1J8MF

Signal recognition particle conserved gtpase domain from a. ambivalens
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
295
structure length
295
Chain Sequence
LLDNLRDTVRKFLTGSSSYDKAVEDFIKELQKSLISADVNVKLVFSLTNKIKERLKNEKPPTYIERREWFIKIVYDELSNLFGGDKEPKVIPDKIPYVIMLVGVQGTGKTTTAGKLAYFYKKKGFKVGLVGADVYRPAALEQLQQLGQQIGVPVYGEPGEKDVVGIAKRGVEKFLSEKMEIIIVDTAGRHGYGEEAALLEEMKNIYEAIKPDEVTLVIDASIGQKAYDLASKFNQASKIGTIIITKMDGTAKGGGALSAVAATGATIKFIGTGEKIDELEVFNPRRFVARLHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the conserved GTPase of SRP54 from the archaeon Acidianus ambivalens and its comparison with related structures suggests a model for the SRP-SRP receptor complex.
pubmed doi rcsb
source organism Acidianus ambivalens
molecule tags Signaling protein
molecule keywords SIGNAL RECOGNITION 54 KDA PROTEIN
total genus 100
structure length 295
sequence length 295
ec nomenclature
pdb deposition date 2001-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF02881 SRP54_N SRP54-type protein, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 1j8mF01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1j8mF02
2CE2X 4KODA 1CBUA 4BZPA 4NYIR 4A0HA 1RYHA 3R7WA 4G5GA 1AZTA 2PZGA 4QHSA 1DO2A 3R9XA 1KHTA 3QPWA 4IXMA 5DN6A 4TYNA 1XPOA 1LFDB 1R4AA 2H17A 3B1VA 2FEOA 4X8LA 4PHTA 3N70A 4IOLA 5L8VA 2VL7A 4EJSA 1NN0A 4JLDA 3DM5A 2OESA 3NXSA 4PC7A 4QBGB 3K9GA 1Z47A 3TNFA 1MV5A 4DLTA 4DVGA 3DOEA 4ZDWA 4UNPA 5AJYA 3DKPA 3EW9A 3OEHA 1NVVR 3X1DA 3VMFA 4OK3A 3NH6A 1GP2A 5FUYA 4M9ZA 4GOKA 1G7RA 1OHHA 2GTPA 4HLCA 3WYGA 4XWOA 2O0JA 2FFQA 3D7MA 1FP6A 2WOJA 3GLFA 3SEAA 3U7FB 2VRWA 1N6NA 2IHBA 1UKYA 2YJTD 1DAGA 4DCVA 3CR7A 3RS5A 4GI7A 1CF4A 2ZRHA 2ZI6A 2GZHA 4BFTA 1NVWQ 3THWB 5KO2A 2GZAA 1E1QD 4A8JB 1DBSA 4HLUC 3O8BA 3GJ6A 3SJCA 2VSXA 2SHKA 621PA 3CLVA 4HEJA 1J7KA 2FZLA 4FW9A 1NL3A 3FHCB 1TF5A 2C9OA 1IJFA 4JLOA 1CJTC 5M04A 3AH8A 3QPUA 4MRVA 2IXEA 1IY2A 1MRNA 1W2GA 2B7BA 4OQNA 3MG9A 3CPHA 3L82B 4CEHB 2ZIAA 2WMOB 4AYTA 1XTQA 2ZJ2A 2YHSA 1VCMA 4L9WA 4LDJA 4EFLA 1XFAA 3IIKA 1P9RA 1JJVA 4XTRA 3PENA 3GEIA 2QTVB 3NIBA 1E4VA 1Z6YA 4EQ6A 3O8CA 3HYTA 3BRWD 4Q03A 3SQWA 1G21E 3GFPA 4OL0A 3WBJA 2HV8A 2CJWA 3QQ5A 5J4KA 2V1UA 1Z2CA 4OHYA 1TU4A 3PEVA 1MO4A 3PUWA 4BGDA 4B47A 4OYHA 4WOPA 1BS1A 2GJ9A 2NPIA 3GJ4A 4JVLA 4BFZA 1JEDA 2MSCB 4HLQB 4JLMA 3AQ4A 1X1RA 5FTLA 1JB1A 4N0DA 1CRQA 1KO8A 2ANCA 4GNKA 4TYPA 2D7DA 3MMPA 1KMQA 2RGAA 3FGNA 3CR8A 1D2NA 2QMUA 3B82A 4LHYA 5C4GB 1KI6A 3GJXC 2JLYA 1YKSA 4US0R 4O3MA 1AA9A 4A82A 1N0WA 2Z4RA 1Q12A 4X8MA 1W36D 1EX6A 3CF2A 4HUQA 3SU8A 4AKIA 4MQBA 2DB3A 2O8CB 1KGDA 1P6XA 3TW4A 4DDTA 3RSOA 2BBWA 4YXWA 5F9HA 4KITB 1V43A 4LWZA 2ZE7A 2KBFA 4UJ3A 5JS8A 4QXAA 1VECA 2XX3A 2DBYA 1OPXA 3WP0A 5AUOB 3WMGA 1XJCA 1PVOA 3Q8XB 5KNCA 4RKEA 1W0KA 1QHSA 4C0AC 1KSJA 2WKQA 2X77A 3B2EA 1XWIA 4B73A 1H8HA 2FNAA 1RIFA 1IN7A 3U3KA 4LRWA 4A6PA 4A4DA 1ZP6A 3LW8A 4C0JA 3EZ7A 2ZSFA 5F2EA 1GKUB 2FFBA 1SULA 2GBLC 4Z1MD 5CITA 2OBLA 4C30A 1KI4A 4DDWA 1P2SA 2QM8A 4PQRA 2FPKA 2VP0A 3QIAA 4M53A 5JCPA 4WXPA 2ZXUA 3GEHA 4Q9LA 5HR5A 4P4TA 1N2CE 1X8JA 5BWMA 2RGNA 3I73A 5K8TA 2E9SA 2WAXA 4Q1FA 1OHHD 1YRAA 3LX5A 4Q4AA 4C0QC 4EPYA 5KTYA 4FWIB 5JLJA 3OE7D 3HU3A 2A3RA 3NDBB 4RJLA 3D31A 4GP7A 4FMDB 5C18A 4O0MA 4TSFA 3ZH9B 5K8LA 2WJGA 4HLDA 3HR7A 1KNQA 2GEUA 3BH6A 2A5JA 4TWZA 2RGNC 1F2TA 1Z29A 1ZNZA 1RRCA 1OFIA 4NE2A 4MUAA 1E79D 2CL0X 2RGCA 1HH4A 1UKVY 5DYIA 1KMHA 4AY2A 3GLHE 2IEZA 3CNLA 4IFBA 4XH9B 2W2XA 2Q9CA 2EW1A 2WJYA 3Q5EA 4GFDA 4RZUA 3NDPA 4BLRA 3BH7A 2FEMA 1D2EA 3LXXA 4ERNA 4W5JA 4P33A 4B3XA 1LNZA 3QSYA 1NF3A 5FOSA 2OCPA 4NCKA 4FMDF 3G5UA 4KSCA 3BH0A 5HE9A 5JHHB 3N2IA 3TLXA 1UM8A 2KB0A 4KCGA 2JCSA 3T34A 1E2PA 3SHWA 1ZNWA 2JASA 1ZIPA 2R62A 2D06A 2W00A 2ZJZA 3C41J 1NKSA 2IYUA 1KYIA 2O8FA 1KY3A 4EUNA 5JWHA 5EE3A 3M0EA 2GVDC 5FPHA 3REFA 4Y0VA 3WYFA 1TX4B 2OAQ1 4EQ6B 3BB1A 3PV0A 3RYTC 2QGZA 2BCGY 3KKMA 4GT1A 2FSHA 3CRRA 4ZCMA 1BH2A 4BFXA 4TLAA 1DG1G 2OV2A 2P6RA 2ORIA 4TZ6A 3MFYA 1LW7A 4X8OA 2YOFA 3RRZA 4LC0A 4I1OA 2H57A 4OJQA 1XZPA 2X1VA 3ZQ6A 3PUVA 4URVR 2P65A 3CKLA 4E09A 1T3LA 2NOAA 2OM2A 2F1IA 3DDCA 4GRAA 2IYWA 4Z51A 4OBEA 3F5FA 4M8NE 1I4DD 1P3JA 2R6AA 4HDQB 4RZ2A 2J7KA 2AFHE 5DHAA 4TN1A 4B32A 1F6BA 1OXVA 5FI1B 1JBKA 1G5TA 1J8MF 3AKYA 1UEJA 4B3CA 2ZI4A 4JLPA 3BGWA 5IHPA 1XPRA 4LYAA 5B30A 4HI0E 4PZLA 3B85A 5DO9A 5AJXA 3VAAA 3AVTA 3K9NA 4WW0A 4RZXA 2GCOB 1LF0A 2ZJAA 1GRNA 3CF6R 3R20A 1OH5A 3SBDA 4PQYA 2J5XA 1TADA 2P67A 1CR1A 2O8EA 2CLDX 3X1YA 2C8VA 2C95A 2XNSA 2ZS8A 2GILA 1VYTA 3OE7A 1PLLA 2HXSA 1E9DA 1K5DA 1GAJA 2V8OA 4RZ3A 3J81k 1O3YA 5DLQC 2B92A 5BN5A 1W4AA 2Q6TA 1U9IA 1GL9B 4DCSA 1NSFA 2N42A 4QGAA 1C9KA 4XSHA 4LUCA 4TLCA 3NHBA 2NGRA 2C03A 2XJ4A 1ZUNB 4OK5A 1NP6A 2QPAA 3ZZTA 1ZRHA 1RRGA 3CWZA 5CYPA 3PG5A 2C98A 1ZM9A 2FFAA 2CLSA 1F60A 3SFVA 4IXNA 4H1VA 1E1RD 4NU0A 4EPWA 1UADA 4AKGA 1N0VC 2J45A 1ZYUA 4HUTA 2YWHA 1W0KD 4OQLA 1F2UB 2XXAA 3PITA 4AKEA 5JEEA 2QTFA 1XMSA 3ICEA 2IF0A 3NC1C 2DFLA 1SGWA 4YXWD 1LF5A 2IHYA 4FCTA 1G20E 2BEJA 4UNQA 3X1ZA 4UNSA 4FD2A 3BAFA 4G0NA 1C1YA 2BKEA 1OYWA 4TMTA 3VR5A 1Z6TA 4IVQA 3AVUA 1DS6A 3B13B 1VYUA 3UWOA 2QAGB 3LW7A 