1J8MF

Signal recognition particle conserved gtpase domain from a. ambivalens
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
295
structure length
295
Chain Sequence
b'LLDNLRDTVRKFLTGSSSYDKAVEDFIKELQKSLISADVNVKLVFSLTNKIKERLKNEKPPTYIERREWFIKIVYDELSNLFGGDKEPKVIPDKIPYVIMLVGVQGTGKTTTAGKLAYFYKKKGFKVGLVGADVYRPAALEQLQQLGQQIGVPVYGEPGEKDVVGIAKRGVEKFLSEKMEIIIVDTAGRHGYGEEAALLEEMKNIYEAIKPDEVTLVIDASIGQKAYDLASKFNQASKIGTIIITKMDGTAKGGGALSAVAATGATIKFIGTGEKIDELEVFNPRRFVARLHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SIGNAL RECOGNITION 54 KDA PROTEIN
publication title The crystal structure of the conserved GTPase of SRP54 from the archaeon Acidianus ambivalens and its comparison with related structures suggests a model for the SRP-SRP receptor complex.
pubmed doi rcsb
source organism Acidianus ambivalens
molecule tags Signaling protein
total genus 100
structure length 295
sequence length 295
ec nomenclature
pdb deposition date 2001-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF02881 SRP54_N SRP54-type protein, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 1j8mF01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1j8mF02
3E70C 2Z0MA 2ZJYA 4LBYA 1ZUNB 4HUQA 1Z0IA 5HKKA 1Q21A 3RWMB 3C7KA 3KX2A 3TH5A 4EDHA 3LBIA 3KQKA 4RCZA 4AKEA 5FL7D 1JECA 4CEHB 1KDTA 4OBEA 1F2UB 3R7WA 5JMTA 3EA0A 2BBTA 4DSUA 4DXAA 2A5FA 2BV3A 3W6PA 1V43A 2LKDA 4WZ6A 3QPVA 1CEEA 3BXZA 2V7QD 3IGFA 2REXB 3VMFA 2CXXA 2C77A 4PZLA 3CH4B 4N3NA 4DUGA 2QPAA 4RCYA 1M34E 5P21A 3MJHA 3DKPA 2FV8A 5KU1A 2YOGA 2Z4RA 5GJCA 2JLYA 4PZZA 4P3YA 4II7A 4XSGA 3LO5A 4TLCA 4PQYA 3WMGA 5AUQA 4XWKA 4MA4A 4HB3A 5BYKA 2NO0A 3GLIE 2MMCA 1TNDA 2IC5A 1S3GA 2J0VA 2CHVA 1RW4A 2XNDA 2G0TA 4HDCA 4M1OA 4TYQA 4A8JB 3GLGA 3G0HA 2V8OA 4ABYA 2V3CC 4MRSA 1NN3A 1T91A 2CE2X 4OQXA 4Z1MD 2IF0A 2CK3D 1D8TA 1ZM9A 5FTJA 4A4DA 1VMAA 3KKOA 3U3JA 5AUOB 3M6AA 1RRPA 3M1IA 4G5GA 2HLDD 621PA 4ZDWA 4LHYA 3HR7A 3F0TA 1KJYA 3K0AA 2JJ2A 2QEQA 4NONA 3QKRB 3V4RA 4ARZA 1OFUX 5EXSA 1BS1A 2ZYVX 4WBSA 4DDTA 2AR7A 4IRUB 3CW2A 2XJ4A 4DB2A 4JYCA 2FGKA 1I4DD 1KK3A 1NN5A 2C9YA 3SJBA 3VHLB 2XEXA 3GFTA 2QL6A 5DI3B 2QRNA 1WQ1R 1MO6A 3CR8A 1E3MA 1S4QA 3HU2A 4BLQA 4G5RA 1EESA 5D3MA 3BE4A 1W5TA 3B1XA 2RGEA 2W6JA 4LC1A 2ERXA 4TN1A 3ZQ6A 4GZLA 1KI8A 1P5ZB 1CBUA 1LV7A 5BN3A 3ECCA 2PMKA 3HPRA 3Q9LA 2RGAA 3LQQA 2WSMA 3D7MA 5K8TA 1WA5A 2ZRLA 3VTKA 2C78A 3GLFA 4L15A 4Q4LA 1PUJA 1KZ7B 1SXJC 3UWKA 1EFCA 1XWIA 4PSKA 2ZR7A 4JLNA 5FTNA 2QSYA 1OHHA 2J0UA 4IXMA 4EPRA 1YZTA 2OEPA 1LTQA 1GNQA 3B1WA 1KI7A 3N2IA 1HA3A 4KFRA 5B30A 1HV8A 3LW8A 1R0ZA 2H16A 1MT0A 3MSXA 3F5FA 5BW8A 1QHNA 3TW4A 2GHIA 2QI9C 1S9DA 5TARA 1U90A 3TSWA 1M7HA 3WRYC 3GCGA 3RS7A 1IN5A 1P62B 2FFAA 4BQSA 4F7WA 1J70A 2FEMA 5FBQB 2LWIA 2ODEA 4B3DA 2RGXA 3K9NA 2XOKD 1PZNA 1P7CA 2EW1A 2GAOA 1HYQA 4OI2A 2CJWB 2G9NA 3DOFA 3PXGA 2QENA 5CDFE 4BUJA 3I62A 2GBLA 4JLJA 4N0EA 2XGJA 1E96A 4YMUA 2R9VA 3OE7D 2IHBA 1UPTA 4FIDA 4ZDKA 4LV8B 1MR3F 4JT4A 1OT3A 1XCGB 3EZ6A 2V1XA 1XDBA 5L3RA 3E5HA 4D2IA 1P6XA 2CHGA 4AG6A 1O3YA 3A4LA 2QE7A 3T5DA 4IOLA 4DLTA 4Z51A 2O8CA 1NI3A 1FQJA 1DPFA 3EARA 5G41A 4NPHA 4V0ME 2IWHA 3S1AB 2WAXA 1W44A 4XIGS 5AJWA 3C5HA 3P1JA 3Q7QA 3KKNA 1E2KA 1XPOA 1CJUC 1MABB 3CF0A 1OH6A 4IFEA 2J9RA 3EIQA 2QP9X 3SN6A 1SVIA 1DAKA 2KB0A 2IYUA 1E2FA 4I1SA 1UF9A 4M9ZA 5J4KA 2QA5A 3R9XA 4CEHA 3AP2A 3AKEA 2J0SA 1E2HA 2ZQ5A 1TEXA 3KJHA 2GJKA 1F2UA 2IA5A 5EXTA 3RSOA 2W2XA 5JBQA 2JDID 1OXSC 2YVUA 5JEDA 1DAFA 2HEIA 2IYQA 3GEIA 1N6PA 1WCV1 5L3VA 1RRCA 4LJ8A 1SKYE 5EE3A 4W7SA 1GOTA 1NVXQ 5BQ5A 1OF1A 1KGDA 4EPVA 3KQLA 2J5XA 2UZ3A 1AZTA 1D2EA 3TVTA 3VR6A 3VR5A 4D6PA 5FPKA 4XD7D 4DVGA 1LB1B 1UADA 2HV8A 1XPUA 4KYUA 1SXJB 1I2MA 1L7VC 2MSCB 3DEFA 4D0GA 1XEWY 2XSZD 1FP7A 4FCTA 1W1WA 1GSIA 2F1JA 1QHIA 4FXPA 5FUVA 1FOEB 3IIKA 1NVVQ 4HAWA 1W0KA 3AGQA 4JLAA 4MGKR 1EFRD 3O8RA 3CRW1 4A8JA 3SDZA 1E2GA 1JXOA 1YU9A 3MFYA 4PC1A 2QAGC 1ZMXA 4ZPXA 1Z6GA 1XBTA 5FI0B 3IDQA 1CXZA 2FSGA 4R7ZA 4X8OA 3NEJA 5GVRA 4AK9A 4NYJQ 1I4TD 1PV4A 4PAMA 5JWRA 1JQJC 3HWSA 3U6BA 4EQ6A 2GAAA 3TJZA 3DHWC 2XB4A 3TMKA 2QTHA 3QKRA 2ZS7A 3QKSB 1E4YA 2VF7A 2FOLA 4HZUA 821PA 4BLRA 1T5LA 4MYCA 1XXHE 1OKKD 3UWOA 3P20A 1CKEA 4ZKDA 1KJWA 1ZNYA 2ZRPA 1EK0A 4M8NE 3PR1A 1W0JA 1D6JA 1K6MA 2KJQA 1IXRC 4BZQA 3H1TA 3HJNA 2PX0A 4AD8A 2DB3A 1C4OA 3I3SR 5DGXA 3RVBA 3MWJA 3FKQA 2OFWA 1KSJA 1YZNA 3RNLA 2WJGA 3VKWA 5FTLA 2QT1A 4CEIB 4B2LA 1SHZA 3K9HA 2REOA 3U61B 4ZDIA 4NU0A 2GNOA 1U94A 4OYHA 2JJ1A 1VPLA 2BEJA 1XEXA 2GCOA 1KTVA 2B8WA 3QF4B 4OHWA 3ADKA 2ATXA 1G8FA 2OILA 2PBRA 5IK2A 5BWMA 1NMYA 4U02A 3AVWA 2JAQA 2JLSA 3CNOA 4RFVA 1S1CA 4KCGA 4MRRA 4UJ5A 1G41A 4B3FX 4DIEA 2J3EA 1E9SA 3TAHA 1U8ZA 2AK2A 1KI6B 1RYHA 3E1SA 2GJSA 3I72A 3K0EA 2RGGA 3MMPA 2WPDA 2QBYB 1Z6TA 3B60A 3BD9A 3W3AA 4FN5A 5GJWC 5A0FA 5JLJA 1E1QD 1U81A 1Y3AA 4LUCA 2JCSA 4G3XA 2WWXA 1YZUA 2CJWA 3NWJA 2DFLA 4DCVA 1GWNA 1Q1ZA 2G1JA 2QAGB 4UNPA 3K70B 4AY2A 1TPZA 3A4NA 2RGNC 4HLCA 5KSOA 1G18A 1GL7A 2QGZA 4Q03A 4DT1B 1BKDR 2B6HA 3B5JA 3UG7A 1I2DA 2R6FA 4FMDB 4Q1AA 5G53C 5TY0A 3KQUA 1E79D 4A6XA 4TLBA 5JZVA 2VSOA 2XTMA 3WXMA 1AGRA 1LNZA 4GBMA 4POAA 1DE0A 4RD6A 4B6EA 2RHMA 1GL6A 