2WL8A

X-ray crystal structure of pex19p
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
110
structure length
110
Chain Sequence
b'ILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESLPPEQFEKYQEQHSVMCKICEQFEAETPTDSETTQKARFEMVLDLMQQLQDLGHPPKELAGEMPPGLNFDL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PEROXISOMAL BIOGENESIS FACTOR 19
molecule tags Protein transport
source organism Homo sapiens
publication title The Peroxisomal Receptor Pex19P Forms a Helical Mpts Recognition Domain.
pubmed doi rcsb
total genus 36
structure length 110
sequence length 110
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-06-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.900 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2wl8A00
2WL8A
chains in the Genus database with same CATH superfamily
4NC3A 3U9JA 1K05A 2P1AA 2R02A 4DVZA 2Y3BA 1ST6A 3TJ6A 3MLGA 1BDJB 2LSEA 3IHUA 1KTMA 3GEEA 2GFHA 4EBKA 1Z7Qc 4XEFA 2DYSC 1CPQA 3LNMB 1WATA 1FFHA 4O6MA 2JX0A 3RQEA 4C7OB 3FHDA 1APCA 1WTYA 1H7IA 3Q7LA 1ZYRF 4JZAA 1SZIA 5L0HA 5L0IA 4DXWA 5L3VA 3EPVA 2YL7A 3FXHA 2W4MA 1A41A 2I15A 1HE9A 3W8HA 1SYQA 2EINC 5CI8A 3AGTA 2QTVA 4YT2A 5F5FA 3POVA 3DI5A 2VASA 4U5DE 1LI5A 1MQVA 1D0YA 2YKZA 3DJUB 5KYXA 2ZXOA 4PACA 2VC9A 5B3IA 1LS1A 3L34A 1GM5A 1JPNA 1QZXA 1F1MA 2CDQA 4PJJA 3TOMA 2UUIA 1A7EA 1WWPA 1YZCA 3GODA 1TWGA 3NYMA 1ZHZA 4U5BE 2XLOA 1H6GA 4N6CA 3S27A 4OIPF 3BEHA 4RBNA 2C03A 2XL4A 1YZAA 2CNWA 3V5ZA 4OIQF 3DAGA 4YWQA 3M4BA 3C8ZA 1OCZC 2P7VA 4NQFA 4HEAJ 3AOUA 1E83A 2QUPA 3DE9A 2KK1A 2VCCA 3B29A 4E17A 3U3FA 4FESA 5L0CA 2D4UA 1ZW3A 5KYYB 3LUTB 2XLVA 4MVQA 3ZVRA 4CS9C 1L7CA 4LERA 3NMJA 1CGME 1MNEA 2YEVA 2R7RA 3G4XA 1OKKD 2Q9BA 3QVYA 2YVKA 5D92A 4AL0A 5A6AA 3JSZA 4XLPF 2G3KA 4U5GA 4AE4A 1QVXA 1R4TA 2HKVA 3JYYA 2VB6A 4LLCA 4F4BA 1NSGB 3FDQA 3V5YA 1XWJA 2IXNA 3E70C 1TFKB 3SYNA 3AQCA 4JTCB 4JCHA 3ABMC 3EH1A 2NUTA 3N2ZB 5E2QA 1QPUA 2XS8A 3KYIA 1VYKA 1FMVA 2XLHA 2YLGA 1I5NA 4Z9JA 5IY5C 5KYWA 1OCRC 1WGWA 1YDIA 3N24A 2R7QA 3ABLC 5COFA 4A4AA 2YQYA 1HW2A 1C03A 3NKEA 5KYNA 2ICWG 5JSLA 4GEHA 3OWTA 1RKEB 1L3PA 2XM0A 3DD7A 3KKBA 1Z3IX 1J8YF 3MX3A 4IAQA 3B0VC 3LLIA 1C02A 3F46A 3BRJA 4JTDB 3CQZA 3N0TA 4PR9A 4ER9A 2MYSA 2B0JA 1S7ZA 2J7PA 4BJTA 4Q5SF 3L8JA 1LE2A 3C62A 3QVZA 4U5FE 5B1AC 2YL1A 1PV3A 3H2UA 4JC7A 2LIGA 3S90A 4JEAA 4JRZA 3VRCA 3CSKA 3VM6A 4BJ5C 2W45A 2A6HF 3JRMO 4MVOA 3NKDA 1ZVZA 1VK5A 1DOVA 3LS1A 2PBEA 3K7DA 1M57C 3O55A 1D1BA 1ORJA 4I3MA 5F28E 2AU5A 2Y3DA 3EG9A 3GORA 2Q3TA 1AUEA 1YA7O 2R03A 1YYXA 2XL8A 4E7SA 3J06A 3LESA 4JE9A 2BC5A 5JP7A 2WVOA 4MTOA 5FCLA 1VOMA 3ZQVA 1TWAA 1Z23A 3L1MA 2EPKX 3IQ6A 4MW8A 4CDVA 3M79A 1MMDA 3ZDLA 3Q7GA 2XLEA 3ZQYA 1KNYA 4MVRA 2Q4FA 1JR8A 2QLAA 4E0HA 3HNKA 5KYUB 3AG1C 1A7DA 5E33A 5AGFA 3AQBA 2W9YA 4IGGA 4QI0A 2L6GA 1D1AA 2KNHA 3O6XA 3DM9B 3S84A 4U5EE 3RVZA 3M15A 5D91A 2QY9A 3EQLF 2LFDA 3TQOA 3IPMO 3DAFA 3MFNA 4IAOA 1BBHA 1K40A 2RSEB 3B71A 2A68F 1T6QA 3GM2A 4JKVA 3TJ5A 2R7SA 5JUAA 4NY3A 4W8KA 5E3AA 1EQ1A 2P6VA 2PX0A 4HFKB 4M63A 1YARO 5JT4A 4MVZA 2J46A 3EH2A 2C04A 4RDAA 2FAPB 2TMVP 2CNWD 4XPWA 2HS5A 3EZIA 4NCQA 2WB7A 4NTAA 3U2MA 2R9RB 3RQGA 3UR3C 5BUOA 1T01A 1E2XA 3GEIA 3VAYA 1YJGA 2QNLA 1OKKA 3I5QA 2XRHA 3FMSA 4EHPA 2HJMA 3AG2C 5CIVA 1E86A 4MVSA 1V74B 3EFOA 2NUPA 4FWVA 5T1DB 3JCUQ 3IQCA 2J7PD 3V7OA 4LLEA 3JTLO 4C3DA 4O79A 3SXYA 4D4XA 1Q0MA 1TWCA 3HNJA 4XEKA 3RKOF 4DBRA 1QSPA 1QKRA 1QQ3A 2UUHA 2NUTB 2HMZA 3L8IA 3NMKA 3NRHA 4QDLA 4WGZA 3WODF 4CBEA 4OINF 1Q0DA 4NTBA 