1Q20A 1QZXA 2GAAA 2V54A 2BMDA 4Q02A 4ASUA 2OFWA 3HU2A 4LYJA 4ZI2A 4BASA 2VLIA 1Z8FA 1CLUA 5FL7D 3TH5A 1E0JA 4P4UA 1ZW6A 5K8IA 4TMZA 5DSZA 1RE0A 1II9A 3R7WB 2PLFA 2JDID 4DZZA 1XTIA 4V0OA 2AKYA 3KJHA 2ZSAA 1OT3A 4DSOA 2WICA 1VTKA 3TUZC 1KSFX 5JS7A 1NLZA 1N6KA 3AF4A 1JPNA 3PIRA 2P5TB 3VHXA 2AXPA 1H8EA 1P9NA 3T12A 4HDCA 3KKQA 2J7PD 3C14C 4M1MA 5CM9C 3RRNA 4BZQA 3BD9A 1II0A 1N6OA 5LBIA 3WNBA 3EIEA 2DYKA 4PX9A 1WP9A 4V0KA 5SZKB 2C78A 3GLGB 4NP6A 2WV9A 4ARZB 1JI0A 2MMCA 2R2AA 3IIJA 3UMSA 1TF7A 2VO1A 4YMUA 1OFUX 1Z3IX 3ASZA 3R8CA 3WMFA 4PZYA 1Z5ZA 3AVQA 5C4MA 1RVDA 2B21A 5TXGA 2YWFA 4A92A 4R71A 1GFIA 2H7VA 1DAMA 1FMLA 2REXB 2JLXA 1R7RA 4MGYR 4B71A 4IDQA 2D74A 3IPXA 1NMYA 4QOSA 3CONA 4V03A 4Q9HA 3T1OA 2DY1A 4M1WA 4AC9A 1AKEA 2PT7A 3BOSA 3CM0A 3LXRA 4RFSB 3CRMA 1U2RA 3GMTA 3TSZA 3R9IA 1DG3A 1E94E 1E2GA 1U98A 1E0KA 1IBRA 2BVNA 2RGBA 3I32A 4K46A 3RRYA 3I5XA 2O0KA 1U90A 1RFLA 3B1YA 3KXIA 4PO1A 4RCZA 4M1TA 2QU8A 3TGPA 2HJVA 2IUUA 2QI9C 1UDXA 2GZDA 1G7CA 1G8YA 1KJYA 1R0ZA 2WM9B 4LHWA 3WXMA 1MABB 2UVQA 4L5BA 1OV4A 4RD1A 4UXIA 4EDHA 4KJZA 5J4VA 1BMFD 1BKDR 3CRVA 5KOYA 1AS2A 1VG1A 1GNPA 2DFTA 2FX3A 1E2JA 4W5HA 4E07A 2ZRCA 4HAYA 3TBKA 5IRCD 1TAGA 3U44A 3T1VA 3SHFA 1EWQA 1R6BX 3KXLA 3CH5A 2A78A 5DIFA 1XEXA 5TARA 1I4TD 1S8FA 5DN6D 3A1UA 2ODEA 1SHZA 4QBFA 5GADl 1OYYA 2ZRAA 2C9YA 2ZRGA 4DC9A 1ZMXA 3FHOA 5C46F 3D8BA 3KKPA 4HATA 1T91A 3ZIAA 4DSNA 2JIZD 3BJIC 3A1SA 1NBMA 3TUJC 1EG7A 4EPVA 1D8TA 2ZAOA 3OIWA 2GXSA 3WBKA 1OH7A 5EUMA 3R9WA 3TRFA 3OIUA 3W5JA 1IN6A 2FWRA 4FWTA 4MRNA 1UAAA 1JEEA 3QKRA 1RZ3A 3CB4A 1BYIA 1ZVQA 2RCNA 2ZYVX 4C7OA 2FN4A 4QL3A 3T1QA 3P32A 1MH1A 2OLKA 1KAGA 4JS0A 4W9MC 3C16C 4DKXA 2ZJBA 4GOJA 4Q01A 1R8QA 1YZQA 2F7SA 2IK8A 3SC3A 2EFDB 5IDVA 3IBGA 1VHLA 2PZEA 3GEEA 3N2EA 1YZTA 5G3YA 3RC3A 2D7CA 3VR3A 3GJ5A 3I5YA 1RYFA 4LBWA 5DISB 2RGDA 2B6HA 5HE8A 5FOTA 5A5GA 3OAAD 3MLEA 3EWSA 3EZ6A 5J47A 4YMTA 1S3GA 1N0UA 2VF8A 3KB2A 3VU9B 2VHCA 1KTVA 3U4QB 1XTRA 1YZGA 2NO9A 3ETLA 3DOFA 4F7WA 2PZFA 1D6JA 4HYYA 3HR8A 1XRJA 1ZUIA 1XXHE 3RRMA 4B3GA 3BE4A 4EFMA 1R5OA 4XIGS 4D4JA 2W83A 1HURA 1UKEA 2G83A 2FSIA 1M74A 5DE3A 4HAVA 1WB9A 3K0AA 1JQJC 5CDFE 1ZM3A 4LJ7A 5DI3B 4TYWA 1YQTA 2ZJOA 1AKYA 1YR7A 3IEVA 1HE1C 3FKSA 5EE1A 1UF9A 3EAQA 3THWA 4A0RA 2D2EA 3VKHA 4JBWA 5FR1A 4NCNA 3RAPR 2HYIC 2A9KA 1Z06A 4BLSA 3GLFE 1Z22A 2BM1A 1W1WA 3QVVA 1XCMA 1SVOA 2OG2A 3PUZA 4AD8A 4RFVA 2WWYA 1E2QA 4MDEA 4ILEA 1CTQA 4PR0A 4DLZA 5LPNA 5GVRA 3LO5A 4A0GA 1COWA 4QRHA 3IIMA 4V0ME 5AK0A 2GEVA 5HKKD 2BEKA 2QQ0A 1ZC4A 1E2LA 4L15A 4CT4B 4POAA 4RFSA 3AVPA 2QBYB 3MJHA 3NG1A 1TEXA 3KZ1E 4PXAA 5JSZB 1E99A 2IS6A 2IBMA 1S3SA 1GTVA 2BM0A 4IVRA 5FOWA 1FUUA 4M22A 4ZCLA 4URYR 1YZUA 3S1AB 1J90A 4NH0A 3I92A 3ZZ0A 4B2PA 3EC1A 2RH5A 4P4SB 1I4LD 2EFEB 1X86B 2ZRMA 4JLAA 1G8GA 3B5JA 4IEIA 4BWYA 3Q5DA 4HB2A 4G01B 4C3ZA 2FU5C 2GEDA 2GJAA 3LFUA 1SVMA 3NH9A 2UKDA 4B74A 5EE0A 2JEOA 2QQEA 4CVNA 4RD2A 1Y3AA 2V3CC 2NO6A 2C5LA 5J4LA 3MWLA 3I3SR 3LBIA 2GVZC 4NYJR 1U9IC 1T8UA 1E2KA 3U6KA 1VIYA 2IA5A 5EUQB 3GLIB 4WXRA 2PX0A 1JNYA 1KAOA 3X2SA 1T6NA 2WJHA 4JL5A 4PC1A 4LJ8A 2CL6X 1T5IA 2JLWA 2WJIA 5FL3A 2PLRA 5JJIA 2PJZA 5HZKA 4BLPA 3K8YA 1A82A 2ZJYA 4NTZA 3RS0A 1OSNA 2F43B 4IVPA 4MGKR 1OB5A 1KI3A 1AQYA 2XZOA 3K9LA 1S1CA 1CU1A 2CNWA 3X1WA 5CB6A 4Q4HB 5AJWA 5DNYB 1SKQA 3QXJA 1VYVA 4D82A 2WSSA 4JLJA 2V6JA 4AWXA 4KO8A 3IGFA 5TV2A 2XB4A 5D3QA 2QRNA 3AF0A 3MRSA 1P72A 1VG9B 3QPVA 4UNNA 1DAEA 3PXGA 4LHVA 3DMNA 3EWAA 3GD7A 1TMKA 2VQSA 1K5GA 1Q1QA 4BUJA 2ZRJA 4ZKDA 1G8PA 2ODWA 4JLBA 2HXYA 2EYQA 4XOIA 1ZNYA 1TTTA 2FH5B 2OFXA 3LVQE 4V02A 2RGEA 1T8TA 3V4FA 5CB8A 4Q00A 5KPDA 1W36C 4GSYA 5FPKA 3VHLB 1NN3A 5G53C 2ATVA 1ZM4A 1WBBA 2B8WA 5E3HA 4GBMA 3QKUA 1SXJA 4DWJA 3SI7A 3JVUA 4I81A 1LB1B 3U2QA 3W6NA 1YHNA 4DUGD 2OZEA 2IF2A 3EA5A 4F93B 1F5NA 4JSYA 2QGNA 3EIHA 4QC2A 2OLJA 3DKVA 1NVVQ 1J70A 1OLOA 4Q19A 1A7JA 2VP5A 3FHTA 5FH9A 3A4MA 4GMDA 4KYIB 4U02A 1W47A 4O2RA 1UPTA 4PAQA 1WQ1R 2ZRDA 2Q3MA 1YJ5A 1F3OA 1JPJA 3BFVA 2ZU0C 3U3RA 1NVUQ 4Q1BA 4D80A 1W5SA 2AX4A 2FZ4A 2I1VB 4DUGA 1RKBA 4Y0AA 1SXJD 2OCYC 2GESA 4TQ9A 2HT1A 1B23P 4LOAA 1P62B 1XD2B 2ECKA 1OW3B 1DAKA 4NYIQ 5FBWB 3DM9B 5CK5A 2O8BB 1Z07A 3H4MA 2I4IA 3QBTA 4OJKA 4I1UA 4B2LA 1N5KA 1XD9A 1NI3A 4OHXA 3RWMB 1TU3A 2EYUA 2V7QD 2N1BA 1E32A 3IO3A 5FOXA 5AJZA 5HTKA 4TMWA 2WMNB 2ZTSA 4IOJA 1DO0A 3LNCA 4NHOA 2NG1A 2YC4C 5EP3A 1XD2A 2NIPA 4NYMR 3HJNA 2VF7A 2YVUA 2ZUDA 2FGJA 1QHNA 3JZMA 3WNCA 5BYKA 3ZVLA 1XTSA 4ZKEA 4TT3D 2WSSD 2YYZA 2NO0A 1KMHB 4B3DA 3AVYA 1A4RA 4KXFB 1DAFA 5HKKA 3EPJA 1AQUA 1G4AE 2WHXA 2XNDD 1DOAA 3A36A 4KBFA 4Q48A 1YR9A 3TW8B 1YU9A 2OEPA 2HLDA 3IHWA 4EPXA 2G0TA 3B1XA 2BMFA 4IFEA 4Q1EA 4MITA 3SN6A 4XVQA 4F4IA 4LJ4A 3AVOA 1MT0A 3W90A 3QKSA 2J0VA 2VYFA 2KJQA 4UXJA 5KU1A 1WA5A 3SJBA 4URUR 4E5UA 5FTKA 4R7ZA 1OH8A 1UBGA 3P4XA 4Q4AB 1GWNA 4KLZA 3QG5A 1GL6A 4Q9KA 2AXNA 5TDHA 4EIWA 3FFBA 1CRPA 3GP8A 1AS0A 2AHOA 1GOTA 5E7JA 1E2DA 3MWKA 2HT6A 1NKTA 5J5CA 4B33A 1NJFA 1WF3A 4DLXA 3U5ZB 2RB4A 2WZQA 2PCLA 3AB3A 5SZIA 3HDTA 2O5VA 1XJQA 2Q9AA 5HCNA 1IN5A 4N0EA 3AP1A 1Z08A 3VX3A 2J87A 2IYVA 1E9RA 2GXUA 2XB2A 4ABYA 1ZM7A 1G8FA 1XU4A 4P31A 5AUPB 2QY9A 3K70D 3BXZA 