3S1AA 2YYZA 4C30A 3EG5A 1MABA 4B32A 4IW3B 4ESHA 4B76A 1P2SA 4B3CA 4O2LA 4P4UA 4JYBA 1CR1A 1OLOA 2IYZA 1EFTA 3QPWA 3GJ6A 2VYFA 2OO7A 1QG2A 3WBKA 1QZXA 4JBXA 4Q4AA 2ZREA 4BEBA 4GMDA 1XB2A 2O8EB 2ZE6A 2IK8A 3EZFA 2ZRJA 3DL0A 1JQLB 3IQWA 3SYNA 521PA 2C99A 3L8ZA 1UBFA 1Z8FA 2E1RA 4OQNA 1VHTA 4FINA 3IQXA 5JS7A 2J1LA 2V6JA 1JR3A 4EJSC 4E22A 3I73A 4KO8A 1ZC3A 4NH0A 4URWR 4OQMA 4C9BA 2QN6A 4D26A 3GJ3A 1R0YA 3UKDA 3ZZUA 4M1WA 4DEXA 4ZCIA 3T1VA 2O8DA 4LC0A 4MRNA 2A9KA 1AS3A 2FSFA 4KLZA 2ZJ2A 1MRNA 2ORVA 4LYJA 1DO0A 3ONWA 4UKDA 3LLMA 4KBFA 2OXRA 1Z0KA 2WIBA 1F6BA 1US8B 2QAJA 1NL3A 2PEYA 3EZ7A 3CKLA 4GNKA 1DTSA 4C0QC 1E2QA 4TYNA 1Z63A 3B1VA 4HAVA 4NL4H 3K1JA 1E0SA 1T0HB 3TR5A 1TL7C 2WSSA 1R5OA 2QMHA 3BK7A 1L2TA 1NLYA 3U5ZB 1OSNA 4DCTA 1TQDA 1LY1A 1P3JA 2ZVQX 4KITB 5FBVB 2FPLA 1Z28A 2F3RA 1RRFA 1JALA 4BLTA 5A4JA 5HTKA 3RSLA 4GRAA 1E9DA 3OFNA 4NYMR 4A1FA 1ZAKA 3TUZC 3CH5A 5AK0A 1N5KA 3MWYW 2O52A 1LS1A 3QXJA 3FHTA 5KSZA 2ZI3A 3BFKA 3QNUA 4B3XA 1AZSC 2C8VA 4XJXA 2ONJA 4LYFA 2J7PD 2R62A 3BH7A 5EUMA 3I1FA 2OFOA 4G5SA 4NHOA 2A78A 3SZRA 3L0SA 4YMTA 4US1R 4FMCF 1HE1C 1HQCA 2VEDA 1Z0FA 1N0UA 1YZKA 2GKSA 2H7VA 4RVCA 1DG1G 2D3WA 2QG6A 2ZJAA 3CX6A 3SJAA 3QSYA 1OYYA 4GDFA 5SZKB 4B35A 1N0WA 1W7AA 1KO7A 4US2R 2ZSBA 4PC7A 5CLQA 1MO3A 2YNMA 3I5XA 2GK7A 1XRJA 1LFDB 3I5YA 1XU4A 1KI6A 2QBYA 4BASA 1KSHA 1UJ2A 1ODFA 1SVSA 2X77A 2RH5A 3W5JA 1GL9B 3LY5A 3LLUA 3WNCA 4CT4B 5B64A 1JNYA 3EXAA 5TXGA 2IS1A 4DDUA 2FG5A 2F43B 3KB2A 1HT1E 5FOVA 2Y8EA 4GI7A 3NBYC 4BFTA 2FZLA 4JJZA 1T3LA 2W6ID 5DNYB 4DT1A 3OEHD 4KBGA 2QQEA 3PEUA 4WOPA 4BFVA 4R98A 1S3SA 4BRUA 2AWNA 2IS6A 1G5PA 2B7BA 3FOZA 1GFIA 4Q9LA 3UATA 3K0SA 1CULC 2IYYA 4QBIA 2XITA 3OESA 3AF2A 1UBGA 3DVLA 5E7MA 1GTVA 4OHZA 1NG9A 2YJTD 4Z1MA 1OB2A 3AP1A 4RD3A 3THXB 1BH2A 4NP6A 1N6HA 4H1UA 3CM0A 4LJ7A 3VR3A 4Q1BA 2XZOA 3K9LA 1PVOA 1NN0A 1KK0A 1W46A 1VYVA 3CR7A 4I1OA 1XMSA 4AG5A 4O3MA 1SHKA 2GRJA 2Q0HA 2ZRIA 2ASEA 3Q5EA 3QBVA 4KFUA 4XWAA 1ZD9A 4YXWD 3TRFA 3EW9A 3C15C 2EQBA 2ZUBA 3PCRB 3QENA 2JGNA 3BB1A 4O2RA 2NGRA 1SXJE 2BOVA 4TMKA 4TYWA 4P0TA 2UZIR 3GEEA 4CRWB 3BFVA 3AKCA 3ZD7A 3X1WA 2GK6A 2OCBA 3KL4A 3Q85A 4OK5A 5KUTA 2GEVA 2FPMA 4TQUS 4KJZA 3PIRA 5BXQC 4LBZA 4C2TA 4OHVA 1A2KC 1J90A 1ZNWA 3ZIAD 2XJ9A 5HZKA 2F1RA 2D2EA 5EP1A 4DLXA 3ASYA 3TVDA 4RD0A 4RFSB 3UK6A 3PENA 4B43A 2J87A 3FFAA 2NZ8A 3I92A 1G3UA 3EIHA 1DS6A 1N6IA 1G1MA 3B1YA 2QPTA 1G20E 4B33A 1KO5A 1AQYA 3KFXA 1KO4A 5DN6D 2PCJA 1E9FA 5DYIA 4BZXA 2X1VA 1XFAA 3IHLA 3A37A 4QM6A 3GLGB 3OIVA 1NJGA 1KI3A 2QZ4A 2VP9A 2HJGA 3ASZA 3U6KA 3KJGA 2PT5A 3QVUA 2LCFA 2BVNA 2ZI9A 2ZE7A 1ELOA 3FYHA 2D74A 4FW9A 3QOFA 1II9A 2IW3A 3LFUA 3C41J 4BRWA 3ICQB 4JVNA 4ARZB 5JECA 3THWB 1KI9A 3RANA 3A8TA 2JIZA 2ODWA 4GT1A 3QKTA 5C1BA 1KI4A 1E99A 1Z6XA 5KNCA 2NO6A 4IHQA 4QM7A 4OHXA 3PEYA 1LW7A 4PXAA 1KZGB 3AGPA 2QY9A 1R6BX 2HYDA 1N5JA 4EFNA 1Q3TA 3W34A 4PC6A 1NJFA 3FTQA 3LX8A 1I4LD 5D3MB 1F3OA 1QG4A 1GG2A 2P0EA 4PPQA 5FTMA 1YHNA 1ZP6A 2FGJA 4D25A 3A1SA 1XMVA 2MSDB 3ZS9A 3BC1A 1LVGA 1RC8A 1ETUA 3G5UA 1VTKA 1TU4A 1KY2A 4IOMA 2J59A 3X1DA 1Z06A 4NZYA 4AKGA 3DMDA 1NKSA 1OXVA 4F92B 4K81B 4LI0A 1P2VA 3KB1A 1T6NA 2C96A 3GJ7A 4NCHA 4A8JC 3VKGA 3A1UA 1YR6A 3RYTC 2RGBA 3O47A 2GXQA 1BMFD 3F3YA 1KO1A 1N6LA 5E3HA 3WNBA 2F43A 2PT7A 4JT2A 4HDOB 4P4SA 1XD8A 4E09A 5K8UA 2ZRHA 2WKRA 3T12A 4QNRA 2IF2A 4TL9A 2HJVA 5HR5A 1TQ2A 4PC3A 2NMVA 1G17A 4OI0A 2AFHE 4LHWA 4K8OA 5CJ2A 4LYAA 1F5NA 1N25A 2GF9A 2D2FA 4JKIA 1RYFA 5FUYA 5F98A 1CLUA 1SGWA 2NPIA 1N6RA 3BH6A 2WOOA 5K8LA 3QXSA 5F3WB 4A36A 1MO5A 2JEOA 5AR1A 1II0A 2IUUA 2OT3B 1G4AE 1WBDA 4KSBA 3TAUA 3QI2A 4B47A 1WE2A 1KSFX 3B9PA 1HH4A 4E03A 1U0LA 2V55B 1GKIA 1HT2E 1EWRA 2ZAMA 2CVHA 1NNEA 4LDJA 1G4UR 1BIFA 1II8A 2WWFA 1QHGA 4KLNA 2CNWD 1W5SA 4MYUA 5AUNB 1WB9A 2RKOA 2ZYWX 1NLFA 1RE0A 5JSZB 2XZLA 4DBLC 1VG9B 5IT5A 3LDAA 3DOEA 5HPYB 3H0KA 4E5UA 3RWOA 4ERNA 1U8YA 4OI1A 3EASA 4B71A 2PL3A 5IHPA 3KKMA 4M9XA 3L2OB 1Z0AA 2WWGA 2ZYUX 4RFSA 3WP1B 4F4CA 4TZ6A 1COWD 4JMPA 3O8CA 3BWDD 4WA7A 1VHLA 2GA8A 4JLOA 4QRHA 4TSFD 4Y0VA 4BFUA 4B73A 2IXFA 4B6FA 1YR9A 2G0NA 5FH9A 4FWIB 2ZJOA 1ESNA 4UXHA 3KJIA 5FUXA 4MITA 4F4JA 2WJHA 5HCIA 1JBKA 3CF6R 4KFTA 3EPKA 1A5TA 2F1IA 2AL7A 2OBLA 4CZ2A 3WY9A 5KNBA 1SULA 5H70A 1M2OB 5EE1A 1OPXA 3RS5A 1RIFA 4B2IA 4DWJA 3OHMA 2BMEA 2WOJA 2GCPA 4XTRA 1IHUA 3RC3A 3ZYCA 1IJFA 4FCVA 1W36D 4MKIA 4KHZA 5F2EA 1XMJA 4W9MC 3PUWA 3AVVA 3VR4A 1Z6YA 1Q44A 4Y0AA 2VHTA 4EQ6B 1H8HD 1E1QA 4D4JA 2IXGA 3AF4A 1AQUA 1DEKA 2X19A 2KBEA 4PQRA 4TL6A 4M1YA 3T15A 4LRWA 4DEYA 1W4AA 1JR6A 1LF5A 2ZRBA 5KTYA 2NG1A 1U0JA 2CBZA 3THWA 4HZUB 2HXSA 1AJEA 1CR0A 2AN9A 2YOHA 4XTCS 1CTQA 2QTVB 3EPJA 2QSZA 4Q7KA 5DSZA 1BO6A 4IVQA 5L3QA 4IOJA 3UANA 2GXUA 1G7SA 1WXQA 1DOAA 3MG9A 5E7JA 5TB5A 4RY2A 1G9XA 4NMMA 2IT1A 2RHDA 4BFZA 4JLVA 2KI5A 3SHWA 3JZAA 3WYAA 1PLKA 2RB4A 4AKIA 4DLRA 3T61A 2DR3A 4M53A 1Z83A 2P6UA 2IYSA 3P32A 4Q7JB 4Z8XA 1KNXA 3RRMA 3AVYA 4JZKA 4NCIA 3GJ8A 1K5DA 3KFVA 4URXR 5KSYA 1IY0A 1V5WA 2NIPA 1P9WA 1JI0A 3NHBA 1XEXB 2GCOB 5JS8A 2WKPA 4WW0A 3EA5A 3BH0A 3WYFA 4F4IA 4XWOA 1FP6A 1MRSA 1IY2A 2ZROA 2H8KA 2BDTA 4DSTA 4Q48A 3IPXA 2RGCA 2BMDA 4MKFA 5DIFA 1IONA 3D31A 3LAWA 