  3UGO A;  1FMW A;  5BQG A;  5DS6 A;  1ZZP A;  2M4E A;  2FFH A;  1VMA A;  1A0B A;  4CS9 C;  4JCH A;  3HNL A;  4YT5 A;  3K1I C;  3SEO A;  1IW7 F;  4MVU A;  3RVZ A;  3LLK A;  2R9R B;  4U5E E;  4MVQ A;  3ZQV A;  3KYI A;  4E18 A;  3MFN A;  2AU5 A;  3RQG A;  3JYH A;  4NTB A;  5DQT A;  3TJ6 A;  2HUJ A;  2FAP B;  3HLZ A;  1O3U A;  4ULW A;  5B1B C;  4N6H A;  3QW1 A;  3EHN A;  1G5Z A;  2IXM A;  3ZC4 A;  3B71 A;  3FVY A;  1JAF A;  3KH2 A;  4BJ1 A;  1A41 A;  4KBL A;  1HW1 A;  2JX0 A;  4D4X A;  5A6K A;  5L0J A;  1M6T A;  5JP7 A;  2G3K A;  4EUK B;  2C03 A;  2VCA A;  5EHH A;  1TWH A;  3L0I A;  1C03 A;  2YLI A;  1W2W A;  2J8W A;  4DOZ A;  3GEI A;  2DI3 A;  3EG9 A;  4N06 A;  4CS8 A;  3GWN A;  1ZU4 A;  3S27 A;  2HKV A;  3DKA A;  2P7V A;  1D1A A;  1PCX A;  1FNT c;  3DM5 A;  5A6J A;  2D4U A;  1G8X A;  2XLD A;  1V54 C;  3JYY A;  1YDI A;  1BDJ B;  2J7P D;  2XXA B;  2Y3D A;  3NKD A;  3PHF 2;  1T01 A;  2J45 A;  3QW0 A;  4M63 A;  5CI9 A;  5FCL A;  1E2X A;  4YT8 A;  3J06 A;  1T6Q A;  4KC9 A;  2DGJ A;  2IXP A;  3TOM A;  3U2M A;  3LNR A;  4KNW A;  1FR0 A;  2XL6 A;  2ASR A;  4LDR A;  4YL0 A;  4MW8 A;  2PBE A;  3S28 A;  3Q6N A;  3ZWI A;  2AWC A;  2P1A A;  1LI7 A;  3ASO C;  2LSE A;  4CS8 C;  5KYN A;  4PK4 A;  4KI2 A;  1UG7 A;  5BUO A;  1NU9 C;  2HV6 A;  2KJG A;  3B9Q A;  4AE4 A;  4A2N B;  3RVY A;  1HW2 A;  1VB5 A;  2R7X A;  4K7B A;  1OW6 A;  2NSG A;  2CW0 F;  3AG1 C;  3LS0 A;  1QPU A;  1D0X A;  2WZL A;  3B29 A;  3DXJ F;  3NRH A;  2B0J A;  1DOV A;  4P6I C;  5E2Q A;  1YA9 A;  2ZD9 A;  3TQO A;  4PFP A;  3IQ6 A;  2UUH A;  4IJJ A;  4MW3 A;  2YKZ A;  3LJB A;  4Q7C A;  1EQ1 A;  3V5X A;  1FAP B;  2M64 A;  2IOQ A;  1APC A;  1NFN A;  2R7Q A;  3HKK A;  3LNM B;  5B3I A;  3ABM C;  3FAJ A;  1N1C A;  1HMO A;  3OA1 A;  3C8G A;  4ZLC A;  3BRJ A;  5EGY A;  3IHU A;  1F1M A;  2HMZ A;  2YL0 A;  2YZS A;  4FX5 A;  4W8K A;  4E7S A;  3DE8 A;  1UFB A;  2XXA A;  3W8I A;  4JCZ A;  4BJ5 A;  1WAT A;  2QE9 A;  4JTD B;  1DOW A;  3JRM O;  5DS4 A;  3JT1 A;  3M4C A;  3AG3 C;  1YJG A;  2NG1 A;  3B0V C;  4JVS A;  2QY9 A;  2KGO A;  3LUT B;  3NYL A;  3IQ5 A;  5COG A;  3Q7G A;  3SXY A;  4O7G A;  2ICW G;  4DRH B;  1V4A