1J8MF

Signal recognition particle conserved gtpase domain from a. ambivalens
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
295
structure length
295
Chain Sequence
LLDNLRDTVRKFLTGSSSYDKAVEDFIKELQKSLISADVNVKLVFSLTNKIKERLKNEKPPTYIERREWFIKIVYDELSNLFGGDKEPKVIPDKIPYVIMLVGVQGTGKTTTAGKLAYFYKKKGFKVGLVGADVYRPAALEQLQQLGQQIGVPVYGEPGEKDVVGIAKRGVEKFLSEKMEIIIVDTAGRHGYGEEAALLEEMKNIYEAIKPDEVTLVIDASIGQKAYDLASKFNQASKIGTIIITKMDGTAKGGGALSAVAATGATIKFIGTGEKIDELEVFNPRRFVARLHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SIGNAL RECOGNITION 54 KDA PROTEIN
publication title The crystal structure of the conserved GTPase of SRP54 from the archaeon Acidianus ambivalens and its comparison with related structures suggests a model for the SRP-SRP receptor complex.
pubmed doi rcsb
source organism Acidianus ambivalens
molecule tags Signaling protein
total genus 100
structure length 295
sequence length 295
ec nomenclature
pdb deposition date 2001-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF02881 SRP54_N SRP54-type protein, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 1j8mF01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1j8mF02
3L43A 3OIWA 4NYMQ 1D2EA 3RYTC 5C4MA 4QJ5A 4X8OA 1G3QA 1S9DA 1K5GA 2G6BA 1GNPA 1XXHA 5LDDC 4XSHA 1VDZA 3V00A 1PUIA 3QKRA 1Z08A 1B23P 4JLVA 4TN1A 3GLGB 1JAIA 1PUJA 2I3BA 3K53A 4NYJQ 4NYIR 2OBLA 1NJFA 3CNNA 5FPTA 2JLYA 4G1UC 2BOVA 1N6IA 3O47A 3GEHA 4TTQA 3L8YA 1XD2B 3ZGXA 1CEEA 3A36A 3PUVA 3EIEA 1N6KA 4PO8A 4DLUA 4ZCLA 1XDBA 1NBMA 1RIFA 1OFHA 3BJIC 3CONA 3AEZA 2R6AA 3EC1A 2Y8EA 1N5JA 4L9SA 1NSFA 1ESMA 2ZSEA 1KHTA 3OEHA 1TAGA 2RMKA 3O8BA 5H1YA 2JGNA 3LO5A 2GILA 5TB5A 3OHMA 5KDDA 2C98A 1II8A 3KJHA 4LBWA 4O3MA 2WBLC 1F5NA 1VG9B 2VIIA 4V0OA 1IAQA 3FPAA 2ZRHA 4OHZA 3H0KA 3KXKA 1W49A 4OHXA 4BFZA 4K81B 4NBSA 2P67A 2O8FA 2I1VB 2N46A 2GVDC 4KLZA 5JSZA 1XD8A 1S3GA 3CRRA 4RD2A 5KUTA 1G18A 1QRAA 3AF4A 1KDTA 1US8B 2EU8A 3R9XA 1DPFA 3KJGA 2CK3D 1TMKA 2CJWA 4NYJR 2AFHE 2AD5A 1NMZA 4EJSA 3I5YA 4Q9HA 2CVHA 1WBDA 1KKMA 1KNXA 2IT1A 3A1SA 1YZKA 5TDHA 1S0UA 4A4DA 1AKEA 2OBMA 4GOXA 3TSWA 3EAQA 3X1YA 1N3BA 4BGDA 1IXRC 4WIAA 5FBLB 3F3YA 1VHLA 1GTVA 2QRNA 3L0SA 4KITB 4JJZA 1EGAA 2O5VA 4HB0A 1V5WA 3TUIC 2QAGA 3NC0C 3WMFA 4LJ4A 3NBFA 2GXQA 3NWJA 3VU9A 1F2TA 3QXHA 4CIDA 1CRPA 4TL9A 2P6UA 2Q0HA 1SXJD 2IYQA 4LX0A 1EK0A 4QHTA 1T3HA 2C9OA 4JL5A 1F60A 2XAUA 3W34A 4B3CA 5E7IA 1FX0A 4C4PA 4OI2A 3ZQ6A 3T61A 1RFLA 2XTNA 3SFVA 2XXAA 2W2XA 3ONWA 4AG5A 1Z83A 5EXSA 2EFDB 2JLXA 1UDXA 4A6PA 4LHVA 4DUGA 3P4XA 5DI9A 1E2MA 2CDNA 2O8BB 4F91B 1X1RA 3U7GA 1W46A 2KBEA 2VQSA 3BOSA 4Q1DA 2VP9A 3VX3A 4PPFA 3LXXA 3VR5A 2WIBA 3A4NA 2DPXA 2AXNA 1LNZA 1QHYA 3FE2A 4MH0R 2QAGC 2FV8A 1Q3HA 1J90A 3MWJA 1ZD9A 1GSIA 4Q5IA 4V02A 4C2TA 4B75A 1JXOA 2QTFA 3RS0A 1EX6A 2ATVA 1TQ4A 4ABYA 3THXB 3QQ5A 4PFSA 3FB4A 1RRCA 3RABA 4QM6A 1Z3IX 4BLOA 4PC6A 1KZGB 2HUPA 5D3MB 4A8JA 5ANRB 2OFOA 4N0EA 2J5XA 4DLVA 3U7FB 2OBNA 3A4LA 4WOPA 4HDOB 4B32A 4JVMA 1GWNA 3HJNA 3L0IB 2C03A 1D2MA 3RLFA 3G5UA 1X3SA 3PITA 2NMVA 1PLKA 1JNYA 3QF4A 4YQFA 3GJ6A 4YMUA 5E95A 2F9LA 1ZJ6A 2QL6A 4F4CA 2WTUA 4G5OA 4MKIA 1Z22A 1BMFA 1OIXA 2ZE8A 1W47A 3V4RA 4OKSA 2ZU6A 3U6BA 1W4RA 1XPRA 4D26A 1YHNA 3B82A 4QBGB 2VP4A 1D9ZA 3ADKA 3W6OA 1GL6A 4LYJA 3CBQA 1DTSA 1EG7A 2DCUA 4Y0AA 4CEIA 3V9PA 2GJKA 4LUCA 1DAFA 4QL3A 2XJ4A 5G41A 3DMDA 4RZUA 4PAQA 2V6JA 4US2R 3S1AA 3LVRE 1CJKC 2ZRIA 1E2NA 1P9NA 4A8JC 2VP2A 2WPDA 3C5CA 4A0FA 2ZRMA 2OM2A 2WMOB 1G19A 3KUCA 4KODA 4PANA 1SVSA 3DOEA 4C0JA 5KNCA 5JEEA 2AWNA 3RRMA 1TQ2A 1ZM3A 3EARA 1IONA 1VG0B 4XOIA 3ZZUA 1YRBA 5ELXA 2Q3HA 3BS4A 5FOWA 1E99A 4B35A 2JLSA 2WAXA 4BECA 3QE0A 3U60B 2FSFA 3K0AB 5C2JB 4QNRA 1KO4A 4R2IA 4W7SA 4R71A 4IVPA 5FH9A 2CHVA 1OHHA 3KTAA 3QKSA 1OH5A 3PFIA 3GFOA 4V0MA 3NH6A 4KXFB 1KZ7B 2FPKA 4JMPA 4LDJA 4WXRA 3ZS9A 4URVR 3JZMA 3X1XA 4PZZA 2IYSA 3CF2A 3AVTA 1EWRA 1NIPA 3GLIE 3IGFA 2KBFA 3E2IA 3IQXA 4GMXA 4NDZA 5G53C 4YMTA 2XZLA 2O8DB 1G3MA 4AK9A 3A1VA 5HPYB 3PR1A 4F93B 1R2QA 1W4AA 3BERA 1CR0A 3T5GA 4QFMA 2QSYA 4XVQA 3AGQA 1OLOA 4W5JA 1AZSC 3CX6A 1Z29A 2ORVA 4MRPA 4ERNA 6Q21A 5JJLA 2OESA 3T35A 1H8HD 3I73A 4FD2A 3QPVA 1XFAA 2D4HA 3AV0B 4TLDA 3Q9LA 4WZ6A 1FPMA 3CIOA 3P32A 3NBXX 4A36A 2O8EB 2IYWA 8OHMA 3JVVA 2OCYC 1W0KA 4QGGA 4FMBB 5C1BA 4P0TA 2ZJBA 4LJAA 1BS1A 2P5TB 2EWWA 4DCVA 3R7WB 2VO1A 3EG5A 3PEWA 5KDLA 2BEKA 2GWHA 2ZRAA 1DAIA 4JLJA 4M1WA 4JBYA 4R7ZA 3MG9A 4Q9IA 3DM9B 5KU1A 1IOZA 2B7BA 2O0JA 4LHXA 3TSZA 2QGZA 1E9AA 4GDFA 4PR0A 3ASYA 1FQJA 1HEIA 1X1SA 4D6PA 2BBWA 4DDUA 1IN6A 4Q9LA 3RWMB 5H70A 3IBGA 2OZEA 3SFZA 1E69A 3W3ZB 2B21A 2W58A 4S2EA 1VCIA 1DAEA 1OXXK 3TGPA 4IOJA 3W5JA 1R0YA 1XF9A 2LKDA 4JLAA 4ITRC 1GKIA 4PHTA 4TQAA 5FUWA 5GVRA 3QUSA 3N5CA 1UFQA 4G5QA 4IKEA 4MGIR 3ZZTA 4C0AC 2F1IA 4RD3A 1A2BA 4TYNA 1L4YA 3IIMA 2I1QA 1N6RA 2AKYA 1KDPA 2PT5A 4JLBA 2PJZA 2FWRA 2ZQ5A 4Q02A 3TMKA 3ICEA 4CEJA 1A4RA 3EW9A 3OIUA 2ODEA 1T91A 3AM1A 4QRHA 3SQXA 2NO1A 1XTSA 5DHFA 3ZIAD 2CEAA 2LWIA 4WVFA 1FMJA 4QGAA 3CF6R 1TEVA 2E1RA 2H18A 5AUNB 1E1RA 3NXSA 1TQ6A 4B6EA 1Z2AA 5JLJA 1YRAA 4OK5A 3ZVMA 5EXPA 1E2DA 4M9XA 4XWKA 3ETLA 1YR9A 1W4BA 4GI7A 2F55A 3G82C 4PHFA 