5DQTA 1EA8A 1LE4A 3ASOC 1A7VA 5DS4A 4WGYA 1VLSA 3LLKA 1ORYA 3U2LA 5KYUA 2H7OA 4C3BA 4YJWA 1VYIA 2NSFA 3W4YA 1PD1A 3GANA 3NMIA 4RD9A 5COGA 3NG1A 2R7UA 4U5HA 2H8AA 2J9VA 3KL4A 1JMWA 4YK5A 3CZ6A 4FX5A 1NU7D 3MYFA 2QE9A 4KNVA 3GWLA 5TJ5E 2X51A 1D0ZA 2ASRA 3C8GB 3WG7C 3V5XA 1MMGA 3KPHA 1E85A 3NYJA 1D1CA 1QLEC 2IXMA 3I5PA 2Q00A 4XLNF 2LQGA 2A0UA 2MWQA 1RJ9A 2YZSA 4YT4A 1M2OA 2IOQA 3HNIA 2R7XA 4HE8D 3ZTZA 1T6IA 1G4WR 2NPUA 4E7ZA 2DGJA 3U3BA 1AVOB 2LFFA 2KW3C 2I8BA 5E3CA 1U89A 2CGEA 2XLDA 4PJNA 4JURI 3DKAA 2OEVA 5EHHA 2GWWA 1E84A 1SF8A 5A6BA 3U0CA 2XM4A 2WL8A 2J8WA 3EHMA 4U9EA 3B0PA 4CS8C 3DE8A 2XLWA 3W8IA 1S05A 1TFOB 4BJ6A 4JCZA 1UG7A 4X0RA 2R7TA 3W2VA 3C8GA 4XQ1A 1NG1A 5F5HA 2XXAB 2GAQA 2L9JA 4G7OF 4YL3A 4MVMA 1LPEA 4BJ1A 1RMVA 1LKXA 2KJGA 3A11A 5A6KA 2M64A 1FFTC 2IYLD 5HSWA 5T3TA 2ZD9A 4XTKA 1N1CA 2J45A 2GA0A 1BR1A 4WABA 3ASNC 4W8PA 4YT8A 1WASA 2A69F 2IXPA 2V26A 3EJNA 2Y3HA 1OW8A 2DI3A 3F47A 3M1CB 3PMRA 2J9UA 3ZG1A 1Z5ZA 5KYXB 1SMYF 4MTFA 4O7GA 2RD9A 3T9OA 2YHSA 3PCVA 3U5SA 1YLMA 4I1MA 1Q0GA 3DM5A 2OU6A 2A0BA 3KH2A 3KMIA 3SP1A 3H2VA 3Q6NA 4ANJA 3QMKA 4H54A 3AGUA 1HE1A 4JVSA 3ZTMA 4CSAC 1HMDA 1ZHWA 3U8PA 2HV6A 3UNGC 4IRUA 5DS5A 3JSEO 3G50A 2A1DD 4MQ9F 3X1OA 1JAFA 2OJED 2R7WA 2EIKC 4KNWA 2CW0F 2NUPB 1MMNA 2V3CC 1T9KA 4AK9A 4K7BA 4Q4ZF 5GPGB 4CDAA 1SR2A 2KYHA 5JS5A 3OEOA 3EHNA 3HJCA 4K0DA 3SXMA 1ZW2A 3FOPA 1RKCA 1ZU4A 2M4EA 2WZGA 2FFHA 3K1IC 2X0CA 3B9QA 4PJLA 3RIPA 3O39A 3RFYA 3T4RA 1ZHXA 3U9MA 2WZLA 4P6IC 1JPJA 4MS2A 1OR3A 1O5HA 4Q7CA 3T6GB 4BJ6C 3PDMP 5AC4A 4C7OA 5FZTA 5AC5A 2EPNA 3JRTA 2ZPAA 4E0IA 2OOCA 4FAPB 3GM1A 2NSGA 4EBBA 3LS0A 3C8GD 1H9GA 4KI2A 1TQGA 2J0WA 2J9BA 4JJFA 4YN0B 1CPRA 1I4YA 4XEVA 3B0UX 2G3VA 4HFFB 3SNHA 1Z63A 4EBJA 2KC3A 1MNDA 4G7HF 3HNLA 2NG1A 1Z6AA 256BA 3EGXB 4BPMA 2W4BA 1CGOA 4ZLDA 1M2VA 2HZ8A 3SXZA 4J7TA 2YRFA 1Q0FA 3UMIA 2PNOA 2H7VC 2Z15A 1H9TA 3EGDA 1LI7A 4U5CE 2JD3A 1ZZPA 4DRJB 4EWCA 3M4CA 1LIHA 4YT5A 1R5ID 3LEOA 4WJ0A 4MW3A 5COMA 2Y3GA 2EIMC 3EG9B 3I4UA 1JOGA 2EPOA 4CS7A 1RKEA 1W2WA 1IW7F 1O87A 4CIHA 4CX9A 3W2WA 3OA1A 3HKKA 4OD5A 2VCBA 1VMAA 1Y4CA 4N06A 4OD4A 5EGYA 3NDBB 2P61A 3QW0A 1DOWA 4K1OA 4IJJA 4DJ9A 1PD0A 1OXBA 2PF4E 1U0BB 4PFOA 2G62A 3JYHA 4A2NB 4P9FA 3QZCA 2L7AA 2MHRA 3SZRA 3IEEA 3T6BA 2HSQA 3S29A 1GGQA 2VH3A 3WAQA 3FAJA 2F22A 1HMOA 2WZFA 3QW1A 2B0HA 3TULA 1ORSC 1G8XA 3HTKC 4L6RA 4P9TA 3FAPB 5CI9A 4Z9IA 1CGNA 2CCYA 2PP4A 4H4KC 4ONSA 4ULWA 3UMHA 3UGPA 2BE5F 2IXOA 2J0XA 4KC9A 1RXQA 1MMAA 1YA9A 2JPUA 3TOLA 1FTSA 3ZIBA 1FMWA 1I4ZA 1K04A 2OJQA 2J9WA 5BQHA 5DVWA 1OQCA 4CSAA 2AWYA 4YL1A 2VCAA 4D4NA 5BQIA 3RH3A 1O3UA 2Y69C 3AG4C 1G5ZA 3GM3A 2R7VA 4N4WA 4CS8A 4PFPA 2R25A 4E18A 1VTMP 4LDKA 4OIOF 4GQHA 1VB5A 2OEXA 4XWJA 1OXKA 3HLZA 1ZHTA 5DQZA 1FAPB 1XZPA 3MBGA 2Y39A 2AP3A 3X2QC 4DVYP 1FR0A 3RQFA 1ZU5A 5DS6A 2IBFA 3LNRA 5EK0A 2HV7A 1NBBA 3FOOA 4JIOA 4JW1A 5JLIA 1C17M 3UGOA 4J32B 4G78A 4MTGA 5L0GA 1GS9A 4YL0A 3TD7A 3ZC4A 3IQ5A 1BZ4A 1RCPA 1NU9C 4B6IA 4EUKB 2HSBA 3H65A 1EI7A 2LK4A 2R7OA 2FGYA 1OW7A 4CDYA 3O10A 4DBQA 2ZXRA 3CAXA 3DWWA 3TK0A 2KQ9A 1UFBA 3UMKA 4AL1A 1BR2A 4J30B 4U9DA 1V4AA 2Q9CA 3EGXA 4JTAB 4DOZA 1LVKA 2KSFA 2OQMA 4ZLCA 5L0FA 3S0XA 3DZAA 4EIYA 1M2VB 1J8MF 3C7JA 3CEXA 5DLJA 3DJNB 1IZMA 3DMDA 4BEMJ 5KYYA 5KYWB 2ETSA 3GEHA 3DXJF 3R2PA 1YAUO 1TWHA 3Q6MA 4PK4A 4OIRF 3K6BA 5HV9A 1BR4A 3KYJA 3L0IA 5B1BC 2Q9AA 5T3WA 4UDVA 2P0NA 1YVIA 2L6FA 3ZWIA 2WVQA 4AE4B 2ZXWC 4Z9HA 4PJMA 4ULVA 5L0JA 3ECSA 1HW1A 1ZHYA 4BEJA 4R32A 1Q0KA 3LEVA 2EPLX 3C18A 4IARA 