1J8MF

Signal recognition particle conserved gtpase domain from a. ambivalens
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
295
structure length
295
Chain Sequence
b'LLDNLRDTVRKFLTGSSSYDKAVEDFIKELQKSLISADVNVKLVFSLTNKIKERLKNEKPPTYIERREWFIKIVYDELSNLFGGDKEPKVIPDKIPYVIMLVGVQGTGKTTTAGKLAYFYKKKGFKVGLVGADVYRPAALEQLQQLGQQIGVPVYGEPGEKDVVGIAKRGVEKFLSEKMEIIIVDTAGRHGYGEEAALLEEMKNIYEAIKPDEVTLVIDASIGQKAYDLASKFNQASKIGTIIITKMDGTAKGGGALSAVAATGATIKFIGTGEKIDELEVFNPRRFVARLHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SIGNAL RECOGNITION 54 KDA PROTEIN
publication title The crystal structure of the conserved GTPase of SRP54 from the archaeon Acidianus ambivalens and its comparison with related structures suggests a model for the SRP-SRP receptor complex.
pubmed doi rcsb
source organism Acidianus ambivalens
molecule tags Signaling protein
total genus 100
structure length 295
sequence length 295
ec nomenclature
pdb deposition date 2001-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF02881 SRP54_N SRP54-type protein, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 1j8mF01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1j8mF02
2C9CA 5BYJA 4MRRA 4RCYA 1N0VC 3JZAA 5KSPA 1W46A 1P9NA 1J99A 1FPMA 2ZSBA 4Q01A 2X77A 2KBFA 4TYWA 4D4MA 3H84A 1ZD1A 3VTKA 1FFHA 4PO1A 4WXPA 1ZC3A 3MCAA 4H1UA 4A1FA 3ZVRA 1XXHB 5IRCD 4A15A 3BORA 3QXHA 4JLAA 1CJMA 2CNWD 1X6VA 4OI2A 2VP0A 4OHXA 1YHNA 2H92A 2IHYA 2OXCA 1FX0B 1JI0A 1Z2CA 3I3SR 4YXWA 3CPJB 4G5QA 1TPZA 3UPUA 4C2UA 2KE5A 2WOJA 3RWMB 4WBSA 3RC8A 4C0SA 5E95A 4L9WA 2H16A 1AKEA 1S96A 2PMDA 4NCIA 4U7DA 2V6IA 1W36B 4IFBA 1MT0A 2VF7A 3FMOB 4B2IA 1A5TA 1XD8A 3E2IA 1QHHA 3CRVA 4Q1AA 4KYIB 2PMKA 3A1SA 1EFTA 3NH9A 1P2SA 4QJ3A 5D3QA 3G82C 4Q1DA 5JSZB 3IQXA 1P3JA 5LD2B 3A1VA 4M1KA 4Q4JB 3DMNA 4PSKA 1ETUA 2OCBA 3RYTC 5DGXA 3MJHA 3NC0C 4NH0A 4W9MC 1JEEA 4LDJA 1M74A 1N3BA 2Q21A 2R62A 5EE0A 2RHDA 2GJ8A 2AL7A 4XJXA 3EA0A 3KL4A 4I1SA 4TL6A 5FR2A 4GOXA 4A6XA 4B3BA 1UBCA 4B3FX 2O8FA 2ANBA 3EZ2A 2F43A 1DTSA 1Z6AA 4RSGA 5EZ5A 1W47A 4DDVA 1C9KA 3QF4B 4MKIA 1KTVA 5ELXA 1ZCAA 2R6DA 2A9KA 3KQUA 1P61B 3I61A 1GAJA 3VKHA 2ZJZA 1ZD8A 4ZO4A 2ZRDA 2JJ1D 4QRHA 3CNLA 5EP1A 2O8EA 2W6ID 1U2RA 4W7SA 1OKKA 2FFHA 1RRPA 1Q0UA 3CBQA 4Q9KA 1GNQA 3L0SA 5CJ2A 1G5PA 2F1IA 4D25A 2ZI3A 4QXAA 1GVNB 3QKRA 2IYTA 3KKPA 2AD1A 1XRJA 2WWXA 4LHZA 2AWOA 3OESA 3PUYA 1VG8A 1G7RA 3DOFA 2JDIA 3EZ7A 3ZZTA 4PHGA 1Q12A 4ESVA 2QT1A 5EE3A 3W90A 3X1WA 1W0KD 2AN9A 2V1XA 2OM2A 1WBBA 3MG9A 3THYA 1CP2A 2ZJ8A 1Z0JA 3CWQA 3Q8XB 3MWYW 3KJIA 2AFIE 4MH0R 4KAXA 3QVUA 3BJIC 4XOIA 5A5GA 2ZSAA 2ORVA 3WNCA 4LJ7A 4D26A 2L0XA 3SDZA 2HCBA 1KKMA 2IYZA 4JVSB 3THXB 4JSTA 2LKDA 4JYCA 5C1BA 1QHHB 4A2WA 1VKJA 2ZI6A 1G3IA 5HCIA 3ONWA 2BM1A 4B48A 1II8A 1NJFA 2GK6A 1G7TA 3U6KA 5EP3A 3RS3A 3DZDA 3BIFA 2QNRA 1IBRA 1R0WA 4HB2A 1E1QD 3EPKA 2NIPA 2PEYA 1IM2A 1E69A 4MGYR 1KZ7B 1RJ9A 2JLQA 5F3WB 1DARA 2TMKA 1OFTA 4DSNA 4ON9A 2FZLA 1NNEA 5J47A 1IXSB 4M9QA 1LS6A 1ZM2A 2F43B 4LJYA 1ZIPA 3TLXA 2AKAB 4MRSA 3BAFA 4WOPA 4F91B 1PLJA 2CLDX 3RANA 2IS6A 3P32A 5BQ5A 1R6BX 4CT5A 1KSJA 1XEWY 4PO9A 4OQNA 2GWHA 3FE2A 5IK2A 2O8EB 2ZANA 3KKQA 1T91A 1DAFA 2QE7A 2OE2A 4HEJA 4QFMA 4QHSA 5BWMA 1GRQA 