4BFYA 1T0HB 4ARZA 2AKAB 1SZPA 3RSLA 3KL4A 1IOZA 3EA0A 4C7OB 1NJGA 521PA 4Z54A 3U7HB 3S1AA 4MKIA 4URZR 3LBNA 5CM8B 1XPUA 1NVXQ 3AUYA 1XEWY 1ZCAA 5C2JB 3IQXA 4IDHA 2YV5A 5KSOA 1KZ7B 4GMXA 3T61A 2ZU6A 1QDEA 2MMGA 4QKQA 2FPMA 1HQYE 1KK0A 3OIVA 1P2TA 2EU8A 3T15A 3ZVMA 1KNXA 3ZS8A 2GNOA 1VMAA 2A30A 3W34A 1NNEA 4OI4A 4JT2A 1N6LA 1OXTA 3H86A 4ZDIA 4KBGA 2HUPA 1GSIA 1S9HA 1R0WA 2DWPA 4LV5B 2EWWA 1R2QA 3SS8A 4B2IA 1E9CA 4FCVA 4QJ3A 1VCOA 3WP1B 5FBQB 1M7GA 1IAQA 4M1OA 4ON9A 1IN4A 2QP4A 3ZIAD 4ESHA 1F48A 1MOZA 2RMKA 2FMXA 2C96A 4G1UC 3VQTA 1R5BA 5CJPA 3UATA 4KVAA 1JR3A 1JXMA 2QT0A 2CCKA 2DR3A 4KAXA 3TKLA 2DWQA 5JZVA 3IHLA 1T3HA 4JLNA 1E0SA 4XVUA 1IJEA 1BO6A 2IEYA 3EZ9A 3OAAA 4HAZA 2CCJA 2WJJA 1CJVC 4AYXA 3D6TB 1KI6B 2YKGA 2XXAB 2REBA 5SZJA 4B35A 1S96A 2XTMA 3I8XA 5CJ2A 2GJ8A 1M1YE 2CVFA 4R2HA 1E2HA 4QG7A 5J4YA 2F6RA 3I72A 1A1VA 4PO8A 3CRW1 2JLVA 2Z6VA 4A6XA 2QORA 1VDZA 2F9MA 2PCJA 4YMWA 1R0YA 3EX7C 1K8RA 1FNMA 2FFHA 4PFSA 4OQMA 3UIEA 1GKIA 4FIDA 4PSKA 4LGMA 4A1FA 1I2MA 5H68A 2GK6A 4DIEA 4L16A 4P4SA 2UZIR 1DVRA 1DE0A 1U8AA 4RSGA 3LD9A 4XWKA 3KFXA 2WTUA 4BEBA 3THYB 2GCOA 4G3XA 2ONKA 4U5XA 5BQ5A 2V4ZA 1TQ2A 4CDGA 2WWHA 3DEFA 3ZQJA 2GRJA 2AL7A 2CK3A 4BPBA 2XSZA 3DPUA 2ZI9A 2F55A 5F98A 1ZU4A 4QNRA 1XNJA 2CHGA 1BMFA 3TSOA 2OE2A 1S2MA 3U7GA 1XD8A 1KI8A 2J0UA 4DT1A 3KKNA 2WAYA 1FQKA 4BRWA 1XEXB 4G5QA 2CJWB 3ICQB 2OUKA 4OHZA 1QG4A 4TYQA 1NLFA 4NCHA 3W5IA 5F9FA 1CXZA 3AF1A 1N25A 4X8HA 3GQBA 3B1WA 3DHWC 4JVSB 2Y8EA 5DI3A 4S35A 4QJ5A 2H5EA 1E2EA 4JJZA 2QE7D 3AV0B 4LZZA 3GLGE 3EPKA 1SVWA 2X8AA 4IOMA 3CRQA 1TQ4A 2H92A 1TNDA 2GF9A 2ZANA 4XD7A 5FL7A 1GDDA 1QHGA 1WXQA 2BV3A 2ZYTX 1G7TA 5FPSA 4DB2A 1KDRA 1ZD1A 2XJ9A 1E2FA 3FDIA 3KJEA 1KY2A 3P20A 3GLIA 3B1ZA 4PZZA 1CJMA 2WVJA 4C0SA 3NTUA 3MGCA 4MRPA 5DI9A 3AVWA 1JR6A 5BXQC 5EZ6B 2OT3B 1WGWA 2EVWX 1W2HA 2KE5A 4LJ9A 2JLZA 4N1AA 3U61B 2CLCX 3Q7PA 1OH6A 2LWIA 4CF7A 2FF7A 2IW3A 5LB2A 5EJEA 3CX8A 5AUNB 2JATA 1SVSA 4Q9IA 3ZD6A 3MJRA 2QT1A 2PEZA 4B76A 4FN5A 4JJKA 2RKOA 1XJ0A 3B9QA 2NMVA 2GKSA 2YWGA 3E5HA 3NBYC 4RD4A 1IM2A 2RHDA 4MYUA 1ZIOA 1H8ED 4AK9A 1Q21A 5G3ZA 4MA4A 1RC8A 4WBSA 1YZNA 5EQTA 2R6DA 3T5DA 3U3JA 4TL8A 2X2FA 1P75A 2ZQ5A 2KBEA 3UG6A 5JBQA 2GJSA 3MUFA 1VCIA 2JDIA 3THOA 1ZM2A 4PAMA 5HPYB 3UG7A 3KFVA 2MSEB 2JLQA 3KUDA 3QOFA 3TUIC 1Z83A 1NIPA 3B78A 1ONBA 3TSWA 5BYJA 8OHMA 2F3RA 4DJTA 4CZ2A 2BBSA 1W0JD 4IDNA 5E7IA 2VBCA 2FDCA 2AR7A 1SKYE 3UKDA 1T5LA 5FPTA 3K09A 2O8EB 1FUKA 2BDTA 2IS4A 3FMFA 4EAQA 4RD3A 3GLHB 4A8JC 3OZXA 1ZU5A 3ZDQA 2IX3A 3RNLA 5JMTA 1PLJA 1L7VC 1V5WA 3EARA 1TEVA 4IW3B 2NO1A 4KFRA 1MKYA 1HTWA 4F4CA 3ZLJA 1JJ7A 2ZRPA 1ODFA 1G5RA 3ZGXA 1J2JA 2HF8A 4KU4A 421PA 1E9SA 3H0KA 3O8RA 4H1UA 4KVGA 4M21A 1OB2A 1G16A 2V1XA 4ZIRB 1Z6GA 1AZSC 4XTCS 1KZGB 2A5YB 1EWRA 1F2TB 4QBHA 5EE9A 3ND9A 4YMSA 4AURA 3KQKA 3L0OA 3V00A 1QF9A 1G64A 1PZNA 5JSZA 4MKHA 5LD2B 5GVSA 1P60A 3IUYA 4Q7JB 1G7SA 2D62A 2QAJA 5J4HA 4BLTA 4XJXA 5LB4A 1XMVA 4Q18A 5SZHB 4PC2A 3OFNA 4KHZA 2BC9A 1N5IA 1ZINA 1TF2A 2CDNA 4Z8YA 2F43A 3RS2A 3AVVA 1D9ZA 4U7DA 4DDUA 2ZVPX 4D0LB 4RY2A 1KO4A 1W4CA 3PEYA 4N3NA 1XZQA 3HPRA 1D5CA 4Q47A 1ZC3A 3ND8A 2VA8A 3LLMA 1L8QA 2GJKA 1XP8A 2HCBA 4ZDKA 2GF0A 2R65A 2AWOA 3DMDA 1T3SA 3FKQA 3OHMA 4DHEA 3KQLA 2FJUA 2W6IA 4UJ5A 1DTSA 2X2EA 1FL9A 4HZIA 1CEEA 2CMKA 3TE6A 1GRQA 1W5TA 3VR6A 3TR5A 4D25A 1GVNB 1YZKA 2QG6A 3KQNA 1KO5A 1XTKA 1L2TA 2XTNA 2F1HA 3F8TA 4DEYA 4AKHA 2VH5R 1NSTA 5CLLA 1MRSA 2RAPA 3QKSB 2GA8A 1RJ9B 2JLRA 3ECCA 4QGFA 1OIXA 1S4QA 1YVDA 1E2MA 1W46A 1NG1A 2GDJA 3QE0A 4Z8XA 5KHOC 1KDPA 4LYFA 1SXJB 1G17A 2HDNB 3VKWA 5KSZA 3PUXA 4DLWA 3LRPA 1Z0AA 2ZI5A 1JXOA 2B7CA 3CBQA 3MWYW 4FINA 2PEYA 3A6PC 2J3EA 2R6GA 3MWJA 4WVFA 2CXXA 1OIVA 1LS1A 1G19A 1XCPA 2Z4SA 4NL4H 4HAWA 4CEIA 1ANKA 3BWDD 1JECA 1MABA 2YWEA 4JT4A 1H65A 3FB4A 1MR3F 5TB5A 4KSBA 5L3QB 4TQAA 2FV8A 3OEED 3CZPA 1E9AA 5D3MB 3ADDA 3G82C 1W4BA 3K0FB 5B58C 1G3QA 3AGQA 3OFND 3A1VA 4LHZA 4GZMA 3NHAA 3HP1A 2Q0HA 2XEXA 4JVMA 4DCUA 4Z1MA 2JJ8A 4Q7KA 5E4FA 4LHXA 4BE7B 1U0LA 1CP2A 1DPFA 4TMKA 1P61B 4FMBB 4I1VA 3TK1A 2P3SA 2IUSA 2IXGA 2ZSDA 4JYCA 4RVCA 2ZRFA 1GITA 3PEWA 5DYGA 4Q66C 4M0LA 1E69A 5FTNA 3PQCA 1QHHA 1KK1A 2D3WA 2WPDD 1XDBA 3QI2A 2ANBA 3GJ7A 4MH0R 1OXUA 1OIWA 1E79A 1IY1A 3AKDA 2WBLC 4TL7A 4F38A 4II7A 3KTAB 5FUWA 2O52A 2R9VA 1N6RA 4NPHA 3HWSA 2QSZA 1M7BA 1Q1BA 2VHJA 2QROA 3NC0C 1M8PA 3RS4A 3AF2A 2C77A 4M4SA 2G1JA 4TSFD 5KPJA 1QHYA 3UMFA 4KYUA 4E22A 3LH5A 1II8B 2IYLD 1IN8A 2B8TA 2JGNA 1W0JA 2VEDA 2ASEA 1G3UA 3QXXA 3W8NA 4O25A 5IK2A 2J0QA 4LBVA 4CRWB 1G1MA 2QMHA 1SKYB 2LCFA 4IHQA 4TTPA 3GJ0A 3QXCA 3A4NA 4B48A 2GXQA 4RD0A 5J40A 1AK2A 3I62A 3CPEA 2WJVA 2G77B 3A1WA 3EZFA 1AJEA 2D4HA 2WIAA 4W7SA 3K70B 4I99A 1H8HD 3LA6A 1NMZA 3NEJA 1UDWA 1J99A 3L0PA 1NN1A 1ZJ6A 2EQBA 2CL7X 2PMKA 2G3YA 2VTKA 1S9DA 2E1RA 3EC2A 1G5PA 5CLQA 2O8BA 4DT1B 2QPTA 4TLDA 4NYMQ 2ERXA 4QJ4A 2PJRA 4D26A 1DAIA 3CUEF 2ZR0A 5CDFA 3FE2A 4Q4HA 1QHXA 2J59A 3KJIA 3AGPA 2AN9A 2BWJA 2WWIA 1WRBA 3ADCA 1E1QA 1Z6XA 3U44B 1HT2E 1R8SA 3NKVA 3T1TA 3Q72A 3C5CA 2UZ3A 3QF4B 4XWAA 1G8HA 5A4JA 1FPMA 4HSEA 1EFCA 2QAGC 3QY0A 5IK2D 4XD7D 3KQUA 1VG8A 3UANA 5LDDC 1ZNXA 4PPGA 3MCAA 3ASYA 2J41A 