A;  2L6H A;  2VAS A;  3IEE A;  4OIO F;  4WJ0 A;  1TWC A;  2VCC A;  3EFO B;  2J0W A;  4JTA B;  3K1H A;  1TWG A;  2OEX A;  2KK1 A;  3R7C A;  4O6Y A;  5T3T A;  4JIO A;  3JSE O;  4H4K C;  3QMK A;  4YJW A;  2Q7R A;  5A6A A;  2CNW A;  4BJ5 C;  3CSK A;  4EBJ A;  3US6 A;  5GPG B;  3DJU B;  4PJM A;  2QTV A;  4MTO A;  4ZLD A;  1T6I A;  3CAX A;  1O5H A;  3C8Z A;  3CEX A;  2CDQ A;  2ETS A;  1I4Y A;  3HNI A;  4K1O A;  4LER A;  2LP4 A;  2P0N A;  4X0R A;  2XL8 A;  4Z9H A;  2W9Y A;  5TJ5 E;  2XLO A;  4AX2 A;  1LE4 A;  4RDA A;  1EKY A;  3W2W A;  3V7O A;  4MS2 A;  4BG0 A;  5BQI A;  4JEA A;  1VTM P;  1LPE A;  3U3F A;  3UMH A;  3WG7 C;  3TJ5 A;  5JT4 A;  1OCR C;  2HS5 A;  3R2P A;  3GOR A;  4PJN A;  1WGW A;  2IXO A;  1V74 B;  2YLG A;  5L0H A;  1YYJ A;  4PR9 A;  1KNY A;  4OIN F;  1KU2 A;  2CGE A;  1PD0 A;  1GS9 A;  2O9X A;  2YRF A;  3A9C A;  4JUR I;  1FFH A;  4XLN F;  1H9G A;  3ZIB A;  1I5N A;  4MND A;  4XPW A;  4IGG A;  4PAC A;  4Q5S F;  2J46 A;  4C7O B;  1ZVZ A;  3C8G D;  4HFF B;  3C62 A;  3FOO A;  3EFO A;  1PV3 A;  2XLE A;  3IQT A;  4MVO A;  3S84 A;  5DLJ A;  1CPQ A;  2OKU A;  1BZ4 A;  1U0B B;  4DBQ A;  2EIN C;  1JRA A;  3H2U A;  3M1C B;  4ER9 A;  2R7S A;  1RXQ A;  2GAQ A;  4FWV A;  3U9J A;  4P9F A;  4QDL A;  5KYX B;  3O55 A;  2L81 A;  4BEJ A;  4UDV A;  1RCP A;  3G4X A;  5E33 A;  4JJG A;  4U5H A;  1NZE A;  4CIP A;  3A11 A;  2EIM C;  2I8B A;  5D91 A;  3U3B A;  4CSA A;  2PP4 A;  2XLV A;  2Y3G A;  3LAY A;  3VYW A;  3W2V A;  2V3C C;  4G7Z F;  3HJC A;  4EBK A;  5KYX A;  2JPU A;  2H8A A;  4MVM A;  1SZI A;  3JSZ A;  4O6M A;  1E84 A;  3BEH A;  1OCO C;  2LCH A;  1GGQ A;  2GDC A;  5F5H A;  3AG2 C;  4XQ1 A;  4DXW A;  4DRJ B;  1H6G A;  3E9V A;  2MHR A;  2LIG A;  2KW3 C;  1XZQ A;  3SZR A;  4CJO A;  5AC4 A;  3AJM A;  4NTA A;  1Y4C A;  2E87 A;  1QQ3 A;  2Q9A A;  4Z9I A;  3CZ6 A;  3RF3 A;  3RYL A;  5L0G A;  2A6H F;  3AGT A;  5JSL A;  4OIP F;  2V26 A;  2Y39 A;  3FXH A;  4NY3 A;  3GWL A;  1TFO B;  3MYF A;  4FAP B;  2R7T A;  3N24 A;  1VLS A;  2W4B A;  5L0F A;  3L1M A;  4CSA C;  3EJN A;  1ZHW A;  5T3W A;  3SNH A;  2R7V A;  3MLG A;  2KQ9 A;  1L3P A;  3GM3 A;  4JE9 A;  4C7O A;  1QZX A;  