5TV2A 4BLSA 2D2FA 4LC1A 1R5NA 1NBMA 3SJCA 1MABA 2GETA 4F92B 1XMIA 4G0NA 1A2BA 4MKFA 4QBGB 1SXJC 4KLZA 4BLRA 4NYIQ 1X1SA 2CLCX 2XX3A 121PA 1SVOA 4IEIA 1YZTA 4RFSA 3T35A 3L8YA 5CB8A 2Q0HA 4PAQA 3N5CA 4OI4A 3BB3A 1U0LA 1KJWA 4FMCF 1G5RA 5FTMA 5TDHA 1E2FA 2A30A 3BGWA 1J2JA 2V7QA 3LO5A 2ORWA 5C2JB 3THYB 2G0NA 4OK6A 3AP1A 1JB1A 2QI9C 3JVVA 2HJGA 1QF9A 1G6OA 4ZPXA 2ZAMA 2BCGY 1BYIA 2DWPA 4DCSA 1MH1A 4A92A 3B1VA 4DJTA 3TMKA 1X86B 2YINC 2FA9A 2ZEJA 1OH8A 1S1CA 4EPRA 3E70C 3A1UA 1P2VA 2P5SA 4IEEA 3TW8B 1Z0FA 2XEXA 2ZRPA 3WHKA 3TUZC 1H8HD 1D8TA 1JR3A 1LV7A 1TU3A 1IJFA 2GXQA 1XDBA 2OBMA 2BBWA 5E7JA 1GZSA 2ZIAA 5FUYA 5LB2A 2AK3A 4DEXA 1II8B 5CYOA 4NONA 2QSYA 4CT4B 4E07A 3MLEA 1JXMA 1UFQA 1NSFA 1DE0A 3KQNA 2PT7A 2P0EA 2ZI4A 3RLFA 2BMDA 2A5DA 4Q18A 1ZNWA 2ZRGA 4M1WA 4Q47A 4EQ6B 2WMNB 3V00A 1RJ9B 3EPLA 4UNSA 4X8OA 3TUIC 5GJWC 1DVRA 3AVPA 3O8DA 4IFEA 4TL7A 5J40A 5K8UA 1SXJA 1D6JA 1BH2A 3DM9B 1XD2B 4Q02A 5HZKA 3QEOA 3IKJA 3W3AA 2O0JA 3GD7A 2KB0A 5EP4A 1IONA 2Z43A 4PFSA 4ZV4A 5KPDA 2UZ3A 1BOFA 3TH5A 1XU4A 3B1XA 2PCJA 1AA9A 2UZIR 2QA5A 3GJ5A 4G5SA 1P72A 5AJXA 1HV8A 3KXKA 4DCUA 5GVRA 3UG7A 4B34A 1KI9A 3KX2A 4FD2A 2FGJA 1SXJE 2HJVA 1W48A 1G19A 2BMFA 1MOZA 2NGRA 3QPWA 5KYKA 2GEUA 1A1VA 1M34E 3QQ5A 1R8QA 4GDFA 1A82A 1GKUB 2GBLC 2FEOA 2WM9B 3SZRA 3WP1B 4TMZA 5FUWA 1JAIA 1ZBDA 3CUEF 3B13B 2VLIA 4FCVA 1CRQA 4WZAE 1G8GA 3PVSA 2KSQA 3GJ3A 3W8NA 3ZDQA 2IW3A 2GESA 1GRNA 5FL3A 3QKSB 4MRVA 4B6EA 4MUAA 3U3RA 3QE0A 4L5BA 5FPSA 4PZZA 2IHBA 1UKYA 4LHYA 3R7WA 4Y0VA 5JJLA 2ODEA 4M2LA 1XMJA 2HXYA 3NWJA 5JCZA 4BLPA 4F4IA 3W9YA 1E9EA 5JECA 1AK2A 4URWR 5KUTA 4KVAA 1KKLA 2WTUA 3TBKA 1T5IA 3A6PC 5HCNA 1IY2A 1CJTC 2XZLA 1WCV1 1E1RD 3L0PA 4DB2A 4G01B 4RZUA 4A0RA 1G3QA 1WGWA 1OFHA 1OB2A 4DWJA 2VA8A 1DO2A 2ZSEA 3A36A 1O3YA 4KO8A 2R6AA 4B32A 1ZU5A 4P4UA 3W6PA 1GL9B 2FMXA 2X2EA 2PJRA 2ANCA 3NBXX 4YDHB 4UNNA 2CE7A 5KDLA 5JHHB 1YR9A 3FMPB 4NCNA 2CLSA 1KDTA 4TMKA 2HF8A 4OQLA 4PR0A 2QORA 3EWSA 1G64A 2YOHA 2W2TA 3UANA 4H9GA 5TB5A 3RWOA 3P26A 4TT3D 1F6BA 4KLNA 3ZS8A 1P9RA 1SXJB 3M0EA 1DAEA 1QHSA 4Q03A 1E99A 1UADA 1DO0A 2B8TA 2FOLA 3AUYA 4QKQA 2HLDD 4US2R 1LVGA 1E9CA 2P65A 1WP9A 1YR6A 2Q3FA 1JPJA 2A5FA 3WBJA 3LXXA 4EJSA 4OI1A 1N6NA 4M1TA 3QBTA 4TMXA 2WPDA 3ZZUA 3NG1A 3P4YA 3REGA 3T5DA 2WIAA 4BECA 2WV9A 1SHKA 2OV2A 5KHOC 3PJRA 4B2PA 1KMHA 4Q5IA 2WAYA 5TMPA 1KI8A 1U98A 3EW9A 1WF3A 2XSZA 4DB4A 2NTYC 4PC2A 1U8AA 4AKEA 3AQ4A 4DCNA 2GJSA 3KFXA 2FFQA 2ZR9A 4PHFA 1BYUA 1LW7A 1GITA 4GSYA 1JQJC 2CEAA 2EFGA 2LCFA 3LVRE 4IOKA 5DYIA 1KK2A 4W5JA 3QF7A 4LV8B 4MGIR 4AIIA 5L8VA 2F1HA 1JXOA 1DAHA 1VTKA 1E2EA 4KFSA 4EKDA 3U44A 5FOSA 4YMTA 1V43A 4O25A 4MDFA 4WIAA 4DZZA 2G3YA 1BMFD 1VIAA 4AD8A 1ZU4A 4MKGA 3X1ZA 4TQ9A 2CNWA 1MO6A 2WHXA 3QKTA 3NIBA 2BBTA 3LBHA 4W5WA 3ZVMA 3GJXC 1AZTA 3CPHA 1Z63A 1YZUA 2J7PD 1G3UA 3RRNA 2IYWA 2NZ8A 1E2KA 5EXXA 2JATA 4FCTA 3DHWC 2QPOA 3AVTA 2V54A 4YC7A 3UWKA 3EAQA 2D74A 4G5GA 5BN5A 4C0BA 1TTTA 4JBYA 2P6NA 1GL7A 1SHZA 2F55A 5E4FA 1OLOA 4EPYA 2GJ9A 3FMFA 2W0SA 3QPVA 1AGPA 4ZDWA 2O8BA 5CLLA 4A0HA 4LHWA 1GKIA 3I72A 2R6GA 2QAGA 2VHQA 4KFUA 3EIHA 1DG3A 2AXNA 2GEDA 5G53C 5JEDA 4ARZA 5JS7A 1Z5ZA 2X8AA 5CM9C 1IHUA 4DIEA 2F6RA 3DO6A 5DE3A 4WAUA 1RRCA 4QBFA 1R0XA 4DLRA 3RABA 3AF3A 