4DLYA 1MT0A 3MGCA 1G3UA 2ONKA 2FDCA 3ND8A 4RD4A 2R6GA 2ZYWX 2A7QA 1DELA 1F2UB 5HE8A 3FKSA 5HTKA 1SVWA 3IILA 1ZNWA 4TMTA 1ZCAA 1VHTA 4LRWA 3D8BA 4ZDJA 4KO8A 4PC3A 1UPTA 2FPMA 2GXUA 1PJRA 3TBKA 2XSZD 2O8CB 2OFXA 1SKYE 3TUZC 2WJJA 1M34E 3P27A 3U44B 3PENA 3ZD7A 1MRSA 4BRWA 1KSJA 1JXMA 2JLZA 3MLEA 4M0LA 1D5CA 2F43A 4FI3C 3X1WA 4DT1B 4E22A 1OE0A 4OL0A 4Q1EA 5EUQB 1RC8A 1HQCA 4A0GA 2EFHB 2FPLA 4WBSA 1BYIA 1OW3B 4NL4H 5AUQA 2WV9A 5L3QA 5DLQC 1GRRA 4IFBA 5DI3A 1OJLA 3DL0A 2Z5FA 3TJZA 5FBRB 5LD2C 1UAAA 2PMDA 1AS2A 3EA0A 4UJ5A 2PCLA 4C0SA 5FPYA 2VHTA 4R98A 2NZ8A 1K8RA 4TMVA 1KKLA 4HATA 1J8YF 2H1LA 2IK8A 4KBGA 2ZITA 4M53A 3SR0A 2C8VA 3T1TA 4M9QA 1IY2A 3B9QA 3BORA 1H8ED 2QT1A 1XTJA 2ZSBA 1T9HA 1OPXA 5JBQA 3DZDA 1RW4A 2YWEA 3OE7D 4KV9A 4TMKA 1Z6XA 3C4JA 1X8KA 1P3JA 5CM8B 1E4VA 1G8GA 3ECCA 4MA4A 2JLVA 2FFBA 2B7CA 2J0QA 2G83A 1LS1A 3CRW1 3EA5A 1HH4A 2QZ4A 3QKTA 3AP2A 1DG3A 1OXUA 2NO0A 2QBYA 4L5BA 3U3MA 3K9HA 4YXWD 5KSYA 2NOAA 2AFIE 4EIWA 5BN3A 1TNDA 1FTSA 3Q5EA 2OT3B 3PEVA 4TSFD 1XJQA 2JLQA 2JJ1A 1PV4A 1G8PA 3CR7A 4Q9JA 1X8JA 2ZRDA 2DFKB 1UEIA 1KI1A 3HR7A 4E03A 2WSSA 2Q9BA 5AWFC 5P21A 4F4IA 1HA3A 1WQ1R 3THWA 1NP6A 1SZPA 2VP6A 2JJ2D 4M21A 3T15A 2W0SA 2CL0X 5E4FA 1KOFA 1GIAA 1J7KA 1CR1A 4QJ4A 3LX5A 4GL2A 5BYKA 3WNBA 4IOKA 1ESNA 1U99A 4HAYA 2H92A 2ZUBA 3N2IA 3C41J 4NONA 2P6RA 1TF5A 2OG2A 1L7VC 4GMDA 4Z8XA 3CB4A 3TLXA 1G4AE 2IYUA 2E9SA 2ZE7A 3AVXA 1QHSA 2ZI9A 1XWIA 3K0AA 3U3JA 2PL3A 1KIMA 1YZNA 5AJXA 1TTTA 2Q9AA 3TQFA 3WRYC 3X1ZA 4ZDIA 2VYFA 2R6DA 2X77A 1M8PA 2NPFA 1L2TA 1P9RA 1FOEB 1HUQA 2QMEA 1DARA 4URUR 2V6IA 3ZVLA 1WA5A 3J81k 1NLZA 4G5SA 1SQ5A 2ASEA 1XPUA 1T5IA 2GDJA 2ZJZA 1UM8A 5CYOA 1OFUX 4BZQA 3RS3A 4DSOA 1SXJB 1VG1A 5EE1A 4HZUB 5A0FA 3KFVA 3TNFA 1CLUA 2EWVA 2VF8A 4M22A 4XWAA 3VKWA 3B1XA 3BIFA 2MSDB 4PPGA 1E9RA 4RKFA 3K9NA 3SNHA 4PO9A 1C1YA 1AJEA 2WMNB 3OFND 1Z06A 1II0A 3N2EA 4XSGA 5J47A 1HE8B 1BIFA 4O0MA 1F6BA 2DHRA 3BK7A 4Q4JA 2BHRA 5FBVB 2P3SA 3B1ZA 4EAQA 2CVFA 4AKHA 1O87A 3CUEF 4WW0A 4H1UA 4RZ2A 1D9XA 1CS4C 2BBOA 4BZXA 4DHEA 2HV8A 2PX3A 2W2TA 2EVWX 2XNSA 3CO5A 1Z0FA 4LWZA 4C9BA 4JVLA 1IJFA 3VR6A 3HWSA 4JLOA 2ZM5A 4PC1A 2MMCA 1E3MA 1XJ0A 2PEZA 3WP1B 1P73A 2WWIA 821PA 2QT0A 3SBEA 3GLHE 4AWXA 3FVQA 3MUFA 1AKYA 1T4GA 4B33A 4AYWA 2WWWA 4C0KA 2CE2X 5TVKA 1E96A 5CK5A 2F6RA 2RGDA 3T5DA 2FE4A 3B85A 2QQ0A 3A1WA 3LQQA 4N1AA 5JS7A 3EPKA 1ZNZA 2QP4A 1E6CA 3K0FA 3LFUA 4TTPA 4WA7A 4DSUA 1LS6A 3GJ8A 3OAAA 2PZFA 4XTRA 3RAPR 1U90A 3I92A 1NMXA 1RRFA 1XCGB 5JJIA 1J8MF 4Z1MD 3C7KA 4V0NA 1AN0A 2ZPTX 4RFVA 2YOHA 5JZVA 3GCGA 1C4OA 1RPZA 2V8OA 1E9EA 3EC2A 3WP0A 4TMWA 4DLXA 1KI2A 2GAOA 1Q57A 1DEKA 3BH7A 5CDFA 1ZINA 3M1IA 1G6OA 3QEOA 1T3SA 4KJZA 2A5JA 2WJYA 1E4YA 4NH0A 2WWFA 3AH8A 1WBBA 2P65A 2PLFA 1CP2A 2A5DA 4HYYA 3ADBA 1ANKA 2Q6TA 4CZ2A 2FZLA 4HUTA 2QM7A 4DDVA 4M9ZA 2IWRA 3GLIB 5K8LA 2W0MA 1ZM9A 2KE5A 4A15A 1YZUA 2GEDA 4G0NA 4Q48A 3R9IA 1X86B 1U8ZA 2PZEA 2JLUA 1N0WA 2HCBA 2OAQ1 5IK2D 2G1JA 3UANA 3U7EB 2H5EA 1R5OA 1Z2CA 4P4SB 2QNRA 4G5RA 1G21E 4C0QC 5HR5A 3WMEA 1SGWA 3C5HA 1IXSB 1ODFA 4C0LA 1UBGA 1DAKA 2ZRLA 4DLWA 4EPVA 4ZDKA 3W5IA 4AY2A 4W5WA 1RJ9B 2F3RA 1F3OA 3CZPA 3VTKA 1I2MA 2OLKA 3CWZA 5AJVB 4LC0A 3VFDA 1MABA 4I81A 4Q7MB 1CKEA 2UVQA 1Y63A 4Q4AA 5GJCA 2LKCA 3SS8A 4KVGA 2CXXA 4HUQA 3CKLA 3P4YA 3QXCA 4NCIA 3KQKA 1ZC4A 3X1DA 4AI6A 1RVDA 3MJRA 1E2IA 1G3IA 4Q1AA 1U2RA 2ZI6A 1WCV1 3H2YA 5FOTA 4P4TA 1OFTA 4DZZA 2FA9A 2X2EA 1E0KA 3NVAA 4LBZA 2EQBA 2ZVPX 2J59A 3DMNA 1AZTA 1W36C 1KO1A 2VA8A 1BOFA 3FDIA 1XEWY 2NO7A 5FL7A 4XJXA 3VNVA 2IBMA 2GVZC 5LBIA 2IUUA 2W6JA 4MYHA 2IS4A 2FEMA 2JAQA 4CRWB 1IN5A 2N42A 2GAAA 2ZYUX 3X2SA 4Q1BA 1YQTA 121PA 3LA6A 4JBWA 2JA1A 1E9FA 4CEHB 2DFLA 1A7JA 2ANBA 2RB4A 2ZS9A 4OI0A 5HCIA 2ZE6A 1NBMD 3H4MA 4AKEA 3FFBA 3GJXC 1HURA 3OEHD 4DIEA 5GVSA 3KQNA 3QNUA 1FZQA 2Z6VA 2JLWA 2XTZA 3EASA 3B78A 4QM7A 3PIRA 3RC8A 3GJ5A 4YDHB 2ODBA 3C15C 1XXHE 4HDCA 4UNRA 1G7TA 1CR2A 2V55B 1W7AA 2X2FA 5F98A 5EE5B 2YWFA 3WYGA 1UF9A 4IEEA 3Q8XB 1AS3A 4HLQB 3GD7A 4P4UA 5H8WA 2D7DA 2BMDA 3TE6A 5DYIA 1RRPA 1U0LA 3FHCB 4JKYA 4A0RA 1VMAA 3B13B 4UQOA 1FL9A 3GLFB 1EWQA 5FPKA 2BC9A 3DVLA 1NBME 3EWSA 4GRAA 4G5GA 4PSKA 2YKGA 2QTVB 4TLAA 2GEUA 1Z6TA 2FNAA 4MRRA 3VKHA 1N0UA 3AQ4A 1SKYB 3QVVA 2VP0A 1QVRA 1P2UA 1XD9A 4DCNA 4JT4A 721PA 5B30A 1UBCA 1LB1B 1LFDB 1XU4A 3MCAA 3NHAA 1GKYA 4S35A 1G8HA 2ZREA 1U8AA 4GP7A 4C7OB 4LJ9A 1VKJA 4Q21A 1T8UA 1R0XA 3QXJA 1ZMXA 3FKQA 2AL7A 3CPHA 1XEWX 5FFMA 2EFGA 4BE7B 1SHKA 2K5UA 2PZGA 3I32A 5DNYB 1E2LA 3KKMA 2QY9A 1G17A 1SXJA 2ODWA 2HT6A 1TQDA 1ZD1A 3SEAA 1U94A 2QP3A 3Q72A 4EJSC 1XBTA 4D4KA 1GP2A 5DYGA 2FZ4A 3RVBA 1P75A 2IA5A 2CBZA 4IFEA 2ZETA 2FH5B 4DUGD 1UDWA 3TK1A 4B44A 1HV8A 4JL8A 1IY1A 3NDBB 2ORWA 3U2QA 2C78A 2GJ8A 5K8UA 4O2RA 2NPIA 3BE4A 4TL8A 2R8RA 1CU1A 1IJEA 1E1QA 1KAGA 3RSLA 3TUJC 3QIAA 4XTCS 1FUUA 5EE3A 2WKQA 4NP6A 4X8HA 1XEXB 1X8LA 2WAYA 3KKOA 5KSOA 5CJPA 3NG1A 1JECA 3MAAC 4GZLA 4HZIA 1PLJA 1S4QA 2RGNA 3K70C 1G7CA 3AKYA 4Y0VA 1P4SA 2CHGA 5JHHB 1EFHA 4KFUA 1XMSA 2IS2A 1ZYUA 4TLCA 4M1YA 4PTLA 1NY5A 1RYHA 2BVNA 4JZKA 3VX4A 3IEUA 3GEEA 2EW1A 4O2LA 5KSZA 4PQYA 2ZTSA 3WHLA 1D2NA 2JEOA 4B2LA 4BZPA 4BLQA 3DDCA 4HB4A 