1J8MF

Signal recognition particle conserved gtpase domain from a. ambivalens
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
295
structure length
295
Chain Sequence
LLDNLRDTVRKFLTGSSSYDKAVEDFIKELQKSLISADVNVKLVFSLTNKIKERLKNEKPPTYIERREWFIKIVYDELSNLFGGDKEPKVIPDKIPYVIMLVGVQGTGKTTTAGKLAYFYKKKGFKVGLVGADVYRPAALEQLQQLGQQIGVPVYGEPGEKDVVGIAKRGVEKFLSEKMEIIIVDTAGRHGYGEEAALLEEMKNIYEAIKPDEVTLVIDASIGQKAYDLASKFNQASKIGTIIITKMDGTAKGGGALSAVAATGATIKFIGTGEKIDELEVFNPRRFVARLHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords SIGNAL RECOGNITION 54 KDA PROTEIN
publication title The crystal structure of the conserved GTPase of SRP54 from the archaeon Acidianus ambivalens and its comparison with related structures suggests a model for the SRP-SRP receptor complex.
pubmed doi rcsb
source organism Acidianus ambivalens
total genus 100
structure length 295
sequence length 295
ec nomenclature
pdb deposition date 2001-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF02881 SRP54_N SRP54-type protein, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 1j8mF01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1j8mF02
1F3OA 1CRQA 1CIPA 4FCWA 3OIWA 3GFPA 3TE6A 2ZI7A 1EX7A 3I72A 3U5ZB 4FMBB 1HYQA 2JIZD 1E9FA 2IYYA 2OFXA 2FFHA 2ZRDA 1OHHD 1Z07A 4RCZA 3MD0A 6Q21A 1L4UA 1QZXA 2RKOA 1G20E 1B0UA 1A2KC 1ZCBA 2OBNA 3IBGA 1Z47A 4WIAA 1KI9A 2BIFA 5TXGA 2J87A 4A92A 4DCVA 1OPXA 2ZS8A 4LOAA 1ZC4A 4UQOA 4M53A 1M74A 2ZJYA 1VCMA 3WXMA 3U7GA 1G4UR 2QM8A 3BB1A 2G6BA 1GTVA 4CGZA 4A8JC 5C18A 3E1SA 4KBFA 4P4UA 4Q1BA 3PUXA 4PFSA 1SULA 5BXQC 4JL6A 4JKIA 4A4DA 5H8WA 1IN5A 2PX3A 1Z5ZA 1VHTA 4H1UA 3OFNA 3A1SA 5D3MA 2IYSA 3KJHA 2P6UA 4WXRA 4QHTA 4DUGD 3KB1A 4QJ3A 3GLIE 2HT1A 5EE0A 3WMGA 4MITA 3VKGA 2CL0X 5DIFA 3T35A 1X1SA 4Y0VA 1E99A 3RC3A 3X1ZA 3EX7C 1RC8A 4TT3D 1Q57A 3BC1A 4EPXA 2OILA 2AFIE 4Z54A 1P2SA 3KUDA 3SNHA 3K9HA 3UG6A 1CULC 1WGWA 4X8MA 5KTYA 5KDOA 4QGHA 2W6JA 2JEOA 3ICQB 3F5FA 1KSHA 3T34A 4TYYA 2Z43A 1E2LA 1S3GA 3FVQA 2BM1A 3LD9A 4CEJA 4OHWA 1F48A 2ECKA 5AUPB 4BZQA 1E2GA 4QBHA 3MMPA 3KKOA 1G3MA 4LJ5A 4WA7A 3W34A 2IYQA 3VX3A 5CITA 1J8YF 2PCLA 3WYFA 2YINC 4PR0A 4YC7A 4RVCA 3W90A 4LHWA 5D3MB 1HE1C 3AF0A 1OH7A 3SHFA 3R7WA 4D4LA 1H8ED 2F1RA 3KXLA 3CPEA 2IF2A 2ZJ2A 2ZE7A 1KIMA 1XPRA 3CF2A 4CIDA 1E2IA 5H68A 4PO1A 4ZO4A 1S2MA 1A4RA 1G5RA 3ECCA 2YKGA 1IXRC 4D4JA 4M0LA 4RD4A 2JLXA 3O47A 1KI6A 1OLOA 2OCBA 4FWIB 4QM7A 1KAGA 3EZ2A 3RNLA 2V3CC 3IQWA 2W2VA 4DXAA 1JAIA 1ZD8A 4BEBA 4WAUA 4CEJB 5JRZA 1W4RA 4W9MC 1Z2CA 2YWFA 2C96A 4YLGA 3LNCA 4GNKA 1MRNA 2DBYA 5J4KA 4MQBA 3K0AA 1L2TA 2FX3A 3R9XA 1GILA 2ANCA 4KBGA 1FUKA 1AZTA 4QBFA 1KK1A 3VU9A 4UXHA 1W49A 2PZEA 2VL7A 1Z0DA 4IVRA 5J4VA 3U60B 3R7WB 5K8UA 2JGNA 4JJKA 1GG2A 2VP5A 3U3RA 4HAXA 3BS4A 1KY2A 3I32A 3L0OA 3N70A 1E0SA 2GETA 4GDFA 1R2QA 5DNYB 1N6NA 5ANRB 2BCGY 2CLDX 1N5LA 1IAQA 3E70C 1LW7A 4MKIA 2ZSFA 4DLTA 1SKYB 1KI6B 3UMSA 1UBFA 3AVOA 4ZI2A 5BN4A 3RSLA 1MV5A 2HYIC 3DZDA 2V4ZA 2Z83A 1N0VC 5L3QA 4ON9A 3R9IA 4Q4LA 5FTNA 3U7FB 3WBJA 4N3NA 1XJQA 1D5CA 4B32A 1XTIA 3Q7PA 2YC2C 3LAWA 4AKIA 4Z8XA 3K0AB 2G9NA 4XVUA 1XTSA 3HR8A 4F4CA 1E6CA 3W8RA 1AQUA 1JJ7A 221PA 2W83A 5EP3A 5FPYA 5BW8A 5TMPA 1E9CA 2NZJA 2Z5FA 3VU9B 4BFTA 3O8RA 1K5GA 2FGJA 2QMHA 2CBZA 4M1SA 5UKDA 3RABA 1G18A 3B1YA 4PSVA 4B71A 4K46A 4AYWA 4C0JA 4DDUA 4US1R 4CW7A 4UXIA 2V54A 4I81A 2QMUA 4LBWA 4HUTA 5JECA 1Q12A 2QPOA 3ZDQA 5JZVA 5JWRA 4Q4AA 5L8VA 4DJTA 3TJZA 4CDGA 4RD0A 1TADA 3EWSA 4NPHA 3T1QA 4BZXA 4O2LA 4DB4A 3FYHA 1SHZA 5L3QB 1G9XA 4R71A 2JCSA 1DARA 2H16A 5A0FA 1E2NA 4D82A 4MGKR 2GWHA 2OCYC 5SZJA 3A1WA 1NIPA 2QRZA 1FQKA 2VTKA 4LBVA 2A3RA 4URZR 3VKWA 2WWYA 1ZNZA 4OI0A 3LLUA 2SHKA 1VG9B 2YVUA 2OXCA 1LY1A 2ZRLA 2VA8A 2KBEA 3U3KA 4L16A 5B30A 1UDXA 2CJWA 1QHIA 3BGWA 2ZANA 3FDIA 3EZ7A 2PMDA 3NC0C 5TY0A 3RS0A 3QPVA 2GCOA 1WRBA 3AKEA 1OXXK 2R6AA 1NNEA 3GJ8A 5G3ZA 4BFSA 5BYKA 2HF9A 3SQXA 2ZREA 4PZLA 1TX4B 1QHSA 4Q4AB 4XH9B 2KWIA 1XMSA 2H17A 3B1WA 2JDID 2IK8A 2ZUBA 2BMFA 4HLQB 1MO3A 1OFUX 4OHYA 2BM0A 4NCKA 3QXXA 1DO0A 2FE4A 2ORWA 1Q1EA 3AP1A 1KDTA 2CLSA 4FIDA 5JS7A 1XXHA 3PUZA 3M0EA 1QHNA 3UG7A 4JLNA 5KSYA 2B21A 1M2OB 5FBRB 4URXR 4M9QA 5JI3E 3K70D 1BH2A 3CRMA 2NIPA 2R8RA 5CK5A 4D0GA 3ZVRA 3VNUA 1JAHA 1JR3A 4KVAA 5EZ6B 3BB4A 4Q18A 1YZQA 4DCUA 2ZI6A 4LJYA 2DFNA 2CJWB 3JZAA 3PJRA 2JLQA 1UFQA 4DLUA 2GCOB 2WOJA 1V5WA 1SXJC 2GILA 3SJZA 2FFAA 4U00A 4I1UA 4O0MA 4P31A 821PA 5IHPA 4BFUA 1UDWA 3AEZA 3FKQA 3IUYA 3TW8B 2IX3A 5IK2D 1AN0A 1RRCA 2VSOA 3D31A 1XXHB 1ZAKA 1P2VA 2V1XA 4WZBE 2NPFA 4XWAA 4Q5IA 4XIGS 1VDZA 1S9HA 3DKPA 3UMFA 3SEAA 5AK0A 4LC0A 3SE0A 3BFXA 3V4FA 2FPLA 1NL3A 1VYVA 3C5HA 3RHFA 2QROA 1J99A 2ZRMA 5KYKA 1AS3A 2FJUA 2B8WA 2QPAA 4Q1FA 3RRMA 2Z4RA 1TTTA 1EK0A 4PANA 4IXNA 2VYFA 2QG6A 3B60A 1XJCA 2O0JA 4BLPA 1LV7A 1TF5A 3FHCB 3IGFA 1BMFA 1G8HA 4MDFA 2C04A 4KXFB 3FWYA 4GT1A 4OJKA 1XEXA 4IJMA 2X1VA 1XZQA 1S0UA 4G5QA 1RJ9A 4NDZA 1CR2A 2V9PA 3EZ9A 4NE2A 1G8GA 4XWOA 4C3ZA 5GJVC 1AM4D 4PHHA 5K8IA 3WNDA 3B85A 1U8ZA 4POAA 1JNYA 1D2NA 4XTCS 2ZR9A 1EESA 3VR6A 1P75A 3I4LA 2YHSA 3I8SA 3IEUA 5EXTA 1XMIA 5GJWC 4PC6A 2DWPA 4RD2A 4BLOA 4N0DA 1R8SA 4LV5B 4M1MA 4BFWA 