4GOKA 3WXMA 2BWJA 5GJBA 2ZYVX 1DEKA 2QQ0A 5KPJA 5KSZA 3QEJA 4PTLA 3ZYCA 1PLKA 1E2PA 3CKLA 4EIWA 1ZM4A 1KO1A 3EZFA 2CVFA 2IXGA 2ZRLA 1QHIA 2QBYA 1UDXA 1YE8A 2RGGA 1GFIA 1LTQA 2BKEA 5AR1A 1B23P 1KOFA 2JJ1A 3DZ8A 1W0JD 5L3QA 1QRAA 1OPXA 3LRPA 3L2OB 1R2QA 1SVSA 4PQFA 1KK1A 2W6IA 3NC1C 1G7SA 2GVZC 2QT0A 1KMHB 1E2DA 2ONKA 3EC1A 2GF0A 1YZGA 4EPWA 1XTJA 1DAIA 3Q5EA 4UXIA 3WNBA 3K09A 2JLXA 1NRJB 2GNOA 1NMYA 1NKTA 2QENA 2X1VA 4IOLA 5DH9A 3KXLA 1MR3F 1JPNA 1KK3A 1NI3A 1N6KA 1D2EA 4QC2A 3BH0A 5FBLB 1Q44A 4BFVA 1G8YA 4LYHA 3ZD7A 1MRSA 4KFTA 2HYDA 2R65A 1ZM3A 4UKDA 5DI9A 1FW6A 2J0VA 3EG5A 3GJ6A 4CEHB 2JJ2D 2RGNA 2FWRA 1ZAKA 1W0KA 4D80A 4QJ5A 3GLGB 1KI7A 2WOOA 5CM8B 3OEED 4L9SA 5F9HA 2Q6TA 1E2QA 4ZCMA 4ZIRB 3UXMA 1VYUA 2XXAA 4JT4A 4B76A 1ZUNB 2IUSA 1G4AE 4A8JA 1SULA 2R2AA 2NO6A 3G5UA 3ICQB 4DLVA 1XTSA 2ZAOA 2WMOB 1T3HA 1JALA 3NVAA 4MYUA 2RKOA 3M4YA 3NBFA 1M7GA 4CIDA 3QKUA 3GFTA 4UJ3A 2PBRA 1ZW6A 4PPNA 2AKYA 2D62A 2N46A 4B3DA 1DBSA 1OXVA 3OFND 1SVKA 1CIPA 4D82A 3KJEA 2E1RA 1FTSA 1XXHA 2FV8A 4YDSA 4DLTA 4KJZA 4LJ4A 2FE4A 5AJZA 1KI1A 2ZVQX 2PEZA 1E2NA 4AYTA 1E1QA 2O0KA 2H5EA 3A58B 4F4CA 1IN8A 3IUYA 4NTZA 3SEAA 1KI6B 4RD3A 1N5LA 1U94A 5AJWA 3PENA 1P60A 5DSZA 1DG1G 1HEIA 1R4AA 5CDFE 3OIUA 4C0KA 4LJ5A 4HDQB 4HZIA 4KBFA 3RS0A 3VR6A 1V5WA 4AURA 1CBUA 5A0FA 4TYNA 1QHYA 3EA5A 5D3MB 4TL9A 4C0AC 5JJIA 4GZLA 3H0KA 5JSZA 1XJQA 4IDHA 4NHOA 2RGAA 1R5BA 4DLUA 2ZE8A 2J87A 3EIEA 4V0OA 5K8LA 2QY9A 2J0UA 4LBWA 2EYUA 3D6TB 3SFVA 3AUXA 4LYFA 3ZQJA 2ERYA 2MSCB 3CR7A 3HR8A 3IHLA 1L2TA 3X2SA 2WWWA 4BZQA 4Z51A 3A1WA 4N0DA 1BKDR 1UF9A 4DT1A 5EXSA 3F5FA 5CITA 1TL7C 2X19A 5JI3E 2GJAA 5DI3B 2B7CA 3QUSA 4MUBA 5BXQC 3NH6A 1Z0DA 4PZLA 2BCJQ 1VCNA 4HAUA 4RZXA 4EPTA 4JLOA 4KXFB 1WB9A 1EWQA 4PPQA 4JJZA 3GFOA 2GZHA 1QDEA 4XTCS 1F2UA 3X1DA 1XX6A 3GLFB 4IDNA 4WZBE 4TLBA 1RYHA 1XWIA 3OHMA 3RVBA 4DSTA 1Z0KA 2SHKA 5FI0B 3AKDA 4C30A 1YKSA 3AF0A 2PCLA 3LA6A 3CH4B 4HLQB 2G6BA 4TSFD 3V9PA 4V0NA 2VTKA 2ZROA 3B7GA 4YMSA 1H8HA 1N5KA 3LW7A 4BASA 1VPLA 1KI4A 1T5LA 4HZUA 3U5ZB 4IVRA 2CBZA 3DM5A 1DPFA 1EFHA 1GNRA 3LD9A 1OHHD 3LV8A 3PV0A 3QENA 4XVQA 4CYMA 3U3MA 3I62A 4Q1FA 3KUCA 4B35A 1EG7A 1PV4A 2AHOA 3SJZA 4A36A 1UJ2A 2I1VB 4V0ME 4Q7MB 4HB4A 3AVVA 4P3YA 2EFCB 3FHTA 1Z6YA 1M7BA 3LW8A 4PC1A 2FG5A 1Z3IX 3NXSA 4QM6A 1KY3A 2ZI7A 5BN3A 2QP4A 3W3ZB 3THWB 1E94E 1OIXA 1G8HA 2PZEA 4GL2A 4FIDA 3HP1A 5EZ6B 1E9BA 5FFMA 3THXA 3WMEA 4X8MA 1U0JA 2PX3A 3U3JA 1NIJA 3FMIA 5DN6D 1BS1A 1II9A 3B9QA 1CU1A 1D5CA 421PA 2FJUA 2WJJA 3C5CA 1E2GA 1VHTA 4PX9A 4QG7A 4RD6A 2BDTA 3I8XA 2WJHA 4B47A 1QG2A 2ZI5A 4HUQB 4F93B 4DIDA 2WIBA 2J0UB 3IO5A 5SZKB 4QBIA 3Q7QA 1GP2A 4E22A 3MWJA 1CR1A 2AD5A 1RYFA 4JL5A 1ZC4A 1KYIA 3CNOA 2QTHA 3M6AA 1HE8B 2ATVA 1YRBA 2CE2X 3CX8A 4I99A 5FUXA 3LLMA 4LYAA 4DT1B 1CJVC 2ZUBA 4Q4LA 2J5XA 2ZR7A 5DNYB 4KSBA 2IX3A 3J81k 3P20A 1LF5A 4NPHA 2GZDA 4QHYA 3SNHA 3RRZA 4TLEA 1XZQA 2NZJA 2G77B 5JWOA 5EQTA 2IYVA 1F2UB 2IT1A 4GOJA 1ZCBA 5FH9A 2DB3A 3AF2A 2VHUA 1NIPA 4C3ZA 5LDDC 3TK1A 2GXAA 1WDTA 3SBEA 2FU5C 1E4YA 3U2QA 1CRPA 2YOGA 3BK7A 1OT3A 2O8CA 4Q4AA 4E03A 1LS1A 3VR2A 1J8MF 1GKYA 1XBTA 2WWGA 5HR5A 3KDSE 2QGNA 1E1RA 3R9IA 1LB1B 1JECA 3RC3A 1AQYA 2PZFA 2YWHA 3CB4A 4B44A 4DRZA 1G16A 4HZUB 4DSUA 2NO9A 