5JMTA 4OK6A 1E0JA 1KI6A 2IF2A 2P5SA 3CPEA 3AKCA 1BMFD 1PVOA 1J99A 2R9VA 3AKEA 5IDVA 1KI4A 2ZSDA 3AF1A 3SJAA 2QGNA 2D3WA 4P33A 3BD9A 4DLRA 3EZ9A 1KSFX 4A9AA 4KFSA 4PX9A 2QTHA 1VECA 1FTNA 3TIFA 4URXR 4QBFA 4Q4HB 1LW7A 2QQEA 1XCPA 2F7SA 3KJEA 3MFYA 1J2JA 4II7A 4TLEA 5DN6D 5CYPA 2QRZA 1I4LD 4A82A 3C16C 4DDWA 3FHTA 4Z54A 5KTYA 1WE2A 3A8TA 1OB2A 5FOVA 4U7DA 5FBQB 1R8QA 1P61B 4MGZR 2A78A 4OQFA 2JASA 1FUKA 1N5IA 2XX3A 3IQWA 2IYLD 3KKPA 1AS0A 3DOFA 5C4GB 1VIAA 4DLZA 2GCOB 1GRNA 2BKUA 3IEVA 1IY0A 2BCJQ 1KTVA 2JIZD 4EPYA 4FMCF 4JYCA 2QN6A 4GPTA 4AKIA 4DB2A 2J7PA 2IYZA 3GFPA 3IO5A 4JYBA 4LY6A 1DBSA 3BB3A 4Q03A 1FMLA 4US1R 3UIEA 1DO0A 3B6EA 2X8AA 4AIIA 5KO2A 4LV6A 5JEDA 3SHWA 1DE0A 1ZIPA 2WM9B 3KUDA 1ZNYA 3LW7A 4D4MA 3BB4A 3CF0A 3O8RA 1N25A 3K09A 4LPKA 1RKBA 4MGYR 1KK0A 1XJCA 2IF0A 4IVQA 1EFTA 4NCNA 3K0CA 1JEDA 3P1JA 4D81A 1XEFA 4I4LA 5SZIA 4XD7A 4OJKA 2GF9A 1QHNA 4BUJA 3BH0A 1JR6A 3UPUA 4D4LA 3KFXA 1D8TA 1YZQA 2GCPA 4DVGA 4JSYA 1OB5A 2VBCA 4Q9KA 2RCNA 3QF7A 4TQ9A 1OH8A 1G1MA 2ODNA 4U5XA 4ZIRB 4UXHA 3K0SA 2WJGA 4NCKA 1FW6A 2KSQA 2V7QD 3BXZA 3OESA 3RNLA 5KNDA 3SN6A 3GLGA 1Z0JA 3OIYA 1DO2A 2D7CA 1JQJC 2J7KA 1W0KD 4KFTA 4V0ME 3GLHB 1ZC3A 2F1JA 3RS5A 3K8YA 1XD2A 3JZAA 2GK7A 2IWHA 3WRXC 1E2FA 3NTUA 2VSOA 1JBKA 2WWHA 2J0UB 4JLMA 1KO7A 3B9PA 4Z8YA 4CEHA 4OI1A 3K0CC 1ZBDA 3B1VA 3HDTA 1KK1A 2GEVA 1QHHB 3A1UA 4TYYA 4EKDA 1ZU4A 1CJUC 4EPTA 2IYVA 2AKAB 3IIJA 4JJKA 2QUZA 1W44A 4TL7A 3BFKA 4DDTA 4A92A 1VCMA 4LV5B 3QOFA 1E9DA 4RCZA 3R9WA 2YVUA 2A2ZA 5F2EA 2JJ8A 1VG8A 4URYR 2QROA 3K9LA 1ETUA 5HKKA 2NIPA 2P2LA 1O3YA 2ZI5A 5J4VA 2WJIA 3ZQJA 3A37A 3BGWA 4RFSB 2UZ3A 1US8A 4D2IA 4EFNA 1RE0A 4POAA 3GPLA 1D6JA 2Q21A 4N0DA 4PSVA 5FOUA 2QG6A 3N70A 2IS1A 3CW2A 1ZUNB 2IEZA 3AB3A 4QBHA 4FMDF 3GLFA 1HTWA 3WYAA 4X8LA 1COWA 2YC2C 3GJ7A 3D7MA 1QVAA 1E1RD 4NE2A 3UK6A 4ZPXA 1P72A 5JWRA 5HZHA 2QI9C 4OQNA 2OFWA 2ZJAA 4QJ3A 3E5HA 4IDNA 2NTYC 3C14C 5AUOB 3HYTA 1MV5A 1NNEA 4FMCB 2F9MA 3MMPA 2A5GA 2HLDA 2DYKA 4ESHA 3FKSD 4A1FA 1IN4A 2AN9A 3NDPA 2RGBA 4MKGA 4BFUA 1JJ7A 4MYUA 1JPNA 3HYRA 2ZR9A 2QP9X 4W5HA 5E7JA 3NEYA 5EP4A 1X6VA 1P2VA 4OYHA 4GZMA 1L4UA 1NRJB 1Z8FA 4EQ6B 4JVNA 2FGJA 2O0KA 2ZAMA 1NF3A 3U3OA 2Z83A 1R5NA 2O8BA 3DKVA 2HCJB 5FTJA 3PUWA 1C9KA 1S96A 2WWGA 3SBDA 4XWOA 2C95A 4MGKR 4OK3A 5F3WB 3U4QB 1GVNB 2Q9CA 1AGRA 4AYXA 5JRJA 2VSFA 4DIDA 4EPXA 1LTQA 1N6OA 1WMSA 2FSGA 3LBNA 3SYLA 1XPOA 4BRUA 3THXA 2C96A 2TMKA 4RCYA 3LBHA 2ZI3A 2OHFA 4LHYA 3SHFA 2RAPA 1NL3A 3TAUA 2ORIA 5D3MA 3FMOB 4BEBA 1NN0A 3PUYA 3TRFA 4GT1A 1ZVQA 5B64A 2WWYA 3E1SA 2FU5C 4Q18A 3V4FA 1OYYA 2QM8A 1W2HA 2ZR0A 3PV0A 1E0AA 3AP3A 1W0JA 1ZUHA 2W6IA 1TADA 3IO3A 3AVVA 3CX7A 2WICA 4P32A 2H57A 4ESVA 2GZDA 4YMWA 1UKZA 2OSBA 4I1UA 3MWYW 3W6PA 4MITA 1RRGA 1JPJA 1MO6A 2QPOA 4NTZA 1A1VA 5FPSA 3F8TA 1FFHA 1FP7A 3A4MA 1W2GA 4FXPA 1ELOA 4ZI2A 2GXSA 1L8QA 1Q1QA 2J3EA 4HAXA 1E32A 4B3BA 1EFRA 4KVAA 1GFIA 2KI5A 3KXLA 4AURA 4QGFA 5KOYA 2ZYVX 1T5LA 1KYIA 2G77B 2ZRGA 2ZRJA 3KB1A 3QG1A 5JI3E 2WWXA 1DAMA 3LWNA 4URZR 4DJTA 2BCGY 2WSSD 2QAJA 3LY5A 1NVUQ 1S9HA 4FMDB 621PA 2G0TA 1GUAA 4LK2A 1II8B 5EXXA 5GJBA 5BN4A 3CZQA 2IL1A 4KFRA 2XGJA 1IN8A 1MRNA 1OT3A 2PBRA 2R44A 4M1KA 4TLBA 3BAFA 4AKGA 5E3HA 4NHOA 4M1MA 2O8FB 1HT2E 1T3LA 2OCPA 1JR3A 2BDTA 5KHOC 1E2EA 1NN3A 3W6NA 4AD8A 5JSZB 3EPJA 4IDHA 4UNSA 1Z0KA 1ZIOA 2HJGA 1W48A 2CLCX 4RVCA 4LPSA 4GSYA 421PA 2FFAA 2CHQA 2UKDA 4E07A 1AGPA 1MOZA 2CJWB 3GJ0A 3IBYA 1VPLA 1VYTA 4GOKA 4ASUA 1E98A 3FMFA 4MUAA 2H8KA 3D3QA 4TT3A 4DKXA 2ZI7A 5EP2A 3UG7A 4GOJA 4IVRA 2V1UA 3ZD6A 2EYQA 2IYRA 2Q3FA 2WJHA 3HPQA 2GJAA 1KDRA 1SHZA 2XOKA 3KB2A 4LHZA 1Z63A 1WB9A 1N6NA 4Q66C 1XTKA 4DCTA 2O8DA 2CCKA 1OH6A 3KX2A 1ZD8A 4QXAA 2QAGB 1R0ZA 1YZTA 1E2PA 4A6XA 3SU8A 4LSGA 4CT4B 4L4UA 3WYFA 3VU9B 1F2TB 2ONJA 1GKUB 5DE3A 1NMYA 1Z6YA 5FI0B 1M2OB 3EZ6A 3JVUA 1YR6A 1P6XA 1QBKC 4B48A 2CNWA 1U81A 2ZYTX 4TWZA 3FTQA 2WKPA 3PQCA 2O8EA 4JVSB 3VHXA 4TMZA 1FX0B 4FCVA 4BWYA 2WSMA 2MMGA 4HAVA 4D25A 4LJ8A 3IUYA 4HAUA 5J4YA 3B60A 4YMSA 2XXAB 2ZJOA 1I4TD 2JDID 4B2PA 1R6BX 3R7WA 3T1OA 3I3SR 3W9YA 1QDEA 3U5ZB 1TU4A 4LHWA 4PXAA 3Q7QA 5CLLA 1P9WA 1QF9A 4HI0E 1HT1E 4OHWA 2W83A 3ZZ0A 3VAAA 1KMQA 2NO9A 4LBYA 2YJTD 1NKSA 2D74A 2ZANA 3I1FA 2GJ9A 2RGEA 4LBVA 3EXAA 5K8IA 2REXB 5FTNA 3Q5DA 2GXAA 3PEUA 3RSOA 5BYJA 1SKQA 1LVGA 4N3NA 4D82A 2AK3A 2PT7A 5BQ5A 5A4JA 1YVDA 2O0HA 5G40A 4OQMA 4B3DA 1KJZA 3B8HA 4HEJA 4BEJA 1G4UR 5CITA 4D0NA 4NU0A 3TAHA 1GM5A 4PSAA 1G9XA 1LF0A 1OKKA 2QA5A 2CMKA 3WMGA 3QI2A 3VQTA 2B6HA 4KLNA 5DO9A 3ZS8A 4A8JB 3TKLA 4B6FA 1NVVR 1GL7A 4A2QA 3RS7A 2YINC 3RDPA 1P60A 3DPUA 5JHGB 1E9SA 1KJYA 2ZRBA 3AF3A 3I5XA 4A2PA 1Z28A 1E79A 2JCSA 3BBPA 3BFVA 1YJ5A 5J4LA 2KWIA 3H84A 1QHIA 3RANA 3QF4B 1G64A 3T12A 1W4CA 4MDFA 3FGNA 4IXNA 3OAAD 4IEIA 4ACBA 2IW3A 5J5CA 2FEOA 3QPWA 1CR4A 4ACAA 3K0EA 1G291 2REOA 2HXSA 2XNDA 4HSEA 3OEEA 2QE7D 4KBFA 3QENA 5IHPA 5LPNA 1ZNXA 1SULA 4E5UA 1S2MA 1SVIA 2ECKA 4Q1CA 3EPHA 1F2UA 4EFLA 3AVOA 1T6NA 4HDQB 5EJEA 4CEIB 4C0BA 3IPXA 3PUZA 1ZRHA 4I1OA 1V43A 2GKSA 4ZI3A 2PX0A 2PJRA 4R9UC 3FMPB 4M1TA 2A9KA 4DLSA 1GILA 1TEXA 3ZVNA 2LCFA 2O8CA 2VH5R 4Q01A 3U44A 4KSBA 2G1KA 3KJIA 4TYPA 1UJ2A 4YDSA 1W36D 