4JEBA 2A6EF 1OCOC 1V55C 2Q7RA 2DB4A 3FVYA 4IWBA 3EZHA 2XSEA 5BQGA 1FNTc 3S9OA 4QI2A 4MNDA 1OCCC 4DRHB 1VLTA 1NFNA 1PCXA 2R05A 2LCHA 1JRAA 3JZ0A 3T6JA 5JVEA 4IB4A 1HY5A 1M6TA 5A6JA 5B3SC 3QTHA 1G4US 2KGOA 3VYWA 3GWNA 1RJ9B 3RW0A 3K1IA 1U6HA 1OW6A 1NFOA 2OKUA 4EKWA 5A6BD 3ZSUA 3ATPA 2O9XA 3LJBA 4AX2A 3RYLA 4O6NA 2PX3A 1EKYA 2YL3A 2WVNA 1YYJA 1WN0A 3IQTA 1OR2A 2E87A 4XPYA 2LP4A 2LD6A 2YWAA 3E9VA 4C3EA 2DYRC 3EFOB 2AVKA 4MVUA 1B68A 2H7BA 3ITFA 3K33A 4BJ5A 2XXAA 1T6UA 4BG0A 2HJ3A 4CJOA 2HMQA 2PFDA 2AWCA 1AEPA 5JRAA 1LS4A 4LACB 2XS1A 3MYIA 4CIPA 3RF3A 4LDRA 1A0BA 4N6HA 2HFIA 3EGDB 3R7CA 4CS9A 1T5OA 1NZEA 2CYDA 2YLDA 3G4ZA 3SXKA 4JJGA 3RVYA 3SEOA 4CJGA 2BL2A 4NTFA 2YL0A 1NLXA 3VF0A 3AJMA 2IM8A 1Y6DA 4G0HA 3K1HA 1D0XA 4GYTA 3AG3C 2GDCA 2XL6A 5L0DA 2YLIA 4J7YA 3PHF2 3WHNA 3C63A 3A9CA 3LAYA 3S28A 2EPMX 1WOLA 4DRIB 2EILC 5K0IA 4I44A 2D5RB 4KBLA 3U8VA 3US6A 2L81A 1KU2A 3K66A 3NYLA 2EIJC 1TR2A 1M56C 2OG2A 3ABKC 2L6HA 1V54C 4G7ZF 4I1OB 2ZXPA 2OCCC 1LM3B 3JT1A 1XZQA 4LDQA 4O6YA 5L3QA 2XLMA 4XPXA 5A69A 1TKNA 1GQAA 2HUJA
chains in the Genus database with same CATH topology
4DVZA 2Y3BA 1ST6A 3MLGA 2LSEA 2GFHA 2DYSC 1FFHA 4O6MA 4C7OB 3FHDA 3Q7LA 1ZYRF 4JZAA 1SZIA 5L3VA 3EPVA 2W4MA 3W8HA 2EINC 5CI8A 2QTVA 4YT2A 5F5FA 3POVA 2VASA 4U5DE 5KYXA 1D0YA 3DJUB 2ZXOA 1LS1A 3L34A 1JPNA 1QZXA 2CDQA 4PJJA 3GODA 1TWGA 3NYMA 1ZHZA 4U5BE 3S27A 4RBNA 2C03A 2XL4A 4OIQF 2CNWA 3DAGA 4YWQA 1OCZC 2P7VA 4HEAJ 4FESA 5KYYB 3ZVRA 4CS9C 4LERA 1MNEA 2YEVA 2R7RA 1OKKD 2Q9BA 5D92A 3JSZA 4XLPF 2G3KA 4U5GA 4AE4A 4LLCA 2VB6A 3FDQA 2IXNA 3E70C 3SYNA 3AQCA 4JCHA 3ABMC 3EH1A 2NUTA 3N2ZB 5E2QA 1VYKA 1FMVA 5IY5C 5KYWA 1OCRC 1WGWA 3N24A 2R7QA 3ABLC 3NKEA 5KYNA 4GEHA 3OWTA 3DD7A 3KKBA 1Z3IX 1J8YF 3MX3A 3B0VC 3LLIA 3F46A 3CQZA 3N0TA 2MYSA 2B0JA 1S7ZA 2J7PA 4BJTA 4Q5SF 4U5FE 5B1AC 3CSKA 4BJ5C 2W45A 2A6HF 3NKDA 1VK5A 3LS1A 3K7DA 1M57C 1D1BA 4I3MA 3EG9A 2Y3DA 4E7SA 2Q3TA 3LESA 2WVOA 5FCLA 1VOMA 1TWAA 1Z23A 1MMDA 3Q7GA 5KYUB 3AG1C 5E33A 3AQBA 2W9YA 4QI0A 1D1AA 2KNHA 3O6XA 3DM9B 4U5EE 5D91A 2QY9A 3EQLF 3DAFA 4IAOA 2A68F 2R7SA 4NY3A 4W8KA 5E3AA 2P6VA 2PX0A 4HFKB 4M63A 2J46A 3EH2A 2C04A 4RDAA 2CNWD 3EZIA 2WB7A 3UR3C 5BUOA 3VAYA 1OKKA 3I5QA 2XRHA 3AG2C 4OIPF 3EFOA 4FWVA 2NUPA 5T1DB 3JCUQ 3V7OA 2J7PD 4LLEA 4C3DA 4O79A 4DBRA 1TWCA 3RKOF 4QDLA 3NRHA 2NUTB 3WODF 4CBEA 4OINF 5DQTA 3ASOC 5DS4A 3LLKA 4C3BA 5KYUA 2H7OA 4YJWA 1VYIA 1PD1A 3GANA 4RD9A 3NG1A 2R7UA 4U5HA 2J9VA 3KL4A 3CZ6A 4FX5A 1NU7D 4KNVA 3WG7C 2X51A 1D0ZA 1MMGA 3NYJA 1D1CA 1QLEC 2IXMA 3I5PA 4XLNF 2MWQA 2YZSA 1RJ9A 4YT4A 1M2OA 2IOQA 2R7XA 4HE8D 4E7ZA 2DGJA 2KW3C 2I8BA 5E3CA 2CGEA 4PJNA 4JURI 5EHHA 1SF8A 2WL8A 3EHMA 4CS8C 3B0PA 3W8IA 4BJ6A 4X0RA 2R7TA 3W2VA 1NG1A 5F5HA 2XXAB 2L9JA 4G7OF 4BJ1A 1LKXA 2KJGA 1FFTC 2IYLD 5HSWA 5T3TA 4XTKA 1N1CA 2J45A 1BR1A 4YT8A 3ASNC 2A69F 2IXPA 2V26A 3EJNA 2Y3HA 3F47A 3PMRA 3M1CB 2J9UA 3ZG1A 1Z5ZA 5KYXB 1SMYF 4O7GA 2YHSA 4I1MA 3DM5A 3KH2A 3KMIA 3SP1A 3Q6NA 4ANJA 3QMKA 4JVSA 4CSAC 1ZHWA 2HV6A 3UNGC 4IRUA 5DS5A 2A1DD 4MQ9F 3X1OA 2R7WA 2EIKC 4KNWA 2CW0F 2NUPB 1MMNA 2V3CC 4AK9A 4K7BA 4Q4ZF 3OEOA 3EHNA 3HJCA 4K0DA 1ZU4A 2M4EA 2WZGA 2FFHA 3K1IC 3RIPA 3B9QA 4PJLA 3O39A 3RFYA 3T4RA 1ZHXA 2WZLA 4P6IC 1JPJA 4Q7CA 1O5HA 4C7OA 3JRTA 2ZPAA 4EBBA 3LS0A 4KI2A 2J0WA 3B0UX 4JJFA 4YN0B 2G3VA 4HFFB 3SNHA 1Z63A 1MNDA 4G7HF 2NG1A 1Z6AA 3EGXB 2W4BA 4ZLDA 1M2VA 3UMIA 2H7VC 2Z15A 3EGDA 4U5CE 2JD3A 4EWCA 4YT5A 4WJ0A 2Y3GA 2EIMC 3EG9B 3I4UA 4CS7A 1W2WA 1IW7F 1O87A 4CIHA 3W2WA 