2QE7A 3QKTA 5HZHA 3BBPA 2BKUA 4LK2A 3U3OA 3P1JA 2F1JA 2IL1A 2BBTA 4TL6A 1HEIA 3VTKA 1TL7C 2J0SA 1HQCA 4CYMA 1E4YA 1KK2A 4EFNA 1XTJA 4DSTA 3QEJA 1IXZA 3AP2A 4JYBA 5JEDA 2VSOA 1P5ZB 4MUBA 3B9PA 3I1FA 2QA5A 2O8DB 2ODBA 1M34E 3GLHA 1HUQA 4CW7A 1JAIA 2KWIA 1UEIA 2WPDA 2ZM5A 2ZI7A 1RRPA 3RLFA 2VP2A 2XSZD 1F2UA 4J0QA 3WHKA 5JRZA 4G5OA 4MGIR 1OE0A 4F4JA 3ZS9A 2KI5A 1Z6AA 3CNNA 5CYOA 1CS4C 3VFDA 1EX7A 4IJMA 4YONB 4ZIRA 4DXAA 5GJVC 3TAUA 2GHIA 3GLGA 1X8LA 1DEKA 1EFTA 1QHIA 1E6CA 2BJWA 3K0EA 2P6UA 1TUIA 4B34A 1KI1A 1G6HA 5DH9A 3PJRA 4CEJA 3OEEA 2XAUA 2WWGA 4A8JA 1GL7A 1LS6A 2NPFA 4C0KA 3VX4A 1ZBDA 4PANA 2ZYWX 4PSAA 2PBRA 2YINC 3L2OB 4RD6A 1XCGB 2BJVA 3O47A 4LSGA 4DEXA 5F3WB 5EXSA 5KYKA 3JZAA 2OXCA 1FX0B 2NZ8A 4FMCB 1Q1ZA 3OEHD 4PPQA 4D4LA 4UNRA 2Z5FA 3P27A 4P0TA 3FMIA 2P2LA 4B3BA 4BECA 2AWNA 2V9PA 1HE8B 1TUEA 2QTHA 5L3VA 4CEJB 2ORWA 2I3BA 1ZAKA 3QUSA 3DO6A 4HAUA 3ZJYA 5JWRA 2WOOA 4A0FA 1ESMA 3CX6A 2GAOA 1W7AA 1X6VA 3VKGA 2R44A 5AR1A 3VU9A 3U60B 4LY6A 4M1YA 1KDOA 3NBZC 3BIFA 4DB4A 1W49A 4NYJQ 4LBZA 4JVNA 1JR3D 3SZRA 5HCIA 3MAAC 1E9FA 1CJKC 1HYQA 2PMDA 3A1TA 2XOKA 2W6ID 4BFWA 4JIMA 1OXSC 2ZREA 1EESA 2VP4A 4FCWA 5KNDA 2CHQA 1JR3E 3Q85A 4QGHA 2OO7A 1WBDA 3LWNA 4Q1CA 2RGGA 1OKKA 4JLVA 4B75A 3BS4A 1U8YA 4US1R 1AIPA 3H2YA 4BLOA 5GJWC 2WKRA 3P26A 4PAOA 2IT1A 2FE4A 4LJYA 3QBVA 5AUQA 2PH1A 4LBYA 1PV4A 1SXJE 1Z28A 2OXRA 4JLKA 3FPAA 3CIOA 4C2UA 4TLEA 1FTNA 3GJ8A 1KOFA 2W0SA 1KKLA 1EFHA 4DLSA 3DVLA 1U94A 4LYHA 3W3ZB 1KI2A 2YZ2A 3B7GA 2IXFA 3SYKA 1DARA 4QFMA 4PHFA 2XZLA 1TQDA 4YLGA 4WZBE 2GCPA 4PC6A 1N6IA 4EPTA 1FFHA 2OCBA 4B6EA 3VR2A 4US2R 2G9NA 2IS2A 2VP9A 3NVAA 1GKYA 1YZLA 3RHFA 1CR4A 2GCNA 3O8DA 2J1LA 2A5DA 2CHVA 3AEZA 1KIMA 2ZYUX 4I1SA 2G0NA 1P73A 1R10A 3RABA 2XGJA 2F3TA 4HAXA 2ODNA 1XXHA 4NDZA 4NZYA 1GZSA 2FOLA 1PUJA 3QJYA 1GRRA 1JQLB 1S1MA 3ZD7A 1KI7A 4A9AA 2ZRIA 3T5GA 1P2UA 3KJGA 2ZETA 2EFCB 2Q3FA 3F3YA 2QEQA 3K53A 1MO3A 3RDPA 1IONA 3KQHA 1Z0JA 4M9SA 3ZVRA 5A0FA 4ZV4A 2VHUA 1IXRC 1D9XA 4BQSA 2RGXA 1FOEB 4OQFA 1UFQA 4NMMA 4M2LA 2DWOA 3EXAA 4BFUA 2J9RA 4TQUS 3RWOA 3E70C 1E9EA 3R8FA 3Q7QA 3H84A 2W2TA 4ACBA 4ZO4A 4TMXA 3TVTA 5KDDA 4TZ0A 5GJBA 1KKMA 1P9WA 1E3MA 2HF9A 2BHRA 2XTZA 2AD1A 5DGXA 2ZSEA 5JRJA 2HLDD 3W3AA 2EFGA 2WSMA 2OBNA 2BOVA 5EXTA 2Z0MA 4LJAA 2W6JD 2XNDA 4XSGA 4ZPXA 2ERYA 4JBXA 4EJSB 2C04A 1NIJA 1T0JB 3BORA 3LBHA 1Q1EA 1NY6A 1G4UR 4TT3A 4MGZR 2JLSA 3AVXA 3VR4A 2G6BA 2OCAA 4RKFA 6Q21A 3IPYA 5KNBA 1TQ6A 3AKEA 2ZEJA 4LJ5A 2O8CA 3AKCA 3GLIE 4A36A 1HA3A 1L4YA 2VIIA 4ZCIA 1EFRD 2JJ1D 3C15C 4UXHA 3PEUA 3CH4B 2OHFA 1W36B 2R6CA 1XXHB 3Q9LA 1AS3A 1XMJA 3DL0A 4R2IA 3A8TA 3QKRB 2H1LA 4DDVA 2YOHA 5BN4A 4WAUA 4ACAA 1A5TA 1US8B 4IDOA 1CKEA 5CK4A 4E03A 1N5LA 3WNDA 1G3IA 3CW2A 1M6NA 1T9HA 2OFOA 5DHFA 2O0HA 2FPLA 3SYNA 2BIFA 4B43A 2WIBA 3LQQA 1Z2AA 3QXHA 3A58B 4BRUA 4GPTA 4AG5A 2ZAMA 1S0UA 2CCGA 2Q21A 4LV6A 5JJKA 2A2ZA 1LV7A 2R8RA 3W6PA 1UJ2A 4ZDJA 5L3SB 1U0HC 1MO5A 2CK3D 1VIAA 2F1RA 1Q57A 5EP2A 2YOGA 4K81B 2QMEA 4OQXA 1II8A 1QRAA 5ANRB 3VNUA 3B6EA 3SBEA 4URWR 1Z0KA 1EK0A 2ZUCA 3AF3A 4JSTA 1AGPA 4PSVA 1CIPA 2XZPA 1KI9A 2WWWA 1G41A 3KDSE 5EXPA 4L9SA 4C0BA 2ZJ8A 3TIFA 4KFSA 3E1SA 3QF4A 4GOXA 4AYWA 1FMJA 2A5GA 2D2FA 3OIYA 5FI0B 1IHUA 3C5HA 3BK7A 2ZUBA 3L43A 1U99A 2A5FA 4LJ6A 3T06B 2A7QA 4JZKA 2LKCA 4PPNA 4JBYA 4M9QA 4MYHA 4NONA 4GDFA 2QN6A 3FVQA 1W4RA 4IOKA 1WMSA 2JJ2D 4MKGA 2CNWD 3LDAA 2W0MA 4UQOA 4KFTA 2IWHA 4A2PA 4C9BA 2QSYA 3HYRA 1XX6A 3FOZA 3KB1A 2J46A 3SDZA 3C4JA 4KI0A 1NN5A 5D3MA 4F92B 2AFIE 4CEHA 2E87A 3SE0A 1YE8A 4G5RA 4DLYA 1AN0A 4WA7A 4F91B 1KDTA 1R0XA 4A2QA 5EE5B 2Z43A 4MKFA 1EFUA 5FBVB 3H1TA 1SVLA 3UXMA 3TJZA 2ZROA 3KKOA 2VHQA 3IBYA 4HUQB 1M2OB 5K8UA 2C9CA 4D81A 4Q7MB 3BFXA 4HDOB 2ZRBA 3THXB 3GCGA 1W44A 4Q7LA 4YDHB 4LC1A 1KO1A 3K0SA 3P4YA 1G3MA 4LPKA 4MRSA 4D0NA 2ATXA 3GFOA 3K0CA 2YNMA 2VSFA 4AI6A 2JA1A 3KTAA 2GXAA 1RW4A 3X1XA 3C7KA 2QAGA 1OFTA 3KUCA 1T4GA 1U81A 1NRJB 3RC8A 4Q4JA 4OI1A 4H9GA 2ZR9A 4TYYA 1SXJC 1D2MA 2EWVA 3CF0A 3TQFA 4D6PA 1OF1A 3W9YA 4MRRA 3LV8A 2L0XA 3I8SA 4QHTA 4MDFA 1E2IA 1AM4D 1UBCA 2QPOA 4CIDA 1SVKA 3FKSD 3UK6A 4FMCF 1ZD9A 4L4UA 2FGKA 4Q1AA 2N46A 3SJZA 1SVIA 1G6OA 4NCJA 2QMOA 4L8GA 3L0IB 1I2DA 3U3MA 4JL6A 2H8KA 4Q21A 2QENA 3HU1A 2G1KA 1WCV1 1X1SA 1VKJA 3PUYA 3K70C 4GZLA 3ADKA 5CIWA 4D4MA 1G3RA 5BW8A 5JFGA 3K0CC 2Q3HA 4QBIA 2IYYA 3IO5A 1E9BA 4JKIA 2CEAA 3IKJA 4LI0A 3LX8A 5B57C 4ITRC 4PHGA 4TL9A 1E0AA 1FTSA 4YMVA 1BIFA 2CVHA 3AUXA 2AK3A 1E98A 1Z0IA 5FOUA 3SYLA 4JKYA 4JMPA 4HB0A 4LCBA 2QRZA 4OHVA 3TMKA 821PA 1FW6A 1QVAA 3SOPA 4PQFA 1UBFA 4UKDA 4PO9A 3SQXA 2DFNA 4FXPA 1PJRA 5G40A 3FYHA 5LD2C 2ZS7A 3THYA 4ESVA 1XB2A 1GIAA 4OI0A 4EPRA 3A4LA 3U6BA 3QENA 1DADA 3PR1A 3M4YA 4P3YA 5FPYA 3GPLA 3OESA 2J0UB 2ZR7A 3EPHA 5JWOA 4GP6A 4AG6A 2ZRKA 3CNOA 3KX2A 1SQ5A 3MSXA 3PVSA 1LTQA 2V7QA 2GBLA 1VCNA 2JAQA 4NCIA 2QNRA 3W8RA 5FR2A 4D4KA 2JIZA 1RPZA 5GJCA 3TAHA 3BB3A 5FBLB 4JL8A 3NBFA 1PLKA 4C0LA 2W2VA 1NY5A 3IDQA 2BMJA 1Z0DA 2Z83A 5KSYA 3WMEA 3I4LA 3EASA 1Q44A 4EJSC 3F0TA 2OILA 1AGRA 5IF9A 1BYUA 3PCRB 1N5JA 1GUAA 1M7HA 4FI3C 1PUIA 4G5SA 4DRZA 2DFKB 3FWYA 4CT5A 5TVKA 3RVBA 5B2ZA 2IYSA 4TMVA 5FFMA 2NO7A 5FUXA 5FOVA 