4EPXA 5LD2B 1XPRA 1N5IA 2ZSAA 4QFMA 2J0QA 2OFXA 5JJKA 1Z22A 3B1ZA 4Q7LA 3NVAA 1R0WA 4G5QA 2R8RA 2JLZA 3FHOA 4GOXA 1XF9A 1GRQA 2GXSA 2WHXA 1SVMA 2WMOB 2RMKA 2XX3A 3CX7A 4Q1FA 3H4MA 4LJ6A 3ZQJA 1YQTA 1KHTA 5JJLA 1UKZA 4DKXA 4QGGA 3EX7C 1CU1A 1XZQA 1X8LA 1G5RA 3MRSA 3VFDA 2AKYA 4HLUA 3R8FA 2D7CA 2ZS9A 1W4CA 4QBFA 3B7GA 3QEOA 1M1YE 4N0DA 4TLEA 2CCJA 3KKPA 4H1VA 4RD1A 4O25A 4EPTA 5DHFA 1L4UA 1S2MA 2H57A 1OJLA 2QORA 1X8KA 3A1VA 3IO5A 2BMFA 2VSXA 3WHKA 1W48A 3THYB 1FX0A 1RZ3A 2O0JA 2ZI7A 4BLSA 1GAJA 5JSZA 1XEWX 4QJ4A 5KDLA 1Q3HA 4KFSA 2ZRNA 3GJ5A 3N5CA 3OEEA 5KSPA 3KXKA 1G16A 4HAZA 1EX7A 4AYWA 1YZGA 1K5GA 3V00A 4Q4AB 1JJVA 4ZI3A 3Q3JB 2P6NA 3BOSA 3PUZA 1NN1A 2WJJA 5FBLB 5M04A 4LHVA 3RS0A 3GLGE 1ZRHA 3FKSA 4RD2A 1JXMA 3QXXA 1F60A 5GVSA 1RFLA 2OCPA 4ASUA 2ZIAA 3P4YA 1YZQA 4V0KA 2BC9A 2O8DB 4IDPA 2Q9AA 2FF7A 2WWHA 3B78A 3AKYA 2WBLC 2PLFA 3K70C 2JLWA 3O8DA 3UMRA 4DCUA 2FFHA 1DAMA 2C95A 1N6KA 3K0CC 4AI6A 1OYWA 4JLMA 4RSGA 3CPEA 3UXMA 3CWZA 5TV2A 2NZJA 5J5CA 1ZCAA 2W00A 5C4MA 4PHFA 1E2JA 4JVSB 4WVFA 2IWRA 4EPWA 2ODBA 5KHOC 1R5NA 2HYIC 1HY3A 4F93B 4LX0A 1IBRA 2JLQA 3AEZA 3CX8A 5JHGB 2FJUA 4KV9A 1Q1QA 2O5VA 4W5HA 5G40A 1ZD8A 1FW6A 4LCBA 4HZIA 5E7IA 4KVAA 4A2PA 3HU3A 1Q0UA 2OG2A 2YWEA 4Q18A 1G6HA 2XTNA 4U00A 1AGPA 1PJRA 4Q19A 3GLFE 2WMNB 3QPUA 4Q1CA 1NY6A 2G3YA 2ZJZA 1E1RD 4ZV4A 3U4QB 4Q01A 4X8LA 3A6PC 1G291 2ATVA 4BFYA 2JA1A 4LPKA 5HKKD 1C1YA 1VG8A 5FBWB 5J4VA 3IEUA 4MQBA 4JVLA 3D6TB 2ZRKA 2VP4A 3RABA 3NDPA 1E0KA 3U7HB 5JRZA 1R2QA 4TMTA 4H9GA 3FFBA 2QP3A 2UKDA 3IBGA 2W0SA 3OF5A 2OLKA 5CB6A 4ZCLA 3RRZA 3KXIA 3GP8A 1EGAA 4DUGD 2RGDA 4PPFA 1W4RA 5J47A 4O0MA 3T1TA 1OIVA 1R0XA 2YOFA 1UDWA 2XTZA 2FWRA 4KI0A 4Q9IA 4I4LA 2G83A 1QHYA 1GILA 2ZANA 4Q1EA 4Q9HA 3WMFA 3IEVA 2P2LA 3CLVA 4L16A 2Q9BA 1OIXA 5CM9C 4CT5A 2XXAB 3ZJYA 1P4SA 2P6RA 2ZEJA 3B13B 4LJAA 2QP4A 721PA 5FBRB 2BBSA 3ZDQA 3BRWD 2Q3MA 2XNDD 4NYIR 3BGWA 3TBKA 4BECA 3N2EA 3AVUA 3ZGXA 1AM4D 1KDOA 1AKEA 3SYLA 5AWFC 5DYGA 3B85A 1P9RA 3GFPA 2R6GA 2I3BA 5G3YA 4QBHA 2OM2A 4Q1DA 1KAGA 2ECKA 4UNQA 1XD9A 2GZDA 2ONKA 1ZM7A 2ZPTX 4WZAE 4BEJA 2Z43A 5AJZA 3THYA 1XTKA 2VPPA 3LNCA 4NBSA 4Q66C 2Q6TA 4I99A 3GLHB 2NTYC 2AX4A 4PPGA 2FMXA 2W83A 3FVQA 3U7EB 3W8NA 2BJWA 2XAUA 4ITRC 2R44A 5J40A 3AVTA 4FMBB 4ZO4A 1N6NA 4LV6A 1KSGA 5DO9A 4EUNA 1YVDA 2X8AA 3T1OA 1KDPA 2W6JD 3W6NA 1TU3A 3L0OA 3TE6A 2XNSA 5KO2A 1PLLA 1P72A 2EYQA 5DISB 3FMFA 1XZPA 1AA9A 4KAXA 4QHSA 3RLFA 1CJMA 5BN4A 2ZAOA 2YINC 3MLEA 3NHAA 1OXUA 4EAQA 1U98A 4AYTA 1DELA 2FU5C 2QMOA 5J4HA 5KYKA 1OHHD 2ORIA 3SU8A 2QM8A 2DFKB 2KE5A 3RS3A 1T4GA 2IUSA 3AVQA 3VX3A 4A0RA 1OXTA 4UXJA 3IKJA 5CYOA 3OIYA 2ZJ8A 4A6PA 3CNLA 4MH0R 1ZYUA 1P61B 3ZVMA 2R6AA 3QQ5A 1QVAA 2KBFA 3VNVA 3T06B 1KKMA 2F6RA 5BYJA 4FWTA 3I8SA 1FQKA 4R71A 4OI4A 4CGZA 4PO9A 1YZLA 1P75A 4C0JA 8OHMA 3QY0A 3PV0A 4BFWA 3AF0A 2N42A 2W2VA 3K0FA 1NSTA 1TMKA 3A1TA 2ZS8A 4IFBA 1R10A 3U44A 3EC1A 3LBHA 4HEJA 4R2IA 4DIDA 1B0UA 2QE7D 3AVPA 5B57C 4JVMA 4ILEA 4TTPA 3WBJA 5J4LA 3U4QA 1WP9A 2OBMA 4RD4A 1T3SA 1Z2CA 1E32A 5FOUA 1H65A 1NBMA 3A4MA 4LGMA 2QNRA 3AVXA 4JS0A 1H8EA 3OAAA 2OUKA 3EIEA 2DWQA 5FL3A 2BKUA 3GLIB 3EZ2A 4W5WA 3DPUA 1DAEA 4HYYA 1ZM2A 4LSGA 4NE2A 2QTFA 4RZXA 4LJ5A 2IS4A 3HPQA 1S96A 3VKHA 2QU8A 4C0SA 3BIFA 1Q1BA 5FL7A 4D81A 5CJPA 4MGYR 2K5UA 3N70A 3T1QA 3W90A 2VBCA 3U60B 1ONBA 4LBVA 1DBSA 1G64A 4PAOA 5FPTA 2V7QA 2IYLD 4LY6A 2WWIA 2ZR0A 1OIWA 2OAP1 4PO1A 1KNQA 1ZIPA 4LV5B 2XXAA 2ZXUA 1G3QA 2H18A 2IHYA 4P4SB 2G6BA 4QL3A 3L0IB 1W0KD 2YC2C 3PG5A 1JEEA 4LPSA 3DZ8A 4QBGB 4Q9KA 1KKLA 3ZVNA 2Q21A 2GVZC 2ZI6A 4IKEA 1Q1EA 3K0CA 1XCPA 4D4LA 1CR2A 1T3HA 2CEAA 4BZPA 3CIOA 1FMLA 2FFBA 1NVVR 2GEUA 4DSOA 3TGPA 4OQLA 1Z07A 2PJZA 2ZRAA 2YWHA 3Q7PA 3L0PA 4TL8A 4L9WA 4TT3D 2HXYA 2QQ0A 3B82A 3FB4A 2ZE5A 4BLPA 2BHRA 4IJMA 2B7CA 2CK3A 4NYJR 3W5IA 4B44A 2XZPA 3L8YA 5JFGA 2HLDA 1FUKA 3ZVRA 3IPYA 4JIMA 3GLHA 1M6NA 2Z5FA 2ZYTX 2NPFA 1JR3E 2A5DA 4LWZA 3R8CA 1G7CA 1VKJA 4G5OA 2JLXA 2PJRA 1TX4B 1II8B 1W0JD 2BKEA 4U5XA 4C0HA 1UDXA 1GKUB 1CIPA 1VG1A 4DHEA 1OH5A 4AYXA 2P65A 4QXAA 4DLVA 2AXNA 1ZJ6A 1E2IA 2OLJA 3K53A 4GOKA 5CLLA 421PA 1Q57A 2FDCA 1UKEA 3CB4A 3SI7A 2PZEA 4PAQA 1KOFA 2ODNA 1OV4A 2JJ1D 4HB2A 4D0NA 4M4SA 4A92A 5AJVB 2A7QA 2I1QA 3AF3A 4QHYA 4HUTA 4MKGA 4YMSA 4TL7A 5IK2D 4EKDA 2ZITA 4UQOA 4YC7A 4L8GA 3NEYA 3AKDA 2WJVA 4XVRA 5EE5B 3T34A 4BFXA 2IYVA 1TADA 1E4VA 2BBWA 3BB3A 1U0HC 4YDHB 4A9AA 2GZAA 5CIQA 1PLJA 2H92A 1U9IA 4NTZA 5K8IA 1WGWA 3C5CA 2EFDB 1E0JA 5KPJA 4Z54A 2WPDD 4WIAA 1ZD1A 3W9YA 3RC8A 4P31A 2FZ4A 2OHFA 2PZGA 1CP2A 4D0LB 6Q21A 3QE0A 1TF7A 4QOSA 2ZUDA 2IL1A 1U2RA 3K09A 4HLUC 1XJ0A 4PPNA 1NIJA 1JAIA 3EPHA 3T35A 3ZZ0A 3NBFA 2EFHB 1G19A 2OXCA 4QC2A 3TW8B 1FZQA 2XOKA 3SYKA 1Q20A 2A5YB 3FMIA 1YRAA 1UAAA 4S2EA 5L8VA 3W3ZB 4V0LA 4EPYA 4AC9A 4C4PA 1G3IA 3OE7A 1KI1A 3P27A 5L3QB 4E07A 1XTIA 4QGAA 4C3ZA 2P5TB 1FMJA 1OW3B 2H17A 2DWOA 1BYIA 4XH9B 2B8TA 3UMFA 3GLIA 5C4GB 2QROA 2O8BA 5FUWA 1DADA 2QPOA 3ZLJA 4RZ2A 4TLDA 2GJ9A 3CRVA 1UEJA 1HTWA 1AS2A 3CBQA 3QG5A 1JB1A 3TK1A 3X1ZA 2WKQA 5D3QA 4CIDA 4C0BA 2B21A 3ZZTA 2WWYA 1OXXK 3CZPA 3TSOA 2JDIA 2O8FA 1JR3D 1VIYA 3VU9B 5KNDA 3JVUA 4URYR 1TF5A 2H5EA 1F48A 3AV0B 