3OA1A 4OD5A 1VMAA 5EGYA 4N06A 4OD4A 3NDBB 4IJJA 1PD0A 2PF4E 4PFOA 2G62A 3JYHA 4A2NB 3QZCA 3SZRA 3IEEA 3T6BA 3S29A 2VH3A 3FAJA 2WZFA 1G8XA 3HTKC 5CI9A 4H4KC 4ULWA 2PP4A 3UGPA 3UMHA 2BE5F 2IXOA 2J0XA 4KC9A 1MMAA 1FTSA 3ZIBA 1FMWA 2J9WA 5DVWA 4CSAA 3RH3A 2Y69C 3AG4C 2R7VA 4CS8A 4PFPA 4OIOF 4XWJA 3HLZA 1ZHTA 5DQZA 3X2QC 4DVYP 2Y39A 1ZU5A 5DS6A 3LNRA 2HV7A 4JW1A 3UGOA 4J32B 3TD7A 3ZC4A 1NU9C 4B6IA 3H65A 2R7OA 2FGYA 4DBQA 2ZXRA 2KQ9A 3UMKA 1BR2A 4J30B 2Q9CA 3EGXA 4DOZA 4ZLCA 1LVKA 3S0XA 3DZAA 1M2VB 1J8MF 5DLJA 5KYWB 3DJNB 1IZMA 3DMDA 5KYYA 3DXJF 4PK4A 4OIRF 3Q6MA 1TWHA 3K6BA 1BR4A 3L0IA 5B1BC 2Q9AA 5T3WA 4AE4B 2WVQA 2ZXWC 4PJMA 3ECSA 4BEJA 1ZHYA 3LEVA 2A6EF 1OCOC 1V55C 3FVYA 4IWBA 3EZHA 2XSEA 4QI2A 4MNDA 1OCCC 1PCXA 3T6JA 5B3SC 2KGOA 3VYWA 1RJ9B 3ZSUA 2O9XA 3LJBA 4AX2A 3RYLA 4O6NA 2PX3A 2WVNA 2E87A 3E9VA 4C3EA 4F4BA 2DYRC 3EFOB 2H7BA 3ITFA 3K33A 4BJ5A 2XXAA 4BG0A 2PFDA 4LACB 3EGDB 4CS9A 1NZEA 4JJGA 3SEOA 4G0HA 3K1HA 1D0XA 4GYTA 3AG3C 3PHF2 3S28A 3LAYA 2EILC 4I44A 2D5RB 4KBLA 2L81A 1KU2A 3NYLA 3K66A 2EIJC 1TR2A 1M56C 2OG2A 3ABKC 1V54C 4G7ZF 4I1OB 2ZXPA 2OCCC 3JT1A 4O6YA 5L3QA 1TKNA 4BJ6C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WL8 A; 
#chains in the Genus database with same CATH topology
 4NC3 A;  3U9J A;  1K05 A;  2P1A A;  2R02 A;  4DVZ A;  2Y3B A;  1ST6 A;  3TJ6 A;  3MLG A;  1BDJ B;  2LSE A;  3IHU A;  1KTM A;  3GEE A;  2GFH A;  4EBK A;  1Z7Q c;  4XEF A;  2DYS C;  1CPQ A;  3LNM B;  1WAT A;  1FFH A;  4O6M A;  2JX0 A;  3RQE A;  4C7O B;  3FHD A;  1APC A;  1WTY A;  1H7I A;  3Q7L A;  1ZYR F;  4JZA A;  1SZI A;  5L0H A;  5L0I A;  4DXW A;  5L3V A;  3EPV A;  2YL7 A;  3FXH A;  2W4M A;  1A41 A;  2I15 A;  1HE9 A;  3W8H A;  1SYQ A;  2EIN C;  5CI8 A;  3AGT A;  2QTV A;  4YT2 A;  5F5F A;  3POV A;  3DI5 A;  2VAS A;  4U5D E;  1LI5 A;  1MQV A;  1D0Y A;  2YKZ A;  3DJU B;  5KYX A;  2ZXO A;  4PAC A;  2VC9 A;  5B3I A;  1LS1 A;  3L34 A;  1GM5 A;  1JPN A;  1QZX A;  1F1M A;  2CDQ A;  4PJJ A;  3TOM A;  2UUI A;  1A7E A;  1WWP A;  1YZC A;  3GOD A;  1TWG A;  3NYM A;  1ZHZ A;  4U5B E;  2XLO A;  1H6G A;  4N6C A;  3S27 A;  4OIP F;  3BEH A;  4RBN A;  2C03 A;  2XL4 A;  1YZA A;  2CNW A;  3V5Z A;  4OIQ F;  3DAG A;  4YWQ A;  3M4B A;  3C8Z A;  1OCZ C;  2P7V A;  4NQF A;  4HEA J;  3AOU A;  1E83 A;  2QUP A;  3DE9 A;  2KK1 A;  2VCC A;  3B29 A;  4E17 A;  3U3F A;  4FES A;  5L0C A;  2D4U A;  1ZW3 A;  5KYY B;  3LUT B;  2XLV A;  4MVQ A;  3ZVR A;  4CS9 C;  1L7C A;  4LER A;  3NMJ A;  1CGM E;  1MNE A;  2YEV A;  2R7R A;  3G4X A;  1OKK D;  2Q9B A;  3QVY A;  2YVK A;  5D92 A;  4AL0 A;  5A6A A;  3JSZ A;  4XLP F;  2G3K A;  4U5G A;  4AE4 A;  1QVX A;  1R4T A;  2HKV A;  3JYY A;  2VB6 A;  4LLC A;  4F4B A;  1NSG B;  3FDQ A;  3V5Y A;  1XWJ A;  2IXN A;  3E70 C;  1TFK B;  3SYN A;  3AQC A;  4JTC B;  4JCH A;  3ABM C;  3EH1 A;  2NUT A;  3N2Z B;  5E2Q A;  1QPU A;  2XS8 A;  3KYI A;  1VYK A;  1FMV A;  2XLH A;  2YLG A;  1I5N A;  4Z9J A;  5IY5 C;  5KYW A;  1OCR C;  1WGW A;  1YDI A;  3N24 A;  2R7Q A;  3ABL C;  5COF A;  4A4A A;  2YQY A;  1HW2 A;  1C03 A;  3NKE A;  5KYN A;  2ICW G;  5JSL A;  4GEH A;  3OWT A;  1RKE B;  1L3P A;  2XM0 A;  3DD7 A;  3KKB A;  1Z3I X;  1J8Y F;  3MX3 A;  4IAQ A;  3B0V C;  3LLI A;  1C02 A;  3F46 A;  3BRJ A;  4JTD B;  3CQZ A;  3N0T A;  4PR9 A;  4ER9 A;  2MYS A;  2B0J A;  1S7Z A;  2J7P A;  4BJT A;  4Q5S F;  3L8J A;  1LE2 A;  3C62 A;  3QVZ A;  4U5F E;  5B1A C;  2YL1 A;  1PV3 A;  3H2U A;  4JC7 A;  2LIG A;  3S90 A;  