4H1VA 3BOSA 1OIVA 3LY5A 4G3XA 1LFDB 5C46F 2ZRHA 2G88A 4PQRA 2G1KA 4KCGA 2YHSA 3ZGXA 1RPZA 1U81A 5F2EA 2IS2A 5AK0A 4P31A 1FUUA 1P6XA 2C95A 4BZXA 1KJYA 3GQBA 2OSBA 4URUR 2XOKD 2CK3A 1K6MA 1KK0A 2GA8A 2Q9AA 1RFLA 2Y8EA 4OL0A 1D2MA 4WZ6A 3CZQA 3TIFA 2HLDA 1G17A 1SKYE 3KUDA 4K81B 4ZCLA 3R8CA 4DLXA 4OQXA 4NMMA 4P4SB 2PL3A 1TU4A 2O0HA 2EFHB 1E9SA 3TQFA 2V9PA 5FBRB 4BFWA 5A4JA 5IDVA 2ZYWX 4OHWA 4C4PA 4URXR 4S35A 2ZRFA 3C15C 3SOPA 3TSOA 1GNPA 2C2HA 1XFAA 2RH5A 4JLMA 4BRWA 3IPXA 4J0QA 4P4TA 2VHJA 1L4YA 1HQYE 4L15A 3LLUA 4EQ6A 1LF0A 2OO7A 4LX0A 4PZYA 2JLRA 2ZE5A 1OH7A 5B58C 5EE1A 3WRYC 3ZS9A 2OLKA 2O8DA 1XD2A 5JWRA 1CR2A 1JQLB 1G291 3AP2A 3N2EA 4HLUC 4ESHA 3C5HA 4D0NA 2NPIA 3VX3A 3QNUA 1E9FA 1O87A 2REXB 1NVWQ 1U99A 4OI0A 3ADDA 3U4QA 1FUKA 2OT3B 1PLLA 1AJEA 2H7VA 3AGQA 3I1FA 1W4CA 5CK4A 3ZLJA 1G3RA 4LRWA 2G0TA 2GTPA 2HT6A 3AKEA 3DL0A 2LWIA 1Q3HA 1BMFA 4G5RA 4BEBA 2JLZA 2YYZA 4Q4AB 1PUJA 4L16A 2O8CB 1KJZA 4GPTA 2W00A 1J70A 4LJ6A 4HAVA 1VDZA 2LKCA 5EUQB 5SZHB 2NO0A 1LY1A 2J7PA 2E87A 4LHVA 4LBYA 4C2TA 4MA4A 2IUTA 1RKBA 1JJ7A 2PJZA 1YQTA 1DS6A 1K5DA 4EPVA 1ZRHA 4HAZA 4OHVA 3DVLA 2W58A 1P62B 1SKYB 2AK2A 1XMSA 4DEYA 3QKSA 2C77A 3VHXA 4MITA 2IYUA 3K70C 3DKPA 3QXXA 5CK5A 1IXZA 1WBDA 2PX0A 2C9OA 3GEHA 3UIEA 1JBKA 1L7VC 4E5UA 2VPPA 5JMTA 1F3OA 3ZVLA 4DLWA 4B33A 1UDWA 3EARA 5GJVC 4DUGD 2HV8A 4ITRC 1TQ6A 2QMEA 4C0HA 1AN0A 1E2HA 1L8QA 1UBFA 3PR1A 2A3RA 1W5TA 2YWGA 4CZ2A 2FX3A 1ANKA 4LV6A 2XAUA 1KSGA 1RRGA 4F38A 4JYBA 1N0WA 5TARA 1VYTA 4JLDA 3ZIAD 4BFUA 1E2MA 1N6HA 2RGXA 5C18A 1KI2A 2WVJA 3I8SA 3T34A 4GP7A 3PFIA 4RD1A 5BYKA 5JS8A 2XTMA 4XVUA 1W0JA 2IL1A 2WKRA 4HLCA 3BB1A 1Z06A 4Q1EA 2R9VA 1N6IA 3BRWD 3TVTA 3W34A 5KU1A 2XITA 3BE4A 4ZKEA 4TLDA 2VEDA 3A1TA 4TTRA 2YWEA 2C04A 2EU8A 2OXRA 3QJYA 3WMGA 1XCGB 2O8DB 2ZJYA 4DXAA 2QM7A 3PUXA 4QM7A 3T1VA 5FTLA 3QSYA 1S2MA 4B43A 2BKUA 5FR1A 1Z47A 2IUUA 1N6LA 4V03A 5CJPA 4CW7A 2FPLA 3U4QB 4Q66C 2JLWA 1IQPA 1W49A 2JJ2A 4YXWD 2UKDA 3M1IA 1FZQA 5H70A 1GWNA 4ASUD 3OEEA 4ZDJA 4GRAA 3KTAA 2J45A 4B3GA 1UKEA 2FSIA 4RZ3A 3SJBA 1IN7A 1N6RA 4M9XA 4XSHA 3GPLA 4LY6A 1Z29A 2BEKA 4KI0A 4JIMA 3OE7A 1NLZA 2I1QA 1TF7A 1SVIA 4U5XA 1OFIA 4JVNA 4Q4HA 4HLDA 3VR3A 5GVSA 3TKLA 3MRSA 5CIWA 2D7CA 3X1YA 1VG9B 2ZRIA 1FTNA 1ZVQA 1TUIA 2RMKA 1XF9A 3CRW1 3ASYA 2EYQA 1F60A 1XJCA 2FPMA 2P6RA 3QY0A 4PAMA 1XPOA 4YMUA 2GXSA 4FXPA 3A37A 3CF2A 3OFNA 2QQEA 3QPUA 4Z8YA 4MQBA 1HYQA 2C98A 2F1RA 2HDNB 3A4MA 1UM8A 5SZJA 3L43A 2CJWA 2ZJBA 5H8WA 3PCRB 3P27A 3K0FA 1EFRD 4O0MA 2ZS7A 3B1ZA 3HDTA 1EXMA 2F1JA 2WWHA 4Q7KA 4HATA 1VG0B 2GXUA 5AWFC 3SR0A 3QI2A 2QPTA 4AYWA 1TX4B 5LPNA 4LPSA 1QZXA 5FBVB 1COWD 2O5VA 3K0AB 4R71A 1N2CE 1UEJA 1VHLA 2BHRA 1UKVY 1P7CA 4MYHA 2A5GA 4X8LA 1XJ0A 3G0HA 5DLQC 3TAHA 5B64A 3F8TA 3SYNA 1G6HA 4R98A 4V0KA 3SYLA 5JHGB 2QRZA 2Z4RA 4JVLA 5DIFA 1J7KA 1OYYA 2EQBA 2DFKB 4DDTA 4TWZA 4PC6A 3HPRA 3U3OA 1ZNZA 2V55B 4B3CA 2ZUDA 3CX7A 4AWXA 2GBLA 3ADKA 3IHWA 4B2LA 3BS4A 2XTNA 2YZ2A 1OYWA 3I5YA 3C41J 4GMDA 1YZLA 2AWNA 4ZI3A 2DHRA 2CCJA 1E98A 2P3SA 2HXSA 4YLGA 2CXXA 2OAQ1 1YRAA 4LBVA 3FGNA 5FOXA 3W8RA 1OH5A 2FFBA 2OBNA 3KTAB 3K70B 1KO7A 4P0TA 2YC2C 4U02A 1US8A 3MD0A 2G83A 2IXEA 1GUAA 2IYYA 3NTUA 5FOWA 1C1YA 3EZ9A 2RAPA 4M4SA 3MFYA 3KZ1E 1D9ZA 