4CEIB 1FP7A 1GNRA 2JJ2A 3WHLA 4D0GA 1P7CA 3AM1A 1EGAA 3N5CA 4GL2A 3K9HA 2VHTA 5FUVA 4P32A 4A2WA 1E96A 1XMIA 3K0AB 5TMPA 3V9PA 1LVGA 4QHYA 4WIAA 3EIQA 4DBLC 2ZI3A 3SR0A 3UWKA 1TPZA 4ZI3A 2ZITA 3BB4A 4NBSA 4PC3A 2OSBA 2X19A 3WRYC 1GG2A 3QXSA 3CX7A 2IUTA 1JALA 3KXKA 2ZE8A 2IYQA 4QNMA 2VP6A 5EP4A 1NMXA 4DIDA 2QL6A 1YR8A 3JVVA 1XEWX 3AP3A 1ZD8A 3ONWA 4XVRA 1GNQA 5JI2E 2WWXA 5FTJA 2QP9X 2BCJQ 2C2HA 2QZ4A 3DZDA 3G0HA 3VNVA 3GJ3A 4CGZA 3WYAA 1KO7A 1G18A 2ZPTX 5E95A 4LX0A 5FTMA 3LQRA 3LY5A 3FTQA 1Q3HA 4OK6A 3RANA 1L4UA 1HV8A 2IC5A 4YDSA 4DCNA 2ZSBA 1ZUHA 4KLNA 2QP3A 1OJLA 4HLUA 4TTRA 5KSPA 5B64A 3M1IA 2J7PA 4A15A 3C8UA 1A2KC 1FZQA 1LY1A 5JJLA 1KJWA 3HPQA 2OBMA 5H8WA 1DELA 1N6HA 1B0UA 1XF9A 4M1SA 4C2TA 5EXXA 4R98A 1P4SA 4W5WA 5P21A 1WDTA 3T35A 1OFHA 3V4RA 3K0FA 3CPJB 1KSGA 2PL3A 2IYTA 2O8FB 1SHKA 1O87A 121PA 4OHWA 4D2IA 3IEUA 4EKDA 2IYRA 3IQWA 2HJGA 3Q3JB 3TQCA 1NBME 3QNUA 1VHTA 1UKZA 2IS1A 3BC1A 2NQ2C 2YC2C 3WY9A 2H16A 1NLYA 2P0EA 2WWFA 2ZRNA 4AIIA 2NTYC 3DZ8A 1X8KA 2V55B 4V0LA 2K5UA 3EZ2A 1KJZA 3B60A 1KK3A 4MYCA 4ASUD 2P5SA 3L8YA 4RCYA 5EZ5A 4TLBA 4O2LA 1E2NA 1YRBA 1Y63A 3OF5A 2QBYA 1QHHB 1US8A 1G291 3EG5A 3LVRE 4QM7A 1FQJA 1EFRA 2JJ1A 3ZYCA 1VG0B 3K09C 4Q4LA 2JLUA 1KSHA 2F9LA 1U0JA 4U00A 2BMEA 1IXSB 1XBTA 2AK2A 3M6AA 3QEOA 3EPLA 1YR6A 3L0SA 2FG5A 3PFIA 1Z0FA 1Z63A 4R9UC 3CO5A 5KUTA 2FA9A 2CBZA 4V0MA 3WRXC 3I61A 3GLFB 1VPLA 2ZVQX 2HCJB 4Q9JA 5KDOA 2IYZA 5FBRB 1UBEA 3CZQA 3RS7A 4C0HA 1G9XA 2G88A 1N6PA 3UPUA 2P6NA 2W6JA 2O8DA 1COWD 1CR2A 2GWHA 4LPSA 3NEYA 2PX3A 3VR1A 3QF7A 1C4OA 3IILA 1E1RA 5UKDA 4URXR 4Q1DA 1CULC 2FSFA 3MD0A 4Q4JB 1J8YF 3FMPB 5JCZA 3SFZA 3ZZUA 4BZXA 5AJVB 4I4LA 4B6FA 4MYTA 1ELOA 4K8OA 3TR0A 3A37A 2HYDA 2ZE5A 3E2IA 1IQPA 2W58A 4V0NA 2IYXA 3UMRA 5JI3E 4OKSA 4LV8B 4Q5IA 2OAP1 1CJUC 3SNHA 4BLQA 4DCTA 5IT5A 3B8HA 1Q0UA 5ELXA 1QG2A 1FX0A 4YC7A 5JHGB 3BERA 3QG1A 2I1QA 1OXXK 3SJAA 4BFVA 3U4QA 4DLVA 5EP1A 4IKEA 1OKKD 2ORVA 2H18A 3GFTA 4PTLA 4M1KA 5H70A 2CE7A 3ZVNA 4BEJA 5H1YA 2NZJA 3D3QA 4DSUA 4HB4A 4OI2A 4YQFA 5TY0A 2XOKD 4QGGA 3THXA 1ETUA 3CWQA 1U8ZA 1CR0A 1RRFA 3BFKA 2ZJ5A 4QM6A 4DLUA 1HT1E 721PA 5KDLA 2FSGA 4PHHA 4M9XA 4B44A 1Q22A 2GETA 2TMKA 3K1JA 3QVUA 1RJ9A 2WKPA 5AWFC 3TVDA 4KFUA 5BN3A 5L3SA 1XEFA 2PT5A 2C99A 221PA 4S2EA 1MO6A 2GK7A 2ZRLA 3LAWA 5G41A 1Q3TA 3REGA 1HY3A 2DPXA 2MSDB 3FFAA 1GM5A 2Q9BA 1IY0A 4HZUB 1QVRA 2QM7A 1ESNA 2EFHB 5CIQA 5JECA 2DCUA 4WZ6A 2ZS9A 1WE2A 1JAHA 1EXMA 2RHMA 3NBXX 5C1BA 3LLUA 3L8ZA 4HB3A 5L3QA 4IEEA 1DAHA 1GILA 2HEIA 1ZCBA 4DLRA 2LKDA 4BFSA 1K6MA 4IRUB 2DHRA 4WZAE 2VPPA 2BBOA 2IWRA 4HZUA 3W6OA 1P2VA 1X3SA 2V6IA 5E7MA 4C4PA 3ADBA 1W48A 2XITA 2REOA 2QUZA 4IDPA 3U7EB 1NBMD 4PPFA 1QBKC 1R5NA 2AD5A 4TTQA 2ONJA 4NKRA 1BOFA 1FNNA 1NG9A 4KV9A 1A2BA 1N3BA 2KSQA 3FMOB 4B3FX 3RS3A 2R6FA 2ZE6A 5L3RA 3NWJA
chains in the Genus database with same CATH superfamily
1XJWA 1CBUA 3OD5A 5EJ5A 3PZBA 1WWPA 1RYHA 4A0HA 1WY5A 4G5GA 2ORYA 4P36A 3IVXA 1UZUA 1AVTA 1DO2A 4W63A 4D44A 5A6SA 1CPQA 3NR2A 3RUEA 3R9XA 3PX2A 1XPOA 4XYBA 4HNQA 2VSYA 4IKPA 1R4AA 3ULKA 2KNHA 3Q3HA 3N0TA 5JCOA 2FZKA 2BFEB 3JAMA 2FPWA 1QKIA 3DG9A 4CL0A 2ZTVA 4KXWA 3P2JA 3VTFA 1RQLA 4JLDA 3CSSA 5SV2A 1VP9A 3DM5A 2OESA 2FDRA 4PC7A 1Z47A 3MOGA 1P8JA 4TXJA 3E0QA 1PF7E 1BDMA 2JFHA 2ORED 2QN7A 4ZDWA 3COWA 3G9XA 2YL2A 3IUBA 1P8AA 2JGIA 3U17A 9ATCA 2ZSIA 5AJYA 5AW3A 2E0IA 3DKPA 1WDKA 2XB6A 3EW9A 1AUXA 2DJIA 4CM8B 2V8BA 2YMQA 1HDEA 1FX1A 4R8KA 3R74A 1ODKA 1QP8A 3DDNA 1B26A 4ZJUA 4QZVA 5KTKA 4O6YA 2HTEA 2VTBA 3OIDA 4OK3A 5M29A 2Y3IA 1GP2A 4CF4A 1K68A 1NHWA 1RNLA 2A58A 1G7RA 1OVMA 2G4LA 2WUDA 3MRVA 4CKEA 1EIWA 1NOKA 2GTPA 2PO5A 5E2IA 3ITDA 1TTHA 3U3XA 3WYGA 2O0JA 2ODPA 1Q0FA 3GRZA 3QTTA 1ORHA 5CCEA 1RM4A 2UUIA 1FDUA 2ODTX 4P81A 2O7QA 3SEAA 3WXBA 4KO1S 4ZT5A 2IHBA 1UKYA 2YJTD 4MSUA 3WGVA 4DCVA 1GFSA 1SEPA 3SZLA 1IL0A 1BDIA 5C1IA 3N6VA 3CJRA 2ZRHA 3TD7A 3WIDA 2OBFA 2ZI6A 4V2UA 2VDJA 4OYRA 4TRRA 1WHTA 4ZGGA 4EO4A 4J1QA 4QTZA 1C8VB 1N1GA 3DTNA 1SY7A 3U80A 5HJ7A 3FCYA 3O8BA 2Q3DA 4GP9A 4AZ3B 1PFQA 5CP8A 2R48A 3T38A 3PQ8A 5F3RA 1ZOIA 621PA 4X0EA 3QOYA 3QW4B 1N2SA 2WFMA 2GTIA 4R9VA 3L1JA 1TM2A 5D86A 3M5DA 1NRWA 4GI2A 5ELLA 1Y9AA 1PS0A 1UJ5A 5HTOA 2ZJ1A 1QBGA 5AW8A 2TECE 4B6IA 1IDN1 3L82B 4X20B 1U3UA 2GQ0A 5L0FA 1ULAA 5L0GA 1PR5A 1UMKA 3RKOF 3SF8A 3LKBA 5DYYA 2Q4DA 3LY7A 4OPMA 1MPXA 3FFWA 5A3SA 1JS1X 3P9IA 3TIGA 3GEIA 1ZISA 3NIBA 4BBZA 1E4VA 3H2GA 4EQ6A 4F8EA 3O8CA 3G0GA 4Q39A 4UHJA 3HYTA 1VSBA 3BRWD 4R1NA 4Q03A 3UJNA 1G21E 3SQWA 3OKAA 1UJ6A 1VQ1A 2HV8A 3OU2A 3ONEA 2IHUA 1SWVA 4P83A 2AZTA 3OVMA 1TU4A 1ZVZA 1XDWA 3L92A 1KY4A 2C0QA 3PUWA 4BGDA 3SYMA 1JDNA 4JUBA 2GJ9A 2P61A 4WOPA 3R7NA 3ROMA 7MHTA 4HH1A 3ZE9A 1OLXA 2AOWA 5HHTA 5I51A 3AQ4A 2A9QA 2Q5CA 3TCKA 5HUHA 2ANCA 3GWGA 3FOCA 2D7DA 1ICEA 3GCDA 2RGAA 3E7FA 1CY7A 3CR8A 3B82A 2C4HA 4NMXB 5GINE 5C4GB 3T5GA 2WZFA 4RM2A 2JLYA 1VPDA 3IQZA 2PZKA 1RXUA 3CNQS 5CX1B 4O3MA 1XZBA 4NTBA 1CPRA 1KFBB 1N0WA 2Z4RA 3GF4A 1ECFA 4J3JA 1J2RA 3IPCA 4X8MA 1Q0PA 1H2XA 1EX6A 4ZRMA 4RTRA 3VH3A 3Q12A 5IF3A 4MQBA 5JZSA 3IMFA 2DB3A 4UOZA 3TW4A 3N2NA 5FQNA 4B0OA 4DDTA 3RSOA 2O7RA 4DJJA 5JS8A 2XX3A 4RMHA 4PZCA 4C22A 