4BFYA 1P2TA 2GEUA 2GJKA 5GADl 5KO2A 2XNDD 3NWJA 2ZPTX 5JEEA 3LY5A 1WBDA 2PT7A 2ZYTX 2ZJOA 1EWRA 4H9GA 4D4MA 4I1VA 5B2ZA 2IYWA 1RPZA 1NMXA 4FCTA 3OAAD 1KAOA 3K53A 4LC1A 1HV8A 1II9A 4PHTA 1JR6A 3GEEA 3WYAA 4DUGA 3L8YA 1DAIA 1CP2A 3U44A 4EQ6A 5FUYA 1RJ9B 2XB4A 3ICEA 4CT5A 3QF4A 2G0NA 4BRWA 2RB4A 4TT3A 2DYKA 4JS0A 3MWJA 3CPJB 2PCJA 3K9NA 4NYIQ 2MMGA 2ZAOA 5HPYB 3SC3A 2O8EA 3QXHA 1DAGA 2J7KA 3VTKA 4CZ2A 4AURA 2O8DB 4JSTA 5BN5A 2J7PD 2CLCX 1IONA 1G3IA 3DO6A 4ZDKA 5FOXA 4B3BA 2IYVA 5DYGA 4GOKA 3AUXA 1G19A 3NHAA 1UPTA 4GP6A 3MJHA 4TZ6A 2QUZA 4B48A 4AD8A 3DL0A 2BDTA 2O0KA 3DZ8A 3NEJA 5CIQA 1WMSA 3KQKA 2GXUA 4NKRA 3PUVA 3U44B 3PENA 4Q9KA 4EQ6B 3TSWA 1H8EA 4D4KA 2EU8A 1DELA 1UBGA 2J1LA 3QF4B 1X8KA 2NQ2C 4AG6A 4FMCB 1FMLA 2ZTSA 3FMFA 4JVLA 4TL8A 3V00A 4E5UA 1RW4A 4ZDWA 1KMHA 2QU8A 1E9SA 1W2HA 2IBMA 2JJ2A 3PITA 4LPSA 2ODWA 4FINA 2O8EB 3GLHA 2NO0A 2O8CA 4ARZA 4JLKA 3TUZC 4R9UC 2JLVA 5AJYA 1LF0A 3X2SA 2VLIA 3FHOA 3AF2A 4MA4A 4GOJA 5HCNA 3EPKA 2C98A 3AUYA 3W3ZB 1KNQA 1KGDA 3CW2A 1N5IA 3LV8A 4EFLA 2V7QD 3AKYA 2IS6A 1E0JA 2BKEA 2LCFA 3HU2A 4B6EA 1NBMD 1NF3A 8OHMA 4LSGA 1BIFA 4M22A 1MR3F 3W6OA 3LLMA 2EFGA 1ZRHA 2F1HA 3P27A 3QKSA 3CH5A 4BLSA 2ZRAA 3K0FA 1HT1E 1UBCA 1E9BA 1Z6XA 3CWZA 4Q03A 5FTJA 4CVNA 1B23P 3WRXC 2HF8A 4NL4H 2HEIA 3QSYA 4F92B 1KMHB 4GPTA 4MRRA 3QKTA 3WP0A 1W0JA 4LBZA 4KU4A 4PO9A 3GLHB 4HLDA 1RE0A 3KKMA 2O8CB 3BIFA 1N25A 3AKCA 5KSPA 4ARZB 3QUSA 2FU5C 2P6NA 1Z3IX 3GQBA 1W4CA 1S1MA 5EXPA 1FZQA 4NONA 3T15A 4V0MA 2RGXA 3BFKA 1HURA 3SU8A 3HU3A 3IDQA 5LD2C 2G3YA 4G5GA 3E5HA 1KKLA 2OBMA 1RYHA 1NVWQ 3QPUA 4MKGA 4PTLA 4M1YA 1GNQA 4BWYA 4Z1MD 4ZDIA 3GEIA 2IL1A 1SKQA 4TTRA 1JPJA 3QKRA 2AK2A 2CVFA 3CR8A 3X1DA 4BLTA 1SXJA 3QKSB 1NY5A 4XSHA 4I4LA 3K0FB 5DYIA 5EUQB 4XWKA 4R7ZA 3BK7A 3WBKA 1MT0A 3K0CC 1G41A 3KKQA 1XD2A 4LHZA 4RCYA 2KJQA 5CB6A 3IPYA 3LDAA 4W5WA 1N0UA 4CEHA 1Z63A 3UMRA 3EZ6A 3W3AA 5K8TA 4D2IA 3ONWA 3PUWA 3EASA 5CYPA 2ZM5A 1SZPA 2V55B 4JL8A 3WNBA 3LX5A 4N0EA 3AGQA 3RC8A 2WJVA 3KXKA 4IKEA 4KV9A 4EPVA 5HZKA 3A1UA 1ANKA 3THOA 3JZMA 2FV8A 1T8TA 2J9RA 1GKIA 2CK3A 4HDOB 4W7SA 2BV3A 1ZM2A 3IHLA 4AY2A 3QKRB 5SZHB 3QI2A 2R6FA 5FH9A 5KNDA 3RS2A 1HEIA 2C78A 4Q47A 4TYWA 1OXVA 1AKEA 2YWEA 2CXXA 3M4YA 4M1KA 2E9SA 2IWRA 2J41A 4OI4A 1UKYA 5KNCA 2QORA 5H70A 4B43A 4QXAA 4TMZA 1XD2B 3KFXA 4IOJA 1US8A 1A1VA 2JDIA 1U90A 4BFVA 1Q22A 2FNAA 1D2MA 3AF4A 3GCGA 3W8NA 4B33A 4CEHB 2WTUA 4HLCA 1CLUA 2FN4A 1QDEA 1TUIA 2VPPA 3BXZA 3TUJC 1I2DA 5DN6D 2IS4A 5D3QA 1N6IA 2VHUA 2ZJZA 2QQ0A 4BPBA 1O87A 3L0PA 1XU4A 2HJVA 3EG5A 3QG1A 5JJIA 3GJ6A 4KODA 4PC3A 1KJZA 3WRYC 4KO8A 2C99A 4L4UA 5L3RA 3CM0A 4M1TA 3NEYA 1CJUC 1T3HA 2HLDA 4XJXA 2WWGA 2ZSAA 2IWHA 2OEPA 1JR3D 3SFZA 5EE1A 2JAQA 4EKDA 1W2GA 1G1MA 3IHWA 3IO3A 1ODFA 3PCRB 1QHGA 1ZVQA 4AWXA 1KI7A 5F9HA 1N6KA 2GVDC 3MG9A 1G6OA 2Q9BA 3K0EA 1PLLA 3SR0A 2R6GA 2WKQA 3FKSA 3TW4A 3ADBA 3AQ4A 4OL0A 4NYJQ 4OJQA 3C7KA 1US8B 2CDNA 2ORVA 1ZMXA 1FP7A 5TB5A 4DDWA 4URVR 5IK2A 1GNPA 1VIAA 3Q85A 4KI0A 1Y63A 2JASA 2ZRJA 5CIWA 1T0HB 2RHDA 4HB0A 2NO1A 1GL6A 1OFTA 1G16A 3K70B 1XBTA 3ZH9B 2ODBA 2RGEA 1E98A 2AX4A 1KSFX 2VHCA 4KCGA 1GDDA 1QRAA 2WJGA 1KK3A 3PEYA 3U2QA 1U81A 4R2HA 1VECA 1CJKC 4N1AA 2FEMA 2GJ8A 4ILEA 1RVDA 4XSGA 4D6PA 1T4GA 1YHNA 2EFHB 3HR7A 4UXJA 1BMFD 1KO4A 1TF7A 5AR1A 5AJZA 2N42A 2OESA 3MCAA 2EW1A 3AVVA 3T06B 4CT4B 1JJVA 1T8UA 1KNXA 2ASEA 3G0HA 2FDCA 2FZ4A 4HATA 2ANBA 4KFSA 4BEJA 1W36C 3EPHA 5LBIA 4PQRA 2JA1A 3EC2A 4JLJA 5FPHA 1UEJA 3B2EA 4KLNA 5C2JB 1IM2A 2YOHA 3TBKA 3QG5A 4Z8YA 3KJEA 2QAGC 3IPXA 5LPNA 3BORA 4PPNA 2ZJ8A 2QA5A 2QY9A 5KPJA 1N5KA 1A5TA 2FA9A 4A0HA 1EFTA 3ZVMA 4B74A 2XNDA 3CX6A 5G41A 2Q9AA 4AC9A 1AS0A 1S1CA 4B75A 3BD9A 4DEXA 1E1QA 2AKYA 2GJAA 4FMDB 4MRSA 1YRBA 3OAAA 1ESMA 1KZ7B 2GEDA 1Z29A 5KU1A 3KQUA 1BYUA 1XMJA 2BKUA 2RGBA 4PSAA 4B34A 2JJ8A 4L15A 4K8OA 3CRQA 2ZRNA 1U0LA 1E69A 4LY6A 1R5BA 4FW9A 3T61A 3ZIAD 4C9BA 3MGCA 3OF5A 1D2EA 1YR8A 3PEWA 3R9WA 5J5CA 1ZM7A 1M6NA 4KVGA 3KDSE 4NTZA 4KITB 1OE0A 3ETLA 2ZSDA 4FD2A 1F2TA 2J7PA 4RD6A 1N5JA 3QIAA 2NPIA 4MDEA 2DFTA 3E2IA 2JJ1D 3D8BA 1KY3A 1IY2A 2OSBA 4WBSA 1OKKD 2R9VA 2VP0A 4LZZA 4JVMA 4OHZA 1OV4A 1SKYE 2CVHA 4HLUA 3TQFA 1OIWA 2BMDA 5JWOA 1BO6A 5E3HA 1WP9A 1DG1G 3EW9A 4C30A 1OH5A 1N2CE 4PXAA 3ASZA 3CRW1 3K9GA 4Q7LA 5KHOC 3AM1A 5H1YA 1GRRA 3HP1A 4E22A 4Z51A 4JLBA 2NZ8A 3NTUA 1NG1A 1JQLB 2AXNA 2RGNC 5EXSA 3LH5A 2JJ2D 3DMDA 3ADCA 2GNOA 1M34E 5CDFA 1E3MA 1F2TB 4GFDA 3QBTA 4IEIA 4DRZA 2MMCA 3I61A 2ERYA 3UK6A 1TU4A 1XJ0A 3KX2A 3OIVA 4HSEA 4NHOA 1X8JA 4DIEA 2V7QA 4UNPA 1KI4A 3BAFA 1OT3A 4IOMA 3TIFA 1N6LA 3TSOA 1SHKA 1NBMA 1P3JA 2QN6A 5FFMA 2RCNA 5AUNB 4NBSA 2QE7A 4ZKEA 3IIMA 2F7SA 1AS2A 4M9ZA 2ZSBA 4RZ2A 4JT4A 2TMKA 4TZ0A 4ACBA 1TEXA 3AV0B 3TK1A 4A9AA 1NN5A 3WNCA 4QHYA 3GPLA 2EFEB 1Q0UA 2GAOA 1KHTA 2WSMA 1PZNA 5FTLA 2QAJA 3B7GA 4LK2A 4TLCA 1EGAA 1P7CA 2BOVA 2E87A 2VHJA 4IFBA 4URYR 5JI2E 1QHHA 2I1VB 4HB2A 1W0JD 2P3SA 3QNUA 4JMPA 421PA 1XEWX 4NU0A 1UKEA 2DY1A 3SZRA 2KE5A 3PQCA 2GVZC 3IIJA 1TAGA 3GFTA 4JLOA 4JL5A 2BEKA 1II8A 1HA3A 1H8HA 3CF6R 2GJ9A 4A2QA 4LJ7A 4JLAA 4MUAA 2ZAMA 1KI1A 2WIBA 3DMNA 1LS1A 1JALA 1WCV1 1G8PA 1U9IC 2VO1A 4S35A 2FSHA 2XEXA 2IA5A 