4Q4HB 1VCMA 4JKIA 4BQSA 4JLNA 4TSFA 5FOTA 2YVUA 3SFZA 4I1VA 2FNAA 1TNDA 1YR8A 3D31A 4MDEA 1NG9A 3CX6A 3TGPA 4N1AA 4IRUB 3TE6A 2MSEB 1CEEA 1OHHA 4CEHA 1N0UA 2GRJA 3Q5DA 3GLGA 2ZVPX 4UQOA 4DBLC 4D81A 4MGKR 2R6CA 1Q20A 1U90A 4KSCA 4B3XA 2WJVA 4ZIRA 2CJWB 2ZU0C 3N2IA 2A2ZA 4NP6A 3K0FB 3D3QA 5G3YA 4ERNA 2OCYC 2A7QA 2QTVB 3ZD6A 1NSTA 2ZITA 3MUFA 2WWFA 1F5NA 4NL4H 1IXRC 4PO8A 4Q21A 1TADA 3H86A 5J5CA 3GLGE 5CIQA 1TQ2A 1GRRA 5DN6A 2NO1A 2CHGA 4TTPA 2ERXA 4MYCA 4IDQA 1ZP6A 4FMBB 3LWNA 4KODA 5JZVA 2F9LA 2J0QA 2BEJA 4LC0A 2CDNA 5HZHA 1WMSA 1Z6GA 4A6PA 4URVR 3FOZA 4ZI2A 4DLZA 5KSYA 3U60B 3KXIA 2VH5R 4UNPA 2QP3A 3ZVNA 5FPTA 4KBGA 2OHFA 1JNYA 1KI6A 1NN1A 1XEXB 1ODFA 1NMXA 3VNUA 2JJ8A 4L8GA 2F9MA 2QMOA 4IXNA 4NYIR 2GJKA 3K9LA 3PXGA 1P2UA 2VYFA 4LZZA 2QP9X 3PEUA 1ZYUA 1FMJA 2Z0MA 5B57C 1AKYA 5D3MA 4NZYA 2IK8A 721PA 1TQ4A 1YU9A 3A4LA 3LVQE 4GMXA 2X2FA 4YQFA 1US8B 5IF9A 1EWRA 2XTZA 5JJKA 1ZNYA 1MO5A 1TEVA 3CW2A 3LQQA 3A8TA 4HDOB 4HB3A 1Z07A 4IW3B 4OK5A 4DCTA 2F3RA 4D4KA 1TF2A 1E79D 1W5SA 2J41A 2EFDB 1T0JB 3MSXA 3KKNA 1G9XA 3T5GA 4Z8XA 3K9HA 3UKDA 1Q3TA 1Q1EA 3DOEA 2VP9A 1IN4A 1R0YA 3NBYC 5DI3A 1HTWA 4ZCIA 2GZAA 2C5LA 1W7AA 1L4UA 2V4ZA 1GIAA 3FB4A 4QGGA 3K70D 1WA5A 1OFUX 3GLHE 4RD2A 3VU9B 4ZDIA 3GLFA 4R9UC 4Q19A 4UNQA 1W36C 3P4XA 5JEEA 521PA 2BBOA 5LBIA 3EZ6A 4Q1CA 1FL9A 1I4LD 2EWVA 1AZSC 1OJLA 2FSGA 2XOKA 3CONA 4WXRA 4A0FA 5EJEA 4AKGA 2GILA 3ETLA 4N0EA 1X8JA 4JLBA 4TLCA 1TEXA 1HURA 2MMCA 2ZRNA 4NYMQ 3IIMA 2JLSA 2MMGA 1TMKA 1S9HA 2V3CC 2XB2A 3R20A 1NLYA 3GLFE 4TZ0A 3FKQA 4JLJA 5DHAA 5TVKA 1EFCA 4RD4A 4W5HA 3CH5A 1MKYA 1RVDA 2WJIA 4M1OA 1KIMA 5CDFA 3RS2A 4D2IA 2W2VA 3FKSD 2IYQA 1H65A 2BJWA 1K8RA 4I1OA 3T1QA 2IF0A 5BN4A 2ZXUA 3SHFA 5IT5A 1CJKC 1E2JA 3CPEA 3B8HA 2OFOA 1KAGA 1MV5A 2NG1A 2JEOA 4TQAA 3FTQA 5HKKD 2KBEA 3SI7A 4LBZA 1CS4C 5H68A 4LJ8A 4QGAA 3THWA 5F9FA 4B74A 4C0LA 1HY3A 3AP3A 2QEQA 2HF9A 1U8YA 2WBLC 3K0CC 3ADBA 3OEHD 2QU8A 4FWTA 5K8TA 2D3WA 2P67A 3NEJA 1NLFA 3EX7C 1KSFX 3GJ0A 4MGZR 3BD9A 4URZR 2XJ9A 4HUQA 1WRBA 4Q9IA 2VSFA 2ODNA 4GFDA 4M0LA 4E09A 3K53A 1X3SA 5L3SB 4TYQA 4Q00A 1XPRA 1OXXK 2NOAA 4AG5A 3GLHB 4A2PA 1P75A 4IOMA 3SU8A 5JLJA 3GFPA 3U3KA 1QG4A 1KGDA 2GCPA 1IY1A 1E3MA 2BIFA 4PC3A 1P73A 2WWYA 5B2ZA 1AGRA 1OV4A 3EXAA 3LDAA 2H8KA 3QIAA 4JBWA 4KITB 2WJYA 1ZINA 2H18A 1AS3A 3TRFA 4R7ZA 1OIWA 2OESA 3QXSA 4GT1A 4HSEA 1G8FA 1ZM7A 4R2HA 3VX4A 2W2XA 4M1SA 1FOEB 2ZPTX 1W4RA 1DADA 2DFTA 2XNDD 1NY6A 2WICA 4JSYA 2IEZA 3AV0B 4JL8A 2EVWX 3CR8A 1S0UA 3EPHA 3TVDA 1W4BA 1I4DD 2Z6VA 4TMTA 4O3MA 3OIYA 4DDWA 4V0MA 2J9RA 4DUGA 5IHPA 2ZSDA 3KQHA 4CRWB 2QRNA 4IVQA 4BFXA 3LNCA 4GNKA 1E9DA 4HB0A 1GILA 5KNDA 5J4LA 5C4MA 2JLUA 4KV9A 5EUMA 2DCUA 5L3VA 1Z22A 4XD7D 4B6FA 3ZIAA 2C78A 4JZKA 1Y3AA 1YZNA 4JLPA 2JASA 3K0CA 1NJGA 1SVLA 3GCGA 2RB4A 2HUPA 2HT1A 2CHQA 4OBEA 3I92A 2N1BA 3QXJA 3OIVA 4LWZA 4M21A 4CGZA 3TSWA 4B75A 1UBEA 3R9WA 3VR1A 3AVXA 2FF7A 2B8WA 3LX8A 4PSVA 2Z83A 1CKEA 1FNMA 1TUEA 3KJHA 3ADCA 3WY9A 1NY5A 2Z4SA 4LI0A 5UKDA 4P4SA 1SQ5A 5AJVB 3W6OA 3ICEA 3H4MA 1T3SA 4BFYA 5C4GB 3ZJYA 2XZOA 5LB4A 4UJ5A 3RNLA 3FPAA 4YMVA 2R8RA 4KU4A 3SJAA 1R5OA 2JIZD 2ZSFA 4M9SA 1HUQA 2ZREA 4TYPA 1AQUA 3TSZA 3IO3A 1CR4A 1KHTA 1Q22A 4IHQA 4V0LA 4ASUA 2IEYA 4TL8A 4GZMA 