2UUBB 5AUOB 3WMGA 3N75A 2VTDA 2NU9A 1WDMA 1W0KA 2XCUA 3VH4A 4C0AC 1KSJA 1CQIA 2AZMA 2WKQA 4A91A 5AQEA 4H1TA 1W75A 2FPOA 3CBGA 1RIFA 3VDQA 2Y77A 2H1FA 3TX2A 2YHUA 1KEVA 3OQIA 2LUOA 3EZ7A 2Q28A 2ZSFA 5F2EA 5G4KA 3NDIA 4LVCA 1OCOC 2FFBA 4OHFA 4CV1A 5HBGA 4DDWA 2O3SA 4U2KA 4PX5A 4JX9A 2ZAGA 2IS1A 4M53A 3K1YA 1WW8A 4D8TA 5IJ0B 1RXWA 4KG7A 2LBPA 5HR5A 2C84A 3M4XA 4DLLA 3X1OA 1OR8A 5BWMA 1SD1A 3I73A 5K8TA 3K1TA 3L49A 1QK4A 2E9SA 4YWQA 3UPDA 4ZXPA 4BE4A 3JSZA 4Q4AA 2CVZA 4UEKA 5KTYA 2NYUA 3OE7D 5EZYF 4R2LA 3ZDXB 5I6DA 4FCCA 3C8GB 4G7OF 1JL3A 4RJLA 3D31A 4O4IA 4B4KA 2R7NA 3AHIA 4O0MA 4IMPA 3LUTB 3H42B 2BMAA 2WAMA 5BWNA 4TWZA 3HR7A 4LJLA 2AN4A 2VPQA 4JXXA 3M6XA 4M36A 1RRCA 4NE2A 4C3DA 1QX3A 1QMGA 1ZN9A 2XTJA 4OTZA 3OKFA 1SIWA 4B87A 1J33A 2CL0X 2ISQA 3OEOA 2Y1KA 1I51A 1TTPB 1IPHA 1OTHA 2UZ0A 5AKIA 4AY2A 5EZQA 1M34A 1M8GA 2IEZA 5G0VA 4PYOA 2CC2A 4XH9B 2EW1A 1X8XA 2FXIA 3Q5EA 3F9CA 2HHJA 1L7RA 4BLRA 3BH7A 3HXPA 1D2EA 4ERNA 5ADHA 1E1DA 5GZ1A 2YRFA 4P33A 1NF3A 4W5QA 2ZIVB 4IJUA 1ZHTA 1QVVA 3NTRA 3AL2A 4EECA 2KB0A 1LDBA 2JCSA 1S2OA 1E2PA 3KT3A 2D13A 1UQUA 1ZNWA 2JASA 3M33A 2PKQO 1DOVA 4FQ5A 4PZEA 2ZJZA 4MB0A 4L0MA 1OY1A 3PC2A 3U1BA 1R50A 3SDSA 1U0OC 3DHYA 3K16A 4EUNA 3G8YA 4QOGA 3OWTA 5EE3A 1UXOA 2GVDC 3UOWA 2UV8A 3L06A 4Y0VA 4X60A 3TZHA 3OUTA 1EUCB 1L7AA 1TX4B 2OAQ1 3RUDA 4JTAB 4YP0A 5CH8A 3I6BA 3MJCA 2FSHA 4HS4A 4BFXA 4ZO7A 3JSEO 2FQWA 4WY2A 4LFAB 4TLAA 4AJOA 2RAUA 5DPMA 4KIUA 5IYZB 3F6BX 4QU8A 4MW2A 3MFYA 2ZW9A 3L7DA 2C2YA 4X8OA 3RRZA 1P7VA 4BL5A 1UP7A 3LHFA 1EM8B 3KOWA 2X1VA 3OLQA 5LCXA 3VHXB 2G9RA 2W2NA 2NAFA 3CKLA 2NOAA 1NZEA 4I5DA 2PUVA 4O4HF 2C3OA 4Z51A 5MF6A 2BKVA 3F5FA 4BVFA 4OJNA 5ICSA 1I4DD 2OHHA 3W05A 4AM8A 3EGXB 5DHAA 4DN6A 2XBMA 1T26A 4YIKA 1AQLA 1IM8A 2F64A 4EHFA 1FBTA 2WYHA 4LLEA 1JBKA 1SA0A 4CQNA 4G65A 2P1AA 4AMUA 2VZ0A 1N7HA 3G2QA 3P9NA 1A27A 4AJ4A 3NAMA 4B3CA 1JDUA 3BGWA 2PS0A 3AG2C 2I7DA 3EHNA 4CTJA 1Z39A 2OOSA 4MARA 2EHJA 2LRHA 4HI0E 4PZLA 5DO9A 4YYEA 3AVTA 3KLBA 3PRKE 1M2HA 1XLTC 1LF0A 1YCGA 4ZLCA 1A9PA 2IU3A 1ZQ9A 3WWEA 1U3CA 2QJWA 4PQYA 3EAGA 3KHSA 2EDAA 4MUYA 3HVRA 1BW9A 1CR1A 3VRHA 5LR6A 3OCYA 2CLDX 4IPTA 2O8EA 3QOWA 2R03A 3N28A 4IJWA 2Q1TA 2BFNA 3HEMA 2VC9A 1X7DA 4BE9A 4NCXA 1A8HA 2ZFUA 1KWGA 2EKDA 3FSEA 4FVTA 4MIOA 4NSNA 6REQB 5IKPA 4X54A 4OGWA 1Z2PX 1ATZA 1LIHA 1T9GR 1WKBA 3C6MA 4E5NA 2DLCX 2VJDA 4QGAA 2ISCA 3DNMA 4E6EA 3K8ZA 4MGEA 3E7WA 5K6RA 2HBZA 4F3YA 3FBWA 1D1BA 2C03A 2GAJA 3P2IA 3NAZA 4MWGA 3VNQA 1SQFA 2YTZA 3MJVA 3ZZTA 3DHNA 1RRGA 3I45A 5JUWA 2O3RA 2HB6A 5CYPA 3VU8A 2C98A 5ADWA 1ZM9A 3SCZA 3ZV4A 5JD5A 4AUMA 1KVUA 2AFVA 4NU0A 2B8NA 1QTNA 2AT1A 1YUMA 1Z2OX 1IZ7A 4YREA 2X40A 1BXRA 4Y2TA 4I7EA 1W0KD 4OQLA 2PT6A 3ESRA 1NXXA 1TW2A 5JEEA 2QTFA 2XGSA 3H9GA 2IF0A 3EH2A 2EG9A 4GL4A 3S6JA 3BHNA 4LXTA 4QECA 1CZLA 1Y5LA 2LK4A 1NFOA 1PEKE 1I3KA 3HVHA 3RYHB 1GPNA 1G20E 1W1IA 5JAMA 4IMRA 4DB4A 4PHCA 2JARA 3UJ9A 8ABPA 2HPVA 5KTOA 1OLXB 3BAFA 3O2NA 4FD2A 4G0NA 4Y9SA 4YH1A 3E1GA 2NQTA 4ER5A 3AM3A 4BXOB 1Z6TA 2F1OA 1F4LA 2G9VA 3GBSA 4LF4B 3OMXA 4ZEXA 1ZX1A 3V48A 4ZVTA 2AP3A 3ICVA 4RJKA 5DYWA 5HUQA 3RROA 1RHUA 1Q20A 3B52X 3DVSX 2GAAA 1UINA 3JQFA 2BMDA 4L75A 3ZKWB 4ASUA 5D91A 3Q6NA 3WFJA 4Q9DA 4DR2B 2FR0A 2VLIA 4KPFC 4EVSA 2WABA 1SCUB 5TQ2B 1LI5A 4HG2A 3T7JA 4OQPA 1E0JA 3L7AA 5ALZA 4BJ5A 3T3HA 1HKHA 3ZJ4A 5KYXA 2RSEB 1KZHA 1GG5A 5DSZA 3U40A 3TIVA 5HX7A 1Z7GA 3R3SA 4XVHA 4V0OA 2W98A 3K1IA 5FWYA 4OGKA 5DSXA 1XQ1A 3VVCA 2ZSAA 1OT3A 5LXTF 1QG6A 4P54A 4R2XA 1CQIB 2WICA 4C88A 4ZFNA 2MSWA 3M3DA 3PIRA 3CPSA 4NFHA 1DBIA 1H8EA 3DCYA 3RT9A 3RRNA 4M1MA 4MQEA 5LNK6 1CB7A 5ES3A 2RAFA 5AKZA 3EIEA 4EYKA 3KZNA 1G38A 2C78A 2PRSA 5DNEA 1QYXA 5HW0A 4N0MA 3DLPX 4NDNE 4P84A 2FSVC 1HL7A 4PGFA 1Z3IX 1I80A 1H2HA 2CT8A 2FCRA 2H5IA 2QTRA 3LUCA 4PZYA 1EDZA 5CLJA 4WOCA 4RWZA 4Z9FA 4H4EA 1T4CA 2B21A 2JAOA 4A92A 1GHTA 2ZJ6A 2H7VA 4E7SA 1EGVB 1DAMA 3ZI7A 1FMLA 4KAJA 1TT5A 3IUPA 4KXQA 3NHPA 4MGYR 5IG2A 3T6BA 1A9RA 3OT4A 4D9NA 3V8EA 2O20A 3DOCA 2FTKE 4IDQA 2D74A 4PLFA 4D99A 8GPBA 2BTEA 4FZ5A 3OJLA 2YN0A 2FEKA 4KREA 1AKEA 3BOSA 2AMJA 3LNRA 2NZUG 4KXXA 4NS4A 3CRMA 1XT6A 3K1IC 2P1DA 1DG3A 1E94E 5LP6C 3BWBA 4KLCA 2BVNA 3CEJA 1P1BA 1X0XA 3FNRA 3R8XA 3DJUB 3W5UA 1U90A 1OZGA 1ESEA 1RFLA 4RCZA 4YCAA 2EZ9A 4ARVA 3OFJA 1KH2A 1SU7A 3OC6A 2Y69C 3O4HA 2DP4E 1TO6A 4MO9A 5DRYA 5C5CA 2HSQA 2VPIA 3EUEA 1CGOA 1MCZA 1Y3BE 1CFJA 5DGDA 2IV7A 4EJ6A 3UMMA 3AG4C 1UDXA 1FJHA 2ZTHA 2AZ4A 3JQFC 4RHXA 2HWWA 1KJYA 2WM9B 3RU3A 3WDLA 3WXMA 1IN1A 3UR3C 3GNLA 1COZA 1NU9C 2UUAB 2XYRA 3N87A 4L5BA 3LP8A 4UXIA 3UGJA 4KJZA 3KZVA 3OP4A 5IVPA 1BMFD 1BKDR 4BEWA 5KOYA 1AS2A 3GT0A 4JBIA 4EX7A 2IIBA 3GUYA 5TX7A 3DWWA 1VPEA 3C3AA 3DUFA 3CEMA 4C20A 5JT4A 1WW2A 3O74A 3U44A 3HCPA 3T1VA 1CWUA 1R6BX 3CH5A 3IRUA 3TBFA 1NF9A 2GKGA 4BNDB 4WT7A 5DN6D 1EFKA 3G7UA 2Z5VA 2ODEA 1HDCA 2P9BA 4QBFA 1N2BA 4MV3A 4G78A 5HNKA 3P9KA 4C0HA 2XE6A 5ALTA 1JRLA 2ZRAA 2PWPA 3ID6C 1X92A 3THSA 5E1DA 4AZVA 4DRXA 1GPAA 5C46F 4CMKA 1XZLA 4I6EA 1R4TA 1U7PA 3ZIAA 4YAKA 2EP5A 1E1CA 1BCRB 5K45A 1FU4A 3WDSA 1DSSG 3ZJUA 5AKXA 5HOQA 2OBYA 3CZ5A 2ZAOA 5ICMA 2JAHA 2GXSA 3RUHA 3R9WA 1T5BA 2J67A 2XNCA 3C3MA 5ALUA 2IZ0A 