1NY5A 1CJKC 1B23P 4L4UA 1SXJD 3GD7A 3IO3A 3PEVA 4JBWA 4A15A 4JL6A 2WICA 2GCNA 1QHHB 4FMCB 1XXHB 2AKAB 1NSFA 4RZUA 2AD5A 4XD7A 3SBDA 1TF2A 4Z8YA 4G0NA 1G7RA 2GJ8A 1QDEA 3KKQA 3AP3A 2EWVA 5FTKA 4DSNA 1GNRA 2EVWX 3E2IA 2XSZA 2ZU6A 1KK2A 1GM5A 5EP4A 4DB4A 5KOYA 4PFSA 1KMHB 5GADl 2O0KA 1A7JA 1EFRA 4UNSA 3WP0A 2VF8A 5HCNA 2L0XA 5EZ5A 5AUPB 3P26A 5AJYA 2WSSD 5HE8A 1Y63A 2HCJB 2ZU0C 1O87A 1KI2A 3GPLA 4PC2A 3SC3A 5DI9A 1FNNA 4JJKA 3Q72A 2IYXA 4I1VA 3NIBA 4M1MA 1EXMA 2FE4A 4IVPA 4HB0A 1P60A 3JZMA 3OFND 3FGNA 3ETLA 4AURA 1E9BA 1FX0B 1SVOA 1OB5A 3SBEA 3NXSA 4MRPA 3B8HA 5SZJA 1OKKA 3RS2A 2JASA 2OV2A 5AJXA 3RHFA 5ANRB 4A0HA 1TEVA 2G1KA 4Q02A 1AK2A 4GMXA 5FI1B 4DC9A 1MH1A 1VCNA 4IVRA 4L5BA 5EE9A 5JCZA 2I1VB 5FOTA 5FOXA 3ADBA 5CDFA 3ADDA 4TYYA 1OH7A 1ZM3A 1A82A 2EWWA 2BWJA 1G21E 1X86B 4C7OA 3J81k 2VL7A 5LD2C 1FUUA 4G1UC 2EYUA 2EU8A 4QKQA 4DLWA 2NOAA 5H8WA 3A1WA 2BCGY 2ZTSA 4RJLA 4V0MA 3SS8A 1HQYE 1HURA 1T9HA 1YR8A 2F1HA 5JCPA 1GP2A 2WAYA 3U3RA 2AD1A 1W4BA 3C16C 3VNUA 1S0UA 1YKSA 4GP7A 2IX3A 2FPKA 5CM8B 3WHLA 2O0HA 3KQHA 4WXRA 3K70D 4NYIQ 2NO9A 2VIIA 1VIAA 3ND9A 3X1XA 4A2QA 2BEKA 1XD2A 2W0MA 1YE8A 1G8PA 4AWXA 4BGDA 4IDHA 2IYWA 1RJ9B 3NDBB 2ZJBA 3K8YA 3KXLA 2HT1A 4W5JA 4KODA 121PA 5FPHA 1WBBA 1U99A 3H2YA 2QMEA 4I1UA 4G01B 2DHRA 2ERYA 1E9RA 1E9AA 4CVNA 1J7KA 1E79A 4LJYA 4WAUA 3U2QA 3TUIC 3AB3A 1N0VC 2BJVA 5JWHA 1P2TA 4MUBA 2A3RA 2VO1A 1ZINA 4ZCMA 3TQCA 1SVLA 2DCUA 4BFSA 2E87A 5FPSA 4JL5A 2CLDX 3WNDA 2C9CA 4US0R 4M0LA 4C0KA 4IDQA 3GJ4A 4JSYA 5EQTA 2GESA 4B2PA 1FL9A 1IN8A 3SEAA 3DM5A 3TNFA 5TVKA 2GETA 1GNPA 4ZKEA 4OJKA 4Q7MB 2OCAA 3VU9A 2FX3A 2OZEA 2J46A 4OK3A 4YMWA 2G88A 2OAQ1 3NC0C 4C0LA 3CPHA 4P33A 3RRNA 3U3OA 4TZ0A 1UKVY 1G8GA 3R9WA 1Z47A 4QJ5A 1QHHA 1G5TA 1XXHA 3ZVLA 4DCSA 4LJ9A 4A82A 3C4JA 4CYMA 1EG7A 1YRBA 2ZUCA 5TDHA 1ZC4A 3L43A 1ZW6A 4IDOA 3VR1A 1Z08A 2CLCX 2AHOA 2VH5R 2IBMA 4B48A 3RDPA 1X3SA 1ZBDA 2A2ZA 4URVR 5IRCD 1ANKA 4DZZA 1KMHA 3F8TA 2KWIA 4X8MA 1Z3IX 1BYUA 1YR7A 3G82C 3EZ9A 3PVSA 4DLZA 4HLQB 3R9IA 1T8UA 5IF9A 3BFXA 4FMDF 2JLRA 2YHSA 2IYRA 1F2TA 3SE0A 2IUTA 1OFIA 5JWOA 3I61A 1TTTA 4I81A 4QJ3A 2ZE8A 4URZR 1M8PA 2VP6A 3HU1A 2ZRMA 3KTAB 1G8HA 3VX4A 3QG1A 2EFGA 5CIWA 2OCYC 4OQFA 2J7KA 3D3QA 4DLUA 4NYMQ 2ZRGA 3KUCA 2ZETA 4JLPA 3C8UA 2JIZD 5FPYA 3FHCB 3X1YA 4BLOA 4RKFA 3KUDA 4J0QA 1IN7A 1UFQA 2PEZA 3MAAC 1E2LA 2C9OA 2CCGA 5FOSA 5C18A 3DM9B 1RRGA 3H86A 5H1YA 4BE7B 2VP5A 2GDJA 3NKVA 1QVRA 1D9XA 4NCJA 2J7PA 4M1KA 1W2HA 1NIPA 4MGIR 4UNRA 4QNMA 5C2JB 3MWKA 4GOJA 4K46A 1S1MA 3QBTA 3CUEF 5DH9A 2DYKA 3PUYA 4FI3C 5E95A 3LRPA 4MGZR 1Z2AA 3IIMA 1GVNB 3LXRA 4IDNA 3K9GA 2MSEB 3EAQA 3MJRA 3U3MA 3TIFA 5LB2A 4EFMA 2CVFA 4Q47A 2Q9CA 1MV5A 4TMXA 2MMGA 1E2DA 3SQWA 2YWFA 3TR0A 1NMZA 2WVJA 2WIAA 1R4AA 3Q8XB 4V03A 1E6CA 4LHXA 4GP6A 2C98A 1J99A 1DAHA 2EFEB 3JVVA 4CEJB 1ZU5A 2OBNA 4TQ9A 3KDSE 1JPJA 1RJ9A 2PZFA 1R7RA 2ZRFA 1W36C 5JI2E 4GL2A 2IEYA 3FPAA 3W6OA 5G3ZA 4WXPA 1E2MA 3CWQA 2WM9B 1WF3A 2W6IA 4PR0A 3K0FB 2DWPA 4TMZA 3OEHA 1IXSB 1NKTA 2DBYA 1AS0A 1DG3A 4P4TA 1A4RA 4M2LA 1TAGA 1GITA 3U7FB 4B3GA 3FDIA 2JLUA 2BM0A 4MYHA 3U44B 3GFOA 2QMUA 4IXNA 2SHKA 3QUSA 1TQ6A 4NCNA 3P4XA 4TT3A 3AM1A 4CW7A 2A5JA 4KSCA 4S35A 2QGNA 2AK3A 1AN0A 3OZXA 1KO8A 2FEOA 3CONA 1RKBA 2YZ2A 4D4MA 3T5GA 3C14C 5B58C 2VA8A 2YKGA 3SJZA 4D82A 4QGHA 2VLIA 1Q12A 4XOIA 2V54A 2ORWA 3OIUA 1C9KA 1GDDA 3AUYA 4YXWA 2D7DA 1FTSA 5L3SB 5DI3A 3PUVA 4MRVA 5JJIA 2CCKA 5EP3A 2CL0X 2FFQA 1N6OA 5EXPA 3EC2A 4V0OA 5HZHA 3A58B 3SOPA 1SZPA 2V6IA 3U3KA 4YQFA 4Q21A 1E94E 3QJYA 1OFTA 2ZRDA 2QM7A 1T5IA 3GEHA 3B2EA 4Q4JB 4AKHA 1L4YA 4UNNA 5UKDA 4MDEA 1U9IC 3SFVA 3ZIAA 5EZ6B 2R65A 2GEDA 1P2UA 3BJIC 3LWNA 4B34A 3IBYA 1GZSA 3EWSA 4FD2A 1KYIA 2GILA 1T8TA 4HDQB 5DHAA 5EUQB 2VHQA 4D4KA 3DDCA 2HCBA 1L8QA 3DKVA 4JLBA 5EXXA 3W8RA 4YONB 5ELXA 3QEJA 3HP1A 2Q3FA 3QIAA 3K09C 2P5SA 1CJTC 1R8QA 2GJAA 3GJXC 1XP8A 1IN6A 3HYRA 2RAPA 1CR4A 1JPNA 5DN6A 5JI3E 3VR2A 2AXPA 1SVWA 3PITA 1GRRA 1CRPA 5E4FA 3M4YA 3TSZA 1N5LA 3CRQA 3KTAA 2VHUA 4JLDA 4B3BA 2IYTA 4YDSA 1TUEA 2JJ2D 4MKHA 4DCNA 2UVQA 3L82B 3WRXC 1W36B 4Q5IA 4ZIRB 1X1RA 3AQ4A 1NF3A 4JLKA 1G6OA 3REFA 1ZNXA 2A5GA 4GPTA 2Z83A 2C03A 1IQPA 4OKSA 2PH1A 3SNHA 3PJRA 1Z29A 2CLSA 1T0JB 3LH5A 1CRQA 3LW7A 1SQ5A 1XTRA 3I32A 4FCWA 4TTRA 5TMPA 2W58A 4M21A 3ZD6A 5JHHB 2D4HA 3VAAA 1Q22A 3VHXA 2J45A 2ZM5A 2TMKA 1IOZA 4RKEA 4HAUA 1BOFA 1GIAA 1QF9A 2DY1A 1DAIA 3NH9A 4PX9A 3LD9A 4DDWA 1QRAA 1M7GA 1WMSA 2VHJA 3M0EA 5DE3A 3MUFA 3NG1A 1DARA 1PUIA 3O8BA 3QVVA 3U7GA 1K8RA 4DRZA 3QKUA 2A30A 5A5GA 3CRMA 3SFZA 1E0AA 2E9SA 3PEWA 3ICEA 3NBZC 4C0AC 1DO2A 4DDVA 2DPXA 5H68A 3FMPB 1JAHA 3IUYA 1TQ4A 4GSYA 4UJ3A 1Z0DA 4IOKA 1UM8A 4LJ4A 1E2EA 2WZQA 2BMJA 1N2CE 1R5BA 3BS4A 4OK6A 3HYTA 4PANA 3BORA 4ACBA 1WDTA 1GKYA 2CHQA 1AKYA 5CITA 3CRRA 1SXJA 3IHWA 4PO8A 4Q00A 2ZI5A 4CEJA 1BMFA 1XEFA 1JEDA 1NRJB 3KQNA 5SZIA 1FNMA 4KVGA 3REGA 4DJTA 2IEZA 2PLRA 3IIJA 3R20A 4JBYA 2QT0A 1D5CA 2XB2A 2ZJ5A 1NVWQ 5GJBA 2VQSA 2VSFA 1LS6A 1VECA 1IJEA 1P9NA 1XJCA 4N1AA 5GJVC 5JEEA 1KK1A 1G8YA 2W2TA 1FTNA 4OJQA 5KDOA 3DZDA 4U7DA 4ON9A 4M9SA 2H1LA 3SHFA 2OESA 3IILA 1W49A 4L9SA 1VCIA 4BPBA 1VYUA 3TQFA 3AH8A 3QKSA 2ANCA 3MD0A 3Q5DA 