3LBNA 5G40A 2KWIA 1D2NA 3SQWA 4BLOA 5AUQA 4IJMA 1Z6TA 2GEVA 2H57A 4XIGS 1VYVA 3CRMA 4TTQA 4XVRA 2ZM5A 3TR5A 2FSHA 1EX6A 3CF6R 3B78A 4OJQA 3RS4A 2G9NA 2RHMA 1N25A 3PUWA 3AVQA 2J0SA 1S9DA 4QNMA 2BC9A 1XTQA 1EGAA 1KO4A 4YONB 2IBMA 2VP6A 3HYRA 5E3HA 4EUNA 1UAAA 3CRQA 1MRNA 2OCAA 5FTJA 2QL6A 3BB4A 4QOSA 4U00A 3OIWA 4AKHA 4XWAA 2W6JD 3PEVA 3ZH9B 2ZS9A 2D7DA 1I2DA 2ZE6A 5B30A 3EPJA 3SN6A 4QGHA 4Q9HA 1NL3A 3UG6A 1Z08A 1PVOA 2ZS8A 2ZTSA 1GG2A 3NEYA 2QN6A 2NPFA 2ZJOA 2Q9BA 1EFRA 1KY2A 1Q21A 4Q9JA 2MSDB 4OYHA 5J4YA 4TZ6A 4NYJQ 1H8ED 2OCPA 4UXJA 4CEJA 2VO1A 2QMUA 1TAGA 1IJEA 1DAKA 2OZEA 3HJNA 3GP8A 3QOFA 4HUTA 2C8VA 4NBSA 1YR7A 3CO5A 2B92A 5FOVA 1COWA 1WQ1R 1Z0IA 4N3NA 1HQCA 3LH5A 3HR7A 1TF5A 1YVDA 2WJGA 2C03A 3NDPA 5JWHA 4LHXA 4Z1MD 2IYLD 1J90A 3I32A 4BZPA 3CZPA 1G41A 5DO9A 4LOAA 3OAAD 5AUOB 4Q48A 2W0MA 1FP6A 3Q9LA 4IXMA 2GVDC 2OILA 3NKVA 4TT3A 4LJAA 1CF4A 3QBVA 1RE0A 2FEMA 4GP6A 3ND9A 4D6PA 1CULC 3WYGA 1QHXA 2ZYTX 3D8BA 2J59A 3THOA 3S1AA 3RHFA 1ESMA 1PZNA 3W5IA 4CDGA 2YV5A 2ZRBA 2BOVA 1SZPA 4PXAA 3RAPR 5CB6A 2BBSA 3L8ZA 1KDPA 4ACBA 3X1XA 2IA5A 1C4OA 1SKQA 3C16C 4F7WA 1G18A 2H1LA 3FYHA 3I73A 1SVMA 2GAOA 1D9XA 1G20E 5FTNA 2DFNA 2V1UA 1CR0A 4TYYA 4EFNA 1NN5A 3O8BA 2BMEA 4OJKA 1E9AA 4PQYA 3AB3A 1BIFA 1NF3A 3REFA 2ZJAA 2DR3A 3NDBB 1WE2A 3RS5A 2XJ4A 5FL7D 4NU0A 3L0IB 1W4AA 4TN1A 4NCKA 2JA1A 4JVMA 2QPAA 1PJRA 2HYIC 4FI3C 4NDZA 3WBKA 2UVQA 3VKGA 4BLTA 4NYMR 2E9SA 3KB2A 4G1UC 5EXTA 2BJVA 3EASA 1ZUHA 1G5TA 2REOA 3SQXA 5GJCA 4UXHA 4B73A 2QAJA 2VIIA 1UEIA 2WKPA 4BFSA 4DSOA 1GM5A 2O8FB 2WSSD 4R2IA 1QBKC 3E1SA 4AC9A 5EE5B 1KDOA 3GEIA 5E7IA 5FPHA 4CEIA 1W44A 1UPTA 1E96A 2CMKA 4QHTA 4RY2A 1W36D 2DFLA 2ORIA 1Q1ZA 5SZIA 4XWKA 3RSLA 1G8PA 2OG2A 4P32A 3QVVA 4LYJA 4BFZA 4CEJB 3IGFA 2D4HA 5FTKA 2OAP1 2HCJB 2CCGA 2YJTD 1NN0A 4TMVA 2KJQA 3KKOA 1R10A 1OW3B 1Q1QA 2VF8A 3I4LA 5EP2A 4PAOA 3IEUA 4EDHA 1RRFA 3LBIA 2FSFA 1OXSC 2ZRAA 4RFVA 1OXTA 2JGNA 2RGBA 3KKMA 1VMAA 1XP8A 4M53A 3QKRB 3HU1A 4JBXA 3VMFA 3FHCB 4LGMA 4KFRA 3R8FA 1E2IA 2R44A 3IDQA 2WAXA 4Y0AA 5P21A 2B21A 5M04A 1R0ZA 4L4UA 4QBHA 4BLQA 3AH8A 2QTFA 2NO7A 1XCMA 1NBME 3S1AB 2GCNA 3ECCA 1GOTA 4US0R 5H1YA 4B71A 1E0JA 1N5IA 3MGCA 4C7OA 2H17A 2ZJ5A 3AF1A 2BVNA 1AS2A 3BC1A 4HLUA 1X8KA 3K0AA 5KSOA 2HEIA 1W2GA 1FMLA 5HE9A 1E32A 2O52A 3PG5A 4FMCB 4D0GA 2FFAA 4JS0A 1Z28A 4JLVA 2RGDA 2XNSA 2K5UA 5DISB 3Q3JB 4X8HA 3B9PA 1T3LA 3F0TA 1Z0AA 3TAUA 2AX4A 3PIRA 1F48A 1RW4A 2XZPA 2YOFA 3KB1A 5KNBA 4WW0A 4FW9A 2DBYA 3WP0A 4C0QC 3ND8A 1E79A 2JLVA 3V4RA 2A5YB 1AIPA 3C7KA 4LK2A 2ZI9A 3EC2A 1JAHA 5EE9A 4MYTA 3QG5A 1G3MA 3TR0A 2QM8A 4A2QA 5F98A 1JR3E 1P9WA 3WHLA 3U7EB 3CIOA 3KJGA 3T12A 4POAA 3ZZ0A 2NMVA 2FGKA 4AI6A 4HYYA 4S2EA 3C14C 2I4IA 4I4LA 5FBWB 4A4DA 1CLUA 3UMFA 4CEIB 4RJLA 4A0GA 1XPUA 2VQSA 2VHTA 1Y63A 2ATXA 2I3BA 3K0SA 1NKSA 3FVQA 4DHEA 4LV5B 1JEDA 2W83A 1NP6A 2Q9CA 3LQRA 4I81A 4ZKDA 2AXPA 2Q3MA 3SC3A 5L3RA 1KO8A 4M1YA 2QG6A 2CL0X 1DELA 1EK0A 2G1JA 4Q7JB 1ZUIA 3T15A 1KSHA 3W6NA 4DC9A 2IC5A 4MKHA 3BFKA 1MABB 1NVUQ 4IOJA 4JMPA 1XEFA 3E5HA 3FKSA 4RFSB 3AF4A 4TMWA 2WWIA 3UWOA 4KVGA 4Z54A 4EJSC 4RKFA 3KQKA 1XMVA 1OH6A 1E2LA 3VR4A 5ANRB 2YNMA 2ZRMA 4ABYA 3VAAA 1OF1A 4IDPA 5FBQB 3GMTA 5HKKA 3IIJA 4PANA 1ELOA 2PLRA 3PEYA 3AKCA 