1AF4A 2ZQZA 1ORJA 3ZCSA 3SX2A 3GRRA 1AVOB 3CB4A 1BYIA 1ZVQA 3HA2A 3TFWA 4QL3A 2JHCA 4N40A 5AW9A 3T1QA 2BEUA 2OLKA 1GGNA 2O5EA 2Z58A 4JS0A 1ODLA 1MX9A 4MPPA 3ZV3A 4AMZA 3EF1A 3TGWA 5K6AC 4NC9A 2FVXA 4Q01A 4JKOA 1ULZA 1CQJB 3HCWA 1YZQA 4F6RA 2IK8A 4PNPA 3MGBA 3T1NA 5IDVA 4JURI 1UZAA 1VHLA 2PZEA 3HDYA 3IBGA 1YZTA 3N2EA 4HAIA 3RC3A 4BP3A 4HXFB 2UUOA 2YJ6A 3I5YA 3K2IA 2GD2A 3FAPB 2VDNB 3LHSA 2ONCA 2AG1A 2CDRA 3U5SA 3KJFA 3AWIA 1JF8A 4G5YA 1V4VA 1BE8A 3T9DA 3QNMA 4KEAA 4YMTA 3Q88A 1LDYA 1S3GA 3K6KA 4UU8A 1N4AA 1JHZA 4E08A 1F06A 4HV4A 2QLBA 4LZNA 3U4QB 4NZZA 4GHWA 4IX9A 4XYLA 5TRTA 3E9ZA 4F7WA 4EY4A 4BZZA 2OORA 3N2GB 4M87A 4PWYA 5AM1A 3HI4A 1KPGA 2D1QA 1ZUIA 4H27A 1XE3A 4O2BF 2Q41A 3TWOA 3UAOA 1A5AB 1TYEB 2W83A 3DMRA 1M8JA 2G83A 2FSIA 4X6YA 5DHTA 3ONFA 4QSMA 2FLKA 1WTAA 1THMA 4HAVA 1CS0B 4KO4S 1WB9A 5CD1A 4BO5A 2NQ8A 3TYXA 4LJ7A 3GQBB 3A25A 4TYWA 4N4AA 3HV2A 1H42A 4AO7A 3ENVA 1QH0A 2XD4A 2R7UA 2CB0A 3DE5X 4EBJA 3ESZA 3NRCA 3WWCA 5LFAA 3TECE 1AKYA 1SBYA 4LQ4A 2HK9A 2OYCA 1U1DA 1NJ5A 3LDUA 5CVEA 1TJPB 4CMEC 1CSEE 1P17A 3L1VA 4A0RA 3VKHA 3AZPA 4YRNA 3TBHA 2R60A 2YIMA 3N3BC 1DRVA 2F62A 3RSHA 4RKWA 2HMYB 3SIWA 3GLFE 3QVVA 5E9QA 1OXKB 2IBSA 3IE1A 1IIRA 1JIIA 3IJ5A 4RFVA 3OZCA 5F33A 1E2QA 2FOXA 4KXMA 2WWYA 4JNCA 4MDEA 5BYBA 5LPNA 2X8JA 3QU7A 1LD3A 2DHDA 2FPGB 3T4EA 4CKCB 3NKDA 3M3HA 4V0ME 4B3GA 3P2EA 3QXGA 4M49A 2H2FA 1EUQA 1ADFA 3D9QX 1PW7A 2CZCA 1S2LA 2QQ0A 2V03A 4DKJA 2C4VA 4HWPA 4POAA 4RFSA 4TM7A 5J23A 1TEXA 3KZ1E 2G76A 3K8OE 3R1IA 4PXAA 2ILTA 4RBNA 1E99A 2QUPA 3G9ZA 4KMMA 1G20A 4MHOA 4WASA 1Z23A 1GTVA 2TSYB 4IVRA 4BNMA 2UXCB 2PGIA 4LRQA 4M22A 4C3BA 3JQQA 1GGEA 4ICIA 4NH0A 2MSLA 4Q3EA 2OLEA 3TK1A 3ZUPA 1AC5A 2RH5A 2P6MA 2PBZA 1WCXA 2EFEB 1X86B 4JLAA 1G8GA 2NU6A 3FDZA 4OATA 1OAAA 3WWZA 4IEIA 3IQCA 1YYJA 3A6DA 1L7QA 4G01B 2XMSA 1Y8CA 1F14A 2FU5C 3GFRA 4H77A 1G8JA 4MKRA 4U1RA 4B74A 2VDWA 3BCRA 3ET4A 2HW8A 5J4LA 1RRKA 3MMSA 1EK5A 2WSBA 3KKEA 3MJEA 4X1OA 2XRHA 1V8OA 3OQ6A 1QJ4A 4NYJR 4P4NA 1U9IC 1T8UA 3FI0A 4X95A 3U6KA 2V65A 4G26A 2QLFA 4H1HA 4J16C 5EUQB 4DJEC 5I7SA 4WUVA 1O8CA 5BMOA 4YHHB 5EIHA 4KZKA 3WX0A 1HDZA 3Q7SA 4L2IB 1R6AA 2RGUA 4LQDA 1SHLA 2FZVA 2IZOA 3H5RA 3QLVA 4KVFA 5AHKA 5ILQA 4N06A 1AUQA 4M7WA 2J4DA 4PICA 4RLSA 1PEYA 2ZJYA 3GVIA 4FP9A 4NTZA 3RS0A 1OSNA 4ZCTA 4DQKA 3TLGA 1KI3A 4BMDA 2CNWA 2Q00A 3KEOA 1J1IA 3RIXA 2WZBA 5AJWA 5CB6A 1F12A 3QXJA 4M9UA 2YV4A 2PUWA 1S05A 4UAGA 5ADUS 4MTGA 3B29A 1BX3A 1SIOA 2PX4A 4UHBA 5TV2A 5JYDA 3G1UA 2V7GA 2QRNA 1CRWG 4X97A 1HE4A 5AVZA 3AF0A 3MRSA 1PK8A 1ZOOA 3MQFA 5CDYA 1P72A 1VG9B 3KXDA 4OBBA 4UNNA 1AXGA 1B68A 1VE9A 4MEJA 4AJ9A 1STOA 1ONPA 3PNVA 4QDTA 4YAUA 3K92A 5HVNA 3IL2A 2IEIA 3B2NA 3NHUA 2DUJA 3B6MA 4WE3A 2OECA 5GP1A 2ODWA 2HXYA 2QZJA 4NQRA 4WVLA 3GP5A 1DKQA 4C4ZA 1W4LA 1GR0A 1ZNYA 1YMUA 5ETJA 3E7XA 2DR0A 4D02A 2L6HA 3H2ZA 2W2PA 1TVMA 3K9BA 5CVVA 4ZQIA 4D74A 1IHPA 3TPFA 1ZG3A 5ALKA 1IOLA 3TRDA 3R09A 3G2OA 3QKWA 3L7KA 3L77A 3VHLB 2JANA 3H8JA 1MC4A 3FH0A 3HCDA 3KUKA 4CR6A 1B6TA 1YA4A 2GUGA 5JZ9A 4GBMA 3ICCA 4DARA 5IBRA 1SXJA 4DWJA 3SI7A 5AI4A 1P74A 5KVAA 3LUPA 4PLVA 4YAWA 3VSCA 4IDDA 1MEJA 5C8YA 4JSYA 2QRHA 1X2BA 3GXOA 2HD4A 2AN1A 3B0VC 3C8GD 3IERA 3UT6A 1XP5A 4NCBA 1U6KA 3G2IA 2VBGA 2Y92A 1W85B 4W82A 1T2FA 2ID8A 3GK3A 3PGXA 2X41A 4OQ4A 2H2AA 3PT9A 4O2RA 1FYVA 1KQOA 1WQ1R 2Q3MA 4YK5A 1Z5OA 4JITA 4NBWA 2Y68A 2JJQA 5HQTA 2G4CA 3NT2A 4IJ6A 5J58A 2R8PA 2ZU0C 3JD4A 1NVUQ 4Q1BA 3PFNA 5H80A 3BICA 1Q0SA 3E7DA 2A1UA 4YN0B 1V3TA 1VXOA 3VR4H 4CIVA 5JALA 4E7OA 4ZVLA 3KDPA 2KQ9A 2OCYC 3MUOA 1GQRA 1UUFA 2OPHA 2AXQA 1YKGA 3D2AA 1P62B 1IOWA 2QNIA 4N8SA 1LK5A 4QUKA 5CPBA 1S3FA 5HILA 3LT2A 4ZV7A 3RLIA 2AMFA 2V26A 1OW3B 1XDSA 1ZK1A 4NYIQ 2I3ZA 3EOZA 2ASRA 3R3WA 5D84A 5FBWB 2X0EA 2BE9A 4RX1A 1X1BA 1LI4A 2HV7A 2Y1EA 3H4MA 1YF3A 1J97A 2OV3A 2RHOA 4B2LA 1N5KA 3JCUQ 2R6R1 5JYEA 1TU3A 2EYUA 1L1QA 4MXDA 5FWAA 3BSWA 3AIKA 5FOXA 4EA6A 3GJYA 2WMNB 4G86A 4XDGA 1TPYA 2A7XA 1ABBA 3L3BA 2CV2A 4RV4A 4EKYA 1GU1A 1P7YA 2NIPA 5F9MA 2ZT8A 4NYMR 3GJRA 3IP9A 4M8KA 3MB5A 4LTMA 4UEWA 3JZMA 4WPGA 3K20A 3C5VA 3KS9A 3V6MA 3VPDA 5CI8A 2JFGA 3ZVLA 5BYKA 3QLEA 4ZKEA 4BNJA 1EP9A 1TGVA 1O7JA 2WSSD 2ZQYA 2NO0A 5AKEA 2Q5QA 3VTZA 3EEOA 2PE5A 1A4RA 1U0GA 1GPDG 1X7GA 1DAFA 2J3QA 2QXUA 3MAJA 5ECGC 4Q48A 1F8UA 3A36A 5JPIA 2ZPAA 3AQBA 5BN5B 2HLDA 3W3AD 4BS9A 5HKBA 2G0TA 4E5KA 3SVZA 2BMFA 5IYZA 2RH8A 1PDOA 2FQXA 2OQIA 4NMWA 1UOQA 4IH9A 3SN6A 3E58A 4LJ4A 4MHSA 3B2QA 2J0VA 2VYFA 2KJQA 4UXJA 5JXJA 2OGWA 4IGIA 1BEEA 3TQHA 2PNJA 4Q4DA 3HHEA 5FTKA 4R7ZA 4Q9NA 4ITUA 3Q4GA 2LP4A 1WHSB 4Q4AB 5JCJD 1E8MA 3QFCA 4FR0A 2CB9A 3QG5A 4HFMA 3WKAA 4F46A 4GPAA 3UQZA 2AXNA 5TDHA 3ETGA 3QVWA 1CRPA 2WUWE 2AHOA 3N0WA 3UH1A 2PX6A 5FO1A 3ODPA 4KQIA 1NC3A 3AFGA 1NKTA 2C3YA 4FUQA 1MB9A 3G2HA 1G5HA 2AG8A 1Z7WA 2CFRA 3Q3GE 3OT5A 1VOTA 1T6IA 2VNJA 3PEEA 3RFUA 3LBFA 4RNCA 1DBPA 3RS8A 3MTDA 1OBCA 4OYYA 1EZ1A 2GBGA 4LJKA 4Q7QA 5IXSA 2Q9AA 1E6MA 3AFIA 2C9ZA 3AP1A 1SBCA 1BXKA 3TOSA 1Z6ZA 3R6LA 4OIFA 4BVAA 5C7OO 5BQGA 5AUPB 4DDKA 1ECLA 5JH7B 1WSBA 3BXZA 3QFFA 5BR1A 2X3YA 4N9WA 5G1OA 1V1MA 1A5BB 1O77A 4F1KA 3V1YA 2D59A 4Y2JA 2NTEA 5K5EA 2ZXWC 5D1NA 3RUCA 2GAFA 