1SVKA 2N1BA 4M1SA 2KSQA 1W2GA 3AF1A 1X1SA 4UXIA 3I8XA 3VQTA 2ZRCA 4HAYA 4DLSA 4NDZA 1NLZA 1UBEA 2R6DA 3CNNA 1CJVC 4NCKA 3OEED 2NO7A 4HATA 5JRJA 2O8BB 5L3SA 3AVOA 4F38A 1G3MA 2F55A 2HUPA 2CNWA 1A2BA 1HE8B 5DLQC 3UPUA 2YWGA 2OSBA 1HEIA 2V1UA 4GFDA 4A2WA 2X2EA 2DFTA 3LVRE 1YJ5A 1ZUHA 3CF2A 2D62A 1E69A 2G77B 4CEIA 3LA6A 2CMKA 1S9HA 2AFIE 2O8FB 4Q4JA 3FKSD 4Q4HB 1JJ7A 5EE0A 1VG0B 5IDVA 1HUQA 4XSHA 4RZ3A 4ASUD 2CDNA 2ZSFA 1COWA 1KY3A 3NH6A 1E98A 1NG1A 3QF4A 3H84A 4TSFA 1EFHA 2F9LA 5CYPA 3X2SA 4C2UA 2ZR9A 4PTLA 2IS2A 1D9ZA 4TMWA 3LV8A 5LBIA 4KU4A 2NQ2C 2I4IA 4EJSB 2C04A 2FH5B 4LOAA 4TLAA 3CPJB 1RVDA 4MUAA 2CL6X 4LBWA 4P32A 1XCMA 4NKRA 5F9HA 2OE2A 4XVQA 1G3RA 2AWOA 2PX3A 2GTPA 3GJ0A 4R9UC 4ZIRA 3I4LA 2QAGA 3ND8A 3LXXA 1VDZA 1H8HA 1AIPA 1S8FA 5KPDA 4HAXA 1OFHA 1FFHA 4HLDA 4URUR 4Q9JA 4PHGA 3LQRA 5C46F 3LVQE 4B75A 4M1TA 1E9EA 2FN4A 1MOZA 1EWQA 1LF0A 1VCMA 3HR8A 1X6VA 2HT6A 1M7BA 3TLXA 4ZDJA 4TYPA 1XNJA 1UEIA 2PMDA 2ZI4A 3NTUA 3TKLA 4LK2A 1FPMA 2N46A 5LB4A 2REBA 4PHHA 3FE2A 1D2NA 1XX6A 2VP2A 3BAFA 1ZVQA 2WJYA 4HUQB 2P3SA 3SJCA 4ESVA 4C7OB 2CE7A 1ZU4A 1ZM4A 4TMVA 2O8EA 1QHSA 1XTSA 1N3BA 2C5LA 1ESMA 3B9QA 3SR0A 5KDDA 1CF4A 1IAQA 1NMXA 2FSIA 2ZVPX 1M74A 4HB4A 2IXEA 2ZSDA 2HF9A 4AIIA 1KIMA 2JATA 2EFCB 3R7WB 3THOA 5CK4A 5FFMA 1DVRA 1Z5ZA 1E9CA 2R6CA 1KAOA 3MCAA 1EFUA 3QF7A 5SZHB 1GUAA 2VRWA 1OH8A 2CL7X 5LDDC 1J8MF 2VTKA 1US8A 3KZ1E 4CDGA 1NBME 1UKYA 1XD2B 4TWZA 1J2JA 1G7TA 1W47A 1SKYB 5BN5A 1IY1A 2BIFA 3ZS8A 4M22A 1VCOA 4V0NA 5B2ZA 4A0GA 3ZH9B 4M9QA 2WTUA 2ZSEA 4B74A 4WZBE 1KMQA 2C2HA 2GBLC 2X2FA 1KDRA 2VHCA 1UBCA 2Q3HA 4HSEA 2P67A 3EWAA 4R2HA 4ACAA 3DO6A 4YLGA 2RGNA 4YMVA 1ZIOA 4D80A 3DMNA 3CZQA 2WWWA 1QHXA 3ADCA 3K0AB 1DAGA 2RCNA 5EP2A 3TUJC 2LKCA 2GF0A 3NC1C 1XMIA 4X8HA 2GZHA 4XVUA 4IEEA 3MWLA 2JJ8A 2BCJQ 2DFNA 5FOWA 2V4ZA 5LPNA 3FWYA 5CB8A 1XTJA 2YC4C 1E2NA 4CF7A 3V4FA 2JLVA 1MO4A 4F91B 4TTQA 3OIWA 4Q4HA 1QBKC 3CO5A 3PUXA 4MDFA 3UIEA 1IN4A 2GVDC 2F9MA 2F3TA 2FSHA 2HDNB 3AUXA 4MYTA 1R8SA 4PHTA 2YV5A 4OHYA 4LZZA 4JSTA 2B92A 3BBPA 4QG7A 2D06A 3A36A 1KJZA 2WV9A 2R2AA 1P73A 3RAPR 2HF8A 3GMTA 3QXHA 4IEIA 3GLFB 4TQAA 2QRZA 4EJSA 3BB4A 3MGCA 4KYIB 1XTQA 3PFIA 1SKQA 1IM2A 3GLHE 1E2PA 2J0UB 2J41A 4JL8A 2BBOA 3V9PA 3WYGA 3PQCA 2FA9A 3BERA 3WMEA 3UG6A 1GRNA 5EJEA 4DLYA 1X8JA 1XJQA 4HI0E 3EPLA 4LHZA 1VYTA 1OE0A 4PSAA 2GWHA 4PSVA 4PQFA 5F9FA 4GZMA 1F2TB 5HE9A 4EIWA 3GQBA 4QHTA 3FMOB 4KXFB 1ZCBA 2V9PA 4V02A 2Z4SA 1CS4C 1ZNZA 3UMSA 2ANBA 1U8AA 1J8YF 2BM1A 3NBXX 3KJEA 5FR2A 3HDTA 4OL0A 5CK5A 2F7SA 5J4YA 2WJIA 1RPZA 2QUZA 2Z6VA 2FNAA 3D8BA 3LBNA 3RS4A 1NP6A 1WRBA 4EFLA 3RRYA 3THXA 3QXCA 1MKYA 1TUIA 4JKYA 1D2MA 1NVUQ 4ZI2A 1NBMD 5FR1A 4BWYA 3LX5A 1H8ED 1Z0JA 1ZUIA 221PA 3OAAD 4A0FA 2GXAA 3SQXA 4PZYA 1IXZA 2VP0A 3B6EA 2PCLA 4LYHA 4QGFA 2O8CB 1Z6AA 2NO1A 1EX6A 1A1VA 1E1RA
chains in the Genus database with same CATH superfamily
3DCNA 3F78A 3HDHA 1ORWA 3B7WA 4EDHA 5EZSA 4QDJA 1TUGA 3W6PA 1V43A 2LKDA 2E4YA 5FX2A 4DUGA 3T54A 3IAHA 2BZ1A 3DNFA 4XSGA 2IU4A 4EJFA 3TNJA 1FBTA 4YLEA 4UCFA 1XVIA 4Q9NA 1TNDA 3BRWA 1S3GA 3DLBA 1RI3A 2PTGA 2C1ZA 2PU5A 4X6YA 4I5GA 4BKUA 4GRDA 1KDZA 1Q92A 3BL8A 2JJ2A 3KRTA 1U28A 1KPGA 3QKRB 4MWSA 4DB2A 4CU5A 2FGKA 4TUYA 1CZRA 4LF6B 3NUQA 2ACKA 3KAQA 2RGEA 4WCDA 4TSKA 4MR7A 2I67A 4U5BE 4L15A 1DAOA 2ZR7A 4N0QA 2VS1A 3K9WA 4UHKA 4QDXA 1S9DA 3IR6A 3TSWA 4YUZA 5B6PA 5M5BA 2D54A 2XOKD 1WUKS 2H0RA 4MDHA 4N0EA 3KR2A 5KNCD 1GRVA 1MR3F 3PQ6A 1XCGB 1IWPB 4Z51A 1VBNA 3T5DA 5ALLA 3JSXA 4JB8A 4V0ME 2Z6QA 2WAXA 1IIRA 1OH6A 1V8OA 5AFSA 1UF9A 1USGA 3AKEA 3FVWA 1F2UA 3RSOA 4JWTA 3EEFA 1L5ZA 5BQ5A 4E11A 1XPUA 5SV2A 4FD3A 2PH5A 1WU8A 4JLAA 4MMXB 4I4TB 1QFSA 1YUBA 3MMNA 4RMJA 4QUEA 4M0CA 5TQ0A 5B6IA 4G86A 1JQJC 4DGSA 3CTPA 3QEBZ 1X1AA 1N9KA 4MZDA 4ZAYA 4C22A 1E4YA 1REQB 1WP4A 1NMSA 4FU0A 1VI5A 4OFXA 1CKEA 2X41A 2D1TA 5CVTA 2AOUA 2L2QA 3FFWA 4GM0A 4GX1A 4XWWA 1YJAA 1T35A 2QE9A 4RMGA 2CWWA 1T0IA 3ABRB 1H0KA 4OAOA 4JBHA 2SECE 1V1RA 1JT2A 3L06A 5BWMA 4OVKA 3CZRA 4RFVA 1AE1A 1VKHA 5FBKA 3TS1A 3HVRA 4YK5A 4KWIA 5DIZA 3TAHA 5ALDA 2CV0A 4FN5A 3DOIA 2Y0EA 5KWIA 4R40A 3DAYA 4B4UA 4OMFG 5KX5A 5CU7A 1WXEA 2VC9A 4GBMA 4POAA 4X62B 4B6EA 3CH7A 3EG5A 1UKCA 4YN0B 5DULA 4B76A 5ALJA 3TG2A 3WYCA 4BO5A 1RHJA 1EFTA 1Y8RB 5AM2A 3IQGX 3GWNA 3IJRA 3O4JA 3U4AA 3F7NA 1ODJA 4BNWA 2NX2A 1PK7A 3GJ3A 3OQJA 1U3CA 3RYIB 2I1LA 3A26A 2CFIA 3LLMA 5B1YA 4C0QC 1DTSA 1UMDA 5COMA 3I37X 1G21B 5FCDA 1QVWA 3ACCA 3CINA 2RAVA 1L2TA 2Z1NA 4BJ5A 2UZ1B 2FRVA 2OHOA 5B36A 2Z2YA 2GPTA 5FUQA 2QNBA 1ZJ5A 1Z7WA 5KSZA 5D5HA 3I1FA 4N3BA 2XW6A 1WPGA 2ZJ0A 3ZD8A 2I6TA 2VEDA 4C7XA 3Q7LA 1RR6A 3WB9A 1FP1D 2MYPA 1R0LA 2VJLA 5ULLA 5EEGA 1P0PA 3PBKA 5JTUA 3T7KA 2H9YA 2BGLA 3PJDA 5LDHA 3TD9A 1U1IA 2OV8A 1CULC 3RRJA 2G28A 2PNOA 3WK9A 4Z1MA 3AP1A 3ANMA 1U2DA 4HR7A 4EA6A 1N6HA 1MP0A 3ZQ4A 5FFNA 4QICA 1TU0A 3QH4A 4YXWD 1CF9A 3WLAA 3F6RA 4YMGA 3JQDA 3K1IA 2OWDA 1Y33E 1UFRA 5KUTA 1B8PA 4TQUS 2ZBRA 3I83A 2ET6A 1BJKA 2ZUTA 1OBHA 2J87A 3D6VA 4X00A 4J0DA 4ROTA 1AURA 3EIOA 3W4JA 2EF0A 2YXPX 1Y8CA 1E9FA 4L4ZA 5TJHA 2IH5A 3A37A 1KMNA 4IDAA 4QSMA 5TQ2B 3QVUA 4B3MB 2G76A 1EKYA 5DT2A 3GAMA 2CLMB 3SSAA 3EVTA 1KI4A 