4C7OB 3FHOA 4EAQA 1HE1C 1NVXQ 5EXPA 2XGJA 1OKKD 2VSOA 3H1TA 3SBDA 1X8LA 3OEHA 4AKIA 3GJ8A 4LJ9A 2GKSA 2BV3A 4QNRA 1GDDA 3A4NA 4DDUA 1ONBA 3B2EA 3H2YA 1Q1BA 4IKEA 4PPGA 5JI2E 1E4VA 1NVVQ 2ZJ2A 3WYFA 4P33A 3BFXA 5KOYA 2VSXA 4CVNA 3T1TA 2GAAA 2P5TB 1A7JA 2ZRCA 2N42A 1UKZA 2GCOA 2JDID 4LUCA 5G3ZA 1GTVA 1B0UA 2VL7A 3UK6A 1XEXA 2VP2A 4EFMA 5FPYA 3GLIA 1VECA 3I5XA 5DYGA 2D06A 2ZR0A 4NYJR 3EWAA 4FCWA 4BUJA 1ZJ6A 2YWFA 5KO2A 4Q9LA 2CK3D 1KAOA 2XNDA 3MWKA 1AS0A 2DPXA 3RS7A 1G1MA 1KDRA 3DPUA 3IILA 3K8YA 4I1UA 4K46A 2QROA 1KI3A 2BMJA 3QXCA 4HAYA 2ZYUX 4BRUA 5HTKA 1XTIA 1EFUA 1KO5A 3GLIE 2CCKA 2ZQ5A 1IN6A 3VFDA 2IS4A 3B6EA 4US1R 2QAGC 1Z6XA 5KDDA 1BO6A 4OKSA 1R8SA 1II0A 1N6PA 4Q7LA 2IYRA 4XD7A 4F4JA 2PT5A 2J7KA 1M7HA 4BEJA 4D0LB 1T8TA 4HAXA 1T0HB 2VP5A 1IY0A 3K0EA 1W1WA 4ACAA 2OEPA 3VU9A 1RIFA 2D2EA 2REBA 4JL6A 1CJUC 2ODBA 5E7MA 2OLJA 3HWSA 1IN5A 2OUKA 3RRYA 1YJ5A 2CL7X 1S3SA 4XTRA 3CNNA 4C0JA 2QZ4A 3Q72A 2GDJA 4EPXA 1NMZA 2GHIA 4KYUA 5IK2D 2QMHA 3R7WB 3RDPA 2C9YA 1VG1A 4MRPA 4DLYA 1F2TA 1DAGA 2QE7D 5J4VA 3O47A 2VBCA 3K09C 1NBMD 2WZQA 5DHFA 5CYPA 2KI5A 5JRZA 1NN3A 2RCNA 2IXFA 3Q7PA 3FFAA 2JIZA 3BH7A 4RCZA 3QG1A 2ONJA 3JVUA 1VCIA 4FMDF 4FINA 3RRMA 3BERA 4XWOA 3P1JA 2DWOA 1RZ3A 2QGZA 5TY0A 4LSGA 3DDCA 1LNZA 4M22A 3SS8A 3B60A 1ESNA 2GCOB 3VR5A 5AUPB 2J1LA 2FDCA 1XTKA 3U7FB 1JJVA 2RGNC 1G4UR 2V7QD 1E0AA 4RVCA 1JR6A 1ZMXA 2ECKA 3B1YA 3C4JA 3UMSA 2GF9A 1KZGB 221PA 5KDOA 3GLIB 3U7HB 1ZIOA 4PHHA 3B1WA 3HU3A 4FMDB 5KNCA 3IBGA 2JLYA 4BPBA 2DWQA 1GL6A 3L82B 5J4KA 3D7MA 5GADl 2ZE7A 1N5JA 2IWHA 4A8JC 1X1RA 3LAWA 3GJ4A 3T1OA 1A2KC 1MO3A 2Z5FA 1ZD9A 1Z2AA 3IPYA 2YKGA 1S8FA 3EIQA 2RGCA 4C9BA 1XEWX 2PLFA 2XB4A 2W6JA 4LCBA 1OE0A 5JCPA 1M1YE 4M1MA 2ASEA 4M8NE 1JR3D 1QHNA 1VIYA 4AYXA 3TW4A 4QL3A 4ZDKA 2JCSA 4GI7A 3T06B 4A9AA 3ZQ6A 4V02A 2C96A 4OQFA 3HPQA 4EJSB 621PA 1YZKA 5JFGA 5L3SA 4AY2A 1U0HC 3MJRA 5FUVA 3WNDA 5HE8A 1S3GA 3U7GA 3GLHA 3TUJC 2ODWA 4K8OA 2QUZA 1H8EA 1TQDA 1XCPA 3B5JA 3HU2A 3AVWA 3U61B 3MMPA 4BFTA 3FWYA 1U9IC 2IF2A 4BE7B 1R7RA 1E0SA 1ZM9A 4OHZA 1IOZA 1FQJA 3UATA 1HA3A 2Q3HA 1P5ZB 4BWYA 1EX7A 4NCJA 1KNXA 2GK7A 1Z83A 1QVRA 2A5JA 1EESA 4Z1MA 2RGEA 1SXJD 3MAAC 4QGFA 2ZETA 5CLQA 4PHTA 2VHCA 3AEZA 4A82A 1FQKA 2FH5B 3OAAA 2IYXA 2QSZA 3CWZA 1I2MA 1Z8FA 4KHZA 5TXGA 3VHLB 2FPKA 3UMRA 4D4LA 1IAQA 3DEFA 1G7CA 2V6JA 3K1JA 4PPFA 3NHAA 2F7SA 4GBMA 3R9XA 2OBLA 4YMWA 5AUNB 5FI1B 1T6NA 3FFBA 2FZ4A 2V8OA 3U44B 3LFUA 1XD9A 6Q21A 5LD2C 1XZPA 1F2TB 1MO4A 1T9HA 3BFVA 3VKWA 5K8IA 8OHMA 2PH1A 1KMQA 2J3EA 3Q85A 3SYKA 2P6UA 1RC8A 3AVUA 1WXQA 3WRXC 5AJYA 1S4QA 4URYR 3W5JA 1T8UA 4CF7A 3NBZC 1SGWA 4D4JA 3IIKA 4OHYA 4XSGA 4TQUS 1YZQA 3OF5A 4XH9B 3FDIA 4BGDA 3BWDD 5FPKA 2IYSA 3OE7D 3JZMA 1K5GA 4WVFA 3MWLA 4OQMA 3AKYA 3BBPA 3F3YA 1A4RA 3L0OA 3OZXA 4DKXA 3CM0A 2OFXA 3AVOA 4NE2A 4II7A 3AVYA 3PEWA 2P2LA 1E6CA 1S1MA 3KFVA 1FP7A 4HAWA 2ZRKA 1U8ZA 1M8PA 3C8UA 3SHWA 3T61A 2O8BB 2DYKA 4HI0E 2NQ2C 5FL7A 2QAGB 2A78A 1E0KA 3B85A 4MRNA 4EFLA 4LPKA 4ARZB 3O8CA 1T4GA 1U9IA 3BXZA 4JLKA 1HT1E 1XB2A 4NKRA 4IVPA 4QJ4A 4DLSA 1ZNXA 4DCVA 1FX0A 2AFHE 3IBYA 3V4FA 3U6BA 2R6FA 2VRWA 3IQWA 2WSSA 2EWWA 3PITA 2DY1A 4FWIB 3DKVA 3AGPA 1OB5A 3GJ7A 1E9RA 2F3TA 3K9NA 2EFEB 3PUZA 2FN4A 5JBQA 1P4SA 