4JEA A;  4JRZ A;  3VRC A;  3CSK A;  3VM6 A;  4BJ5 C;  2W45 A;  2A6H F;  3JRM O;  4MVO A;  3NKD A;  1ZVZ A;  1VK5 A;  1DOV A;  3LS1 A;  2PBE A;  3K7D A;  1M57 C;  3O55 A;  1D1B A;  1ORJ A;  4I3M A;  5F28 E;  2AU5 A;  2Y3D A;  3EG9 A;  3GOR A;  2Q3T A;  1AUE A;  1YA7 O;  2R03 A;  1YYX A;  2XL8 A;  4E7S A;  3J06 A;  3LES A;  4JE9 A;  2BC5 A;  5JP7 A;  2WVO A;  4MTO A;  5FCL A;  1VOM A;  3ZQV A;  1TWA A;  1Z23 A;  3L1M A;  2EPK X;  3IQ6 A;  4MW8 A;  4CDV A;  3M79 A;  1MMD A;  3ZDL A;  3Q7G A;  2XLE A;  3ZQY A;  1KNY A;  4MVR A;  2Q4F A;  1JR8 A;  2QLA A;  4E0H A;  3HNK A;  5KYU B;  3AG1 C;  1A7D A;  5E33 A;  5AGF A;  3AQB A;  2W9Y A;  4IGG A;  4QI0 A;  2L6G A;  1D1A A;  2KNH A;  3O6X A;  3DM9 B;  3S84 A;  4U5E E;  3RVZ A;  3M15 A;  5D91 A;  2QY9 A;  3EQL F;  2LFD A;  3TQO A;  3IPM O;  3DAF A;  3MFN A;  4IAO A;  1BBH A;  1K40 A;  2RSE B;  3B71 A;  2A68 F;  1T6Q A;  3GM2 A;  4JKV A;  3TJ5 A;  2R7S A;  5JUA A;  4NY3 A;  4W8K A;  5E3A A;  1EQ1 A;  2P6V A;  2PX0 A;  4HFK B;  4M63 A;  1YAR O;  5JT4 A;  4MVZ A;  2J46 A;  3EH2 A;  2C04 A;  4RDA A;  2FAP B;  2TMV P;  2CNW D;  4XPW A;  2HS5 A;  3EZI A;  4NCQ A;  2WB7 A;  4NTA A;  3U2M A;  2R9R B;  3RQG A;  3UR3 C;  5BUO A;  1T01 A;  1E2X A;  3GEI A;  3VAY A;  1YJG A;  2QNL A;  1OKK A;  3I5Q A;  2XRH A;  3FMS A;  4EHP A;  2HJM A;  3AG2 C;  5CIV A;  1E86 A;  4MVS A;  1V74 B;  3EFO A;  2NUP A;  4FWV A;  5T1D B;  3JCU Q;  3IQC A;  2J7P D;  3V7O A;  4LLE A;  3JTL O;  4C3D A;  4O79 A;  3SXY A;  4D4X A;  1Q0M A;  1TWC A;  3HNJ A;  4XEK A;  3RKO F;  4DBR A;  1QSP A;  1QKR A;  1QQ3 A;  2UUH A;  2NUT B;  2HMZ A;  3L8I A;  3NMK A;  3NRH A;  4QDL A;  4WGZ A;  3WOD F;  4CBE A;  4OIN F;  1Q0D A;  4NTB A;  5DQT A;  1EA8 A;  1LE4 A;  3ASO C;  1A7V A;  5DS4 A;  4WGY A;  1VLS A;  3LLK A;  1ORY A;  3U2L A;  5KYU A;  2H7O A;  4C3B A;  4YJW A;  1VYI A;  2NSF A;  3W4Y A;  1PD1 A;  3GAN A;  3NMI A;  4RD9 A;  5COG A;  3NG1 A;  2R7U A;  4U5H A;  2H8A A;  2J9V A;  3KL4 A;  1JMW A;  4YK5 A;  3CZ6 A;  4FX5 A;  1NU7 D;  3MYF A;  2QE9 A;  4KNV A;  3GWL A;  5TJ5 E;  2X51 A;  1D0Z A;  2ASR A;  3C8G B;  3WG7 C;  3V5X A;  1MMG A;  3KPH A;  1E85 A;  3NYJ A;  1D1C A;  1QLE C;  2IXM A;  3I5P A;  2Q00 A;  4XLN F;  2LQG A;  2A0U A;  2MWQ A;  1RJ9 A;  2YZS A;  4YT4 A;  1M2O A;  2IOQ A;  3HNI A;  2R7X A;  4HE8 D;  3ZTZ A;  1T6I A;  1G4W R;  2NPU A;  4E7Z A;  2DGJ A;  3U3B A;  1AVO B;  2LFF A;  2KW3 C;  2I8B A;  5E3C A;  1U89 A;  2CGE A;  2XLD A;  4PJN A;  4JUR I;  3DKA A;  2OEV A;  5EHH A;  2GWW A;  1E84 A;  1SF8 A;  5A6B A;  3U0C A;  2XM4 A;  2WL8 A;  2J8W A;  3EHM A;  4U9E A;  3B0P A;  4CS8 C;  3DE8 A;  2XLW A;  3W8I A;  1S05 A;  1TFO B;  4BJ6 A;  4JCZ A;  1UG7 A;  4X0R A;  2R7T A;  3W2V A;  3C8G A;  4XQ1 A;  1NG1 A;  5F5H A;  2XXA B;  2GAQ A;  2L9J A;  4G7O F;  4YL3 A;  4MVM A;  1LPE A;  4BJ1 A;  1RMV A;  1LKX A;  2KJG A;  3A11 A;  5A6K A;  2M64 A;  1FFT C;  2IYL D;  5HSW A;  5T3T A;  2ZD9 A;  4XTK A;  1N1C A;  2J45 A;  2GA0 A;  1BR1 A;  4WAB A;  3ASN C;  4W8P A;  4YT8 A;  1WAS A;  2A69 F;  2IXP A;  2V26 A;  3EJN A;  2Y3H A;  1OW8 A;  2DI3 A;  3F47 A;  3M1C B;  3PMR A;  2J9U A;  3ZG1 A;  1Z5Z A;  5KYX B;  1SMY F;  4MTF A;  4O7G A;  2RD9 A;  3T9O A;  2YHS A;  3PCV A;  3U5S A;  1YLM A;  4I1M A;  1Q0G A;  3DM5 A;  2OU6 A;  2A0B A;  3KH2 A;  3KMI A;  3SP1 A;  3H2V A;  3Q6N A;  4ANJ A;  3QMK A;  4H54 A;  3AGU A;  1HE1 A;  4JVS A;  3ZTM A;  4CSA C;  1HMD A;  1ZHW A;  3U8P A;  