5T1D B;  4IAR A;  1YVI A;  2OOC A;  1JR8 A;  1MNE A;  2Z15 A;  3Q6M A;  1Z7Q c;  2L9J A;  3U8V A;  4IRU A;  4PJL A;  3WOD F;  2J9U A;  1AEP A;  4JZA A;  4E0I A;  1J8Y F;  3E70 C;  5CIV A;  2B0H A;  4RD9 A;  3HTK C;  3HNK A;  1OCZ C;  3W8H A;  3X1O A;  3C18 A;  2VC9 A;  3NMI A;  3TK0 A;  1M2V B;  1K04 A;  3SXM A;  2GWW A;  1CPR A;  3FMS A;  5HV9 A;  4DRI B;  3VF0 A;  5DQZ A;  1MMA A;  4EBB A;  1K40 A;  3VRC A;  5COM A;  1Z3I X;  4E7Z A;  1MMD A;  2YLD A;  3ZVR A;  4E17 A;  3PDM P;  2MWQ A;  3V5Z A;  1T5O A;  2I15 A;  3T6G B;  4G7O F;  1AVO B;  1HY5 A;  4HEA J;  2LQG A;  3GEE A;  2HSQ A;  2Q3T A;  2X51 A;  2BL2 A;  2MYS A;  2XL4 A;  5DVW A;  2EIK C;  1ZU5 A;  4BEM J;  4CX9 A;  2Q00 A;  1A7E A;  3W4Y A;  1Y6D A;  4FES A;  1JPN A;  5L0I A;  1YAR O;  3H65 A;  3MBG A;  1VOM A;  1YYX A;  3FHD A;  2J9V A;  4N6C A;  3K33 A;  1LI5 A;  3LES A;  5L3V A;  4EWC A;  3G50 A;  1LKX A;  2L6F A;  5B1A C;  5B3S C;  4J7T A;  2YQY A;  4XTK A;  3Q7L A;  2BC5 A;  3NYJ A;  1Z63 A;  1RKE B;  4JW1 A;  2PFD A;  1OCC C;  3S9O A;  2IYL D;  4E0H A;  4QI2 A;  3F47 A;  4XPY A;  3ZTM A;  4MTF A;  1D0Y A;  2HJ3 A;  3ABK C;  1WN0 A; 
#chains in the Genus database with same CATH homology
 2WB7 A;  2WVQ A;  1M2V A;  4YT2 A;  4Q4Z F;  3EHM A;  1FFT C;  3PMR A;  2G62 A;  3GAN A;  2XRH A;  2EIJ C;  3DJN B;  3RIP A;  1ZHZ A;  2Y69 C;  3ECS A;  1ZHX A;  3DZA A;  4GEH A;  2J0X A;  2NUT B;  2R7U A;  2OG2 A;  5KYW B;  1Z5Z A;  2BE5 F;  4N06 A;  3LS1 A;  1VK5 A;  3FDQ A;  4LLC A;  2H7B A;  4QI0 A;  1NU7 D;  1D1C A;  2Y3B A;  3NKE A;  4CS7 A;  1FMV A;  1FTS A;  2HV7 A;  3I4U A;  3I5P A;  3TD7 A;  1V55 C;  5KYU B;  3K7D A;  2Q9B A;  2XSE A;  2PX0 A;  4K0D A;  1Z23 A;  1ZHT A;  4OD5 A;  1JPJ A;  4XWJ A;  3KL4 A;  2W45 A;  2ZXR A;  4OD4 A;  5KYN A;  4RBN A;  3OWT A;  3VAY A;  3RKO F;  4U5D E;  4O6N A;  1SMY F;  4F4B A;  1RJ9 B;  1D1B A;  2FGY A;  3EG9 B;  3SYN A;  3OEO A;  3DAG A;  3ITF A;  1MND A;  2ZXO A;  4MQ9 F;  2NUT A;  3N2Z B;  3GOD A;  5KYW A;  3S29 A;  3EPV A;  4ANJ A;  3UMK A;  3DM9 B;  1IZM A;  1LVK A;  5HSW A;  2WVN A;  3T4R A;  2CNW D;  2R7O A;  3CQZ A;  5KYU A;  1S7Z A;  2PX3 A;  1TWA