4Z1MA 1P72A 1SVMA 1Z0KA 2NOAA 1T3SA 3VHXA 3EXAA 4P4SA 1KSGA 4KFTA 2OAQ1 3T5GA 4ACAA 2DWOA 1QBKC 2QP3A 1KOFA 1SXJD 2PLFA 3LBHA 4YDSA 1KO7A 1P62B 3SFVA 4Q9HA 4DSOA 3NHBA 1J8MF 5DISB 3ND9A 4JIMA 4JBXA 1RRGA 5BQ5A 2H18A 5TVKA 1GFIA 1QHHB 4V0KA 2X2FA 2P2LA 3GJ3A 5FR1A 2YWGA 3B1ZA 5DHAA 5JHGB 1GOTA 1NY6A 2FSGA 2ZR7A 5G3YA 3OZXA 1Z6TA 4DCTA 3H1TA 2ZRGA 1II8B 1DEKA 2W58A 3D7MA 3H4MA 2PX0A 4DDVA 2YWHA 4Q7JB 3QOFA 4FCVA 3FTQA 1DE0A 2F43A 3QE0A 4TL7A 4A36A 4LV6A 1BOFA 1W47A 3DDCA 1EFUA 2P67A 1GRNA 1ZIPA 1JECA 3U4QA 4P4SB 3SN6A 4E07A 2CK3D 4LI0A 4YMUA 1SVOA 3PXGA 3RLFA 4DLRA 2GAAA 2EWVA 1DBSA 2ODNA 2EFDB 4M9SA 2ZE5A 2CHQA 4B35A 4JYCA 1XXHE 2XZPA 3CB4A 4PPGA 2FWRA 4FI3C 3C8UA 2AWNA 2GDJA 1XTQA 1T5LA 3SI7A 1XP8A 2IYTA 4DLYA 1YKSA 4IXMA 3ZD6A 4HB3A 1FMJA 5FPKA 1LTQA 1E2DA 3G82C 2N46A 4ITRC 4ZCIA 1P2UA 1R6BX 1R7RA 1TMKA 4OK3A 4DLZA 5HTKA 3L0SA 1JR3E 4KSBA 4GL2A 4MUBA 1OXTA 1W44A 2QAGA 1NSTA 5DN6A 3UIEA 1E9RA 4LHYA 1FOEB 3THWA 1QF9A 2WPDD 4A8JA 2F43B 3RRYA 2ERXA 2R65A 4V03A 3H0KA 5CM9C 2A5FA 4G5SA 5FL3A 2DHRA 4U5XA 4GMXA 2HLDD 1DAMA 1ETUA 2QRNA 4HDCA 4II7A 4PPFA 2IHBA 5EP4A 3AGPA 2QNRA 2GK6A 2Q21A 2VSFA 1W5SA 1AGRA 4NZYA 2OLJA 1BYIA 1D6JA 4G01B 2FG5A 4JLVA 3U6KA 3B13B 1U8AA 3VMFA 1D8TA 1X8LA 3U7EB 4OK6A 3V4RA 3FKSD 2IYZA 3JVUA 4Q00A 5CB8A 2ZI9A 3OHMA 1TL7C 1GZSA 4LYJA 5E4FA 3HYTA 4M8NE 4DVGA 4BE7B 2QT1A 3TVDA 3S1AA 3ZZ0A 4C0SA 4JJZA 3OEED 2XXAA 1GSIA 4ESHA 5B57C 2ZE6A 1R0XA 2J0SA 5CK4A 3THWB 4ERNA 2HXYA 2BBOA 2OFWA 2IC5A 1LF5A 4US0R 4QGFA 4Q4HA 4A8JB 1MO5A 3CZQA 4BASA 4QKQA 2CNWA 3RS5A 4NCHA 1VYUA 2UKDA 3A6PC 2B7BA 4OKSA 1WA5A 3W6PA 2CE2X 2OV2A 4IFEA 2J46A 1KYIA 2FSFA 3RRNA 5EE9A 2NO6A 5FUWA 5JHHB 1Q44A 2AD1A 1YZTA 3RWOA 2F55A 1VYTA 1GL7A 2WMNB 4A6PA 4L5BA 3A1TA 3CR7A 2PBRA 2ZR0A 1C1YA 1XTKA 1U8YA 2GCNA 3L82B 5FOWA 3TSZA 3OEHD 3EARA 3SBDA 2A2ZA 2WWXA 4EJSC 5DGXA 1DAHA 5L3SA 1QHYA 2IT1A 3KKNA 2V8OA 3NKVA 5JS8A 2ZI5A 4EPYA 5FI1B 2AXPA 3S1AB 1VCNA 4QBGB 2XXAB 2QP9X 2CL6X 2FSIA 1OF1A 2N1BA 1N6RA 1XMVA 3DM9B 4QNMA 3AVPA 2XZOA 2IEYA 4Q4HB 1JXOA 5EE5B 5B58C 2VQSA 2QP4A 2B92A 3VFDA 4Q1EA 3UWKA 2QSYA 3DM5A 4KLZA 3GJ0A 1XB2A 2GCPA 2H8KA 1Z06A 1YQTA 4KSCA 1CKEA 4B3XA 1IJEA 4DC9A 4CF7A 1NVXQ 1QG4A 2BMJA 2F1IA 1Z28A 3AVWA 1Q3TA 4NYMR 1CS4C 4I99A 2IUTA 1E1QD 1TQ6A 3CX8A 1I4TD 2HUPA 3NXSA 4OQMA 1Q3HA 1XEXB 1XRJA 3K8YA 3EZFA 4HUQA 2GKSA 4C0QC 4ZCMA 2IS1A 3KUCA 1HY3A 1TQ4A 2WV9A 3EC1A 1P9WA 4A1FA 3KQNA 2O52A 1SVIA 3PR1A 3ZIAA 5HKKA 4B3CA 4DCSA 2R44A 4Q66C 5JMTA 3O8DA 3GFOA 3Q3JB 3IIKA 1SVWA 3CLVA 1W7AA 2A5YB 3WY9A 3M1IA 3TAHA 2NO7A 4GBMA 2O8BA 3KJGA 3U7HB 1ZD1A 1W46A 3ZQ6A 5AJWA 1IN8A 2ATXA 2Q0HA 3BE4A 2UVQA 1MO4A 4M9XA 2GXAA 2QMEA 3LQQA 4HZIA 3K09C 4HZUA 4C2TA 2BVNA 2J5XA 2JJ1A 4ABYA 1DPFA 1M7HA 2CL7X 3O8CA 1OKKA 4QM6A 4AYTA 2K5UA 2ZXUA 3ZVNA 1Z08A 1NSFA 4DIDA 5CJ2A 4A15A 3OIUA 2PT5A 3GLHE 2DWQA 3D6TB 1E2FA 1O3YA 4HUQB 1ZJ6A 3RAPR 5C4MA 4DKXA 1JEEA 1A82A 4DSTA 1MOZA 1E4VA 5DI3A 1FTSA 2C5LA 4TLBA 1E2JA 2JLSA 2FPMA 3BB3A 5FTMA 1E2HA 5LB2A 2BHRA 3PIRA 1E0KA 1FNNA 1R8QA 1KI3A 1FP6A 521PA 2VBCA 721PA 1KSJA 3EPJA 3QEJA 2B7CA 4V0NA 2NO9A 1K6MA 1XTJA 2O8BB 1OFIA 5JSZA 3QVUA 3P4YA 4AKEA 2AD5A 1UJ2A 3IQXA 2BBSA 4OQLA 2C9CA 3MWKA 2R2AA 2C03A 3VAAA 1G4AE 1R5OA 2XZLA 1KDPA 4HZUB 2BWJA 1CTQA 1Q1QA 3KTAA 1OIVA 2LWIA 4QC2A 4TMKA 4EPRA 1E9AA 3WHLA 1KJYA 4JLMA 2A9KA 2JLUA 2AN9A 2Y8EA 4KYUA 1NRJB 1ZU4A 3FMOB 4UNRA 2QE7D 5CLLA 1CRPA 3EAQA 2ZRPA 4LJ8A 4EPWA 5TDHA 1C4OA 1E94E 1VG1A 4NP6A 4NMMA 3I62A 2ZROA 2B6HA 2EWWA 4RZ3A 5FPSA 3CNOA 2HCBA 5DI3B 1Z6GA 2QTFA 3GJ4A 1Z0JA 2XTMA 1IXZA 4RZUA 4V0ME 5BYJA 3EA5A 5FBLB 4Q01A 5BN3A 3L0IB 2P5SA 2GXSA 3OIYA 1XZPA 3C15C 5C4GB 5JCZA 4BECA 4XD7A 1WBBA 5AUQA 1FX0A 2X8AA 3BERA 2WJHA 4TL9A 5JSZB 1ZBDA 1FL9A 2CE7A 4EFNA 1H8HD 1M8PA 4ZCLA 1YRAA 2GF0A 3Q9LA 2VH5R 5FBQB 1HT2E 4OQFA 4FMDF 1LS6A 4G0NA 3KTAB 2XTZA 4BQSA 4MGIR 3U6BA 1RRFA 3WHKA 2WVJA 3A4NA 1UKZA 4HI0E 3LFUA 1Q21A 2ZUCA 4MKHA 3DKVA 3BH6A 4BRUA 1U0HC 2WHXA 4LDJA 4WZAE 3K0SA 2YOFA 2HT6A 3CH4B 5FBWB 4DLSA 1G7TA 3I8XA 5DO9A 5LB4A 1S4QA 1IY0A 2OXRA 5C1BA 2I4IA 3UKDA 1W5TA 2KSQA 4LJ6A 3AP3A 1VPLA 3SDZA 1AA9A 1YZNA 4LCBA 2DR3A 4C7OA 3EIEA 4ASUA 4QRHA 1W1WA 1COWA 3WYGA 1Q1ZA 2V6JA 2AFHE 3T5DA 1FX0B 4GRAA 1HQCA 4K81B 1W48A 2WJJA 4L9SA 4TTPA 2C77A 1FTNA 1CR0A 1JB1A 1GWNA 2QENA 3B1VA 1R5NA 2W6IA 2FFQA 3LA6A 1EFHA 1TNDA 5JCPA 3HPRA 3LWNA 2YNMA 1R10A 4WVFA 5F2EA 4M1OA 5E7MA 2PEYA 3HYRA 2VF7A 2HDNB 2GZHA 4QJ4A 3T12A 1ELOA 1CF4A 5KPDA 1CJTC 3FFBA 1DAKA 1FNMA 2YJTD 3HDTA 3QXSA 3FOZA 1SXJB 4EJSA 5AWFC 2QSZA 3MAAC 2FPKA 1CR1A 2REXB 1CBUA 1XCPA 2ZRCA 1UBEA 3AVQA 3CZPA 3QPWA 4XVQA 2F6RA 2WKPA 5E95A 3B9PA 4JLDA 4Q1CA 1RIFA 4C7OB 4TQAA 3Q72A 3ND8A 3X1WA 5DE3A 1J90A 3SJBA 1ZUHA 4HAVA 3RDPA 3LO5A 4PC2A 2O5VA 2QMOA 3KFVA 2D7DA 1Z0IA 1HUQA 1U94A 4D25A 2WPDA 3FGNA 5FL7D 2GTPA 3IBYA 1ESNA 2GHIA 4Q9JA 4D0LB 3KKPA 1N0WA 1Z6AA 3KJIA 4RKFA 4KJZA 4IVPA 4WW0A 4MYTA 3F3YA 2HXSA 2OE2A 1OXUA 3CNNA 4QOSA 2DCUA 4WZ6A 4HAZA 4EJSB 1SGWA 3PG5A 2P5TB 1OW3B 3L8ZA 4TL6A 4TSFD 4DSNA 4YMVA 2C9YA 2GBLC 1KI8A 3NDPA 3PVSA 2XX3A 2ZRIA 3IO5A 3TR0A 4MRVA 4XVRA 2JATA 1WDTA 4LRWA 1P6XA 1SQ5A 5JJLA 3FPAA 1TF2A 