3M0EA 4FIDA 4JLDA 3HPRA 3ZJYA 521PA 4DT1A 4BFSA 2HJVA 4ZCMA 2HT1A 4EQ6A 1UEJA 1PLLA 3GP8A 1W5TA 2FGKA 3FMIA 2XB4A 2QU8A 5BW8A 2QORA 1LV7A 4B76A 2QEQA 5CDFE 3KTAB 2ZR7A 3QKSB 4BLRA 2JATA 2OEPA 2ERXA 4W9MC 3QSYA 3BB1A 1A82A 3KZ1E 3QBTA 4XVUA 2EFEB 4ARZB 4FW9A 1GITA 1N6PA 4V03A 4DCSA 1ZCBA 3OIVA 4IHQA 3LVQE 3ZYCA 2OCAA 3IPYA 3TVDA 1XX6A 1P2SA 4LYFA 4ZCIA 1ZM4A 3BFXA 3I62A 3Q7PA 1OFIA 4NKRA 4DWJA 2JLRA 1NY6A 4UXJA 4BLTA 4B3FX 1DAGA 2DWPA 1E2JA 1KSHA 5G3ZA 3QBVA 2YOGA 5LB2A 4CT5A 4O25A 1BO6A 2GCNA 4F92B 2FOLA 2HYIC 5FL7D 4QGHA 5FOSA 2GHIA 5SZJA 1ZU5A 4DLTA 2W6JD 3RS4A 5AUPB 1OH7A 1M74A 4KSCA 2X19A 3HU1A 5JWOA 3LW8A 5FR2A 2REBA 3AF0A 1M1YE 3U6KA 2AD1A 4HB2A 3W8RA 2AXPA 3NHBA 3SDZA 5HZKA 1KMHB 4BASA 4RZXA 3THYB 3KQLA 4UKDA 4MYCA 3AKDA 4KI0A 3KKQA 2PCJA 2CLSA 2ZJ8A 4Q1FA 1G16A 1SVOA 1OXSC 3A1TA 3B5JA 2GZHA 4MRVA 5JWHA 5C46F 3CX8A 1U0JA 2J87A 1GRQA 3AGPA 1HY3A 3L82B 2PMKA 4P31A 2OLJA 3AVWA 5JFGA 1G3RA 1YE8A 5J4HA 5KYKA 3PXGA 4J0QA 5KPDA 2KJQA 2ZS7A 2NQ2C 1TUEA 3SC3A 1EFUA 2YNMA 4EPWA 5TXGA 4BQSA 5KDOA 2BV3A 2H17A 3K9GA 1Q1EA 4LJ5A 4GP6A 4NYMR 2F1HA 4BLPA 4F7WA 1CJVC 2A5FA 4I1SA 5AR1A 2P6NA 4L15A 5BXQC 3ADDA 2ZRPA 4PPQA 2WJVA 1Q1ZA 2ZXUA 1VCOA 2GZAA 4D0GA 2CK3A 3EZFA 5HE9A 2V3CC 1XNJA 2QPTA 2OUKA 1K5DA 4CEJB 1G5TA 2C9YA 2VHUA 3DZ8A 3HP1A 3CRQA 3L8ZA 2XEXA 2R6CA 3W90A 2WHXA 2J46A 1GNRA 2G3YA 2IYTA 3REGA 2C77A 2VF7A 2YHSA 5AJWA 1B0UA 1XTIA 2GETA 3GQBA 1Q21A 5EP1A 4DXAA 2BEJA 4G3XA 2SHKA 4V0KA 3AUYA 2VEDA 1AA9A 4OI4A 1G8YA 4DBLC 2C99A 2ZIAA 2Q3MA 4G01B 4ZKEA 2J41A 3LLMA 2H16A 4JLKA 1Q0UA 1YU9A 5LD2B 1R5BA 3ZH9B 3K70D 3IHWA 2V4ZA 4PQFA 1T0JB 4HZUA 3NC1C 1OSNA 1R0WA 4IW3B 2W2VA 5FOXA 2J0VA 5CB8A 5FUXA 2RH5A 5EP3A 4B43A 1NLFA 3LNCA 3KL4A 1Z0IA 1R8SA 4Q00A 5KNBA 2A30A 2FFHA 4PPNA 5AJYA 4C3ZA 2GESA 3L0OA 2OCBA 4Q19A 1G5PA 2ZRNA 5CIQA 5FBWB 1ONBA 1JI0A 1S1MA 5DGXA 2F43B 1R10A 2ZROA 3VR4A 3E70C 1NI3A 4PC7A 2IHYA 4FCWA 3C8UA 1ZM2A 2E87A 5F9HA 2EYUA 5G3YA 4E09A 2FJUA 4IOLA 3QXSA 2NGRA 3VMFA 4OQXA 5A5GA 1E1QD 4B3GA 4Q4LA 5JI2E 1JEEA 5L3QB 2ANCA 5AJZA 5DI3B 2XZOA 4DB4A 5FTKA 3EPLA 2ZEJA 1XP8A 1H65A 1SXJE 1Z5ZA 2A3RA 2QMUA 4KAXA 4Q47A 3MWKA 4R2HA 1P5ZB 1SXJC 4B34A 4YC7A 4H1VA 3WY9A 3QVUA 3WHKA 1KK2A 4FWIB 4PC2A 2QSZA 3H1TA 3LX8A 2XTMA 4JL6A 3WNDA 2ZSAA 1GDDA 1N0VC 3SYKA 3RRZA 1YZLA 1ZAKA 4DSTA 2DFNA 1G8FA 4D0LB 3MJHA 2CCJA 1HYQA 1CBUA 1WXQA 3AP1A 1M7HA 1W5SA 2B92A 4C0HA 3FHOA 3KDSE 4L9WA 3TVTA 1TF2A 1NVWQ 2QBYB 1CF4A 2J1LA 3R8CA 1U9IA 3IDQA 1IHUA 1NN1A 4IDQA 3TR5A 1MO3A 4OQLA 1VYUA 1E2QA 5B2ZA 3VNUA 3RS2A 2RGNC 4DSNA 2Z4RA 5H68A 4L8GA 4YMVA 2J0SA 1U0HC 1R4AA 3B1WA 3FFAA 3QY0A 1EFCA 1FNMA 2Z4SA 2WPDD 5L3RA 5TV2A 1OV4A 4UJ3A 4TMXA 2QPAA 1DS6A 1OIWA 3GLIA 5L8VA 3THWB 1XMJA 2IEYA 5TY0A 5CM9C 1Q44A 5DN6A 4LOAA 2GRJA 2CCGA 2ZRFA 2C04A 4PHHA 4JLNA 4P4SA 3UWKA 1NSTA 5DSZA 1Q12A 3SJBA 1MKYA 1Z07A 2HYDA 4RSGA 1KAOA 4D80A 3B1YA 3UMRA 4DEYA 2MSCB 2J7PD 4KU4A 1OHHD 5FUVA 1KJWA 2IUTA 3TW4A 2ZSFA 3LAWA 5CB6A 1Z47A 1FQKA 2JIZA 3FYHA 3W8NA 2Z43A 1RJ9A 5C18A 5L3SB 3HU2A 1KI8A 2B8WA 4HLUA 4I99A 221PA 4OBEA 3WNCA 1U9IC 1AM4D 4KYUA 5B57C 4AYTA 2PLRA 1XMVA 1N6HA 2BJWA 5EQTA 1JAHA 1P2TA 2NZJA 4PQRA 1CJTC 2EFCB 2N1BA 4NMMA 1GNQA 4XD7D 4ZKDA 1DVRA 2CL6X 4ARZA 2RGGA 1XRJA 2WOJA 3TR0A 4MRSA 1Q20A 1VIYA 3CNLA 4RZ3A 1WP9A 1KY2A 1Q3TA 4HAZA 3GEIA 3ICQB 4PZYA 1I2DA 1E0SA 5IF9A 2FMXA 4RKEA 1H8HA 2FSHA 2VHQA 5BWMA 1M7BA 2B8TA 2J9RA 1Z6AA 4JS0A 4URWR 4WZBE 2QENA 2YYZA 5CJ2A 2IX3A 3R20A 4JKIA 2WVJA 3NBZC 5EE0A 4GNKA 3D6TB 4IRUB 1KGDA 3I8SA 1HE1C 2QMOA 3QJYA 1EESA 1RZ3A 2V7QA 3K09C 3ZVRA 2IYYA 3PEYA 2IXEA 4DRZA 1AQUA 1BYUA 2H7VA 2P0EA 3BRWD 4HLCA 4HLUC 3F5FA 3QG5A 4DC9A 1NVXQ 1AIPA 4Q4JB 2WZQA 3I61A 4HB3A 1GZSA 3LBIA 4BFYA 1KO5A 1KDOA 4BLSA 5L3VA 1KMHA 4ZDWA 1SVLA 4M9SA 3THYA 1Q1BA 2IHBA 3DO6A 4LCBA 5FTLA 1TX4B 4TTRA 1N5KA 2OV2A 3ZDQA 4TL6A 3KQHA 4BFWA 1G7SA 2FF7A 5DIFA 1XZQA 1E2GA 3A6PC 1G5RA 3REFA 4QHYA 3O8CA 3GLGE 4UNQA 1W1WA 2RKOA 4B71A 5HKKD 3CLVA 4IJMA 3UATA 5GJWC 1CXZA 4HLDA 4MKHA 1DAHA 4D4JA 5DHAA 1R7RA 2BM0A 3CM0A 2BMJA 1YZGA 2V9PA 4H9GA 4WZAE 2FSIA 5EUMA 1WRBA 4OHYA 3ADCA 3F0TA 3TQCA 2QMHA 1SVMA 3K0FB 3MD0A 5CLQA 3WBJA 1QZXA 2DWQA 5FTMA 3LV8A 3ZIAA 4Q7LA 4CVNA 4PAMA 1COWD 1P62B 2X1VA 1LY1A 3CPJB 4TZ6A 3U3KA 2D2EA 1QHXA 4B74A 4AC9A 3SJCA 4C7OA 2ZJYA 4I1VA 2PEYA 3T1QA 3A58B 2ZE5A 2GTPA 4V0LA 2AX4A 1GAJA 3LH5A 1KNQA 3UG6A 4Z51A 3SQWA 2HLDD 1SVKA 3QEJA 3AUXA 1OYWA 3NKVA 2VLIA 2FN4A 1AK2A 2CE7A 1TU3A 2HF9A 3LDAA 2GBLA 2BJVA 3GJ3A 2DY1A 4IDPA 2R2AA 3HU3A 4LGMA 5FUYA 2XSZA 1E9CA 4MKFA 1HQYE 3GLFE 4A0HA 2O52A 4TYQA 1KK3A 2OILA 5F9FA 1E9BA 2NO6A 4NPHA 3TW8B 3AVUA 1W36B 3MRSA 5BN5A 4LV8B 2VRWA 3CRMA 2IXGA 4EPRA 1UBFA 4M1SA 3SOPA 4KHZA 5TMPA 3Q3JB 2D2FA 2HDNB 2RGAA 4EUNA 2ZJ2A 2VSXA 2HXYA 3O8DA 5FL3A 3VR1A 4TYWA 3I72A 3CH4B 3EIHA 5GADl 3FWYA 3CNOA 3U3RA 2DFTA 1XEXA 1A5TA 2YWHA 2ZUDA 3IKJA 5E7MA 1MABB 1G6HA 4AG6A 2AWOA 2BBTA 1DADA 2F1RA 4QHSA 4Q4AB 2DB3A 4LJYA 2KB0A 4UNNA 4HUQB 2I4IA 5EZ5A 1JQLB 1MO5A 1UKYA 2A5YB 3MSXA 2IC5A 3PCRB 2ZVQX 3VR3A 1XXHB 1H8EA 5FR1A 3VHLB 2GBLC 1OXVA 1XB2A 3QKRB 2BIFA 3OE7A 4LYHA 4ZO4A 2BMFA 4B3XA 2D06A 1S8FA 4RD0A 1G20E 1W0JD 2W6ID 3ND9A 