1E99A 2PRIA 1MJGA 3I01A 1N4AA 2C00A 1R6BX 3UTDA 1N5JA 4P80A 3L93A 4C2AA 3ZG1A 2FW0A 4I3GA 5ALUA 4WI1A 1LVGA 2PD6A 2GGSA 2FR1A 1C9DB 1YA4A 2QTAA 4NCHA 3UHFA 1JHYA 4BVEA 3OP1A 5LUBA 3V80A 3VA7A 1A2OA 4HS9A 5DTEA 4DVYP 2OM6A 2BI4A 2YEVA 5HR5A 4DA8A 4F5ZA 4LYAA 1TM3E 2ST1A 1RYFA 5FEMA 1M1NA 5F98A 2DKNA 1N6RA 2P1AA 3P9ZA 4OA5A 1ESZA 3GB9A 2X13A 3K6RA 1WSWA 1GKIA 4MP3A 3K1YA 4LXXA 1NXSA 4QEKA 4ER7A 3H7IA 2GBPA 4UBKA 4R1SA 5B1EA 2H4HA 1LI7A 1V8DA 4DBLC 3LDAA 4NK4A 4ERNA 1AKUA 4N54A 3NB0A 1L0BA 4JLOA 1NOKA 4EENA 2ZJOA 1G2PA 2B4QA 3O4FA 5MN4A 3QBJA 3OX1A 4PLVA 1F8YA 5DYWA 2NU8B 1RIFA 1UJ5A 4HSGA 4UBIA 1X1BA 1XLTA 1Z3CA 1DQPA 1H8HD 4CFYA 2KBEA 5CT4A 2QLAA 3I58A 2HXSA 5IVDA 3NX4A 2P9JA 2QTVB 3EPJA 1CZKA 4Q7KA 2YS7A 1ECCA 5E7JA 3SVZA 5CDGA 3USCS 2R8EA 2OC4A 1QYXA 3IXLA 1FXUA 5KJFA 3BH0A 3WYFA 5D01A 2VT2A 3IA2A 1VIVA 5G0SA 2OFXA 3LBAA 3ASVA 1YYXA 5JSFA 1D2GA 4II3A 2CXSA 5KYKA 3P45A 1NBIA 4AUMA 3TI9A 4HLUA 4GUDA 2AJDA 3P0FA 4D3ZA 5DVWA 1LGYA 4H1VA 1SM4A 2P4HX 3KYIB 1EVYA 1ZSNA 3IDFA 3UT0A 4KFSA 3OEEA 3EIUA 5KKNB 2ZDQA 3F9IA 4RGYA 4OFWA 2WHYA 3LOUA 2QXUA 1E5TA 5F35A 1CB7A 4KMSA 4JTCB 4IDPA 5F21A 1YO6A 3DMGA 1F0YA 2FB9A 2FFHA 1DAMA 3LTNC 2SCUA 1PD1A 1GTZA 1YU6A 2NZJA 2R7WA 3PX3A 1NE7A 4YCBA 1CJCA 1Q1QA 1CY0A 1ZD8A 2EZUA 2OGTA 4DIMA 2ZCJA 1ZVVA 3VPBA 3ND7A 3TQTA 3BEHA 3O38A 2JA1A 1TUBB 1PCXA 2WWVD 4TTSA 2M6SA 1J0DA 2WJ6A 1NAHA 2C5AA 5LDGA 4UBOA 3GGJA 3SQDA 1J39A 1WDLA 4GXTA 4PPFA 1R0XA 2YL7A 1N2SA 4WFQA 5D6NA 4BYMA 2XTZA 5AOCA 3FUVA 2QIOA 1GILA 1UXOA 3N76A 4S12A 3RFVA 4CT5A 1JKXA 2B9EA 4E5PA 4PXYA 2NTJA 3N2EA 1I36A 1Y4DE 1ZJWA 1RAAA 1HRDA 1P9RA 1WV1A 1FDSA 2EPKX 2G3KA 1JHAA 4TKUA 1O3UA 3H19A 3DKKA 4PPGA 3QOWA 2RBGA 3MM4A 3BM5A 2PBEA 1WW2A 4JQCA 1YS4A 3L0OA 4RWEA 3P2EA 3GARA 2Y3IA 2JBWA 1QH8B 4AYTA 2VJMA 2J9BA 4NH4A 4A26A 3IT1A 1H0HA 3T06B 5K8JB 1NVEA 1S2GA 4BFWA 1PEKE 4IFBA 1NRIA 1R10A 3PLRA 5L4SA 4TZKA 1ND5A 3KPUA 1EEXB 3STUA 1L1EA 4F9TA 2CHFA 2PFKA 1TKAA 2W43A 2H1HA 3LF1A 4BXOA 3ER9A 2XYQA 4RL6A 5HKAA 1E59A 2Y93A 3SXPA 3VR6D 4XM1A 1OPRA 4OAQA 2OAP1 4LV5B 2G5PA 4JI0B 4AP5A 1KKLA 3FGOA 3QLJA 1T3HA 3NNNA 3I52A 2PJZA 3JQEA 2ZE5A 2GCIA 4B44A 2XZPA 5JFGA 1ZD5A 2Z5FA 3BGSA 3Q7RA 1J9GA 1GFZA 1UJCA 4GPAA 1UDXA 4A03A 3ZGOA 4FHDA 5EIBD 4ZYVA 3WGZA 1VL6A 2D5IA 1RXIA 3MLBA 4A92A 2CHUA 1XT6A 4QGBA 4M98A 4XUCA 5B58T 3QYFA 5DBGA 4R1UA 2XL8A 2GZAA 4NTZA 4G1FA 5E9AA 4H0CA 1B76A 5CI9A 2ZUDA 5C3MA 3IEMA 1QM5A 3T35A 3NBFA 4DRXA 1QDUA 2PBZA 3EGIA 3W3ZB 2PFGA 4C4PA 4K3VA 5GOTA 1GU0A 4GKKB 4XH9B 1ZVKA 2NAFA 2XUOA 3UW3A 4BP9A 4CM8B 1FQWA 1JG4A 3L46A 2C2GA 3I2IA 3QG5A 1SAYA 2A9RA 3TK1A 3M6MD 4C0BA 4JJ8A 4U3JA 2ZWMA 2GCNA 3D81A 4HQ6A 3P71T 3KELA 3P2OA 4IGAA 4NIMA 4KRYA 1QDEA 1GNRA 4B45A 2XSZA 4K1LA 4F6RA 3RUCA 3EZIA 4UNSA 3OKCA 4EZBA 2JFVA 4QUGA 2HCJB 4BQEA 1O87A 4UASA 2A0FA 2OGWA 4YJDA 2HJHA 3A4YA 4W1QA 4NOMA 1XI2A 5FLXA 3UA3A 2X9LA 3ZC3A 4L51A 3RHFA 3T7TA 2IYPA 2HHCA 3RSCA 3Q7GA 4DV7B 1UOEA 4EYGA 2ZXOA 2VRCD 2C7QA 5I47A 5J9FA 2XGSA 2Q5LA 5I3ZA 4ZVLA 2BCGY 3SS8A 1QQBA 1K7SN 3PL5A 2I9PA 1O6FA 1YWGO 1L7AA 3DZAA 2KQUA 4WXRA 2J0EA 5CHEA 4MR8A 5GY7A 4KQHA 1FFDA 5JVDB 2Y0CA 1ESDA 1FUIA 3VVCA 1CQPA 3RVYA 3E9QA 4RETA 3GJYA 4MKRA 3E7DA 2A3RA 1C30B 1TYBE 2CDBA 4W99A 4C76A 4UPDA 3HWWA 2JJMA 4JSYA 1QU2A 4LTNA 1J42A 4BPMA 1FXWF 5I9BA 4LQCA 4XPWA 2J46A 3CPHA 5K8VA 3GANA 3OTGA 1QHEA 3R9WA 1KE2A 4E5MA 2WG0A 1U3TA 5K0LA 5B7QA 2R02A 2AWCA 5MHTA 3EZ9A 3ZCVA 2YHSA 4BMCA 4R7TA 3PFCA 4FTWA 4KYVA 3MRTA 2R4UA 4NE7A 3UM9A 1L8LA 5LR6A 4J0QA 2EZ4A 1C02A 3HRKA 2VP5A 3NKVA 1QVRA 2AKEA 3S6JA 2J3LA 1ESCA 1W2HA 1V8ZA 2IQ5A 1G6KA 5LB2A 4G07A 4BNKA 2NUAA 2YWFA 4FYIA 3ET5A 4RHXA 4V03A 3QPCA 2CKMA 3RYCA 3JVVA 1VE5A 2C7OA 2F59A 5B7NA 3LJKA 4D3SA 1W36C 4GL2A 2HCTA 3QVKA 1RP7A 5DBOA 4NZMA 2DWPA 5AXCA 2DBYA 2OO3A 3EEQA 4NI5A 4CM6A 3BRCA 2A5JA 2Z6UA 3U4DA 4C06A 4YIHA 1TAHA 1UK9A 4YUYA 3E1KA 4WZBB 3N3AC 3ZU3A 4JT8A 3LYUA 3T38A 2PZJA 3U0BA 1RKUA 5EXPA 4PR3A 3MD9A 3U3KA 2QK4A 4Z0TA 4DZTA 2NVWA 2IE8A 3VC3A 2R65A 4XWYA 1HYHA 1RWVA 1Z7Qc 2GILA 5KB3A 4U5GA 3DKVA 5EXXA 1DIGA 4DRYA 2J9FB 3HP1A 1GHTA 2QUHA 1TWCA 4HRAA 3QEMA 4B4WA 3U9SA 4BAGA 2J9YB 2W45A 4DRHB 1L5RA 1QOZA 1TUEA 4CR7A 1GGVA 2N9UA 3KO8A 2C03A 1CUJA 4RVSA 3VH4A 3LEOA 4RPIA 5JHHB 3WJ1A 1RZRA 1PV2A 3OPYA 2PS3A 1SQ6A 1HSZA 1HLFA 1IL0A 3C74A 4BIMA 3OLQA 4RVFA 3EMKA 2VCAA 1P4RA 3VPCA 5JCJD 2VDLB 3NAGA 4EYSA 3AEUA 1XEAA 3GFVA 1CY2A 1RMVA 3B6KA 5NLLA 1FMTA 2QTZA 2P77A 4EUFA 4CEJA 5CDTA 5IS2A 3TOXA 1CUYA 3IIJA 4YPVA 4YYEA 1VECA 4MI6A 2BFEA 3F8SA 1QYCA 2CL5A 1X1EA 5KDOA 3IILA 3NONA 1XCLA 1GCIA 3LHDA 3L0DA 1TM7E 1DIOB 4K6MA 4MA5A 5L3SA 2IZ0A 2HA6A 2GDCA 4L8YA 2FAPB 2A57A 2E7ZA 4RKQA 4I3MA 2P79A 1SB9A 3ZWKA 4TKVA 2CC2A 1J07A 3VR5D 3FKSD 1OCEA 1AQLA 1HUQA 2WAMA 1U7DA 3DFFA 3P9PA 1M0WA 5L3ZA 2P4EA 1H3FA 3AOUA 2PX3A 4R9UC 1Z8DA 4LRXA 3ANTA 3QP9A 4P7BA 5HW0A 5ECGC 4WESA 1Q1AA 3PC6A 5ECYA 2PMDA 5TPWA 3U1TA 2B1GA 1EFDN 3OOYA 3U9LA 3UHAA 3TOCA 2AZMA 4HHEA 1TZCA 3WDLA 3GFBA 4KR9A 1NMXA 4E2YA 5DF1A 3KZXA 1KIMA 2JATA 2YWJA 4JNCA 2HQOA 2O2ZA 2XZTA 3M5CA 2R6CA 4DMLA 3QF7A 5H4GA 2DF8A 3P5SA 3C1UA 3RUIA 4U9IS 4KEAA 4M22A 3P19A 3ZH9B 4WZBE 3ORQA 2B9VA 