A;  5L3Q A;  4I3M A;  1BR2 A;  3AQB A;  2ZPA A;  4AE4 B;  2Q9C A;  2YHS A;  4YN0 B;  3RFY A;  2WZF A;  3B0P A;  4I44 A;  4XLP F;  1J8M F;  1ST6 A;  1M57 C;  3O39 A;  1RJ9 A;  3ABL C;  1Z6A A;  2R7R A;  3F46 A;  3NDB B;  4GYT A;  3K6B A;  2R7W A;  2WVO A;  4CIH A;  1ZYR F;  3EGD B;  5E3A A;  4U5F E;  4YWQ A;  3B0U X;  2VH3 A;  4G7H F;  2KNH A;  2WZG A;  5IY5 C;  3NG1 A;  3T6J A;  3JRT A;  1TR2 A;  1QLE C;  3ZSU A;  4C3B A;  1OKK A;  2DYS C;  4DVY P;  1M56 C;  1BR4 A;  4BJ6 A;  5KYY B;  2DYR C;  4J30 B;  3DMD A;  4HFK B;  2YEV A;  4DBR A;  4G0H A;  3LLI A;  4I1M A;  3L34 A;  4J32 B;  4DVZ A;  1PD1 A;  4U5G A;  3EZH A;  3JCU Q;  1VYI A;  2JD3 A;  3KMI A;  4HE8 D;  1NG1 A;  5D92 A;  4LLE A;  4B6I A;  3EZI A;  3KKB A;  3ZG1 A;  2EIL C;  4PFO A;  2D5R B;  3DAF A;  3QZC A;  3ASN C;  4BJ6 C;  3EGD A;  4OIQ F;  5CI8 A;  4C3D A;  2W4M A;  3EGX B;  2G3V A;  3EQL F;  4JJF A;  3UGP A;  2NUP B;  3SP1 A;  1D0Z A;  3POV A;  2H7V C;  2J9W A;  4C3E A;  3NYM A;  1LS1 A;  2ZXW C;  3N0T A;  4AK9 A;  3EH2 A;  4IAO A;  3UMI A;  3MX3 A;  3AG4 C;  5KYY A;  3T6B A;  1BR1 A;  3AQC A;  3DD7 A;  3LEV A;  3RH3 A;  3I5Q A;  2ZXP A;  2A6E F;  3UNG C;  4YT4 A;  4IWB A;  1MMG A;  4CBE A;  5F5F A;  5E3C A;  4O79 A;  4LAC B;  2GFH A;  2VB6 A;  5DS5 A;  2A68 F;  1OKK D;  1SF8 A;  2IXN A;  1O87 A;  2J7P A;  2WL8 A;  4U5B E;  1MMN A;  4OIR F;  2OCC C;  1TKN A;  3O6X A;  4U5C E;  4CS9 A;  2H7O A;  3UR3 C;  2PF4 E;  2Y3H A;  1M2O A;  3EGX A;  4KNV A;  1VYK A;  2A69 F;  3K66 A;  2A1D D;  2NUP A;  3X2Q C;  1ZHY A;  4I1O B;  2C04 A;  2P6V A;  4PJJ A;  3S0X A;  4BJT A;  3EH1 A;  3UGO A;  1FMW A;  5DS6 A;  2M4E A;  2FFH A;  1VMA A;  4CS9 C;  4JCH A;  4YT5 A;  3K1I C;  3SEO A;  1IW7 F;  3LLK A;  4U5E E;  3JYH A;  5DQT A;  3HLZ A;  4ULW A;  5B1B C;  3EHN A;  2IXM A;  3ZC4 A;  3FVY A;  3KH2 A;  4BJ1 A;  4KBL A;  2G3K A;  2C03 A;  5EHH A;  1TWH A;  3L0I A;  1W2W A;  4DOZ A;  3EG9 A;  4CS8 A;  1ZU4 A;  3S27 A;  2P7V A;  1D1A A;  1PCX A;  3DM5 A;  1G8X A;  1V54 C;  2J7P D;  2XXA B;  2Y3D A;  3NKD A;  3PHF 2;  2J45 A;  4M63 A;  5CI9 A;  5FCL A;  4YT8 A;  4KC9 A;  2DGJ A;  2IXP A;  3LNR A;  4KNW A;  