1JALA 4DEXA 4Q7KA 4GFDA 2PH1A 5SZHB 4PZLA 2ZUCA 4P3YA 4B2IA 2GJSA 2R62A 4PAOA 1OIVA 3OZXA 4YXWA 2G88A 1T8TA 1YR7A 5J40A 2JJ1D 2RGCA 4XIGS 1ZM7A 3UKDA 1E94E 2D62A 1EFRD 1MO4A 4TSFA 2YOFA 4FWTA 4F38A 3B2EA 4Q4HA 1S1CA 2Z0MA 5IT5A 3UWOA 3U7HB 2GK6A 1CJMA 5EXTA 1U98A 4IOMA 4QOSA 2DBYA 1Z0AA 3K1JA 3Q85A 4K8OA 2OAP1 4QBIA 3QXXA 1RYFA 3LQRA 4WXPA 2G0NA 2WOOA 1F48A 1VTKA 1N2CE 2JJ2A 2IUSA 3BC1A 4JT2A 5FPHA 3DEFA 2VTKA 1NKTA 2BBSA 4CF7A 3CH5A 4RD1A 1Y3AA 4KCGA 5JJKA 3NEJA 4WAUA 1Q22A 4MDEA 2GCOA 4K46A 3SZRA 1A2KC 2VHCA 2BMEA 3PVSA 1JR3D 1TF7A 1YR8A 3AVPA 3EX7C 3G0HA 4EJSB 4U02A 4RJLA 1QG4A 3ASZA 2HF8A 4U00A 4LJ7A 3M6AA 1M6NA 3I4LA 2RHDA 3CRVA 1LF5A 3LD9A 4ASUD 1GL9B 2ERYA 2VP5A 4TT3D 1PZNA 4LJ6A 1QG2A 1KI9A 5L3SA 4M2LA 5J4KA 3NH9A 4UXIA 4MQBA 3EWAA 5K8TA 1WF3A 1NIJA 4QG7A 2C5LA 2XOKD 1XCMA 2ZI4A 4NCHA 1EX7A 4TQUS 3RWOA 4PHGA 2OXCA 1NLYA 2UZIR 3TSOA 4C30A 3HR8A 1KO8A 2DWOA 5UKDA 2YWGA 3UXMA 5EE9A 3SI7A 5SZKB 1GG2A 1NVVQ 4FINA 2YV5A 1XMIA 5IRCD 2GA8A 3EZ2A 1JR3E 3FOZA 1KI3A 3IHLA 4ON9A 3K70B 5DISB 3OF5A 2YZ2A 4ZIRA 4BFTA 5GJVC 3RC3A 1DG1G 2CNWD 1NJGA 1E2KA 2W00A 4C2UA 1NN5A 4B47A 4A2WA 3U61B 3B7GA 2R6FA 5JRZA 1WGWA 2IYXA 4M4SA 3LRPA 1VYVA 2XB2A 1QHGA 2AHOA 4JSTA 3EZ7A 2AK2A 1UKVY 3GJ4A 1IXZA 4IDOA 4MUBA 3GLHA 4L16A 3RRYA 2ATXA 2AR7A 1ZUIA 3OFNA 4M8NE 3UMSA 3WBKA 3PUXA 4LI0A 2FG5A 4NCJA 2RHMA 4MYTA 5KSPA 4BFVA 2FX3A 3VKGA 4OHVA 1CIPA 2JDIA 1M7GA 1ZP6A 2J0UA 1I4DD 1S3SA 3DHWC 4LC1A 2OXRA 4F4JA 3RHFA 2NG1A 3VR2A 1QHHA 3QPUA 2G9NA 1BKDR 1VCNA 3TH5A 4ZV4A 4LYAA 3LLUA 3AF2A 4CDGA 1G41A 3BWDD 4CW7A 1CRQA 2ZRKA 2FFQA 2V54A 5KPJA 1IBRA 4UNPA 1FP6A 4HAWA 5LB4A 2GNOA 3T34A 4US0R 1TL7C 1Z0DA 1MH1A 1K6MA 5JS8A 4XVRA 1OKKD 1UBEA 2BM1A 3LXRA 1XTRA 1P7CA 1N5LA 1II9A 5CIWA 2ZRCA 2F3TA 2V1XA 5D3QA 3AVQA 2DR3A 4RFSA 3SE0A 4CGZA 2C9CA 3CWQA 5HCNA 3KKNA 4RD6A 4MRNA 4YLGA 4EFMA 1XTQA 5M04A 1GOTA 3R8FA 4Q7JB 4QKQA 1KI7A 4YONB 1E79D 3W3AA 2ZJ5A 4PO1A 4RY2A 5AK0A 4NZYA 3DKPA 3SJZA 5FI1B 1XZPA 3D31A 2WIAA 3GFTA 4KYIB 3SYNA 2OE2A 4QNMA 1J70A 1KI6B 2VPPA 4Z1MA 2WKRA 1OF1A 4B73A 3KQUA 1FNNA 3UMFA 2XNDD 4OJQA 5CK4A 5EZ6B 3OEED 4JLPA 3WXMA 2J45A 4CYMA 2GF0A 1YKSA 3P26A 1G7RA 3PJRA 4IXMA 1JJVA 1NG1A 3BH6A 2QE7A 3S1AB 1NG9A 5JECA 3H86A 1CTQA 2BKEA 4BPBA 1TUIA 2MSEB 4FCTA 1Z6GA 2VHJA 2CL7X 4GBMA 1WDTA 2ZU0C 1UADA 2C2HA 3EIQA 3T1VA 1UKEA 2ZS8A 1N6LA 2RGXA 3RRNA 4TZ0A 5TARA 2BWJA 2L0XA 2ZAOA 3L2OB 3DM5A 3QKUA 5IK2A 5DH9A 3L0PA 3NBYC 1IM2A 4NYIQ 1ZW6A 4FN5A 3GMTA 3T06B 3AVYA 1EXMA 2HEIA 4M1OA 2IS6A 2IXFA 3U4QA 5JCZA 1IQPA 1CULC 5JCPA 1JB1A 1DOAA 2XZPA 1KSGA 2YC4C 3MWLA 3PG5A 4QC2A 1U8YA 4LZZA 4X8MA 4DCUA 4BFXA 4EDHA 1OXTA 1BH2A 4JBXA 3P20A 3THOA 2OO7A 2XITA 4XH9B 3NIBA 2R65A 3KXIA 4ILEA 1MR3F 5B58C 2VL7A 3ZLJA 3CR8A 3IIKA 2XJ9A 2CLDX 1IN7A 3M4YA 1TPZA 3I8XA 1E2HA 1AQYA 4JIMA 1T0HB 1KY3A
chains in the Genus database with same CATH superfamily
2VK4A 1UK6A 4UHJA 4DA9A 2G6BA 1XXHA 3PNMA 4DXWA 1JAIA 4D4NA 3VSCA 2J31A 4G6ZA 1S8OA 4PO8A 3A1DA 1UDCA 1ESMA 2IZZA 3HWWA 4HWTA 2JGNA 5TB5A 5DLDA 3EG9B 1P2DA 5BWCA 1LUAA 3H0KA 3T6JA 1VBFA 4I55B 3L0BA 4V0RA 2GYVA 3NHWA 1KKMA 4YBZA 1A76A 4YAGA 4AXBA 3ZTTA 4L4RA 4DXHA 4W99A 2HF2A 1QYVA 2V7BA 1LPNA 2B4RO 3NWJA 4AMGA 4YMLA 2Q0HA 1SXJD 3GMSA 4LNUB 2HRRA 2YLGA 1ZKMA 2OSVA 4FHEA 4CPDA 3FOFC 1UKAA 3LDUA 4C4PA 1JKIA 5DFAA 4UATA 1Y4CA 3AUKA 4K9NA 4A6PA 3LVFO 1F4VA 4KI2A 3CRZA 3BOSA 4UPEA 1LSUA 1E1YA 3I2IA 1LNZA 1Z37A 2W6MA 3MWJA 3A2LA 3IIEA 3VVBA 3RABA 4F5WA 3C3MA 3PQDA 3KVNA 3AZPA 4WOPA 2XUPA 2AR0A 3CW8X 3SNKA 3DOUA 4HN2A 1ZA1A 1TVKA 3QF4A 4IZIA 1ZJ6A 3BXFA 3HCFA 5ALMA 4OKSA 2GPNA 3U6BA 2A0KA 1BCRA 4W5RA 1Q77A 4RUKA 5KWEA 1DIHA 4Y0AA 4LUCA 4NQFA 4NU5A 3FLEA 5T7BA 2N3ZA 3KAJA 3DVAB 1P9NA 4A0FA 1G19A 4RV4A 3ZY2A 4TMFA 1EK2A 4C0JA 1ADFA 2HMAA 2JLSA 5HSWA 4IWXA 4EKNB 3VOBA 2CHVA 3JD3A 3IMCA 3T9AA 5BQ3A 1WPGA 2V7WA 2EGUA 2Y6VA 5ARCA 4ZZIA 1W4AA 3HA7A 1VC2A 2QSYA 3W8DA 5B1AC 4HAOA 1PL6A 3I73A 2GPYA 2K7ZA 1UJ5A 5HQJA 4LJAA 1Z26A 2DPGA 1IWPB 4IIJA 1RXWA 1U6JA 2P5YA 4RMNA 1QP8A 3HL0A 2ZWVA 3DEIA 2FW6A 4UD6A 2E1PA 3Q7GA 2JJYA 2CXUA 1R0YA 2QWXA 4ITRC 3TAXA 3AKZA 4X6UA 4JLBA 2P0YA 4YCCA 3M2PA 2ONCA 4EUSA 4NXNB 4II3A 1TKAA 5AUNB 3ZVMA 4LSZA 3GFSA 3U9LA 1MT0A 4RXTA 4EY3A 4NBLA 4QI0A 4DRYA 2FPMA 3ABOB 2YUTA 1YA7O 4W82A 3RVRA 3DA8A 1XGKA 4M0LA 2VYNA 3X1WA 2FW9A 2LUOA 4MZDA 1XCOA 4C6TA 1MQVA 3JSAA 3MTQA 1FS4A 2AFIA 1E6WA 3MYFA 1OJLA 3G5LA 5FYDA 2PMDA 1FRZA 5E6SB 4HATA 5BUCA 4HNUA 3BILA 4KQCA 3T1TA 3CZRA 3Q3CA 4FHGA 4D3DA 4O63O 2A86A 2IVZA 4ZT4A 4MA4A 3SJUA 5F2OA 1LJUA 2H11A 2NUPB 2RHJA 2QZ4A 4HNVA 5KSYA 4WK4B 2OB2A 2WRZA 4OL9A 1U9CA 4Q9JA 1UEIA 2NSYA 5D3KA 2PA3A 1YNOA 4AZ0B 2PBEA 3KM0A 5JC1A 1I3MA 3B1FA 3AF6A 3QBEA 2P6RA 3HP4A 5E3IA 3MOIA 1JKJB 1F8YA 1UZAA 1QHSA 3F9CA 5AVWA 4DMKA 2LV8A 2Q3EA 4IIBA 2VHZA 2WILA 4ZDIA 5F5LA 4H7IA 2VYFA 2JD2A 1WMFA 3S2ZA 4JJGA 3TK0A 4ES6A 3FPKA 1XFDA 1RD4A 1UM8A 5ALLA 1CVLA 2CNNA 2J3QA 1TRHA 4OLJA 4CIYA 4O1MA 4GZ6A 4AUEA 4ZV7A 3RQEA 5JVDB 1X7ZB 1XRMA 4M83A 3O74A 1FMTA 2PX3A 1V2GA 4W8HA 4LXTA 1D6MA 1JPVA 3VR6A 3ASNC 1EFVA 5DTRA 3WP1B 2C84A 3I9KA 4AYWA 4XEVA 5TVKA 3D4NA 1HEYA 4NARA 4Y9TA 2QQ0A 1MDFA 4TWRA 4RPGA 