2HV6 A;  3UNG C;  4IRU A;  5DS5 A;  3JSE O;  3G50 A;  2A1D D;  4MQ9 F;  3X1O A;  1JAF A;  2OJE D;  2R7W A;  2EIK C;  4KNW A;  2CW0 F;  2NUP B;  1MMN A;  2V3C C;  1T9K A;  4AK9 A;  4K7B A;  4Q4Z F;  5GPG B;  4CDA A;  1SR2 A;  2KYH A;  5JS5 A;  3OEO A;  3EHN A;  3HJC A;  4K0D A;  3SXM A;  1ZW2 A;  3FOP A;  1RKC A;  1ZU4 A;  2M4E A;  2WZG A;  2FFH A;  3K1I C;  2X0C A;  3B9Q A;  4PJL A;  3RIP A;  3O39 A;  3RFY A;  3T4R A;  1ZHX A;  3U9M A;  2WZL A;  4P6I C;  1JPJ A;  4MS2 A;  1OR3 A;  1O5H A;  4Q7C A;  3T6G B;  4BJ6 C;  3PDM P;  5AC4 A;  4C7O A;  5FZT A;  5AC5 A;  2EPN A;  3JRT A;  2ZPA A;  4E0I A;  2OOC A;  4FAP B;  3GM1 A;  2NSG A;  4EBB A;  3LS0 A;  3C8G D;  1H9G A;  4KI2 A;  1TQG A;  2J0W A;  2J9B A;  4JJF A;  4YN0 B;  1CPR A;  1I4Y A;  4XEV A;  3B0U X;  2G3V A;  4HFF B;  3SNH A;  1Z63 A;  4EBJ A;  2KC3 A;  1MND A;  4G7H F;  3HNL A;  2NG1 A;  1Z6A A;  256B A;  3EGX B;  4BPM A;  2W4B A;  1CGO A;  4ZLD A;  1M2V A;  2HZ8 A;  3SXZ A;  4J7T A;  2YRF A;  1Q0F A;  3UMI A;  2PNO A;  2H7V C;  2Z15 A;  1H9T A;  3EGD A;  1LI7 A;  4U5C E;  2JD3 A;  1ZZP A;  4DRJ B;  4EWC A;  3M4C A;  1LIH A;  4YT5 A;  1R5I D;  3LEO A;  4WJ0 A;  4MW3 A;  5COM A;  2Y3G A;  2EIM C;  3EG9 B;  3I4U A;  1JOG A;  2EPO A;  4CS7 A;  1RKE A;  1W2W A;  1IW7 F;  1O87 A;  4CIH A;  4CX9 A;  3W2W A;  3OA1 A;  3HKK A;  4OD5 A;  2VCB A;  1VMA A;  1Y4C A;  4N06 A;  4OD4 A;  5EGY A;  3NDB B;  2P61 A;  3QW0 A;  1DOW A;  4K1O A;  4IJJ A;  4DJ9 A;  1PD0 A;  1OXB A;  2PF4 E;  1U0B B;  4PFO A;  2G62 A;  3JYH A;  4A2N B;  4P9F A;  3QZC A;  2L7A A;  2MHR A;  3SZR A;  3IEE A;  3T6B A;  2HSQ A;  3S29 A;  1GGQ A;  2VH3 A;  3WAQ A;  3FAJ A;  2F22 A;  1HMO A;  2WZF A;  3QW1 A;  2B0H A;  3TUL A;  1ORS C;  1G8X A;  3HTK C;  4L6R A;  4P9T A;  3FAP B;  5CI9 A;  4Z9I A;  1CGN A;  2CCY A;  2PP4 A;  4H4K C;  4ONS A;  4ULW A;  3UMH A;  3UGP A;  2BE5 F;  2IXO A;  2J0X A;  4KC9 A;  1RXQ A;  1MMA A;  1YA9 A;  2JPU A;  3TOL A;  1FTS A;  3ZIB A;  1FMW A;  1I4Z A;  1K04 A;  2OJQ A;  2J9W A;  5BQH A;  5DVW A;  1OQC A;  4CSA A;  2AWY A;  4YL1 A;  2VCA A;  4D4N A;  5BQI A;  3RH3 A;  1O3U A;  2Y69 C;  3AG4 C;  1G5Z A;  3GM3 A;  2R7V A;  4N4W A;  4CS8 A;  4PFP A;  2R25 A;  4E18 A;  1VTM P;  4LDK A;  4OIO F;  4GQH A;  1VB5 A;  2OEX A;  4XWJ A;  1OXK A;  3HLZ A;  1ZHT A;  5DQZ A;  1FAP B;  1XZP A;  3MBG A;  2Y39 A;  2AP3 A;  3X2Q C;  4DVY P;  1FR0 A;  3RQF A;  1ZU5 A;  5DS6 A;  2IBF A;  3LNR A;  5EK0 A;  2HV7 A;  1NBB A;  3FOO A;  4JIO A;  4JW1 A;  5JLI A;  1C17 M;  3UGO A;  4J32 B;  4G78 A;  4MTG A;  5L0G A;  1GS9 A;  4YL0 A;  3TD7 A;  3ZC4 A;  3IQ5 A;  1BZ4 A;  1RCP A;  1NU9 C;  4B6I A;  4EUK B;  2HSB A;  3H65 A;  1EI7 A;  2LK4 A;  2R7O A;  2FGY A;  1OW7 A;  4CDY A;  3O10 A;  4DBQ A;  2ZXR A;  3CAX A;  3DWW A;  3TK0 A;  2KQ9 A;  1UFB A;  3UMK A;  4AL1 A;  1BR2 A;  4J30 B;  4U9D A;  1V4A A;  2Q9C A;  3EGX A;  4JTA B;  4DOZ A;  1LVK A;  2KSF A;  2OQM A;  4ZLC A;  5L0F A;  3S0X A;  3DZA A;  4EIY A;  1M2V B;  1J8M F;  3C7J A;  3CEX A;  5DLJ A;  3DJN B;  1IZM A;  3DMD A;  4BEM J;  5KYY A;  5KYW B;  2ETS A;  3GEH A;  3DXJ F;  3R2P A;  1YAU O;  1TWH A;  3Q6M A;  4PK4 A;  4OIR F;  3K6B A;  5HV9 A;  1BR4 A;  3KYJ A;  3L0I A;  5B1B C;  2Q9A A;  5T3W A;  4UDV A;  2P0N A;  1YVI A;  2L6F A;  3ZWI A;  2WVQ A;  4AE4 B;  2ZXW C;  4Z9H A;  4PJM A;  4ULV A;  5L0J A;  3ECS A;  1HW1 A;  1ZHY A;  4BEJ A;  4R32 A;  1Q0K A;  3LEV A;  2EPL X;  3C18 A;  4IAR A;  4JEB A;  