3S28 A;  3Q6N A;  4CS8 C;  3ASO C;  4KI2 A;  4G7O F;  2LSE A;  4PK4 A;  5BUO A;  1NU9 C;  2HV6 A;  2KJG A;  3B9Q A;  4AE4 A;  4A2N B;  2R7X A;  4K7B A;  2CW0 F;  3AG1 C;  3LS0 A;  2WZL A;  1D0X A;  3NRH A;  3DXJ F;  5E2Q A;  2B0J A;  4P6I C;  4PFP A;  4IJJ A;  3LJB A;  4Q7C A;  2IOQ A;  2R7Q A;  3ABM C;  3FAJ A;  1N1C A;  3OA1 A;  4ZLC A;  5EGY A;  2YZS A;  4FX5 A;  4W8K A;  4E7S A;  2XXA A;  3W8I A;  4BJ5 A;  5DS4 A;  3JT1 A;  3AG3 C;  2NG1 A;  3B0V C;  4JVS A;  2QY9 A;  2KGO A;  3NYL A;  3Q7G A;  4O7G A;  2VAS A;  3IEE A;  4OIO F;  4WJ0 A;  1TWC A;  3EFO B;  2J0W A;  3K1H A;  1TWG A;  4O6Y A;  5T3T A;  4H4K C;  3QMK A;  4YJW A;  2CNW A;  4BJ5 C;  3CSK A;  3DJU B;  4PJM A;  2QTV A;  4ZLD A;  1O5H A;  2CDQ A;  4X0R A;  5KYX B;  4LER A;  2W9Y A;  4AX2 A;  4RDA A;  3W2W A;  3V7O A;  4BG0 A;  3WG7 C;  3UMH A;  1OCR C;  4PJN A;  1WGW A;  2IXO A;  4OIN F;  1KU2 A;  2CGE A;  1PD0 A;  2O9X A;  4XLN F;  4JUR I;  1FFH A;  3ZIB A;  4MND A;  4Q5S F;  2J46 A;  4C7O B;  4HFF B;  3EFO A;  5DLJ A;  4DBQ A;  2EIN C;  3M1C B;  2R7S A;  4FWV A;  4QDL A;  2L81 A;  4BEJ A;  5E33 A;  4JJG A;  4U5H A;  1NZE A;  2EIM C;  2I8B A;  5D91 A;  4CSA A;  2PP4 A;  2Y3G A;  3LAY A;  3VYW A;  3W2V A;  2V3C C;  4G7Z F;  3HJC A;  5KYX A;  4O6M A;  1SZI A;  3JSZ A;  1OCO C;  5F5H A;  3AG2 C;  3E9V A;  3SZR A;  2KW3 C;  2E87 A;  2Q9A A;  3RYL A;  3CZ6 A;  2A6H F;  4OIP F;  2V26 A;  2Y39 A;  4NY3 A;  2R7T A;  3N24 A;  2W4B A;  4CSA C;  3EJN A;  1ZHW A;  5T3W A;  3SNH A;  2R7V A;  3MLG A;  2KQ9 A;  4C7O A;  1QZX A;  5T1D B;  2Z15 A;  1MNE A;  3WOD F;  3Q6M A;  2L9J A;  4IRU A;  4PJL A;  2J9U A;  4JZA A;  1J8Y F;  3E70 C;  4RD9 A;  3HTK C;  1OCZ C;  3W8H A;  3X1O A;  1M2V B;  5DQZ A;  4EBB A;  1MMA A;  1Z3I X;  4E7Z A;  1MMD A;  3ZVR A;  2MWQ A;  4HEA J;  2Q3T A;  2X51 A;  2MYS A;  2XL4 A;  5DVW A;  2EIK C;  1ZU5 A;  4FES A;  1JPN A;  3H65 A;  1VOM A;  3FHD A;  2J9V A;  3K33 A;  3LES A;  5L3V A;  4EWC A;  5B1A C;  1LKX A;  5B3S C;  4XTK A;  3Q7L A;  3NYJ A;  1Z63 A;  4JW1 A;  2PFD A;  1OCC C;  4QI2 A;  2IYL D;  3F47 A;  1D0Y A;  3ABK C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...