3OEEA 3I3SR 2DFKB 1UF9A 2F3TA 5AJVB 3ZD7A 4J0QA 1PLJA 4LHVA 3GP8A 1M7GA 5EUMA 3GLFA 1W4BA 1YZUA 3BFVA 1NMYA 4B3DA 5IRCD 3QF7A 121PA 5J4HA 4ZIRA 4CYMA 2CNWD 4Q02A 4C0BA 3LBIA 4TQ9A 3UATA 1Q1BA 2W2TA 1A7JA 3UXMA 2G83A 2W2XA 5AJXA 5CJPA 4LJ9A 2H7VA 4I1SA 1R0ZA 1PLKA 2Q3FA 4M4SA 1YU9A 4LYAA 3FHTA 1NKSA 4G5RA 4QGGA 3NBZC 1JXMA 4JYBA 2OBLA 1QVAA 4PZYA 5K8LA 3OEHA 2YOGA 1R0WA 4UJ5A 5DSZA 1TEVA 3PEUA 4C0HA 5EP2A 1G17A 2PH1A 1Z8FA 4L9WA 2B8TA 2ORIA 1ZM4A 2ZQ5A 5EE3A 2IS2A 1RYFA 2D2EA 2V6IA 2OCPA 2BBWA 4WOPA 1NMZA 4GZMA 5G53C 1W4AA 3AF1A 3QXJA 2D7CA 1ZNXA 1KI2A 4MH0R 3THYA 3N2IA 3GLFB 3HPQA 1S96A 3G5UA 1XCGB 3LW7A 4IHQA 4TLAA 1EFRD 3TGPA 5KUTA 1DS6A 4JZKA 4ZIRB 3KL4A 5J4YA 4Q4JA 2X19A 3GLGA 1BS1A 1XX6A 2BCJQ 1GL9B 1SVSA 4TMXA 3NG1A 3CUEF 3MJRA 2ZU6A 4RJLA 2W00A 3TNFA 3Q5DA 3U3MA 4LGMA 3KXIA 4DDTA 1K8RA 3VQTA 3W5JA 4S2EA 1E9EA 4P0TA 4B2IA 2ZYWX 4NYJR 3U61B 2CCJA 4OQXA 2WWFA 1QG2A 2A5JA 2VRWA 2WM9B 4NH0A 3AVYA 4JSYA 2UZ3A 4ZPXA 2VP4A 1P73A 2OLKA 4BLQA 2ZITA 1EX6A 4UKDA 3WMFA 3W9YA 5HKKD 1DO2A 1G3QA 4F38A 2OCAA 2FEOA 3SYNA 4BGDA 4EUNA 4OYHA 3THYB 3QENA 1J70A 1ZM3A 1L4YA 2ODEA 3GEHA 1JI0A 2C95A 1S3SA 1P60A 4Q4JB 3GLGB 3NBYC 1E32A 4RFVA 1ONBA 1E2MA 2D2FA 4FWTA 3SJAA 2KBFA 1JBKA 2FGKA 1NVVR 4C4PA 2EYQA 4JLPA 2IYLD 4TLEA 5FR2A 2JLRA 2OAP1 1VCOA 1FPMA 1MO6A 1ZW6A 1EFCA 1ZD9A 3NH6A 3B8HA 4JKYA 5CDFE 3AH8A 4RFSA 4YXWA 2PZFA 3L43A 1T3LA 2Q6TA 3N2EA 1AKYA 3VX4A 2WWWA 2QZ4A 3K0CA 2PL3A 3DHWC 2Q3MA 3GLIA 1C9KA 3UANA 1D9ZA 3A4LA 4GMDA 4XTRA 1DAFA 4CEIA 1RRPA 1YZLA 2C8VA 2GK7A 3B78A 1GKYA 3P4XA 1KKMA 1Z22A 2ZJ5A 1WF3A 1NBME 3PV0A 2GZDA 2GRJA 4L8GA 3B5JA 3L2OB 5BWMA 1CJMA 4PHGA 5J4LA 1NI3A 1KO1A 1A2BA 1Q20A 5LD2B 4IDOA 4Q19A 1N3BA 2XNSA 2G77B 2J0VA 3O8BA 3RRZA 1IN6A 2MSDB 2ZRHA 2PZGA 3HU1A 4HEJA 4PHFA 1WB9A 4V0OA 4DLVA 2J59A 3H86A 1AIPA 2AKAB 4P3YA 4RFSB 3CO5A 1KDRA 1AGPA 4FXPA 3GJ5A 1XF9A 4Q1DA 2GEVA 4LPKA 2QQEA 1YR6A 3GLIB 3NVAA 2WAXA 4YQFA 2IUSA 5M04A 1AK2A 5GVRA 1CEEA 1G3RA 1AQYA 3CPHA 3RS3A 4CEIB 4RSGA 3DVLA 1TQ2A 1RZ3A 4G5OA 1IN4A 2G1JA 3IKJA 3BOSA 1GIAA 3ZZTA 5JWHA 5IT5A 5HE8A 3EIQA 2PJRA 5FI0B 4XD7D 2BJVA 3B82A 1DTSA 2J45A 1G8FA 5KDDA 3LQRA 4NCIA 4NCNA 3IILA 2ZI4A 1Z0FA 5ELXA 3IEVA 2D74A 3FFAA 2WSSA 3T1VA 4ZI3A 1LB1B 2P65A 2ZVPX 2YV5A 3F8TA 3LBNA 1P9RA 4HB4A 3FMPB 4O2RA 1G7RA 2EFCB 2C9OA 3LW8A 1KJWA 4TMWA 5TV2A 4OHXA 5B64A 5JFGA 4Q9LA 2WOOA 4Q7MB 2Z0MA 5FBVB 2GBLA 1E2PA 2XAUA 2CHVA 3DOEA 1G5TA 2RGDA 1NG9A 5F3WB 1Z2AA 2W0MA 3W5IA 1T9HA 3ASYA 4KYIB 1IN7A 4JVNA 3B1XA 4RZXA 4M21A 1VIYA 2QI9C 2UZIR 3MUFA 1OYYA 5F98A 4ASUD 2X2EA 1KO8A 1COWD 3KQLA 2ZVQX 3RS7A 1G291 1II0A 1T6NA 1YR7A 2A5GA 2QEQA 2EVWX 1FUUA 2P6RA 5KSZA 2BEJA 1NJGA 4UNNA 2W6ID 3RSOA 1OH8A 1TQDA 3AVXA 4QBIA 5HZHA 3P20A 2ZU0C 3EIHA 4JT2A 3A1VA 1RKBA 4YMWA 1Y3AA 4P33A 2A78A 4FMCF 4EIWA 1ZNWA 3CNLA 1F5NA 4B47A 3AVUA 1EG7A 2V1UA 2R6DA 3ZZUA 1TPZA 2WWHA 1ZNYA 3EA0A 4NCJA 2XTNA 4IDPA 2QTVB 4Q48A 3C5CA 4TYPA 1HH4A 3ZVLA 3K1JA 1S8FA 4HAWA 5CLQA 4RD1A 1N6OA 1E1RD 4D80A 5FTKA 1ZM9A 4YDHB 3GD7A 5HR5A 2WZQA 4DWJA 2ZJBA 2ZETA 4LJAA 3TAUA 1NN3A 1ZU5A 5DHFA 1KDOA 1UM8A 2RGCA 5GJBA 2Q9CA 1W0KA 3KZ1E 2VEDA 1E9DA 4IDQA 5FL7A 2XITA 1T91A 4G3XA 4DLWA 1U98A 3I73A 3ZGXA 2AHOA 3GJXC 1G21E 1EXMA 3LX8A 4EPTA 4BFXA 3OE7D 3Q8XB 2ZE8A 3RS4A 2FMXA 1G5PA 4OBEA 3DEFA 2Z4SA 1VG8A 4YONB 3U4QB 4TYQA 5E7IA 3VKHA 2NTYC 3QXCA 4MGYR 2GA8A 5G40A 2EQBA 4A0GA 4EAQA 4OI1A 4TLDA 4TTQA 1PV4A 2GZAA 1YZGA 3CONA 4TSFA 4HAUA 4GZLA 1OJLA 4V02A 3SJCA 1IQPA 1NP6A 4IDNA 4WXPA 3W6NA 4ESVA 3NDBB 2I3BA 1W36B 1G64A 4KAXA 2GESA 2EYUA 2WWIA 2OZEA 3N5CA 1NJFA 4ZV4A 3H84A 5J40A 2QAGB 5J47A 3RANA 1HTWA 2FFBA 2X77A 3MSXA 4D0NA 3TVTA 3PFIA 1P5ZB 2XOKD 4X8OA 4KFRA 1ZC3A 3JVVA 1UADA 3TH5A 1V43A 1T5IA 1X1RA 4QG7A 3RYTC 5EJEA 4HDQB 5A5GA 1GKUB 4NYMQ 3ZYCA 3CRVA 4B73A 4I1OA 3TR5A 4C0AC 4A2PA 1YR9A 4F91B 5JJKA 3LRPA 1KTVA 1ZINA 4TN1A 4O3MA 3SQWA 3WMEA 2RAPA 2H92A 3FMIA 2F9MA 3MRSA 1E2EA 1VCIA 5CYOA 4PAOA 1CU1A 1E79D 2QPTA 2VP2A 4U02A 1I2MA 1MABA 3DPUA 5P21A 4M1WA 2BBTA 2ONKA 2I1QA 4OHVA 4DZZA 1XD9A 2D4HA 2J0QA 1G8YA 3A58B 4ZDJA 2RGNA 3D3QA 2IEZA 5A4JA 1LVGA 4JBWA 1ZUNB 4AK9A 4KHZA 3R8CA 1GRQA 4LHXA 2QTHA 5HE9A 4LBYA 4B76A 2GXQA 1G6HA 2QM7A 2IXGA 2O8FA 2REOA 2MSEB 2XSZA 3QEOA 2XGJA 1EFRA 2P0EA 2WKRA 3VR2A 4DLXA 4MRNA 3ZS9A 4B3GA 1LNZA 2Q3HA 3HJNA 4LV8B 3VNVA 1G7CA 2BC9A 2DFLA 1KO5A 2QL6A 1KK2A 2OHFA 1NN1A 2W0SA 3P1JA 4JBYA 1XFAA 2JIZA 4TYNA 1OHHA 4P4TA 3ZS8A 2OM2A 3WP1B 1AJEA 3I5XA 1FW6A 1P61B 1RFLA 1GITA 1MABB 2CCGA 2ZYVX 5FOUA 5L3SB 2G0TA 2IYRA 1P9NA 2XJ4A 4ZKDA 2WIAA 4TWZA 3Q7QA 2O8DA 4DBLC 5CM8B 4TQUS 2AR7A 1JPNA 3Q5EA 4Q9IA 2L0XA 3ZJYA 2JLYA 2ZIAA 3T1OA 1SVKA 2IW3A 2R62A 3K70C 1GP2A 3MFYA 4UJ3A 3CKLA 3QJYA 1N6HA 2ZJAA 3M6AA 2GF9A 4F7WA 4OK5A 2O8FB 1E96A 2JLZA 2WJIA 1KK0A 5C46F 3MWLA 4MYUA 2RHMA 1ZP6A 2HCJB 4BZPA 5JEDA 3OFND 3LVQE 5SZIA 1Z6YA 2OFOA 4YMSA 2MSCB 3TKLA 1U9IA 3NH9A 4MGZR 5FOVA 2G1KA 2IHYA 4F4JA 1XTRA 2CHGA 3ADDA 1MH1A 5SZKB 5L3VA 4QNRA 4R2IA 2Z6VA 3ADKA 3GJ7A 4LWZA 4IOLA 1CXZA 1XDBA 2FOLA 4W5HA 1U99A 4BFZA 1PJRA 4CRWB 1MKYA 2FZLA 4MRPA 3NC1C 1NIJA 3RVBA 2ZEJA 4UNSA 1DOAA 4YXWD 4U7DA 4AI6A 2A5DA 2W6JD 2CCKA 2F3RA 