4K05A 1POXA 4OIRF 1LS6A 1Z5OA 4BVAA 1L5QA 1JDTA 3A31A 5JRDS 3WRVA 2I2DA 3SEOA 1PVDA 2CW5A 5ERXA 4B79A 1DEKA 3CZ6A 2A5JA 1ULZA 5CD1A 1RACA 1JWBB 3REOA 3H5WA 4JJ7A 1RYYA 2V5VA 4Q48A 2AN4A 2BM9A 5LYYA 2H5EA 2J9XB 1ULSA 4LQCA 1G63A 3WMEA 1SGWA 2Q5FA 5BSVA 3SVZA 1C8VB 2PRJA 4DKJA 1RJ9B 1PR4A 1I2MA 2OLKA 1IMOA 2PVPA 4CKCB 4WDQA 5GAJA 1ZC4A 1RVDA 3LUBA 3AB8A 4ALLA 1C7IA 1XEWY 5FL7A 3C3XA 2GVZC 4CRWB 1O95C 1QAQA 4YJFB 2P90A 2ZYUX 3SQLA 4U7WA 5B6PA 4JBWA 3M8KA 3BBLA 3I9MA 2GRUA 3CB2A 1NA5A 2X22A 3H4MA 4DNFA 4F3YA 3AOUA 5ALRA 4QDXA 4K3VA 3GJ5A 2BONA 4UNRA 2LE0A 4R8RA 4YAEA 3C45A 3GD7A 3WB2A 2OAGA 4IXDA 4YJ2B 4A0RA 4MGHA 4NE9A 3LQ2A 4M9RA 5IXYA 3CO0S 3H0EA 3D59A 5IAOA 1LFDB 3AUSA 3OP1A 1A0OA 1PD1A 4JEUA 1E1CA 3TIVA 3D3JA 1CP3A 5JY6A 5DDIP 3I32A 5JH7B 1X2EA 4WCFB 1YULA 1WR8A 1O94D 1P75A 2YRXA 2CBZA 3C8GB 5E1OA 5TJ9A 4B44A 4BEVA 4KDEA 5G0UA 3QX8A 4MOWA 2WAYA 1M2HA 1BWSA 1J7JA 3T9DA 2WINI 1N8NA 4ARIA 4ZN6A 2D5RB 3F6EX 4O2LA 1J9ZA 1D2NA 1M5UA 4BZPA 1WCIA 4P22A 4BQPA 1QONA 5CB4A 4DLRA 5IDQA 3C6MA 1B8VA 3TIFA 1BFKA 5DN6D 1I4YA 1X7XA 4WJZA 4N8DA 4RLFA 1P61B 4MGZR 1N5IA 4C3VA 5C4GB 1E5DA 1QJCA 1IY0A 2JIZD 3FTCA 1YRLA 2KW3C 4Q03A 1F0NA 1QORA 1T10A 1ZIPA 2WM9B 2ZDQA 3KUDA 4YUAA 2YZ7A 4NS1A 4PZDA 4MCJA 1NNUA 1ADCA 3MJVA 2IXBA 4BX9A 1Q0HA 5LLDA 1NOKA 2HOQA 4JE9A 3TJMA 2NX2A 2VBCA 1A5AB 5IC6A 4ZIRB 4GQBA 2AI2A 5JQWA 1EVEA 2WQZA 1A27A 1XD2A 2Q8QA 3VKUA 2PNOA 4YCAA 5IBPA 3HJFA 4DLPA 3UJAA 3LKDA 5CIVA 3B29A 2H2IA 2X4GA 3S1LA 1DBPA 2V4MA 2QROA 3NWPA 1Y9AA 2JJMA 3L7DA 5DNWA 1O3YA 4XX0B 3KALA 1YMVA 3BGWA 4D2IA 1RE0A 4POAA 1L7AA 2F3SA 5CX1A 4PSVA 1IHOA 3Q10A 2Z8YA 2BFDA 4IIVA 3ISVA 2QK4A 3OBBA 3ZVKA 5JNLA 1J22A 2OFWA 5INTA 3L8CA 4MGEA 2BGRA 2WPNA 2X7XA 3GRKA 2F9MA 3MMPA 5CT8A 2FP4A 3N9IA 4IDEA 1IN4A 2I3GA 3AJ9A 2QP9X 4XM1A 1NUPA 1NUQA 4MAFA 1PJ2A 1CQWA 2A9VA 4CE6A 4IMPA 3VXKA 4AJEA 4MGKR 3A6ZA 4TWAA 1AGRA 3DKRA 1O7JA 1MVLA 1B4DA 4YUWA 2B3DA 4K40A 3JQPA 1P8JA 2J4DA 3E1SA 3UTCA 1OGIA 2G5CA 5LZ5A 1Y8ZA 3UMHA 4HVAA 3AP3A 4ESVA 3WWYA 5F73A 1YVEI 1B8OA 1JPJA 4NTZA 3LPNA 1OX4A 1EFRA 2KI5A 1EGHA 5AM4A 2R8YA 4QGFA 1OX5A 4HWRA 2ZRJA 2P0NA 2D5AA 4LSWA 1XQ9A 4EHHA 4YV7A 1RQRA 2C20A 5EXXA 1FU7A 5F7OA 4CMEC 3KOXA 1E6EA 3W1VA 1HT2E 2P30A 5JSZB 1LPEA 3ETGA 2AG1A 4U2CA 3NHKA 2Q6KA 4ASUA 1DU4A 4GBED 2FW8A 4Q3CA 2H7CA 1V5GA 3BD8A 3UGJA 2X0JA 4EYEA 3LO8A 4ZAFA 1NMYA 4U9HS 2D5IA 1DBRA 1ZVZA 4B48A 1U81A 3PDMP 4R51A 4W1RA 3QW4B 1QIGA 2DI3A 2NUTA 4YMSA 4W9NA 1L5OA 2BFMA 3G0BA 3IEIA 3LDHA 1KMQA 3WIVA 2ZANA 1QQBA 2REXB 5E3JA 3I9OA 3JZDA 5FJJA 3NNSA 1PG0A 4OQMA 4TV9A 2YN0A 1XR3A 3M4ZA 1G9XA 1LF0A 3KH2A 3L5KA 2X15A 3ZS8A 3TKLA 3GR6A 3P7MA 1CGNA 4E5PA 1KJYA 3LF2A 5GV7A 2JGAA 4PNPA 5CAEA 1TCAA 3TLZA 1KZHA 3EYWA 3DAHA 2P9ZA 3EJ6A 5IHPA 4ZVUA 4R3NA 3EPHA 4YL3A 1BD4A 3AVOA 4CEIB 3OJ0A 5ERYA 3ELBA 5DNCA 3RVJA 2H1RA 4JVOA 3DT9A 4C3DA 3DVRX 3ZK9A 1LQ2A 3D6UA 3GD5A 1AX9A 4RTMA 4BLVA 3FPSA 3X44A 4DQUA 2QVZX 2ZTUA 3RFVA 1NU8A 4ZD6A 3KZ1E 2O4CA 5E1BA 4B4UA 3JQ8A 2QUIA 4IHQA 3LVQE 1XX6A 3GX1A 3ZGLA 1OFIA 1RAEA 1NY6A 1RKVA 1ZW1A 5J58A 2ADOA 3LS1A 1G2QA 3HKDB 5AC4A 5KX5F 1WUJS 1QE3A 1S2NA 1GSAA 5C46F 1AQLA 1EE1A 2XB8A 1VE5A 3IEXA 3D8SA 1U89A 3IR7A 3A1NA 1ADJA 3K9GA 4DBZA 2O48X 4DUZB 2FZCA 2HHAA 5EESA 5EGYA 2ZRPA 2WJVA 3NZEA 5ARDA 3I9LA 1TTPB 1DI0A 3D5TA 3QA3E 2R6CA 1GV0A 2BKXA 1XTIA 4BB9A 3RV3A 4Z9XA 2W45A 3U7IA 1QDUA 1EB8A 1CUDA 1R0WA 4IW3B 4ER7A 4CQNA 3BZBA 3ACBA 5JCOA 4C03A 1Y4AE 5CNJA 2K7FA 5GONF 3IAFA 3F74A 1DDIA 4E5SA 2OZLB 1GYRA 4FQ8A 1Z39A 1J25A 5JI2E 2PT9A 1I36A 4F04A 1RCPA 4YP6A 1YVRA 4ICIA 5DOZA 4YC7A 2LBPA 3QVUA 1NQXA 1A9TA 1VJGA 1Q2XA 1RE1A 4LNHA 4BWVA 4QT4A 2XEDA 3RTCA 3WMWA 3A6KA 4WFIA 4BV9A 1JUDA 4U5QA 2QBYB 3MWFA 3IDQA 4PV7A 4NZPA 1BWPA 2V9ZA 4CL3A 2NNWB 1R4AA 1EFCA 2V9CA 1CZRA 4DZTA 5D2CA 1DS6A 5F23A 3V2HA 4ZT6A 1M66A 1NFQA 4LG1A 1KYZA 4P4SA 3LL7A 2PS1A 1HE1A 3D0OA 2IUTA 3TW4A 1NI4A 3CEPB 3EPPA 1VHWA 2GZ2A 3TWOA 3PA6A 2GGSA 2ACEA 4XD7D 1GNQA 3CNLA 4WHMA 1QNFA 5CW2A 1Q3TA 3NHFA 5BWMA 1NU9C 1BWRA 4WZBE 2QVLA 1D1TA 2QENA 1BA2A 3DEZA 4CMIA 3VYUB 2CLFB 3O4VA 1AIPA 2DECA 5CB0A 2WD7A 2Q3TA 1NVDA 4DRJB 3L1MA 1XKLA 5L3VA 2AOUA 1QBGA 1J5XA 4YRSA 5C52B 3DO6A 2OV2A 2PSFA 2GEJA 5DKFA 4WERA 3T7AA 1CZNA 5A6BA 1I5NA 4D8XA 2Z8YM 2Y3DA 3QLVC 1DAHA 4RVUA 2IFTA 3OJWA 1SO8A 2Q1UA 4H9GA 2WVOA 1PQ4A 1U7TA 2HSQA 4HDMA 2FN8A 1P62B 2R86A 5KOJA 1SIOA 1S05A 5JT1A 3D2BA 1LWOA 4XPXA 3EXHA 5EWLA 2XD4A 3A58B 2MSNA 3E3OA 4LZOA 1DFGA 2FN9A 1K66A 3D54D 3ZV5A 1KTMA 1SVKA 1YZYA 4UM7A 3LDAA 2GBLA 2IP2A 4L6AA 1HQYE 4OMUA 3RBVA 4EI8A 2XQGA 4CMJA 1CCWA 4X1KA 2JFGA 1RHJA 1FU4A 4FBGA 3EIHA 3E2PA 3SHVA 3FWYA 2QRVA 4KR0A 4F97A 2X7JA 1IW7F 3EXEA 3DV2A 5K0JA 3OZWA 3MSXA 5ADWA 4WCFC 3SXKA 3DJUB 3QFCA 3UXHA 3GNTA 5T3TA 3U3XA 1VLQA 1G20E 3R3HA 4Q7KA 1K40A 5JE8A 1VJ1A 3IAAA 4PYIA 3M1AA 4KVFA 3QTBA 3FCEA 1URPA 1M1XB 3SIWA 5EXTA 3G8AA 1YIAA 3OJEA 4C4OA 4BO9A 3C3AA 3QXXA 2WOOA 1WUYA 5FPHA 3IPRA 1K3TA 3CZ5A 4P3XA 2O6LA 1OX6A 3DD1A 4IX1A 3EQ7A 4GGPA 5AM0A 2JIPA 2VPIA 4HE8D 2AI1A 3N7TA 1JQKA 1EUQA 3RFUA 5HK9A 1KI9A 1XC7A 3DKIA 3JPWA 2C5LA 3FHDA 4FOTA 1NVVQ 2G7MC 3HLTA 1NJGA 3L6BA 1BMTA 5DP2A 4A2WA 4ARUA 3DG9A 