2A6E F;  1OCO C;  1V55 C;  2Q7R A;  2DB4 A;  3FVY A;  4IWB A;  3EZH A;  2XSE A;  5BQG A;  1FNT c;  3S9O A;  4QI2 A;  4MND A;  1OCC C;  4DRH B;  1VLT A;  1NFN A;  1PCX A;  2R05 A;  2LCH A;  1JRA A;  3JZ0 A;  3T6J A;  5JVE A;  4IB4 A;  1HY5 A;  1M6T A;  5A6J A;  5B3S C;  3QTH A;  1G4U S;  2KGO A;  3VYW A;  3GWN A;  1RJ9 B;  3RW0 A;  3K1I A;  1U6H A;  1OW6 A;  1NFO A;  2OKU A;  4EKW A;  5A6B D;  3ZSU A;  3ATP A;  2O9X A;  3LJB A;  4AX2 A;  3RYL A;  4O6N A;  2PX3 A;  1EKY A;  2YL3 A;  2WVN A;  1YYJ A;  1WN0 A;  3IQT A;  1OR2 A;  2E87 A;  4XPY A;  2LP4 A;  2LD6 A;  2YWA A;  3E9V A;  4C3E A;  2DYR C;  3EFO B;  2AVK A;  4MVU A;  1B68 A;  2H7B A;  3ITF A;  3K33 A;  4BJ5 A;  2XXA A;  1T6U A;  4BG0 A;  2HJ3 A;  4CJO A;  2HMQ A;  2PFD A;  2AWC A;  1AEP A;  5JRA A;  1LS4 A;  4LAC B;  2XS1 A;  3MYI A;  4CIP A;  3RF3 A;  4LDR A;  1A0B A;  4N6H A;  2HFI A;  3EGD B;  3R7C A;  4CS9 A;  1T5O A;  1NZE A;  2CYD A;  2YLD A;  3G4Z A;  3SXK A;  4JJG A;  3RVY A;  3SEO A;  4CJG A;  2BL2 A;  4NTF A;  2YL0 A;  1NLX A;  3VF0 A;  3AJM A;  2IM8 A;  1Y6D A;  4G0H A;  3K1H A;  1D0X A;  4GYT A;  3AG3 C;  2GDC A;  2XL6 A;  5L0D A;  2YLI A;  4J7Y A;  3PHF 2;  3WHN A;  3C63 A;  3A9C A;  3LAY A;  3S28 A;  2EPM X;  1WOL A;  4DRI B;  2EIL C;  5K0I A;  4I44 A;  2D5R B;  4KBL A;  3U8V A;  3US6 A;  2L81 A;  1KU2 A;  3K66 A;  3NYL A;  2EIJ C;  1TR2 A;  1M56 C;  2OG2 A;  3ABK C;  2L6H A;  1V54 C;  4G7Z F;  4I1O B;  2ZXP A;  2OCC C;  1LM3 B;  3JT1 A;  1XZQ A;  4LDQ A;  4O6Y A;  5L3Q A;  2XLM A;  4XPX A;  5A69 A;  1TKN A;  1GQA A;  2HUJ A; 
#chains in the Genus database with same CATH homology
 4DVZ A;  2Y3B A;  1ST6 A;  3MLG A;  2LSE A;  2GFH A;  2DYS C;  1FFH A;  4O6M A;  4C7O B;  3FHD A;  3Q7L A;  1ZYR F;  4JZA A;  1SZI A;  5L3V A;  3EPV A;  2W4M A;  3W8H A;  2EIN C;  5CI8 A;  2QTV A;  4YT2 A;  5F5F A;  3POV A;  2VAS A;  4U5D E;  5KYX A;  1D0Y A;  3DJU B;  2ZXO A;  1LS1 A;  3L34 A;  1JPN A;  1QZX A;  2CDQ A;  4PJJ A;  3GOD A;  1TWG A;  3NYM A;  1ZHZ A;  4U5B E;  3S27 A;  4RBN A;  2C03 A;  2XL4 A;  4OIQ F;  2CNW A;  3DAG A;  4YWQ A;  1OCZ C;  2P7V A;  4HEA J;  4FES A;  5KYY B;  3ZVR A;  4CS9 C;  4LER A;  1MNE A;  2YEV A;  2R7R A;  1OKK D;  2Q9B A;  5D92 A;  3JSZ A;  4XLP F;  2G3K A;  4U5G A;  4AE4 A;  4LLC A;  2VB6 A;  3FDQ A;  2IXN A;  3E70 C;  3SYN A;  3AQC A;  4JCH A;  3ABM C;  3EH1 A;  2NUT A;  3N2Z B;  5E2Q A;  1VYK A;  1FMV A;  5IY5 C;  5KYW A;  1OCR C;  1WGW A;  3N24 A;  2R7Q A;  3ABL C;  3NKE A;  5KYN A;  4GEH A;  3OWT A;  3DD7 A;  3KKB A;  1Z3I X;  1J8Y F;  3MX3 A;  3B0V C;  3LLI A;  3F46 A;  3CQZ A;  3N0T A;  2MYS A;  2B0J A;  1S7Z A;  2J7P A;  4BJT A;  4Q5S F;  4U5F E;  5B1A C;  3CSK A;  4BJ5 C;  2W45 A;  2A6H F;  3NKD A;  1VK5 A;  3LS1 A;  3K7D A;  1M57 C;  1D1B A;  4I3M A;  3EG9 A;  2Y3D A;  4E7S A;  2Q3T A;  3LES A;  2WVO A;  5FCL A;  1VOM A;  1TWA A;  1Z23 A;  1MMD A;  3Q7G A;  5KYU B;  3AG1 C;  5E33 A;  3AQB A;  2W9Y A;  4QI0 A;  1D1A A;  2KNH A;  3O6X A;  3DM9 B;  4U5E E;  5D91 A;  2QY9 A;  3EQL F;  3DAF A;  4IAO A;  2A68 F;  2R7S A;  4NY3 A;  4W8K A;  5E3A A;  2P6V A;  2PX0 A;  4HFK B;  4M63 A;  2J46 A;  3EH2 A;  2C04 A;  4RDA A;  2CNW D;  3EZI A;  2WB7 A;  3UR3 C;  5BUO A;  3VAY A;  1OKK A;  3I5Q A;  2XRH A;  3AG2 C;  4OIP F;  3EFO A;  4FWV A;  2NUP A;  5T1D B;  3JCU Q;  3V7O A;  2J7P D;  4LLE A;  4C3D A;  4O79 A;  4DBR A;  1TWC A;  3RKO F;  4QDL A;  3NRH A;  2NUT B;  3WOD F;  4CBE A;  4OIN F;  