5EP1A 4A0FA 1OFHA 1QVRA 1J2JA 1ZYUA 1OSNA 2CEAA 4EDHA 2NMVA 4XOIA 4DEYA 2IUUA 2D06A 1DG3A 2ZS7A 4GOXA 1OB2A 4US2R 2G88A 2YC4C 5DLQC 2YYZA 2HJGA 2VIIA 2OO7A 5DH9A 4PQFA 3C4JA 2ZRKA 4HAYA 3CBQA 1WE2A 4LUCA 3J81k 4DSUA 2AK3A 1IXSB 1JQJC 4MYHA 1D9XA 2ATVA 2BJWA 3A37A 3BH0A 1NVUQ 3C16C 3HWSA 4D81A 2NG1A 2IXFA 2C2HA 1VTKA 5AUOB 4R98A 1H65A 1HE8B 3C41J 3UPUA 3U3JA 2QBYA 2AL7A 2PLRA 2D3WA 3TRFA 1NKTA 4GI7A 1DVRA 5EZ5A 1IHUA 1TUEA 1AZSC 1F2UA 1GNRA 1YE8A 2D62A 1U2RA 2XJ9A 4B2PA 5FOTA 3MWYW 4NYIR 4URWR 5KDLA 4M2LA 1OB5A 3R8FA 3QQ5A 1F6BA 1XD8A 4URUR 1NLYA 2ZRBA 3LVRE 1UAAA 3QY0A 4QHSA 3CWQA 3CIOA 4IRUB 5FUXA 1Z0AA 5LDDC 1XEWY 2A7QA 3SHWA 4DB2A 1SXJE 5GJCA 5HCIA 3OESA 2QT0A 4C2UA 3KB2A 2CMKA 3TQCA 1UKVY 1E2KA 1R4AA 2WSSD 3GMTA 2LKDA 4MKFA 4QFMA 4Q7KA 5DI9A 1JEDA 2QBYB 1R0YA 2DB3A 1G7SA 2IYUA 2VHQA 3PEVA 2NGRA 1IOZA 1PUJA 1SVLA 2DPXA 5E7JA 2IXEA 2WBLC 1L7VC 1F2UB 3BJIC 4JVSB 2PJZA 4LJ4A 4DCNA 3BH7A 2VSXA 1BKDR 1XEFA 4PQYA 4PPQA 621PA 2BMEA 1IBRA 2H5EA 4BLRA 3SBEA 2ZSEA 1E2QA 1EWQA 1CR4A 1NN0A 1OYWA 2OUKA 2F9LA 4YMTA 3UWOA 2KI5A 4Y0AA 2VF8A 4IW3B 4W5JA 1XPOA 2E1RA 3P32A 4PAQA 5KNBA 2YZ2A 1X6VA 3A8TA 1YJ5A 1XWIA 2A30A 2HV8A 3AF3A 3DOFA 5EXXA 3I1FA 2H57A 4HLUC 4DT1A 3TUIC 1ZUIA 4F93B 3C14C 1NLFA 1M1YE 4FN5A 3ZLJA 1VHLA 3I5YA 3ZQJA 3I92A 3A4MA 3FE2A 2ZS9A 1DAEA 4PC7A 3NBXX 1XPUA 1TU3A 3BWDD 1IJFA 1M7BA 1YVDA 3NBFA 4DHEA 1F60A 4Q21A 4OQNA 4PAMA 2QGZA 4AYXA 1X86B 2AWOA 4PX9A 1WQ1R 4A82A 4TMTA 1U0JA 5IDVA 4RY2A 5TARA 1I4LD 4H1VA 2IF0A 4F4IA 1E1RA 1NLZA 4LYHA 4TMVA 4KFUA 3T1TA 1W36D 5FPTA 3THXA 3SYKA 4A0RA 4D26A 3VR1A 1GAJA 1K5DA 3R20A 3LXXA 2R6CA 3X1YA 1FQJA 3H2YA 5EQTA 2HYDA 1W0KD 4X8HA 3MLEA 3EWAA 4C0LA 4DT1B 4QGAA 3VR4A 3OE7A 4E03A 4QJ5A 3NIBA 1UEIA 1I4DD 2RGGA 4A6XA 1S9DA 1G3UA 4UNQA 5GVSA 1Z83A 2F1JA 3V9PA 1XCMA 1VMAA 4GP7A 1LFDB 4HYYA 4V0LA 3B9QA 2IYXA 2J0UA 3FB4A 2QGNA 3CRRA 2VHTA 4IVQA 1MRSA 3QBVA 1KMQA 4B3FX 1J7KA 4A2WA 3GLFE 3LXRA 1CJVC 2RMKA 3REFA 5FOSA 4O25A 1T0JB 1VG0B 4Q1AA 2ONJA 2WAYA 3QVVA 4PSKA 1WXQA 4AIIA 4PZZA 3AKDA 4PO8A 1FFHA 4AG5A 3THXB 2VP6A 1L8QA 4MYCA 1IY1A 2KB0A 1XNJA 4OI2A 2RH5A 4P32A 2FH5B 3A36A 4C0KA 2WJYA 3AB3A 4G1UC 2PEZA 3K9LA 1E4YA 2VP9A 1ZCAA 2WMOB 2XOKA 3K09A 3VHLB 4B2LA 2J3EA 2REBA 3QKUA 5FUVA 1OXSC 2LKCA 1ZIOA 1OIXA 4B44A 5KSOA 4LYFA 3B6EA 2JLWA 2J0UB 2OG2A 1PUIA 3CF0A 1VKJA 2FF7A 1QHXA 3SYLA 1KZGB 1OH6A 2XB2A 2O0HA 2WICA 4IOKA 4AKGA 1X3SA 1E79A 1N6PA 4IEEA 4RD3A 3U3OA 4GSYA 2ZRFA 4LX0A 1GM5A 2RGAA 3CX7A 4AKHA 3GLGE 4BUJA 2H1LA 3F0TA 1E0AA 5JLJA 4RKEA 4EFMA 3BBPA 4B6FA 3AVTA 3RWMB 3X1XA 5JRJA 2OT3B 3VR3A 2ZUDA 4PC1A 2GJSA 1PVOA 1HQYE 3P26A 4X8LA 3REGA 1YZKA 1GUAA 3VR5A 3TLXA 5JBQA 3EPLA 3SOPA 5F9FA 3BRWD 4QL3A 3AP2A 4IDHA 2XSZD 5KOYA 3PUYA 4E09A 1DADA 2ZYUX 1P4SA 1NVVQ 3SS8A 2PMKA 5IF9A 3KQHA 3TMKA 1GVNB 2ZI3A
chains in the Genus database with same CATH superfamily
4NV3A 2CV0A 4LZWA 4WK0B 3FUCA 8ABPA 5KWVA 4IXTA 1TK9A 2JIZD 3QJ5A 2ZK7A 3I0MA 3IV6A 2O1SA 4WCFC 5C0OE 4WIAA 2Z56A 1I4OA 4NQRA 4M53A 2VAWA 4HD8A 3WXMA 2Y9MB 3V9AA 3UJPA 4PFSA 2E3JA 5IEBA 1SIBE 3KJHA 2P6UA 3VYTB 2OILA 4GAEA 4TVOA 3UG6A 3GRAA 4YB8A 2CLEB 1NW4A 3GUVA 1Y9ZA 1VE5A 4QBHA 2JH8A 2QUHA 3KLOA 3RUCA 3C4VA 4PR0A 2ZCJA 5JSLA 4GWKA 1HE1C 2H1WA 4ZOEA 4D4LA 2V26A 4IJQA 4PCAA 1KIMA 3CZ9A 4WE3A 1AX9A 4RD4A 3FTPA 4BN4A 4BUZA 2VA9A 1B8PA 4H08A 4B4UA 4W9MC 2C2WA 4ND3A 2JRLA 4EG5A 2GH1A 4V38A 1RJGA 3KS9A 3M6VA 3R0IA 1Z7YA 4BVLA 2R1ZA 4O4LF 5BVGA 1Z0DA 2FYTA 1R2QA 2WB4A 4R6XA 1MV5A 3JWGA 4PCVA 1E18A 4DIKA 4ND8B 1E5QA 1BDJA 2Q3BA 1YQUA 4A27A 7GPBA 3DT6A 1KRHA 4AYWA 2UZ1B 5BXYA 3WJ7A 1N9GB 1EE1A 2JK0A 1MQSA 1Y4SA 1PFYA 1SHZA 4KXYA 2Q46A 1E2NA 3W9BA 2RBEA 2IYNA 2J5QA 3LUJA 1GAEO 4F9TA 2QRZA 1O6BA 2R7NA 1IQRA 3MD9A 2PYDA 2ZSHA 2D0DA 1YNSA 2GCOA 3OJLA 2KWIA 2H17A 4YTEA 4OO3A 3AHEA 1OFUX 5I3CA 1YFJA 4HDSA 5FBRB 3URMA 1D04A 5LXTA 2JEYA 5AM2A 1LWOA 1Y42X 4DLUA 1SXJC 4RH1A 1YVRA 2AOVA 4CN9A 1NYQA 2B3DA 4CIWA 4W7IA 3D31A 1ZAKA 4F4FA 2OYCA 4IH4A 1S9HA 1I32A 3SE0A 4DMCA 3IDFA 2FPLA 4MV4A 3VR3D 1AS3A 2P75A 4GR5A 1TTTA 1QIKA 3G2JA 4BLPA 5PGMA 3LMKA 3G59A 5K5EA 1XEXA 3ZWNA 1S0UA 4QTUB 3ZWOA 2VRCD 2VJMA 2ZKLA 1YMUA 5K8IA 3F90A 3MOGA 1E1MA 3JWJA 2JVKA 2PS1A 4RJ2A 4TV9F 1R00A 3CA8A 2DTDA 5AVRA 4DVJA 1NMXA 3EXG1 5ITWA 1L4GA 4CT5A 1UBTS 3LXMA 5CGZA 1HFJA 1TZMA 4AURA 2F3PA 1R88A 1LZKA 2NZYA 1DWQA 3SZLA 2HA0A 3VSDA 1IYZA 3AUSA 2GXUA 2HSEA 4K9PA 4Q9KA 2XS8A 4D4KA 2X23A 1Q6ZA 3VH4A 1E9SA 4ZI5A 3STTA 3WMWA 4TKUA 4KO2S 2YRWA 3OQJA 1T5BA 1R27A 1Z33A 1PS0A 1RLUA 3ADPA 2JIRA 2R7VA 2X9NA 3OA2A 4K5QA 2A92A 4M22A 3P27A 3ORHA 1WMDA 4CVNA 3KPHA 2HRQA 3G1UA 1BCSA 5KX5B 2PLNA 2FU5C 3SU8A 3OLQA 4RHXA 2QWXA 2W11A 2OCIA 4TVKA 2X42A 4YR9A 5IC4A 4BX8A 5JYDA 3MWGA 4XSHA 3MHTA 2I2WA 1X9GA 2VTVA 1GGEA 2OU6A 2QX4A 1R18A 2XMGA 3W3AA 3GQBB 1AHPA 3V5YA 2X2OA 3VU3A 3QX9A 3E1GA 5T67A 3V7NA 3O10A 3IHLA 3GJTA 3RS2A 2GHTA 1SQFA 2W4IA 2M4EA 3I4CA 1A1VA 3Q3IA 3LLSA 3NVKI 4CEHB 4TYMA 1WR8A 2AEJA 2GM4A 3NM5A 1Y4ZA 3FZNA 1RM0A 2BHSA 2HJVA 3WRYC 1C3LA 3C1UA 2ZSAA 2AFHB 4HXFB 3H5OA 3MG9A 1K75A 1G6OA 3MXTA 1YH3A 3C7KA 5I8ZA 3LNTA 1FIUA 4URVR 4ZOLF 4JJ8A 2C9ZA 5DVZA 1QIDA 1VGRA 4HB0A 3U49A 