3ACDA 3R76A 3DO6A 3CNBA 3PQ2A 5IFLA 5GZ6A 4HG2A 3FTNA 1P4JA 4X8HA 2GZHA 1P3DA 2Y2UA 4WK6A 2FKAA 1C0PA 3CV3A 1A9QA 4YFYA 1IYZA 3P8ZA 4XWTA 5TSDA 2EZTA 2BONA 3TSAA 4XI9A 5C81A 5CA1B 3UXYA 2F9MA 3QUCA 4MYTA 4FQ8A 3TLKA 4UDOA 2AVNA 3BBPA 3EXHA 3U3BA 2ECPA 4PS0A 3RAPR 1VGQA 1HOXA 1GCUA 4CUJA 2J0UB 3WYGA 5JNUA 3ZTZA 2O2YA 1SCAA 1ONPA 1X39A 1T6ZA 2BAGA 3E7WA 1ZNZA 1D3AA 3UMSA 3D4OA 1J49A 3OC0A 1Y8QB 1XMXA 4EFLA 1AKWA 3VKVA 4L6AA 4ZI2A 2WV7A 4IICA 2G17A 3GZ4A 4J43A 1P1HA 1R9GA 4LAFA 4QSHA 1K2VN 1Q14A 4EDFA 5DLYA 4DV0B 4N5HX 4J8PA 5IY5C 1THTA 5JAIA 4DSZA 2QHXA 2VYND 2WJ4A 5JMTA 2D0OB 2PL1A 2WP8J 3PXEA 4WZ6A 1M2NA 3N1UA 3NBKA 5KYVA 3RE1A 4OKIA 5IH7A 2J9VA 5KU1A 1BRMA 5GJCA 2WT8A 3ROEA 3M4BA 3F3MA 2G8NA 4H15A 3L1IA 4KZPA 3GFGA 4ENTA 5FAKA 2FR8C 3WLMA 2Q8PA 2R25B 4ENQA 1WMFA 4ZI7F 3NDJA 1HNWB 1U8TA 2HLDD 3HNLA 3M6WA 3ZH2A 1MV8A 2L6GA 5B3SC 1A7DA 4NONA 3SIXA 4EX7A 3R6GA 5ICEA 1I4DD 2C9YA 2XGOA 2XCUA 3AUUA 3GFTA 2QL6A 1FAPB 2R7LA 3HU2A 1KY5A 5D3MA 5FAXA 3O8OB 2VG8A 3IURA 2WSIA 2YHIB 4Q4LA 1SXJC 5BVGB 2NO5A 1C3XA 4KDFA 4MRMB 3ITNA 1SOUA 3MSXA 2V0GA 3MIZA 3SXYA 5JBIA 3OU6A 5LKAA 4WSOA 2GAOA 4P86A 1G4US 2MIIA 1IATA 1PL6A 2ZDHA 4FIDA 1JQEA 2XS1A 4ZO8A 4TQGA 5L0CA 1YB2A 3OOJA 3QE9Y 3QMKA 3LLIA 3R7DA 2OPBA 1FSFA 2AMFA 5JT4A 2A0YA 3AP2A 2BGGA 1XE3A 4RSRA 5KNDD 4LIPD 3VKFA 3AHDA 2IYQA 2X4DA 3VRHA 4MVJP 4DA0A 1E7YA 4ZGGA 4HNUA 4CWAA 1L7VC 4JEMA 5BOSB 1W1WA 1E85A 4Q34A 3AGQA 4UDNA 2O05A 1E2GA 3KVOA 3L77A 2HV7A 1Z6GA 1XBTA 2Q2QA 3EMBA 3Q8KA 3TG8A 2PYIA 3BJZA 1DX4A 1OD6A 2HGSA 821PA 1D0VA 4X91A 3TLMA 1CQIA 1R4MB 2WR8A 1X13A 1C4OA 3D4LA 5CB4B 4TTIA 4EF4A 2VHVA 1H0SA 2E5FA 1SBCA 4OFZA 5K0BA 4MTFA 1GPBA 3TO5A 3H1FA 4EI8A 1SHZA 5BVHB 4K2AA 3AEKB 2ZQYA 1XYYA 1MTOA 4MRRA 3OCUA 5JOQA 4OUDB 3WOHA 3LUAA 3NW9A 4WX2B 4QUIA 2ZJ4A 3Q40A 4ZT5A 4ZYYA 5J3JA 2BP7A 3HXMA 2VK4A 4HLCA 4Z86A 4H0NA 4Q03A 3M33A 3F4LA 3JQAA 3N9IA 2WU1A 2PKCA 3IE2A 1KS9A 2RD9A 2APJA 4C30A 5F5HA 2L19A 4B32A 3K4PA 2PP4A 4P4UA 1DV2A 3GJ6A 4EGCB 5KYXA 1Y6JA 4U8GA 1L7MA 3IQWA 1GTL1 3E9VA 2O7RA 4OQNA 1VHTA 2V6JA 4R8KA 1R12A 3R40A 3CVUA 4MRNA 5M34A 5AM4A 1K06A 3CVVA 5L4LA 3CW9A 5AK4A 3SHQA 4ZI5A 1E2QA 5JT1A 4INJA 1WHTB 1RTKA 2HPAA 2JH9A 1IQUA 3AW8A 1YFLA 5AW9A 3RVMA 4C7JA 4HWPA 1Z28A 2YY6A 3DYBA 4V24A 7REQB 5ALVA 1LPOA 3U48A 4BQIA 1UPUA 2H1OA 1SD1A 1C17M 1O57A 1HQCA 3O8QA 1HFEL 1SVUA 4UDYX 4Y6RA 1P2FA 5AKJA 1N3YA 1N9GB 1MPXA 2QG6A 4K9QA 3O73A 3CCCA 2PDAA 2YNMA 2FCAA 4HXFB 3OD5A 1C1DA 1ZHHA 4O4HA 4LCJA 4BLUA 3GQBB 3R0IA 1QP0A 3PEUA 4O4JA 2C82A 4QBIA 3WL6A 4BX3A 2YXLA 4NP6A 1KPIA 4BB6A 4LJ7A 1VYVA 1VI6A 3GEDA 3L5OA 3Q5EA 3ZWPA 2ISSD 4N5NA 4EA7A 1R18A 4CRWB 2ZXWC 4MCIA 2F1RA 2Z57A 1C7QA 4KTVE 4EF5A 1NVBA 3L92A 5CT5A 3KAPA 3H5TA 3TTVA 4YCJA 3OFSA 4GECA 3IBTA 1KYVA 1C7JA 4DMFA 1XTBA 2G36A 3AETB 1FJGB 4EY7A 2O7QA 2ZZMA 1F2DA 1PL8A 4IL5A 2MU1A 3O10A 1VTKA 1LQTA 5IXJA 4CM5A 4M7OA 2GXQA 4E09A 4P4SA 5E9QA 3UMVA 1XZKA 5CFLA 1OXBB 4DYHA 3BHNA 2BDUA 1DWQA 3E27A 2NPIA 3LWZA 5K8LA 1FRQA 4PRZA 1WE2A 3HM9A 4L27A 1OAOA 3E82A 2V55B 1HT2E 2MSKA 3ZCSA 3AEQA 3O75A 3QYPA 3QWAA 4HRYA 5AW3A 3O1LA 1MHPA 1WB9A 1QZZA 2LIGA 1NQVA 4ND2A 3QU2A 3PFHA 2FEWB 4M9XA 2ZYUX 3KM0A 3NGXA 4IIBA 1GUYA 3M49A 4UXHA 1XRMA 1N1EA 2M1ZA 3BGDA 1SIBE 3NM6B 1XQ6A 3G50A 3S84A 4B2IA 4EBJA 2OAEA 2BMEA 4H27A 3MCZA 3F9RA 2W2LA 2VCHA 3BIWA 3FM9A 4NXNB 4Q3DA 1APCA 1Q44A 1W59A 4EQ6B 4ZODA 1WASA 1EVIA 4GL4A 4FUQA 2VDQB 1BO6A 1CNMA 1IN1A 4YAWA 5L7YA 3ZDDA 4RY2A 4PSDA 3ZBUA 1OR2A 2IT1A 3FVVA 2I2BA 3R5FA 3WIOA 1AUXA 4GKBA 4Q7JB 4JN6B 1WO8A 3P32A 3DZHA 1YI8A 4A8TA 4K6HA 5EJ7A 3FMSA 2IHJA 2Z1DA 2XNKA 2PD3A 3D54D 3NNDA 3IPXA 3ZV3A 4GPBA 3EFHA 1NT2A 1N5IA 4Y1RB 3WLRA 2HIMA 1NVFA 4BJ5C 2RMKA 5FHRA 1M5UA 4MVQA 4LJ6A 3DBIA 5HFNA 4QGGA 3MWEB 1JAYA 3H2UA 3EOBI 1JOGA 3G59A 2IV7A 3G88A 1ACJA 5DHFA 4BNIA 4OHRA 5ALKA 4ZEXA 1VIMA 4DPKA 4HL6A 3OP4A 1OCRC 4HAZA 4YBZA 2SKEA 3V00A 2GO1A 4BE9A 4CTJA 4AW9A 4HGZA 2H7OA 4WN3A 4DILA 2BFPA 4MVJI 4IQFA 1W76A 1U8FO 1TMYA 1FP4A 4CKWB 1A9SA 3GZJA 4DANA 1T9BA 3EBOA 1U0EA 3CPEA 3TXYA 3KYCB 3L8DA 4EY3A 1HY3A 3MJTA 1U2DC 3ERCA 4MW1A 2FETA 4IX9A 4ZT3A 1FW6A 1KYZA 3KU4A 4DG8A 2QLLA 4ZD6A 3TW0A 2XTNA 5JSHA 3GLFE 4DTCA 4NC3A 3K1IC 2C4MA 4LPKA 6GPBA 4MUXA 5BSMA 4CMIB 1U4OA 5KVSA 2W98A 5DEOA 4CFSA 4KHPB 4CDYA 3NKEA 1KXJA 3M5DA 4ZZIA 2ILTA 3H2GA 2JIQA 1QGED 4MTLA 4IMJB 4FBGA 4JUIA 5BR4A 1U80A 3D2LA 4BECA 5FLKA 1V39A 1K6JA 3WWDA 4RH3A 4PJJA 5D5PA 2NSYA 4YCMA 5AJZA 3BSFA 3LNCA 2MINB 2FMFA 5ICFA 3V4SA 4AZWA 3IBSA 3VO1A 1F7UA 3WWOA 1NF2A 1CJMA 1L4LA 4AY3A 1OXUA 5CH8A 1X94A 2H1SA 1NMQA 4QPPA 2KS6A 1IWBB 5CYOA 2VT3A 2XWSA 1T5DX 3U80A 3KVRA 3GVCA 3PF9A 2PL5A 1PZMA 2OJQA 3JRTA 3TLGA 4LE1A 4XPIB 3KALA 3B29A 1EZ1A 1LU9A 2BMWA 4Z3KA 2LIVA 1SUPA 2ONCA 2VNHA 4MW0A 3WBJA 4ZZ2A 1ILEA 4LGMA 1M2HA 1J5XA 3V7YA 1ZCJA 4LSGA 2HHHB 1EA5A 4EJ0A 4ARUA 2HJRA 3T4XA 2B20A 3KNZA 2FZGA 4LBVA 3CLSC 1T0BA 4QYTA 4GM1A 4DW8A 1M5RA 1L7DA 4G4IA 2RB5A 5BQPA 1XLTC 2YC2C 3PHGA 4BN0A 3ZVNA 2X0FA 3EVGA 1N8NA 2H06A 4J4BA 1NVVR 1TGYA 4EHLA 3MLAA 4OXYA 2PGLA 3W2VA 2QQ0A 4DBRA 2B7CA 3W5IA 5D00A 3IPYA 1W5FA 1G7CA 1PQYA 5BV7A 3D2CA 1VIDA 4DHEA 3E3MA 5A5EA 4GX0A 2JAXA 