5DQT A;  3ASO C;  5DS4 A;  3LLK A;  4C3B A;  5KYU A;  2H7O A;  4YJW A;  1VYI A;  1PD1 A;  3GAN A;  4RD9 A;  3NG1 A;  2R7U A;  4U5H A;  2J9V A;  3KL4 A;  3CZ6 A;  4FX5 A;  1NU7 D;  4KNV A;  3WG7 C;  2X51 A;  1D0Z A;  1MMG A;  3NYJ A;  1D1C A;  1QLE C;  2IXM A;  3I5P A;  4XLN F;  2MWQ A;  2YZS A;  1RJ9 A;  4YT4 A;  1M2O A;  2IOQ A;  2R7X A;  4HE8 D;  4E7Z A;  2DGJ A;  2KW3 C;  2I8B A;  5E3C A;  2CGE A;  4PJN A;  4JUR I;  5EHH A;  1SF8 A;  2WL8 A;  3EHM A;  4CS8 C;  3B0P A;  3W8I A;  4BJ6 A;  4X0R A;  2R7T A;  3W2V A;  1NG1 A;  5F5H A;  2XXA B;  2L9J A;  4G7O F;  4BJ1 A;  1LKX A;  2KJG A;  1FFT C;  2IYL D;  5HSW A;  5T3T A;  4XTK A;  1N1C A;  2J45 A;  1BR1 A;  4YT8 A;  3ASN C;  2A69 F;  2IXP A;  2V26 A;  3EJN A;  2Y3H A;  3F47 A;  3PMR A;  3M1C B;  2J9U A;  3ZG1 A;  1Z5Z A;  5KYX B;  1SMY F;  4O7G A;  2YHS A;  4I1M A;  3DM5 A;  3KH2 A;  3KMI A;  3SP1 A;  3Q6N A;  4ANJ A;  3QMK A;  4JVS A;  4CSA C;  1ZHW A;  2HV6 A;  3UNG C;  4IRU A;  5DS5 A;  2A1D D;  4MQ9 F;  3X1O A;  2R7W A;  2EIK C;  4KNW A;  2CW0 F;  2NUP B;  1MMN A;  2V3C C;  4AK9 A;  4K7B A;  4Q4Z F;  3OEO A;  3EHN A;  3HJC A;  4K0D A;  1ZU4 A;  2M4E A;  2WZG A;  2FFH A;  3K1I C;  3RIP A;  3B9Q A;  4PJL A;  3O39 A;  3RFY A;  3T4R A;  1ZHX A;  2WZL A;  4P6I C;  1JPJ A;  4Q7C A;  1O5H A;  4C7O A;  3JRT A;  2ZPA A;  4EBB A;  3LS0 A;  4KI2 A;  2J0W A;  3B0U X;  4JJF A;  4YN0 B;  2G3V A;  4HFF B;  3SNH A;  1Z63 A;  1MND A;  4G7H F;  2NG1 A;  1Z6A A;  3EGX B;  2W4B A;  4ZLD A;  1M2V A;  3UMI A;  2H7V C;  2Z15 A;  3EGD A;  4U5C E;  2JD3 A;  4EWC A;  4YT5 A;  4WJ0 A;  2Y3G A;  2EIM C;  3EG9 B;  3I4U A;  4CS7 A;  1W2W A;  1IW7 F;  1O87 A;  4CIH A;  3W2W A;  3OA1 A;  4OD5 A;  1VMA A;  5EGY A;  4N06 A;  4OD4 A;  3NDB B;  4IJJ A;  1PD0 A;  2PF4 E;  4PFO A;  2G62 A;  3JYH A;  4A2N B;  3QZC A;  3SZR A;  3IEE A;  3T6B A;  3S29 A;  2VH3 A;  3FAJ A;  2WZF A;  1G8X A;  3HTK C;  5CI9 A;  4H4K C;  4ULW A;  2PP4 A;  3UGP A;  3UMH A;  2BE5 F;  2IXO A;  2J0X A;  4KC9 A;  1MMA A;  1FTS A;  3ZIB A;  1FMW A;  2J9W A;  5DVW A;  4CSA A;  3RH3 A;  2Y69 C;  3AG4 C;  2R7V A;  4CS8 A;  4PFP A;  4OIO F;  4XWJ A;  3HLZ A;  1ZHT A;  5DQZ A;  3X2Q C;  4DVY P;  2Y39 A;  1ZU5 A;  5DS6 A;  3LNR A;  2HV7 A;  4JW1 A;  3UGO A;  4J32 B;  3TD7 A;  3ZC4 A;  1NU9 C;  4B6I A;  3H65 A;  2R7O A;  2FGY A;  4DBQ A;  2ZXR A;  2KQ9 A;  3UMK A;  1BR2 A;  4J30 B;  2Q9C A;  3EGX A;  4DOZ A;  4ZLC A;  1LVK A;  3S0X A;  3DZA A;  1M2V B;  1J8M F;  5DLJ A;  5KYW B;  3DJN B;  1IZM A;  3DMD A;  5KYY A;  3DXJ F;  4PK4 A;  4OIR F;  3Q6M A;  1TWH A;  3K6B A;  1BR4 A;  3L0I A;  5B1B C;  2Q9A A;  5T3W A;  4AE4 B;  2WVQ A;  2ZXW C;  4PJM A;  3ECS A;  4BEJ A;  1ZHY A;  3LEV A;  2A6E F;  1OCO C;  1V55 C;  3FVY A;  4IWB A;  3EZH A;  2XSE A;  4QI2 A;  4MND A;  1OCC C;  1PCX A;  3T6J A;  5B3S C;  2KGO A;  3VYW A;  1RJ9 B;  3ZSU A;  2O9X A;  3LJB A;  4AX2 A;  3RYL A;  4O6N A;  2PX3 A;  2WVN A;  2E87 A;  3E9V A;  4C3E A;  4F4B A;  2DYR C;  3EFO B;  2H7B A;  3ITF A;  3K33 A;  4BJ5 A;  2XXA A;  4BG0 A;  2PFD A;  4LAC B;  3EGD B;  4CS9 A;  1NZE A;  4JJG A;  3SEO A;  4G0H A;  3K1H A;  1D0X A;  4GYT A;  3AG3 C;  3PHF 2;  3S28 A;  3LAY A;  2EIL C;  4I44 A;  2D5R B;  4KBL A;  2L81 A;  1KU2 A;  3NYL A;  3K66 A;  2EIJ C;  1TR2 A;  1M56 C;  2OG2 A;  3ABK C;  1V54 C;  4G7Z F;  4I1O B;  2ZXP A;  2OCC C;  3JT1 A;  4O6Y A;  5L3Q A;  1TKN A;  4BJ6 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...