1EZZA 1SBYA 1C1XB 5AM5A 3MBIA 4DZTA 1H5UA 5AJZA 1XTZA 3M5DA 4XYMA 4CT4B 1SWWA 2VP3A 2VSNA 1I1NA 1NJ5A 2WAOA 4EGSA 2WQ7A 5FX2A 3E22B 2ZJ8A 1CY1A 5KPJA 4C14A 3U40A 4DRIB 3ZVMA 3I34X 3PRJA 1AS0A 1YZHA 3O26A 2HMSA 4ZT7A 4K7JA 3P9YA 3I9MA 5FEMA 4QFDA 1YVEI 4ZO9A 2IOFK 1J2YA 4NZMA 2HFKA 3VGJA 3MGGA 1FF9A 3IQDB 1ICEA 4JELA 4S0XA 1OKKD 3PXCX 3TQFA 2XVZA 3GFVA 3DCNA 5JR3A 5L53A 1JKXA 4UDNA 3K1IC 3CRW1 4IO0A 4JLBA 4Y2PA 1WZCA 2AKEA 4JDPA 5DCYA 4B3SB 5BR1A 4PRLA 2PX2A 3DBHA 2EZ4A 1GNTA 1N2JA 1F2DA 4K9DA 1NC1A 1AS2A 2B61A 1P0QA 3MS7A 1U5AA 1ILWA 1JEYB 1KHTA 4LWPA 2ZIFA 4N5DA 3SSMA 2W2QA 4ZLCA 1MMFB 2P3SA 3QNUA 4NU0A 3SIPA 1L5HA 3V7FA 2IFTA 2GOYA 5IBQA 3CF6R 2GJ9A 2DH6A 5B7PA 4LJ7A 1AK9A 3DL4A 1SD1A 3TOCA 1ZCZA 5JJBA 4WEQA 3WO1A 2FSHA 4QPJC 1Z0KA 3A6DA 4U9HS 2NSGA 1EWTA 4CBEA 5KWEA 3KFLA 3DYVA 2P27A 5EMHA 2X2FA 3RUDA 3OD1A 2PLAA 3M1YA 2P2CA 3HN6A 1AUPA 2CYAA 2VYVD 3DDCA 3U4QA 2Z30A 5K4GA 4LI0A 3DMYA 1HT0A 2W2KA 1LVKA 4CL3A 4AQ7A 2UUHA 2GA0A 1T1GA 1VKZA 3H6HA 4WCFA 1HL3A 3L1VA 5JCJA 1FOEB 4RV5A 3IP1A 3FLBA 3UUEA 3UMJA 1JKJA 2FHPA 1C5KA 3WLPA 4W9RA 1MUUA 3B13B 5E4TA 5A3JA 4HPJB 5MGBA 4S3MA 4M8NE 3F3KA 1ZESA 2PNFA 2ZE6A 2J0SA 1BKSB 4B3IA 1VLTA 5J63A 3THWB 4US0R 3O1HB 1MO5A 1XNHA 2CNWA 1VYUA 3FZQA 3BAZA 4E2YA 4TRJA 1HE1A 3ONDA 2QDKA 2YN4A 3N2KB 1IOWA 1NSGB 3SBDA 1UWVA 4JRZA 5ILQA 1M6VA 3B5IA 1VCNA 2XXAB 4W8PA 5BNFA 3TDNA 2LBPA 3NHZA 1JXOA 1RACA 3R6LA 4G78A 1VE6A 4ARBA 4MQ9F 2H8KA 3M1AA 4JOBA 3ABMC 2R8BA 4QASA 2TECE 1NBIA 1O6ZA 4RE5A 4DRXA 3K35A 2FX5A 3PR1A 3ZIAA 2DFVA 1GGKA 4B3CA 2R44A 4BY9E 1N0IA 1JG1A 1SVNA 1WY7A 4X90A 2Y6UA 1U7DA 5DT2A 4M0DA 3ONFA 5E9AA 3N24A 5IWAB 3UT5B 1Z08A 3KB8A 2DWQA 3V5ZA 2UVPA 3LAYA 4HUQB 1GTSA 1MU0A 1E4VA 2XD9A 1FTSA 3FI9A 3QZCA 1JHDA 4I14A 3L0IA 3KEOA 1RLOA 4MLDA 4ZYZA 4OP1A 2DGJA 3KVYA 2OKGA 4EB3A 1BXKA 3MTQA 2O8BB 3DV9A 4GH5A 4GEHA 3IQXA 4UTXA 2C03A 3SY8A 2OXTA 1CTQA 2LWIA 1P0IA 3INGA 1JDVA 5A05A 1NRJB 4EENA 1X7WA 1QZTA 2FRVA 1CHNA 4Z9HA 3O8QB 3KQVA 1VG1A 3CNOA 2C1ZA 1Z6GA 1LE2A 3WBBA 3QV1A 3ZCPA 4CQLA 2PDAA 1T2FA 1WBBA 1WPRA 4UEQA 5JSZB 5P8WA 5FBQB 1YJXA 4MGIR 1QPUA 2IQ5A 3A4NA 4MTCA 3OQHA 1Y9EA 4BRUA 4C20A 1AQ6A 2I76A 4B85A 1GCGA 3B6ZA 4JIOA 2V6JA 3HCBA 5DFAA 1FTNA 1M3SA 3P9QA 3NDIA 4A6EA 1RJEA 4BKRA 2O8NA 1ELOA 3HXOA 3HDTA 1RAGA 2GCEA 4G6ZA 4E94A 3Q3CA 2KM1A 4FYXA 2WKPA 4KR3A 3Q7EA 1LI5A 4FLEA 2I0FA 5KQSA 4M0EA 3UNGC 3H9CA 4S04A 4HKTA 4PG8A 4G7HF 1YVPA 4RETA 3QPDA 4DWWA 2D2IA 4IDBA 3I5PA 3DJUB 2HXSA 4KBYA 1OW3B 1MNAA 1VE1A 1OXBA 4MVJI 2E0IA 3KUUA 4ZU1X 4AECA 2J09A 4JZYA 4LHVA 1A71A 2ZZNA 2VDWA 3GLFA 4XCVA 2YL2A 3STUA 2W2TA 3KSUA 3EFHA 4BN5A 1G63A 5AJXA 3IPAA 4GMFA 4H15A 3G0OA 4W9NA 3HKCB 2B0CA 3OZCA 2IUEA 2F59A 2W2OA 1XI2A 4PNEA 3OPYA 3EXHC 5HEKA 4HL6A 5KBYA 1XT6A 4CM3A 4ZIRB 5J4YA 5T4BA 1QK3A 3MOSA 4D3XA 1SR8A 3TIGA 1HLDA 2IVFA 3UC9A 3L6DA 2X8LA 3ROKA 5A06A 2NW6A 3NB0A 1ESEA 4Y7DA 1L4EA 2W45A 3AVYA 1PQPA 2ZITA 3QU7A 3AG3C 10MHA 2QUIA 5JSYA 1G20A 5DX8A 1AMUA 1UOQA 1HX7A 2A86A 4XQ0A 2G40A 3H99A 5BVHB 3KEFA 5I45A 3T52A 4LKRA 4XR9A 3N5KA 1I3CA 2WJ6A 5AJTA 3IA7A 2WWWA 3CRZA 2IRWA 5AP9A 1Z22A 5KHAA 2ZBQA 3B5JA 4PHGA 4J07A 1HDCA 3IOYA 5KC9A 1K1EA 2AYZA 3OY2A 3E23A 2V4UA 4JURI 1M83A 2RHHA 1NNLA 3FNHA 4LJSA 5DEOA 4AWBA 3CO5A 2MSNA 1N3IA 4Q1DA 4G24A 3PXDA 2EQ5A 2V59A 1Q0LA 2O2HA 2IGTA 1AKVA 4G5OA 4I2NA 2I8LA 4C08A 3H1EA 2NYRA 2GVNA 2YVAA 3K1AA 3C97A 2OD2A 3QW4B 3FUTA 3S40A 6AT1A 5C37A 3DJNB 3LBNA 5GM2A 1VRVA 4KIWA 1R6TA 1GZDA 1JHVA 3OTOB 4JVNA 4MR8B 5DZSA 5AKKA 1JSXA 1LH0A 3KQLA 1I7NA 4J0EA 3RVPA 3A28A 4RGVA 1O6GA 3WYCA 1KJNA 3AVXA 1AGNA 1GTZA 3DBOB 1TJ4A 3TD7A 4YGXB 4MARA 1K0UA 3IPCA 1BFKA 2CLFB 2GZ2A 4KR9A 2VPYA 1O0BA 2WZBA 1SG0A 5K6TA 3T7IA 1H1DA 2PZMA 1Z23A 4YWJA 3D7KA 3K2IA 3IURA 1P1FA 4CUJA 2RGCA 3NAMA 3CQ9A 5FL7A 4OB6A 2XITA 3I8OA 4IKOA 3ZGXA 5FKJA 2D00A 1G21E 3KKLA 4EPTA 3OE7D 1UJ5A 2JJQA 2ZPUA 3UK2A 3HFJA 3ETGA 1C0EA 2QG4A 1JSZA 4WBNB 2Z5GA 3ZHQA 1I0LA 4KAXA 1XP5A 3EQ6A 2Q1UA 1T29A 2YDXA 3BILA 4YJ3B 5ADHA 3UYKA 1H69A 3E8XA 2QVXX 1B43A 3B0PA 2VDPB 3CAXA 5JNRA 4U1RA 5K3BA 3FWPA 3K1IA 2QPTA 2JIMA 2ONKA 1EM6A 4FGJA 5AI0A 4JBWA 4AK9A 2WUEA 2IXGA 3M49A 5C5EA 1AD2A 2DVMA 2CLMB 4J43A 1BEEA 2DFLA 1ST6A 1KK2A 4KIJA 2JGFA 3CT4A 2JIZA 3ZE9A 1XOIA 1G1AA 3F7TA 2ZYVX 1N1DA 2HUJA 3D8HA 3G8YA 4Z99A 2BGKA 5CH8A 2L0XA 2JLYA 3IQGX 3KBOA 1E96A 4G4JA 3Q5GA 4E17A 1UJ6A 5SZIA 3D6NB 1PR0A 3RNOA 1DOVA 2QD4A 4AZ0B 4QNRA 4GS5A 2FWMX 3DE7X 5HUQA 2I5PO 4YRQA 3GCXA 3BSFA 1XHEA 1C3JA 2A5DA 3E4CA 5C3MA 2KYRA 4XOIA 5DH9A 5E9JA 5FULA 1GZVA 1LI4A 4YMGA 3G8AA 2J85A 1HE8B 4JP1A 3O94A 1CQIB 2WVQA 1P2FA 3KYCB 2A69F 3SDSA 3ETJA 3EVTA 1P8AA 2BISA 3IKTA 3VUFA 5FUXA 3NO4A 2H2AA 4HUJA 3DV2A 4R7TA 5LC1A 3SCZA 4PBRA 2NGRA 1PUJA 5B6PA 2WBLC 3HTXA 4HFKB 1UDAA 2VSXA 3UHFA 2QN1A 3RGGA 2ABWA 5JH7B 3SBEA 3HRKA 3I05A 4DA0A 5BR7A 2YJ4A 2E1RA 4O4IB 1PR3A 1C41A 2AG8A 1ECCA 1M1YE 2CXTA 4WN3A 4X00A 5G0UA 3UMVA 1SUFA 3L1IA 1ORDA 4YCJA 1MB2A 4M49A 4HEQA 4A0RA 4QPPA 5AXBA 1XVTA 3H2YA 2JB9A 4C0LA 3VR4A 4KQIA 1RXWA 3DVQX 1WOLA 4EG8A 3D8NA 3QH4A 4GKBA 3TRDA 3AG5A 3C6QA 3PDIB 1CUIA 3WK6A 4O2AA 3RBXA 4HEHA 4A2WA 4MW2A 3LYAA 2ONJA 1M73E 1N2OA 