1MENA 2Y6UA 4DLKA 1MQAA 3LCCA 2WIDA 2NWQA 4YYZA 3T3MB 2FOIA 4YRPA 5D7NA 2AE2A 3ECSA 5CXUA 1Y6DA 2Q2WA 2YMQA 2GBGA 1IUNA 3E81A 4NQZA 5FWXA 1FS5A 2BBWA 4X6XA 1NAIA 5HSWA 2QVGA 5HF6A 3QE0A 4LTMA 3JSZA 3O9ZA 1SBZA 4HLUC 4QATA 3UJ8A 1PYOA 3ODGA 5DHSA 2PNJA 5BYAA 4RTLA 2P5TB 4TXJA 2JFPA 5IUJC 4J90A 2OD7A 3HN2A 3LY9A 3ZI7A 5F7ZA 2P0NA 1PVDA 1ZOPA 2V7XA 3R24A 4UVDA 1VIYA 4E5SA 4NOKA 1VA4A 2EKQA 2WICA 3ZWOA 2AKAB 4EBKA 3MW8A 1G7RA 3B36A 2B5OA 3ZWQA 3W78A 2CF5A 2LFDA 2H0QA 4PFSA 1PGNA 4CV0A 3WLJA 1I13A 5AJYA 2O1SA 3CUVA 1NFOA 5DI9A 2R6HA 4NENA 3O7MA 4ZWNA 1FX0B 4EG4A 4O2BA 4TXLA 1LRLA 1Y1SA 4JOCA 2LDXA 2JASA 4A0HA 1F06A 1MH1A 3T9OA 1PV3A 4RL4A 2FSSA 5FD8A 1ZR4A 3E3NA 5K6RA 1JKMA 4I1MA 4RD9A 1P2DA 1E7QA 4CT0A 5JCPA 1V1JA 3JD1A 4PONA 3OF3A 2AD1A 4G2NA 3VNUA 2ZUUA 2FPKA 3OQ1A 1T2CA 4D1YA 4AWXA 1DZ3A 4KYTA 3DOHA 5TMDA 5DNCA 3ELUA 2C7RA 4AUEA 2X0IA 4KLRA 3CZ4A 1O0SA 1ZINA 2HRDA 3IC5A 3D6AA 3PNYA 4B85A 2ZB2A 3VH2A 1OWNA 5HDQA 3ZC4A 1JLLB 2VOJA 2I15A 3AL0C 3SEAA 1LLFA 1AZLA 4L50A 4YJ2F 4YMWA 2OAQ1 3L7LA 5EC8A 2C3UA 1A8SA 4HFFB 4CYMA 1Z7GA 3E1GA 2CLCX 2AG6A 3S2IA 2J0XA 4NTAA 1TVKA 5IF9A 1CRLA 2OHGA 2IUTA 4DARA 4URZR 1C7EA 4IDDA 4KWCA 3JAKB 5MDHA 4NYMQ 5IMSA 3AF5A 4LY0A 1QOPB 2BFCA 5BNTA 4PLWA 1UFQA 2H5JA 2C9OA 4IIEA 4OJNA 4FOOA 1GPH1 3RYFA 3RV3A 1LC0A 3LDFA 3MWKA 4GOJA 3QBTA 2JFQA 5CJJA 4MGZR 2TS1A 1GTMA 3LCVB 2Z8YM 4YT5A 1KU2A 3HVJA 1JEAA 3UFXB 5B3JA 4YP5A 1JWBB 2EFEB 1NSGB 3VDQA 5PNTA 3RWBA 3I9LA 3KT0A 4GBGA 3U0VA 1V4BA 3MTGA 1DG3A 1A4RA 2AG5A 3PDJA 3QUSA 2PQMA 4MARA 3P4XA 5DTIA 3AM1A 4LEIA 4S35A 1AN0A 3MILA 3OZXA 1SC9A 5DHRA 4F60A 3H2HA 3COWA 2YKGA 5AKGA 4HN4B 2OK7A 4HGRA 4KQGA 1VLSA 1XMOB 5KTRA 5AW2A 2QF7A 1E58A 2QYSA 4PLYA 4WUVA 4WY8A 2Q4FA 5BO5A 4AKHA 4WZZA 3NIGB 4ZANA 5TR9A 1EP9A 3AG2C 4FD2A 4D4KA 3H65A 1XU7A 1DDGA 3LCUA 2GJAA 5HYVA 4LZAA 4UARA 4XASA 2B8NA 4AQDA 1STOA 4EYEA 4MW2A 1O08A 3CEAA 1KJ9A 2IBFA 4Q5IA 1H6AA 1KFCB 2VH1A 1TE2A 3KUXA 4LDKA 3MSCA 5KYTA 2XCRB 1CRQA 1TEZA 1S2NA 4X66B 4BMDA 3VAAA 2W2KA 4IMPA 2DY1A 1E3SA 1QYVA 5AVVA 3QKUA 5IAJA 3GO4A 1EK2A 4K6OA 4BX9A 3JQ7A 3MGBA 3RYLA 1R5BA 1FDIA 2CNNA 3KT6A 1NRJB 1CNEA 3OO1A 1AQNA 3QWIA 5L6MB 1P4GA 2L6HA 1MB0A 1QFXA 1FFBA 1NBAA 2M64A 1MOQA 4YRZA 5JS6A 2O2DA 4KDEA 4OYYA 3I8XA 1U1CA 4UEJA 3GDFA 1ENYA 4BQNA 1JA1A 3U9JA 3UPUA 2YIVX 1F0KA 3WGNA 4MKZA 3LT1A 4UU1A 4MHOA 3V6LA 5EE0A 2AZXA 1VG0B 3U4HA 2C84A 3IHTA 4GWKA 1NG1A 3QF4A 1H2RS 1RQ2A 3JALB 1EFHA 1FFSA 1TJ3A 3DDOA 5CBPB 4F4UA 2DETA 1T4CA 2N0SA 5LP6F 4LOAA 4YRGA 4BU0A 4P32A 1SQSA 4PYKA 3GI1A 1YD7A 2NXCA 4AF6A 4CTOA 4DA4A 3DEHA 3RF3A 1JFSA 5AVZA 1FFHA 3GLKA 3LVQE 1PFWA 4JSRA 4ALJA 3W5HA 1ECGA 1CDEA 3OX2A 3MOGA 1ZU4A 3VISA 1CZHA 3T4UA 2WVHA 1SWWA 2EOAA 4AWBA 4ZTZB 3RTBA 3GAFA 4DTIA 4X45A 4L4YA 1R9NA 1GPYA 4L0CA 5BWOA 5LDDC 3UUFA 3DBOB 2AI2A 3BXXA 4PX3A 4KR7A 4UEWA 4AS2A 1M1UA 4LJRA 1BXGB 3L7YA 4GZ5A 3K9BA 4EVSA 2A94A 3O7WA 4FGLA 3MQ2A 2BEVB 5D3ZA 3FPGA 4NLLA 4W8HA 5LCXA 2FCRA 2I6SA 4F91B 1QLHA 2ZTUA 1FJXA 5FTWA 2QZ9A 5EWMA 2IEAA 1F8XA 2AG8A 1T3TA 1KE1A 1LSUA 3AM3A 5I4BA 4BHTA 3KE9A 4TKLA 4ZQGA 3DXFA 5CBKA 4LHZA 5HE9A 2QB5A 4V02A 4M8KA 4MA0A 5GGYA 3KJEA 2VPZA 3F2IA 1WZEA 2QUKA 2Z6VA 2C2BA 3THXA 1MKYA 3UWSA 1H8ED 2ISCA 1VSBA 4ADSG 4QGFA 2NO1A 2XMDA 2WAOA 1PZFA 4IH9A 1T2VA 3STVA 4CKYA 3JAWB 3FBWA 3O3OB 2AOTA 2ETSA 4P38A 1Y4SA 2J85A 4FB4A 4ZQCB 1FC0A 3MJHA 4DR3B 4P3YA 5FWYB 4ARCA 1OYOA 3FPHA 2IC5A 2CHVA 1ZIXA 4TYQA 1NN3A 2BKLA 3HNIA 2XHZA 3A6HA 3KXDA 3K0AA 3QITA 3MT7A 1R27A 4N76A 4LXHA 4KQ6A 3FSEA 4D8YA 1KQ3A 1H2WA 3FLMA 2FWIA 4OIFA 4REOA 4GZLA 1BDMA 4ZU6X 4B6PA 3ECCA 2YL2A 2Z04A 3LQQA 3HWRA 4TWRA 6NULA 2Q62A 3MNFA 1OHHA 4YV2A 3MINA 2OUIA 2O3UA 4O4JF 1YFZA 4D0RA 2OYCA 1T1GA 1P62B 3TZLA 5A02A 3QU4A 3TNLA 3K9NA 1PZNA 4OI2A 2CJWB 4II2A 4WLOA 5MN5A 1M6TA 2YY7A 2WU0A 4YWQA 4D2IA 4W1PA 4DLTA 1M6VA 2AMYA 5KINB 3D5EA 4TX1A 3EVEA 3OSUA 5JXJA 2I9KA 4ZGWA 4LE0A 4GOMD 3BWCA 2A0UA 4BAZA 1G9TA 3C3PA 2I0FA 1WCV1 5L3VA 2PD4A 3FAJA 4BVJA 2JHFA 1D2EA 3I9FA 5KYYA 2HSBA 2CDQA 3GJZA 1VPEA 4RJJA 1XEWY 4MGHA 3N58A 1UWVA 3O8RA 3Q41A 3DT8A 1ORTA 5FI0B 1HZZA 3EFEA 4J75A 2B37A 4DYDA 3U6BA 1W5BA 3QV1A 1MU0A 2RHHA 2QTHA 2D6FA 3FZYA 3WL5A 3FA2A 4ND6A 5HMLA 1ZS9A 3DL2A 2PX0A 2GOYA 1IM8A 4X84A 4NU0A 1G63A 1A50B 2FPOA 1C4XA 1E8MA 2HWYA 2QR3A 5D7BA 2O07A 1AOXA 1G41A 3KLBA 5C8ZA 2O2CA 4EKGA 2EPMX 3B60A 1OROA 4P34A 4EA9A 3ZX4A 3FWKA 3LUBA 1QQ6A 2CN1A 3K30A 3P9NA 3KQUA 3L1MA 3H04A 4LERA 4GKVA 4EHIA 2ZBQA 5COQA 4KO3S 2FJ0A 3N39C 4X20A 3GF4A 2IYZA 4JBXA 4DL9A 4HRVA 2JJQA 1FY2A 3EVBA 1UBFA 2RHJA 1O6BA 5JS7A 2GM3A 5JAOA 3U26A 2YRFA 5KNLA 4C01A 3ZZUA 4B7UA 4M1WA 2O8DA 2A9KA 1KU6A 2IEBA 4RPGA 1NYTA 2H5IA 3OICA 5KMGB 3O94A 1PWHA 4AJ1A 3TR5A 5G0VA 2YXEA 2WSSA 3FCXA 3C6KA 2FLWA 1LY1A 3MS7A 2F3RA 2XT9A 1FSGA 1F7VA 2PGJA 4EUSA 5AK0A 3FHTA 2ZI3A 3NM5A 1WJGA 1JYEA 2FEKA 3IJPA 3O74A 4BLVA 4L5CA 3ZUGA 3HZOA 4EHJA 3FNEA 2P2NA 3SJAA 5AW6A 1KO7A 4FDUA 2HKVA 2XKBA 1KI6A 4ZYUA 3FOPA 4HGPA 2F43B 1OI7A 4WGFA 2CSUA 2W6ID 3AIMA 1V3TA 2QQEA 4A6EA 1QQAA 2EIJC 2B7BA 3FOZA 1DIRA 2B4KA 2W90A 4D8WA 2J9WA 3NCTA 1DT5A 2QTGA 4KIJA 4TWJA 3N8KA 4NMWA 3S5UA 2OKGA 3NT2A 4MUYA 4LKOA 5HFJA 3V2IA