2ATXA 3NHLA 4LI0A 3VTFA 3VR2A 1QHHA 2QUAA 1WXIA 5DTMA 2FFQA 3ZBQA 2A69F 3EN0A 2KC3A 1OI2A 4JA2A 3I34X 1H3EA 3S3TA 4LVUA 3L8HA 3Q6IA 4H4CA 5L40A 2B1QA 3WK6A 4H0FA 2GZMA 1OCRC 1NV8A 4FYXA 2PL1A 3BWEA 8GPBA 4LFAB 4I5IA 5HQ3A 3C1OA 3PJGA 2H31A 5JECA 1B42A 1YRHA 4RL4A 4IH1A 2L0XA 2JI7A 2ZAOA 4QAJA 4PIMA 1WY7A 5DHPA 2Q1TA 1Y6DA 4NTAA 3AVYA 1A1SA 2MSWA 4MYRA 3X1KA 4EDHA 4XH9B 2R65A 4ILEA 4ND3A 1B14A 1KZ4A 4QJ5A 4AZTA 5DOVA 1G3QA 1MX9A 2IITA 3MAJA 3SZMA 1LVKA 4ZMRA 9ABPA 2R7SA 2FLKA 4KAAA 4PLCA 1V7ZA 1YA4A 1N6KA 1EVZA 2VJBA 4UUNA 4FPXA 2OXIA 1IZ7A 3FTEA 5ISMA 3AINA 5L4NA 3NOXA 3O8BA 4G1CA 4BVFA 3SSMA 1AMOA 2OYCA 2WTEA 5BR8B 4NSNA 4R83A 4YL0A 2CVHA 1FR0A 1N3BA 1QANA 1IK4A 5D7NA 4BZWA 2ZXWC 5A1TA 3KWMA 3UVEA 3QVXA 2NU6A 2R02A 3NEAA 1NHGA 3VU9A 2AJTA 4XWTA 2X8JA 3E8SA 4QHTA 1Q15A 3TGLA 2C9OA 4PLVA 4NRDA 2H8AA 2PD3A 1JHVA 4G8DA 4C4RA 1ZVKA 4KKXB 4I50F 3QITA 5DI9A 3HM2A 5I47A 3VKFA 5B1YA 3A4NA 2HK9A 4OLFA 2V26A 1LDYA 4RA6A 4MW2A 1G2PA 4J0IA 3PCTA 5BO5A 2AF4C 5BQGA 1YS7A 2PV7A 2CV1A 5CA1F 5KMGB 3VHQA 3O7WA 1QPZA 2J9ZB 1JNYA 3FXHA 2HHCA 5JNUA 3GJ6A 1RCTE 2AMFA 1SURA 2AE2A 5DNVA 1B74A 2H1IA 3EZYA 4G5OA 1I7QB 5J2TF 2XUKA 3ZTYA 2EAUA 4A2NB 3CBQA 1U3CA 1MA0A 4RGBA 4P6IC 1POWA 1YXMA 5BN4B 5IW8A 5KHAA 3DOEA 4TLMB 3EBLA 4I44A 2QVCA 1ONSA 4ND1A 1G9SA 2A9FA 2Z1NA 4QEDA 5DM2A 2VKQA 2HMVA 1YBHA 1HE4A 6GPBA 3K1AB 5AKHA 1Q0TA 3QOWA 1C3OA 2JK0A 2HSGA 3JWIA 4YMTA 3VPCA 1JF8A 1FP4B 3LYAA 1RKEA 1C29B 2VCCA 2F8SA 4ERNA 5U4XA 2J8WA 1R4ZA 4XGKA 1VGQA 2OCYC 4WFKA 2EIMC 5GY7A 3H2IA 1XJ5A 2R5NA 1ZW3A 4M1WA 5KU1A 4K9KA 2X41A 1E9AA 2BBWA 1B0AA 2RH4A 1THMA 4DOMA 1DAEA 4HLNA 3QUSA 2ZG6A 4IKEA 3BSYA 1Z73A 3AERB 5CH5A 2ODEA 4Q3KA 2HZBA 2IGBA 2IQIA 1P81A 1DHTA 2XKBA 2RI1A 3EIWA 1XTSA 4BVLA 3OQPA 4QGAA 1TEVA 5JLJA 1Y7LA 1NWHA 1I5EA 3MGCA 1F1BA 4YJ3F 1H4QA 5HTKA 2QY6A 4DJEC 2OO5A 2QXUA 1KU6A 2B98A 4EW1A 1SB9A 3H1AA 1MHPA 3OT1A 3S1SA 4OL0A 4IRMA 2YVAA 4A0GA 1TYEB 2EFHB 4YLEA 4Q7EA 5J2UB 4EHKA 4N39A 2WFZA 4JMLA 2C5SA 2PCLA 2XWPA 1WDMA 4ZI7F 1G5HA 2WEKA 2PV0A 3DLCA 1F8UA 4PG6A 1NQTA 3P0EA 1EFLA 2QNIA 1UBHS 3OE7D 3JSEO 4E2YA 2QV0A 2JLVA 2B7CA 3EA5A 5K0NA 4LOLA 2EF1A 4D9IA 1FTSA 3NBAA 1TDJA 2EDCA 3LY8A 3PQ6A 2JD3A 1YMUA 2VTBB 4PGGA 2WSSA 3SAJA 1NP7A 1PYGA 2CL0X 3KYIB 3NYRA 2H92A 5TPWB 4L57A 3TPFA 4WOKA 2IHZA 2H63A 1TD1A 2WSIA 1BQ3A 5K09A 1HQKA 4G81A 1QKKA 1CUCA 1QUEA 3GQBB 1J00A 3F5MA 1V9LA 4G07A 1HMPA 3ZVLA 4QU8A 1WA5A 4G5SA 4W1SA 1GPMA 3ANMA 2QJRA 1FF9A 2GZ3A 4PNZA 3GVHA 4P3PA 4MCHA 1CLUA 2QSJA 3MM4A 1EDEA 2IYFA 4EA9A 4IJJA 2COEA 1PV3A 1B26A 4UOEA 2C9ZA 5LOVA 4H1UA 4RZ2A 4DHEA 2HV8A 2W2TA 2XNSA 5KEIA 4BMVA 1J2RA 3HWSA 1HYBA 3NEPX 4KH1A 1UWKA 1P73A 1HXHA 2Q5JA 4WTOA 3WHIA 4OATA 5D1NA 2WWWA 3GEBA 2FZGA 1JU4A 2ZCVA 1Z5GA 2GYUA 1NBWB 3T3HA 3OD1A 1U90A 1NMXA 1RRFA 1J8MF 3C24A 3F6PA 3WAKA 2YOHA 3GCGA 4TM7A 1I0IA 3HEAA 5CDFA 3F73A 3A9RA 4CNBA 1TM2A 3BSSA 4K9LA 2IU6A 4D9KA 3RPEA 3OZSA 1OW6A 2X13A 2HCTA 3K6JA 5DTQA 2VK1A 4WBNF 1BDJA 4HEAJ 1U8TA 4ENWA 2HPHA 3UK2A 3RAJA 4Y7CA 4KMOA 3MLAA 2PJUA 3CZPA 1SBTA 3OX1A 1K98A 4Q7MB 5TC4A 1Q74A 7MDHA 2UVQA 1R64A 4KVGA 5HILA 2BTOA 1WCV1 5JZMA 1AN9A 4MROA 2AH5A 1E60A 3DMNA 4ZZ1A 2VA8A 4X3CA 5LBIA 2IUUA 3M15A 1MOSA 1Q14A 3BJRA 2TMYA 2N42A 3RSSA 5AXDA 3I5AA 1T4MA 4RY0A 5DX8A 2JA1A 2OK8A 2ZS9A 4BWFB 4QAQA 2PX6A 1YQWA 3H16A 2XI4A 4TGLA 2INGX 4BKQA 5TMDA 3GJXC 1HURA 3AFMA 4TTIA 1Z4LA 4RGYA 3WLNA 3RC8A 4N47A 3RUFA 4ND8A 1CFJA 3Q8XB 1AS3A 4PFQA 2D7DA 3EJWA 3HB9A 2L19A 3QE9Y 1K8ZB 2UAGA 4TLAA 3R0QA 2VI5A 3L07A 4RHXA 1K7FB 4YCJA 4L5IA 3NHAA 1XQXA 5AVZA 1Y8RA 1R0XA 1ST3A 1UFKA 4AT1A 2Q1SA 1GCAA 4M3NA 5DNYB 2QM3A 1DMSA 1ZJWA 3WLLA 3OY2A 1G6Q1 3JQBC 3QRWA 2OQ2A 3QEMA 1ZHOA 5KKCA 4O2RA 1CU1A 5FA6A 2G25A 2XBMA 2PO5A 1T2UA 4F2PA 1X8LA 4CM8B 3KKOA 5EMHA 4MWBA 5AKZA 2PLAA 4N5LA 4B2YA 3LC2O 3MRXA 2IS2A 1J1ZA 2XNKA 3OM9A 3SKXA 2R7XA 1MD9A 3P0IA 3AXTA 2PMEA 1NFNA 2EG9A 2IP1A 2XTAA 1TVMA 4IICA 1Y82A 1YHYA 4IUDS 4LERA 3ZWAA 4CLOA 3HCAA 1I33A 2F64A 3ND6A 4KFSA 2QTHA 2A4MA 3ASOC 1ATIA 5KTNA 1ZL2A 2XS1A 1UT6A 1FS6A 4Q4DA 1PCXA 5FOVA 4U7DA 4OQFA 1ZYRF 3MS4A 5KNCD 1GUFA 3FZGA 5C3UA 5CW1A 4FMCF 2QN6A 4D6YA 4GM0A 4AIIA 3B6EA 3WXBA 4GKJB 3LPDA 4PE5B 3K09A 4DADA 4CCAA 1V55C 4NCNA 4OREX 4G78A 2P9YA 2GF9A 4G1FA 4BUJA 3UPUA 1OB5A 2X9LA 3DCYA 1ES9A 4DQVA 4CMHA 4G67A 3UWSA 2PRKA 4WMLA 2NO4A 4JOSA 1TFKB 4E4TA 3QNWA 1FEZA 1ZWLA 2YTZA 3V1KA 4WZAA 1E3WB 4R6WA 3BMOA 3WGZA 2WWHA 2RI6A 4OO3A 1ZBDA 3U0BA 2CNOA 4C7XA 2HH9A 4YYEA 1J42A 1TTHA 1KS9A 4LZNA 3LQ4A 1HFJA 3AG2C 4CBVA 3HCDA 3KHUA 2Q21A 2VPXA 1PAUA 5IZCA 2AS0A 1UOEA 5TJHA 4MI9A 4E5VA 4DA4A 4ZPXA 3CVYA 1USUA 4KXMA 3RVOA 4E2ZA 3ITNA 3W06A 1J0XO 2PSHA 1OLSB 1MB0A 2O8VA 4CF5A 3T5CA 3NNNA 1MC8A 5JQGF 5EJ2A 4JVNA 2FGJA 3ESAA 2XUHA 2BSQA 2VSYA 5LQUA 4OGKA 1SG6A 4ZAZA 5F3WB 3F3KA 2HPVA 2XWBF 1FYDA 1HZJA 3DUFB 2P78A 4J30B 2ZSIA 2WYUA 4MR7B 3VC7A 1KIFA 2VWPA 3KVOA 1VL2A 3VVLA 3QJ5A 4M55A 4TTTS 4LDQA 3JW8A 5B64A 3IOEA 5IWCA 1E0AA 4BNUA 5F77A 3KPWA 4G7HF 3SXYA 1NX6A 1VQ1A 4O2AF 1QB8A 2O23A 1NJ1A 1FFHA 2GBFA 3A4MA 1G4US 2AFHB 1QNLA 3KPHA 1Q19A 3EBPA 2WYVA 5LQSA 2XWJI 1HKUA 1GZ4A 1WU8A 1KOLA 1II8B 3T7SA 1MRNA 3BAFA 3PGA1 