5KAPA 3ILXA 1R0BA 1PP4A 4PZZA 4PO8A 2R3SA 1L8QA 3QUAA 1XNJA 3WWCA 3QOWA 3ISVA 1XF1A 2JF0A 3R23A 4MV5A 4WV3A 3FYDA 4GM0A 3SEQA 3GOQA 1QCZA 2YHUA 4ZPJA 3CBGA 3PC2A 1D7OA 1RYDA 1SCBA 3WK7A 2I62A 3F0TA 2I2BA 5A0VA 2PP4A 3VR3A 1NQWA 2ZUDA 4PC1A 4X8LA 3B7PA 4ZODA 5KOYA 2IZ0A 3KQHA 1NVVQ 1V8PA 2HAEA 1V1JA 3L7BA 5JS2A 3L93A 2VRCA 1TJ3A 1NDHA 2C4UA 3I6BA 2UUIA 3U39A 2GPAA 3G9ZA 1QZXA 1B0UA 1P7WA 1Z47A 3NKFA 2VYQA 2WWRA 1Z5PA 2QM8A 3X44A 1JR8A 1MIOA 3N8KA 1K5PA 1W94A 4EHNA 4H7DA 4UEKA 5H8WA 3EXEA 4OFBA 1E64A 2PVCA 1JPVA 4Z0NA 3VKGA 1POXA 5ERXA 1RC8A 1P5JA 2AFIE 3E9NA 3P0FA 3SNHA 2XHZA 4F4HA 3CWCA 4EUSA 2X7JA 1N4AA 2JEOA 3T34A 3VDRA 4TYYA 1XZDA 1JEJA 5AUPB 1PNRA 2DZDA 4MWEA 4WK2B 1J8YF 3W90A 1KC3A 2YJ6A 2WM8A 4E0BA 3FSEA 3BKWA 2JLXA 3KELA 1ZMRA 1Y8QA 4RVDA 3QLVC 4CEJB 4BO0A 1QPBA 2GWRA 5I7RA 1K2WA 2FX3A 3TAXA 3UJNA 5JAUA 1QJ4A 1W76A 3G1TA 5BSEA 1GG2A 3Q2KA 3TR6A 4HAXA 5CX1A 2C1EA 1J0BA 4EP1A 4CTOA 1H7IA 3RSLA 2Z83A 3H9EO 3Q7PA 2LDXA 4RYDA 3CH6A 2Q1SA 3BEDA 5FPYA 2EBWA 3DWIA 1MW8X 4ROTA 3B1YA 1C0LA 3QTBA 1NVGA 2VATA 4PZAA 4A0SA 5L8VA 3N2ZB 2QM0A 3H5VA 2DI3A 4AF6A 4A7PA 4BAUA 4H4EA 3OOEA 3SXZA 3EODA 3HJCA 1FLAA 4N6OA 1QTNA 5FBZA 4WY5A 5ICCA 3TB6A 3I2YX 3LLUA 1JAZA 1AHIA 4EO4A 3LNRA 3SQXA 1V6AA 3H9GA 4JUCA 4LS3A 1ZJ4A 4NCKA 3OP1A 3LQ4A 3ZOZA 4JGGA 4TWIA 2G67A 3K8ZA 3UG7A 5B53A 5AXCA 3CRMA 1IULA 5LVAA 4KVAA 3EVEA 4O1MA 4DCUA 2PKEA 3RHSA 2DFNA 3PYXA 4QI2A 1KDZA 5JMPA 5C7OO 1NQVA 2FFAA 1LX6A 1SR2A 2OP0A 4WZBE 1JQ3A 1YS7A 2IW1A 4R1OA 4KC9A 3IAHA 4H3VA 3E8SA 1EK0A 2XGOA 2H1FA 4MDFA 5DP1A 1NUQA 5I9BA 4X20B 1E89A 5L4NA 2UYCA 1FFEA 1P75A 3MC1A 1Y6ZA 3ZWDA 4QULA 1FYWA 4LV5B 4BFWA 4UU1A 1Q0QA 1PL8A 2XDAA 2ACEA 2G36A 4U5EE 2X0FA 1ICIA 4UBKA 2PUJA 5B2ZA 3RH3A 3AGUA 4LC1A 3L8YA 1L8XA 4AXBA 2B78A 3FHDA 3IERA 1WETA 3OFVA 4EY7A 3AHHA 3CZ5A 2PKXA 2HHJA 4RKYA 3OEOA 2IYVA 2RC5A 2BDTA 2O0KA 1O5OA 4FJ0A 3TSWA 1I33A 1AEPA 4G0VA 1JIUA 3G17A 1NU7D 5A4DA 1YZYA 4LMAA 2J9BA 2IQIA 3OCVA 3G3EA 2VLIA 3QVJA 3CLUC 3RROA 1E0JA 1KQOA 4YP6A 2GKOA 3P7MA 5LA6B 4INAA 3L7AA 4GVPA 4RELA 1ZR2A 4O02B 4NCXA 1HT1E 3C7JA 4N7RA 3A6EA 3FY4A 4ATNA 2PKQP 1PEKE 2XMPA 2AXEA 2VDLB 3HNOA 1NE2A 2ZTMA 2MR6A 3EDYA 3DZCA 1F8XA 3QUSA 1CQJB 3ZDDA 4PV7A 1Z17A 4FOOA 2GNAA 1VHWA 3VNSA 5KJ6A 1M1ZA 3AFNA 4ZDIA 4J0FA 2GKGA 2EP7A 1I1OA 1Q77A 4BNNA 2PAAA 3R7AA 1PSWA 1NZDA 1IZZA 1XD2A 1A4XA 5DWDA 3UMRA 2O0LA 1EHYA 2Y9PB 4B7AA 1N1EA 3KP1A 5IS2A 3KXKA 4KV9A 5HZKA 1GKIA 1UAYA 1EK2A 1ECPA 2HSGA 4FIZA 4FR5A 4DNFA 3IJEB 5FH9A 5HCUA 3Q7LA 4H77A 1TVKB 3WNQA 2XNKA 2XYGA 5KNCA 4B43A 3KFXA 3GCGA 3PXBA 5EVJA 3BXZA 1QDEA 2P0YA 4JBGA 2C4MA 2RI0A 3ONEA 5JCJD 2ZP1A 3KAQA 2WYVA 3QG1A 1C0PA 4PC3A 3RF7A 4G85A 3UAGA 3AG2C 1T3HA 3OM1A 2OEPA 3COPA 3T4RA 2HJHA 2N0SA 2FR8C 4YROA 2EJBA 1TCAA 3UJBA 2OZPA 4KI0A 4ZCPA 1U1EA 2PZLA 2VHCA 3UMCA 4BYMA 3TOSA 1GZUA 1JDBB 2VZ0A 3Q3VA 4JYAB 1OVMA 4A3SA 1DJQA 3EPVA 2OO3A 4BQPA 4QXRA 2ANBA 1NBOA 1Z7GA 4Y3UA 4WTOA 1ZGAA 3IPXA 4C4XA 3BORA 2PH7A 1S1CA 5IJAA 4G84A 4DEXA 1ISIA 1ESMA 1N3LA 3NRBA 3OTWA 4X61A 2VK4A 1QK4A 3D1JA 2PXXA 5C5DA 5DTJA 4L8YA 3ZIAD 3MGCA 4XASA 5EZYB 4UTPA 5FWAA 3Q88A 4KVGA 3QITA 4BHTA 2I9KA 1Y37A 4RD6A 3R0XA 3TBHA 3DGEC 4MTFA 4IYRA 1WATA 4FNGA 1EGMB 2G4VA 1OXKA 2QMQA 2WFLA 4WBSA 2IXDA 4YLEA 2UYQA 3PNKA 4TWAA 5LIPA 3HJFA 3K9GA 4DLLA 2PAFA 3IXLA 1XZKA 2V7BA 4IEIA 3TYXA 3ZV5A 1PZMA 1CRLA 1CK4A 3LUPA 1P3JA 4RANA 4I9UA 2HRRA 3IIMA 2GRAA 5EIFA 4JT4A 4TZ0A 3KWJA 4C7JA 1Q0UA 2Q6OA 4HGRA 1H9TA 5C4IA 4URYR 1P7CA 3W04A 3BXGA 3L18A 4X1KB 3EUAA 3WJ1A 3B1KA 1HA3A 2ZAMA 3L4JA 1R4MA 2JZOA 2J4FA 4Y0NA 1EVLA 1GZ6A 3N05A 4O6MA 4X5OA 4RSRA 3EWIA 2VWPA 1FMWA 1E6WA 4K6KA 1QBKC 3KWLA 1SXJD 3G2NA 1J8MF 1YE3A 2GDZA 3HCOA 5ARDA 4IUBS 1P2GA 4QBKA 2P2LA 1T0PA 3NHYA 3TQIA 3H1TA 1QIHA 5BWNA 2PX0A 2P11A 3K5HA 1EFUA 1ZL0A 2AUNA 2HIGA 2QVBA 3VHXB 1Z35A 4D99A 3M6MD 3TL2A 3ZDXB 3WRVA 5EFZA 1T5LA 4DLYA 1EAMA 5EGNA 2YVQA 4JW1A 3DLCA 1PGJA 2XL4A 1UH5A 4BB0A 1RYZA 2QAGA 1Q7EA 4LHYA 2OHVA 4JI3B 2P2GA 3C6BA 4RHUA 4IUCS 4ETMA 3NM6B 5C35A 1EVEA 1SK8A 1D6JA 3NV7A 3FKSD 4DV2B 1PT9A 4DVGA 4QOIA 2CXSA 4CL2A 3DOCA 1MNQA 2H31A 3AJRA 3BSWA 4F5ZA 4QGFA 3ZV4A 3U4MA 5IXSA 3I42A 4QKQA 3JQGA 2B7BA 3B3QA 3GR6A 3IE2A 2E85A 2FSFA 1ZK4A 2F55A 3CR7A 1U8YA 4I6GA 3WGHA 4YUXA 4BNHA 4C4SA 3AVPA 3NM4A 3QLVA 2UZ4A 1NBBA 1RCFA 1DIHA 5DWQA 5AFSA 3URKA 2FF5A 4KLZA 1V4VA 1H2RS 2PM8A 3TFWA 4CF7A 3HWRA 1Z28A 3V55A 3DE3X 1NI5A 2LIPA 1I4TD 1P77A 4DUPA 3A05A 3VU8A 2BKXA 1ONPA 3FD8A 4GBMA 1HMDA 2ATXA 5ER6A 2YLDA 2L69A 2O7SA 4Q7CA 4YCSA 2K5UA 1NSFA 3I6YA 4QSHA 3BRJA 5CJ2A 2ZWVA 3QMWA 3BD8A 4DSTA 2C5LA 1T4CB 5ERGB 3IX7A 4YJHB 1UZNA 4GZ6A 2NO9A 2XRFA 4P9TA 4M8KA 2BBSA 2L6HA 2VCAA 2F8LA 2XMQA 2X0EA 3DTNA 1E9AA 4ZAZA 2A9KA 3JTMA 3HXKA 1LXCA 1DFHA 2C5AA 4AZWA 4XYGA 2HCBA 3RYFA 3EOBI 2X4GA 4XPIB 1WW8A 4Q01A 1FVHA 2P5SA 1ZRSA 3CEMA 1Y81A 4BECA 2Q7XA 3O55A 1H8HD 1GG9A 2VF5X 2PXCA 1FMFA 1TO2E 5IUNC 1P6QA 2DGDA 4D9CA 1OC4A 1CB7A 5H02A 4O29A 1I9CA 3OLWA 5AMXA 2Q6LA 1GGQA 1WUTA 5C1BA 1VPLA 5ALYA 5BN3B 4EBJA 3E82A 4HYEA 4QRHA 1Q1ZA 3H1AA 3U9JA 4CIYA 2HSJA 1YTUA 1CUCA 1MA3A 5F2EA 5HJ7A 1P1RA 4FSDA 1ZW3A 2Q7RA 4EZEA 5KPDA 3QXSA 4KAAA 4DBLE 