1G5FA 4HNGA 2ZP1A 1MB3A 1P44A 3RSLA 1M5TA 4LW8A 3PGJA 5CT6A 1U65A 3U7HB 5DP1A 3S1AA 2Q07A 4MKIA 2ZYGA 1L5MA 2YJZA 5ED0A 3VR3D 2I4RA 4M8SA 4RVHA 2I3GA 3AI2A 2CHEA 1ISHA 3H99A 4IDHA 1L5YA 3C70A 3QVXA 5KSOA 2NUAA 4KSYA 1RPNA 5BVHB 1QGZA 3O39A 2QR2A 1HSOA 3EF3A 3BF7A 1V1MB 2Z3VA 4Y6SA 4DWWA 3ZHZA 1L5QA 3DNPA 2BP7B 4C7XA 1GAXA 1KNXA 4O5OA 3ABRB 4E21A 5CA1F 1I7SB 1BW9B 4GVXA 3W34A 5B36A 2HBRA 4HRAA 1IEQA 4K2HA 2PUJA 4DV0B 3RBAA 1R18A 2YNMD 3S8YA 3C7JA 2GPNA 1FNCA 4MNTA 4KBGA 5IBQA 1B43A 3CF4A 1K97A 1W30A 3WK7A 4H4DA 1NVFA 1GXSB 1S9HA 1APBA 3FUUA 1DTEA 1R8JA 4OA5A 4BMZA 1R2QA 4RZQA 3WOVA 1FB5A 4ZTUB 1BHO1 4QJ3A 3I2KA 3WP1B 5FBQB 4RJ2A 1JG2A 1IAQA 1B41A 1IN4A 4ALIA 3QA9A 2QP4A 2I1WA 3ZIAD 3VVLA 4IAOA 2RMKA 1E92A 1WSWA 3S0XA 2FMXA 4AB1A 1MVLA 1NBAA 1IIBA 2C96A 3VQTA 5CJPA 3V7UA 2ZIGA 1P2BA 3DFKA 4ZAFA 1JR3A 3UATA 2CCKA 4U3JB 5CB0A 3RRFA 4HDKB 1NDUA 2R7XA 3FYSA 2X13A 4Z53A 4N6HA 4MUIA 5FUBA 1IVNA 5TGTA 1NXOA 1T2VA 1O57A 2BC5A 1QFXA 1T3HA 3FOPA 1YSCA 4JLNA 1E0SA 1VJ5A 5JFOA 4HAZA 1NQVA 1JFLA 2H4JA 3R9KA 2JD3A 1CJVC 1R4NA 2VDVE 3KQMA 4IIHA 4MW6A 4QGBA 4FB4A 4XX1A 4JQYA 2OZLB 5JW6A 2XTMA 1Z37A 2HKVA 2VPYA 3R40A 1C17M 3UA3A 1Z62A 1GFWA 3DBHB 4CS9C 4EJMA 2FDXA 5JFTA 1N1CA 1X39A 4QG7A 3D8NA 4JWTA 4IIBA 3NMJA 2ZT7A 1UPUA 2ZBVA 4ND6A 1JHPA 1FXUA 3ETNA 3TKYA 3F7TA 4M6WB 2QORA 1K89A 3K73O 2PSSA 1TD9A 2Z2ZA 1M67A 4D5GA 3R3YA 2PCJA 2LD6A 1SXHA 2PQ0A 4OP3A 1L3BA 2AUTA 4PE5B 4Z9BA 4EITA 5F12A 5LVAA 5FWXA 2FQQA 4NZ9A 4YLEA 3RS9A 4EG4A 3UNGC 4FFBB 2C83A 4OQMA 3UIEA 3G0DA 5CB4B 4KB5A 3OF3A 4AL4A 1PFUA 4RQBA 3BFPA 3SVTA 3FYTA 4JEUA 4NECA 2P9CA 1JLRA 3QH4A 2GK6A 3ZWBA 3I9FA 1EGHA 4JQSA 1GQYA 5FD8A 3H9QA 1H2RS 2EX4A 3QX8A 4KQXA 1KDVA 2AVKA 2ACKA 3K96A 3Q3IA 4L16A 4P4SA 2K6GA 3FTCA 1U8AA 4YRAA 3USZA 2B5WA 3IYLW 3LD9A 4PFJA 1KFJB 4UUMA 4F21A 5JD4A 4AKSA 1ZBQA 4W5NA 4XWKA 1BOOA 3KFXA 3THYB 4DV3B 4C01A 4U5XA 2NNWB 3R0QA 2BGRA 2W6NA 3QEMB 1TQ2A 2VT6A 1EQUA 1WKCA 1T2AA 3ZQJA 4RETA 2GRJA 2PXAA 2WF8A 3E9DA 2C5GA 2QSUA 4NS1A 4NZPA 4X6LA 1TYZA 3TNYA 3QZCA 2FZWA 3DPUA 3PFGA 5CVDA 2OEVA 3DZAA 1BQ4A 3PJFA 3UV7A 3V7OA 1TGYA 3GFBA 5B3IA 1DJLA 4B6RA 2NSGA 3I6ZA 4QNRA 3BX1A 5TF4A 3IRVA 4R9SA 1WXWA 2ZJ3A 2OMKA 1S2MA 3AG6A 1XD8A 4WZBA 5DBEX 3KKNA 2WAYA 1R6XA 3GROA 1FQKA 4RU1A 1XEXB 4BRWA 2IU4A 2RI6A 1ZK4A 4EVQA 1VYIA 4QAJA 3RTAA 2DTDA 2YFKA 4OHZA 2IM8A 1R6UA 1A0BA 1J56A 1W5EA 3UJHA 5F9FA 5A69A 1CXZA 3TRIA 3HABA 4G8BA 2DPHA 4FKBA 2QD1A 4Z9AA 4Q1VA 4QJ5A 3B0UX 2A9OA 2B2CA 2GEBA 3OZAA 1JHOA 2E4ZA 3AV0B 4E5DA 4RYDA 2VUSA 3CRQA 1A97A 2H92A 2GF9A 3Q7EA 5FL7A 5AVKA 1DIHA 1GDDA 1A1SA 5IJ9B 1VCHA 4PCUA 2FMIA 3G7SA 3LRXA 1H3EA 1KDRA 4DB2A 1EYZA 1SNYA 3JYQA 2XJ9A 3MTJA 1SUFA 2D8MA 3HN2A 2L69A 4J8PA 1S7CA 4NHEA 4KN9S 3P20A 3GLIA 4PZZA 1CJMA 1Y1SA 1Z12A 2IP2A 3A4TA 3NTUA 2DFVA 1EXDA 2C2WA 1CUCA 2QLTA 2XWSA 4MI1A 2WB4A 5DEIA 3A14A 3A4YA 3DDUA 3P9ZA 3E05A 3LSYA 1A2QA 4TTAA 5BXQC 2EVWX 3CLSD 1ZOSA 5HK8A 2CVQA 5IZ4A 3CVYA 4N1AA 4JY7A 2CLCX 3U61B 1OH6A 1FR0A 2FF7A 3N2KB 2FPPB 3CX8A 1TK3A 4MVOA 1YIOA 2I7XA 2ESRA 3RYFA 4LDNA 3YASA 5AUNB 2UYHA 3LZ6A 4JJKA 3T0GA 1XJ0A 1AGXA 3IOCA 1NV9A 3NBYC 2JI8A 1BGXT 2EILC 3I6YA 3O8NA 4CLHA 4AK9A 2G5PA 5G3ZA 4LWPA 1AKWA 2H4ZA 5BRJA 1X80A 4OP1A 4IH1A 1M66A 1YS6A 2BT4A 5EQTA 5C35A 1BEZA 3T5DA 1P75A 3N59A 4EI8A 3C43A 5JR3A 1FE8A 1NQUA 4L28A 3ZE2B 5JBQA 1QIHA 2X76A 3CLUD 3GGGA 3OJOA 4UDOA 2R5FA 2JDIA 3JV7A 1JQAA 3IDOA 4CM8A 1VKZA 1Y33E 3BKXA 3AY0A 3DFMA 2BFPA 1H94A 2X7XA 3KUDA 1XWJA 1JHDA 1Z5WA 1Z83A 4TS1A 5CH5A 4EG5A 4IHJA 1LJLA 1C4WA 3AQIA 5DM2A 8OHMA 1CEYA 3L18A 2F3RA 4ND4A 2HHLA 3TW0A 1KJIA 2CXHA 1R27A 3LDGA 1A71A 4H3KB 2VG8A 4QDOA 2BBSA 3ABOB 3I76A 2L7AA 3OCJA 4QOIA 1YFLA 1K04A 3UMHA 2JG3A 2HV6A 1C9JA 1TZJA 2HUJA 2RARA 1SVUA 4AUEA 3E8XA 4NARA 4LE2A 4RD3A 3O83A 3RTGA 4EA8A 3QW1A 2QMQA 1CYEA 3BMCB 5ESDA 1HZJA 3E7PA 1U4OA 3PBKA 4YJGB 3RNLA 5I9IA 1FYFA 1L7VC 3QMWA 1N9GB 3DDOA 1TEVA 4IW3B 4FGKA 5T3WA 3KK0A 1BSVA 3KZOA 1HTWA 2X7HA 4XGRA 3Q3VA 1JJ7A 1TB4A 1ODFA 4Y2YA 3ZGXA 2HF8A 4KU4A 3RC1A 2OVFA 4W6QA 1I1NA 1GGQA 2Q4RA 1E3JA 5JMWA 4H1UA 3CXUA 4KVGA 3RSQA 4JOSA 5AIBA 3BVPA 1XLTA 4TTTS 3L4BC 4IQ8A 4HZGA 2EIJC 3EW7A 3GODA 4IZIA 1XV5A 1NVAA 1X7WB 3HB7A 2H7BA 3ND9A 4MV7A 4OH1A 2CYDA 3RVLA 3TTWA 4AURA 3COJA 4ZAGA 2IH2A 3V00A 1U6IA 4R54A 1SG0A 1FNBA 5MN5A 2OTCA 3LKDA 4A6EA 1NFFA 3UXYA 1V5EA 3D0OA 4KI2A 2WAAA 4BC1A 5J4HA 3VSDA 3W7AA 3B9BA 3GVPA 2RGYA 2ZLBA 4CKWB 1AX9A 1N5IA 2BC9A 2CDNA 4TV9B 1RABA 1TT7A 4J0GA 1ZITA 2QNBA 4HADA 4DDUA 2IJGX 2V7PA 2ZVPX 3DOIA 4D0LB 2G4VA 1U2DA 2ZOSA 2HPZA 2W93A 3PEYA 4IDEA 4BO7A 2RC6A 3W4KA 4D9IA 3AK4A 3ND8A 1J25A 3LLMA 3CVJA 1L8QA 4HDMA 4C6SA 4ZDKA 2FRXA 1HPLA 2Q4FA 3FKQA 4DHEA 1NT2A 3C8DA 3E2PA 2W6IA 2IXPA 2JLCA 2RHCA 4HGZA 4RJIA 1TUGA 2VCAA 1U3TA 3WNZA 5IC5A 1CEEA 2VK4A 4C04A 3PKJA 1GRQA 1ABFA 3AEKB 4ALJA 3II6X 5DLEA 3TR5A 5AK5A 2XYGA 3ETCA 2HIMA 2HK8A 3G1WA 3CZMA 3R76A 4AJLA 4MVQA 2D5IA 1F38A 3FY4A 1S8AA 5INTA 2F1HA 2XUOA 3PXBA 4CV3A 4AKHA 2H52A 1NSTA 3DAFA 2CDAA 3QKSB 1VFNA 4FSXA 1RJ9B 1XNHA 3ECCA 2PDAA 5CBPA 4UU7A 5ITZB 1E2MA 1W46A 4ZALA 2Q2VA 1NG1A 1BRTA 3O6XA 2GDJA 2I80A 2BUAA 3QE0A 4TLLB 3O8OA 3MC1A 4Z8XA