4OXNA 4BE9A 4QPJC 4IDHA 1JFTA 1FP1D 1U2DA 3EYAA 4FWBA 3JQCA 2Y39A 1ZLXA 2H8KA 3OIDA 4H6VA 3FFXA 5KNCH 2WKWA 4DNXA 2IYRA 1NF9A 3KB2A 3HPQA 1CERA 4MNTA 1Z63A 2XKAA 3SU8A 4C2BA 1U1CA 2RH9B 4OLAA 1GKUB 1MUUA 3PQ8A 2WF5A 3FTDA 4FCVA 2YWCA 3FXAA 1I9GA 2MMGA 1HDRA 4LJ8A 4LYYA 3ZNPA 3HBFA 1JSCA 3OX4A 1U2TA 2D2VA 4LF7B 3PE3A 5K9ZA 3AESB 5B7QA 5HCUA 4LBVA 2EPKX 1SKQA 1LVGA 3KQMA 3WGLA 3B8HA 4X1IA 3SXUA 4YRCA 2H85A 1OKKA 1YA8A 1LNQA 2CMKA 2R7NA 4A8HA 1IEVA 4A8JB 3U4GA 2JVIA 5JHGB 3TLGB 1XKTA 4MDFA 4GPZA 1Q91A 4X1YA 2KW5A 3ZWBA 1Z82A 3TTTA 2NTEA 5KINB 1RVV1 4I1YA 4FI3F 1AGXA 1V43A 4BO0A 4D3SA 2EBFX 1Z4OA 3KT0A 4G8JA 4RJJA 3NOQA 3FYTA 5TPZA 1CZHA 3CSKA 4YWQA 4J0FA 1UK9A 5HGXA 1WASA 521PA 1SZDA 1NBIA 2RG7A 2LIGA 3RODA 4Z4HA 1XUOA 3EWNA 1NYRA 1SQ6A 3OPMA 2DFPA 4N6OA 3QSYA 1L7CA 4ARZB 1D4FA 4FW9A 2ZQYA 4I2VA 2I8CA 3TVDA 4FYYA 1U8CB 1A9PA 2JIQA 2LQGA 4NKRA 1R3DA 4PICA 3UW3A 4EKEA 1H93A 4YJGB 1N0HA 3H3FA 4PGMA 2HYIC 1Q0LA 1A7KA 4KSCA 3JZ0A 3B2QA 1E1LA 1U2PA 2Y1LA 1U02A 5K8CA 2AD1A 3DOIA 4M0CA 4JQSA 3THYB 4J7UA 2CLSA 3L82B 3N6VA 4C7VA 2OHGA 3KG2A 4O4HA 3E23A 1LDMA 3T3OA 1RJGA 4F06A 3COJA 1W34A 5L4SA 1EUDA 1F7VA 3GG9A 3FLAA 1AQNA 4KSYA 2ZXUA 4GQAA 2WU1A 3PTZA 1QH1B 2W43A 1QG6A 3N2LA 1X74A 1SUBA 2CFRA 2C77A 2YHSA 2EBWA 1Z4IA 3CZ9A 1OWOA 1OYVA 3JR7A 2Q2NA 3GRRA 3L79A 1LE4A 4AJIA 2YIMA 2WWVD 2AEFA 5EWMB 1UC5B 3SBOA 4DQLA 2EPOA 1JSRA 1YYXA 1TJYA 3UGKA 2V96A 4WXMA 1SG9A 2JIRA 3V80A 2GESA 4M76B 3WLSA 2ZRNA 1ONBA 4C06A 5C4IA 3E9DA 3MWGA 5B55A 1GFZA 3H99A 1U63A 3C18A 3DBRA 3FPGA 1IFXA 5LP6B 1BVHA 4IAQA 2WMDA 1F20A 5F5NA 3H8JA 2AQKA 2IIPA 1C2YA 2IV2X 1WVGA 5HIKA 4ZI5A 1BJKA 3H1EA 4QQFA 3WLRA 4OB7A 2ZTHA 1VYUA 2IH5A 3I01A 4YMVA 1PJTA 4JC4A 2G9UA 2RIRA 4JURI 3C6BA 1YTLA 3GRZA 1UPCA 4JC7A 2XE7A 4E2WA 1SCDA 3T7IA 1Z07A 1ADGA 1NXSA 5JYDA 2PJDA 3TD7A 2PRSA 2AUNA 1LKZA 1ST6A 1W6RA 1BHO1 2G82A 2IUEA 2NZJA 4DNOA 1VPEA 2EFCB 3O55A 1H0HA 3ZK8A 1DVRA 2CL6X 3FNBA 3RJ9A 1O57A 4R6XA 1UDBA 2I9PA 3GF4A 3JQ7B 2NUBA 1FAPB 1TZCA 1M67A 3JD4A 5LCXA 2GEBA 2WE8A 3SZGA 2J9UA 4UUOA 3PEYA 2IXEA 2KLBA 1YQEA 3DP7A 3A9WA 3KYCA 1M83A 4N5NA 4HB3A 2JHCA 1KO5A 1Z25A 2HSJA 1WETA 5FTLA 4WUVA 4K2AA 5AESA 1IQUA 3O8CA 2RKOA 3DOOA 5HKKD 1A9ZA 4IJMA 2VVTA 4PGAA 4LCJA 1WEHA 1PNQA 1CRWG 4JB2A 5F76A 1ZESA 4LDRA 3F5DA 4YH1A 3ADCA 1ACJA 3SC6A 2H7VC 1PT7A 1EJ6A 4PAMA 3GZNB 4LLEA 1I6WA 5BT9A 4C7OA 4V0LA 3T3IA 3W4YA 1T8RA 3AUXA 3CV3A 3HY4A 4KW7A 1EP9A 5BVHA 3P9KA 3EA4A 2R2AA 4IDBA 3O1LA 5BV8A 1RHQA 1V5FA 1OT5A 2OD7A 2AHRA 4M1SA 4EPRA 3SZUA 3Q3JB 5LXTB 3VR1A 3E58A 1N7HA 2Q9UA 4NBUA 5JRAA 4F71A 3M5WA 5IMSA 4QHSA 2P4QA 1R6VA 3OZTA 4BGIA 1MO5A 1RDFA 2IODA 1XXHB 1JDBB 2J6BA 1LU9A 4H35A 2J0WA 3I2JA 3ND9A 3RRFA 3V97A 4PZLA 3FAKA 2HSWA 4TKMA 2BSAA 2M32A 5J40A 3X1OA 1E94E 1U1IA 1M8GA 2Q4DA 4CTKA 2Z0MA 5K6AC 3CH6A 1VTKA 3DEFA 1XOIA 3CH5A 1QH9A 4UQLA 2VHCA 4K6HA 2PXXA 5EJ9A 1J06A 4Y1EA 3U80A 3N39C 1IHYA 2Z9CA 2ZBDA 3T4RA 4KRFA 4J91A 4MLPA 3FOAA 3NH9A 5J4KA 1YAHA 1PZFA 2XRYA 3LLKA 1NLYA 3O4RA 2V0NA 3A70A 3DYIA 4B3TB 1YZFA 4BFTA 1BCSB 2I7DA 4BFLA 2R8OA 1NN5A 1ZIDA 2XDWA 4WPGA 2IYXA 2AHOA 5HUJA 3GLHA 2GFIA 1C1DB 3LYUA 1QFZA 4GM4A 2JDIA 5EZQA 5AK4A 4ZCRA 2QTRA 1MTOA 4RW0A 3WGUA 3ZE1B 1YF3A 2REQB 3LLUA 5AI6A 4CW7A 1B1AA 4A91A 1H2WA 4EGJA 1MH1A 5DWQA 4MHSA 3TRIA 4RFSA 3H2HA 3NP9A 4Q7JB 5FFFA 1C4KA 1PIWA 1LH0A 4IXWA 4NZYA 1S2DA 3S2YA 3GP3A 3UUFA 1ORJA 1G21A 2PZ8A 2XNDD 4FP9A 1FRNA 5JS2A 1M0SA 4EYQA 2ZU0C 3RYFB 2ZS8A 3O6VA 4WKBA 1F0YA 2XM4A 3OX3A 3QVMA 3U4QA 9MHTA 1CULC 5JCPA 3DDOA 3ZJUA 4G24A 4RHUA 1VZ3A 3AX6A 3RH0A 5K0ZA 1Z7BA 3DAOA 5HG0A 5LL6P 1Q7CA 3ZLJA 1MC1A 2ZBGA 1TPZA 1KY3A 1ZPDA 2JFOA 2WZDA 2FEXA 5T8KA 4R8LA 5CYFA 3TEJA 5ESDA 2WR8A 5CVCA 1XDUA 1XL1A 2HGZA 5E7QA 3K1TA 4BFCA 1Q0MA 1YB1A 1IQRA 4IIJB 1I4WA 4TTQA 1JFVA 1QFMA 5JJCA 1RLTA 1OAKA 3NRBA 3BJIC 4KQFA 1TAGA 3GBVA 1GZ6A 3QVKA 2AC2A 2H52A 3LO5A 1K3FA 4IIHA 4LOJA 5A04A 2O8FA 2I1VB 1YDGA 1BDIA 1X1BA 5ESXA 3U3ZA 4OU4A 3UC5A 3RSCA 1YZKA 1N9ZA 4NFHA 4CIBA 4WIAA 3OP4A 1QIFA 5FWDA 4HB0A 3NBFA 2GXQA 1P0MA 2JD0A 3RTDA 3W7VA 2ONYA 4OX9B 4PPYA 2HMSA 3PIDA 1O94A 1GLNA 3ONWA 5EXSA 5KNBD 2JLXA 3FWPA 3P9NA 4LF9B 1HPLA 4L50A 4RO0A 3HH8A 3K1IC 4ALJA 4AQDA 3O2NA 4Q1DA 2W2QA 2VP9A 2UUCB 3LBAA 4CM5A 3H1BA 5ALSA 3V8PA 5JNRA 3PE6A 3O7MA 3PPYA 2Q5CA 1YOVA 3D3WB 2VBFA 4Q5IA 4OSEA 4R01A 4I46A 2P2CA 2P4UA 4PFSA 1C9MA 4MYDA 3KR2A 3GFRA 4N9WA 5ANRB 3OLCX 1IZMA 1ESZA 3HY3A 2CVPA 3RVQA 1X7GA 3G5UA 5FUBA 1JIIA 2F00A 2PR2A 1VPTA 3LEVA 3A1CA 1AKRA 4JEHA 3I01M 1NSGB 3J7TA 1H6DA 1G66A 3LHFA 1XPRA 1H3FA 1D9ZA 4KQXA 1UWCA 3AOEA 1M0TA 2GEFA 3GOQA 3EVBA 3S1AA 3O3OB 3AHFA 4A8JC 3PQ5A 3HVUA 3HCWA 2FZ5A 3KUCA 4IH9A 2JKYA 5JV5A 1ESEA 1WHSA 4B35A 2HHHB 2XA1A 4EMUA 1XRQA 1RWBA 2HR1A 1K7XB 4V0MA 1BRTA 2XMPA 2TMGA 3ITFA 4AS2A 4PZZA 4C20A 3ESZA 5G53C 2IXNA 3DWEX 1TC1A 4F93B 4POOA 1HG0A 1Z29A 2YRWA 2SCUB 3ESBA 1PJLA 4P2GA 8OHMA 1GQOA 2ZJBA 1TR2A 4BV3A 3OPNA 4DTCA 2IXMA 3UA3A 2YFKA 5GWXA 2ZVDA 1DIOB 1DAPA 2W2LD 2H1WA 4OQEA 3LXMA 1JEJA 3CPSA 2W58A 3WB1A 1OXXK 4Q6BA 2NO5A 1H22A 5EK0A 5GVRA 3ZI7A 4TYNA 3WWOA 1M10A 2SECE 1X70A 2PJZA 2Q0SA 4WKCA 3W7BA 3EW9A 1FSPA 3QYAA 4QRHA 2WHRA 4BUCA 4YQYA