2AJ8A 2OJED 1XCPA 3CZPA 1DUSA 2HJ3A 1VL0A 3B9PA 1XL0A 3KCNA 3PF8A 1ZUHA 1ZIYA 4B46A 5FL7D 1V3QE 1X1CA 5IKPA 4P8RA 5HK8A 2OE2A 1KEKA 4WZ6A 2ZSKA 3PG5A 2BTQA 2P5TB 5FXMA 1WPQA 4KQJA 3LDHA 4N03A 4DXDA 1SQ5A 2WW8A 5CHYA 4KWIA 9ATCA 2H6EA 4DA9A 1V11A 4C0BA 3VI3B 2AW3A 4L75A 3N59A 3S99A 3QFTA 1PLKA 1YU9A 3ZQ4A 4QGGA 2ZZKA 4D9IA 1J49A 3K94A 1SUCA 4A16A 1LLQA 1B1AA 3MTAA 4DWVA 1ECGA 1AA6A 4OB8A 1Z6ZA 3E4DA 1T8WA 3R76A 3ZV6A 5AVWA 3DBVO 4P9NA 2PS9A 3GLGA 1KZ9A 1GFSA 3KXIA 4Y98A 4NAUA 4WNAA 4XWJA 3DC7A 3PEFA 2A5JA 2A1DD 3IMFA 4NH0A 4E15A 3GUHA 4KV7A 5HKKD 3RIHA 1T35A 1DO2A 2FN3A 1G3QA 3THYB 4KH0A 2W7TA 4LTMA 3G2KA 5K0SA 1D1TA 5LQCA 5FI3A 3F3SA 3DCYA 5KI6A 1NI4B 4R7GA 1SU7A 1N92A 4BKQA 1L3PA 1ZW6A 4B8WA 2WJPA 1RWQA 4W4TA 3A32A 3ENWA 3FPCA 1PDWA 3GHYA 2G82A 1GFZA 1PYGA 1UK6A 2Z8YA 1V5FA 4ZGBA 3H5LA 5A6AA 4ZVNA 3TDKA 2RH8A 3WHIA 2J9GA 1DKMA 4NTAA 1M54A 1AIPA 1NP7A 1OGIA 3SVLA 1E3SA 1AGPA 5T7BA 1OR8A 2GEVA 2V65A 4HTAA 5AOBA 1TMGE 5IWCA 1OTHA 5IT5A 4QOGA 5FI0B 2YV4A 1OQAA 3FOFC 3EFOA 1IDN1 4EJ6A 4ZI3A 1C8BA 2WIKA 2F1OA 3A9VA 2FR8A 5FBVB 2ZFUA 2Y27A 3ZHSA 4KACA 1IN7A 3SZ3A 2BMWA 2B6NA 1QZ3A 4BIIA 4JKVA 2X2EA 2EVWX 2LV8A 2BEJA 1YZ3A 4MW0A 4IWXA 4XVHA 1DWUA 4CL8A 3FUWA 4JT2A 3MJTA 1Y3AA 3S0XA 4PCUA 2NU8B 3RVOA 4ZC1A 1NUPA 1TPYA 4X62B 3TM5A 3AJEA 1T15A 2WWHA 2GFQA 3K1JA 3CNHA 1GQSA 2WZQA 3WX0A 4TUYF 3ELDA 4OIMA 2R7OA 1OWLA 4I1MA 3PQDA 4DDHA 3VR4D 4HC4A 4TV8F 2D6FA 4QAQA 1YHZA 2Q2NA 3J7TA 4PXSA 4ZT5A 5FNVA 2GA8A 4YJ2B 2VWQA 5JNUA 4LMPA 1PV4A 3VZRA 1CUVA 1CE8A 3NHSA 1P3Y1 2EYUA 3RHZA 4H7JA 1C02A 3C2QA 5IJ0B 1AURA 1HTBA 1WG8A 1N5OX 4MVCA 4D0NA 2EZTA 1KE1A 4PFPA 2FQYA 4HDQB 4F91B 3WXBA 2QSJA 2VP2A 2Z98A 3LY7A 4DZZA 3FXHA 2GFIA 4AROA 2PKYX 5CFZA 5A5DA 2HCFA 1GRQA 1ZMTA 3I1YA 1JVNA 3OA1A 3OZSA 3M34A 1LE4A 1T1JA 2GGSA 2C4VA 5T1DB 3ECAA 3Q3EA 1BX3A 4G8DA 1HLPA 3TLMA 3WP1B 3SXMA 1P9NA 4GI3A 2I6FA 4ALKA 3RG2A 2QHXA 1JPNA 2QYOA 3ZJYA 4GC5A 1ZDMA 2HNAA 3K70C 4DBRA 1Y6JA 2WJIA 1XCBA 2JNWA 4EABA 3AFMA 1I9GA 2CD7A 3PQ5A 4U9IS 4R2IA 3CU5A 1PJRA 1MKYA 4TKVA 2O23A 4JB0A 4F46A 4RTQA 5BUOA 3H4VA 1JP7A 3AM5A 1ZYUA 4EDHA 2H65A 1DG3A 4MOWA 3T9AA 2P4UA 4LF4B 2YC4C 4BJ6C 5DLQC 2HJGA 4EWCA 2VIIA 3CXUA 1I3LA 1WE2A 3J81k 3S2YA 1KH3A 2YWCA 4RDXA 1JG7A 1VJ0A 2B37A 2XZDA 4BNDB 3WOHA 4HH3C 1OQCA 4B2PA 3PHF2 5K1ZA 3WLEA 2G5PA 2II6A 3O2QB 5IBPA 3BXFA 3WYBA 4YRNA 1EIZA 4K9KA 2QT0A 4FM9A 4QFMA 4ZV7A 4ZHQF 2EP5A 4O6NA 1CHDA 1SVLA 4M46A 3T4XA 2IXEA 3LC0A 1JKIA 3A4IA 1KBOA 2ZWOA 2PJZA 2XYRA 2QLAA 2BMEA 1RABA 1T9ZA 1L6IA 3Q3HA 5I9MA 1XPOA 4G56A 1T2NA 1GN8A 5L0JA 1P5RA 5C8YA 3SF8A 1U7XA 3AUFA 4TTVA 1N2HA 2I4MA 2QUAA 1MEJA 4ZT4A 1BQEA 4JP2A 4OIFA 1Y5IA 1X19A 3B1JA 4QQRA 3E35A 5TF0A 1U0JA 4RY2A 1FS6A 5KKCA 2IHVA 3X1YA 5EFOA 1C7ZA 1VKOA 4QGAA 3TQRA 1UC9A 5KOJB 4CS9C 4G07A 3VMMA 1Z34A 3OZBA 3RRJA 2VLBA 3BK2A 3P5BA 4O25A 1WXQA 4FAPB 2R5WA 3TZEA 2AA3A 1CEYA 5KIAA 1IOLA 4B31A 5ILGA 1T2EA 4KC0A 2YW9A 3CNBA 1M76A 1ODCA 1LLDA 4ABTA 2XUIA 1KZGB 2M6SA 1MVLA 3K0KA 4PVCA 1GM5A 4G23A 2VCEA 4N6CA 1H2WA 4BEWA 2ZUUA 3ENVA 5IJ9A 1FMTA 1D6SA 2R6HA 1GUAA 2FRXA 3EPLA 4UEOA 4CM4B 1IB6A 5GONB 4A0QA 5NULA 4KQFA 1TTQB 4LRUA 4UUPA 1H1LA 3MTIA 2R9RB 2J6BA 3VNAA 1A2KC 1ZCBA 4ES6A 2J87A 2FW0A 2ZJYA 4YYZA 1V39A 3E1SA 1XDGA 3DAOA 1M2EA 3ZE1B 3DZIA 1Z5ZA 4GXNA 2AG1A 4QJ3A 3RM3A 2YCBA 2AV6A 4L5AA 3MM4A 2WJ4A 5K05A 4KR6A 5JCOC 1YC5A 2I8BA 2BM1A 3W2IA 5TRTA 2DAPA 1SXGA 3MMPA 4EMSA 3N8IA 4YLYA 4PCLA 3F97A 2OC9A 4RVCA 5IUKC 2XUQA 1W6RA 1R8JA 3STHA 4FKBA 7MDHA 5BQFA 1SXPA 3LTNC 2OQMA 4O4HA 1XTUA 1Y5LA 1WKCA 3C0KA 1KI6A 3FCXA 3IAUA 3EZ2A 2W2VA 2YN0A 4GSLA 5DCWA 1EFVA 3BD6A 1Q83A 4MHTA 5D85A 1JHMA 2B1JA 2AGVA 3K6KA 1G6Q1 1ZS9A 2O54A 5J4VA 3ZCTA 3U3RA 3HCWA 1KY2A 3N70A 3OWOA 1OBHA 5JVEA 3EGWA 1DEOA 4BMVA 4DMHA 1KZ4A 1QXSA 1ZCFA 1CJSA 3DZDA 1QH0A 4MVSA 3I2JA 5F9MA 4Z8XA 2QRLA 3TSAA 2EKLA 2RE8A 4FHFA 2XB6A 1WS6A 1U31A 4ZWNA 2OGUA 4MQUA 4R1QA 3U7RA 4X7MA 3RABA 4K46A 4E1AA 1Z4LA 3LCMA 2YY7A 3ZDQA 2MWMA 4RD0A 3EFEA 3FW1A 1QJCA 5L3QB 4I9NA 1VRWA 4RPHA 3MTGA 2Y3BA 1D2RA 3K0HA 4HOYA 3L1MA 2HSWA 2QX8A 3CZMA 2ESRA 3U3KA 5TY0A 2PMDA 3DXYA 5G3ZA 5KNCD 2O7VA 2F17A 4PZLA 3RJ9A 1IK6A 1A0BA 1CFJA 4OHYA 4JI6B 1KDTA 3GV0A 3IJ5A 3E3OA 3HCAA 5IC6A 3DE4X 2CD9A 5CK5A 5CB4B 4F1JA 1I0IA 3O9ZA 5JAHA 1KOGA 5EZ6B 4NPAA 1SZJG 5H3LA 3I0ZA 3P5SA 4LJYA 2TMDA 3NZEA 5J9FA 1FYXA 4JWKA 4K40A 3L7CA 3EBLA 2NPFA 1C3EA 2BR3A 4QELA 5CRIA 4UTRA 4P83A 2AX3A 4RK7A 1PJ8A 5LWHA 2QG6A 5HXAA 2X4IA 3JQBC 4ZD6A 4TMYA 5MFPA 1VIVA 5BSWA 4G5QA 1YQQA 4NTFA 7YASA 4G9GA 2YBDA 4DN6A 4DMKA 4CFZA 4HN4B 4IZOA 4BJ5C 4X6XA 3NJ4A 4XTCS 4WN9A 3LT1A 4YO8A 4RD2A 2E6KA 1JZSA 1P2TA 2Z15A 2Z3WA 4REQB 2WVOA 3I2IA 5D51S 3LY5A 3FPGA 2ZYTX 1F3LA 2FY8A 1RE1A 5ITZB 5LKAA 1RPZA 2PFDA 2GYWA 4LWQA 5HS4A 4A4AA 4RH3A 2G0NA 4BO3A 1BNCA 4F5DA 4KXXA 2MMGA 3CR3C 5HPYB 1BW9A 1A77A 4CZ2A 1JG4A 2CLCX 4ZDKA 3ZDLA 5FOXA 4CCSA 3AUXA 1T1SA 1FU4A 4AD8A 4KQ9A 3ULKA 9LDBA 3R77A 5AI5A 1L5OA 1OROA 5LMNB 5J3JA 5K0EA 4F6LA 1F1BA 4E5UA 4MVZA 2HCTA 3LYLA 4YAGA 4OHPA 4NXNB 1L8AA 3FHOA 3EPKA 4IICA 1BJTA 1HEUA 1YTLA 4PHCA 2NT4A 5JAMA 5BSTA 5FTJA 4KXNA 2SCUB 1CIJA 2K7ZA 4GPTA 1YVIA 1FYFA 3A70A 2QVZX