3WMFA 1XXHE 3TNFA 3LX5A 3IEVA 3BH6A 4DVGA 2QBYB 1M2OB 2B6HA 4NCHA 3B82A 5L3QB 1CXZA 1J8YF 2BM0A 3ASZA 3HYTA 4JKYA 4O2RA 4PC7A 4RD0A 3O8RA 4OK3A 4RKEA 1G21E 5G41A 4AK9A 2B7BA 4Q4JA 4WA7A 3SE0A 4RZ2A 5KTYA 1SVWA 3LXRA 3VQTA 1Q57A 4PSAA 1HT2E 2IS1A 1W2HA 2ZU6A 4O2LA 2ZRJA 2ZUCA 1PUIA 2PZGA 3K9GA 1OXUA 4M9ZA 3KQLA 2AR7A 2VP4A 2IWRA 3TJZA 3CLVA 1CTQA 3GEEA 2WPDD 3CF0A 1I4TD 3QF4A 4JT2A 5HPYB 2OFWA 1NVVR 3NHBA 1DOAA 3CRRA 3RSOA 1FNNA 2WSMA 1QHGA 2C99A 4FN5A 4JJKA 2WKQA 5BW8A 1HH4A 1P2TA 1DAMA 1AM4D 3N70A 1VCOA 4TLAA 3TQCA 4UNRA 3AM1A 3WYAA 2JAQA 1XNJA 3PUVA 4Q1BA 1N6OA 2EW1A 2XXAB 1XTRA 4G5OA 1UBGA 2CHVA 1NG1A 1M6NA 3DMDA 1GSIA 1QVAA 4A8JB 4IDOA 3VNVA 2XSZD 2J46A 2CL6X 5FOUA 4HDCA 2CVHA 1OSNA 5JRJA 2YC4C 821PA 3PQCA 5J4HA 1KNQA 4AG6A 4ILEA
chains in the Genus database with same CATH superfamily
2W11A 5ITVA 3W2EA 1DRVA 2IHZA 5KSPA 2IH2A 3RVPA 4PO1A 3TLKA 1ITZA 4R51A 5CVCA 1CJMA 2VP0A 2WHPA 3KQPA 1JI0A 3H16A 1PQ4A 3RWMB 3S40A 4DGSA 1MVOA 2IHUA 3LUJA 2PMDA 2REQB 4EVRA 5U4XA 4HGYA 3KEGA 2ZAGA 1JXQA 4W9MC 4ZQBA 2PF4E 4O29A 3OBIA 4NOLA 1ZCAA 1ZGGA 3EJWA 1YZ3A 5ALRA 1ZD8A 3HHEA 3KK0A 4ZO4A 3A1DA 4IHJB 1KFKB 1SCIA 3M5CA 1TJPB 4DIMA 1G5PA 5HKOA 3TOLA 3MOSA 4LHZA 2GK3A 3OESA 4G37A 5JZOA 1ILEA 1M1ZA 3SYRA 2CB0A 3OOYA 5LLDA 5E4JA 2RD9A 4HPWA 4PCUA 2FN7A 1WBBA 4ZVUA 1A9PA 2DBVO 3D59A 4IGKA 3JWPA 4XQEA 4N65A 1ADJA 4J03A 1WR8A 1TD1A 4CR6A 5AI6A 1Z12A 3DLHA 1TC2A 1I6LA 4WV3A 2BEWB 3GH1A 1L7OA 1IUOA 2V97A 3BZWA 3G5MA 1RJ9A 1OFTA 4ALKA 1PW7A 3BTVA 3EULA 1GL3A 4MRSA 2Y93A 3IESA 5IAKA 3SZMA 4U6QA 3GCXA 2ZANA 2HRBA 3G8AA 1GRQA 3HUFA 5FWYB 2D2FA 1U0SY 4OJTA 2RHCA 3KYJA 3GFQA 4KLZA 3JARB 121PA 3LPAA 2JZNA 3SJUA 3LQYA 3C3JA 1Y1PA 4ENPA 2QI9C 3HBMA 4I7EA 1U2DA 4ZPXA 3IA2A 1SO8A 3IQEA 1JLMA 5CGZA 1X86B 4RK1A 2O9JA 1VMIA 4O2BF 4JITA 1LV7A 4GD3Q 4E7ZA 1MHPA 3HWX1 1II8B 1R15A 2AF4C 2ZI4A 5HSGA 4Q18A 3K3PA 3UJCA 4EQ6B 3Q1LA 4TSRA 4X8OA 2ZIXB 3EZGA 5B7QA 2ZQZA 4M55A 2GM5A 2UZ3A 1BOFA 2H5IA 4EVIA 4G5SA 2BR3A 4HS9A 4Z9HA 1SXJE 4INPA 5IJAA 1YFLA 2GBCA 4TV9B 2Z08A 2L17A 3PFHA 1R8QA 2KC3A 2C61A 3KKZA 5CYGA 4KEAA 3L0YA 1PWXA 5BW6B 3B6JA 2P9YA 2VYND 3W8NA 4CQJA 5J2UA 2YCBA 4L78A 1FVFA 2ODEA 1CC1S 5J59A 5JECA 4ZHQF 2AYXA 1IJKA 1K9SA 1IG3A 1MQAA 2F64A 4DWJA 2P5UA 4P2GA 5LQNA 1DWOA 4DA6A 4RF4A 2X2EA 1E1MA 3NBXX 1KDTA 5M2QA 3GLVA 3PGMA 3EIXA 9MHTA 2F62A 5BUOA 3ITDA 1W59A 2XVAA 1YFJA 2ZDHA 3AUYA 3RUHA 3TOZA 1TTPB 1N6NA 2UVDA 4OQPA 3ZY3A 4AZWA 4KBLA 3HGMA 1IW7F 3W8FA 4RHYA 2IYEA 9LDBA 4Q5IA 3H1BA 1V1RA 2GM9A 1QF7A 1K8QA 4J07A 3GY0A 4J7XA 3G0DA 3H8VA 4WIAA 2R7TA 1A1SA 4LVCA 3V1LA 4MKGA 3UZUA 4QAJA 2WHXA 2CZCA 2BZ1A 3LBHA 3WGMA 4FM9A 4OSOA 4FCTA 1VKZA 3ZW8A 1PFYA 4G5GA 5ES3A 4RTKA 2F55A 3H4TA 1H5NA 3IKLA 2GEDA 3WB0A 4QBFA 4W99A 1H94A 3C6YA 4WACA 1KMMA 5KSZA 4LZNA 1RWXA 1C9MA 1E20A 4D9IA 1M2OA 2PRSA 4ARVA 4F1KA 2CF5A 3IAEA 3EMDA 1ULAA 2GVZC 4H08A 3UHOA 1YZGA 3GEBA 2X0IA 3K09A 3HKEA 1QRUA 1NMYA 2JL1A 4BFVA 4MR7A 4W82A 3GJ6A 1BE6A 2JGDA 2PH7A 2DERA 4CCYB 3WLMA 2CWDA 2XXAA 1AHIA 2NWQA 4PQEA 2IUSA 4Q4CA 3R7CA 3KAQA 3CNEA 3UBMA 2R11A 3IVGA 3PLAE 2WKSA 1D03A 2O2DA 4Y6QA 1GSHA 3BWMA 3C1OA 3C7TA 2DKNA 3EZNA 2PU5A 1FTSA 1RWKA 3NTXA 3O95A 1E2NA 4O2AF 1J97A 2KYRA 5DOZA 1DG1G 5JCJA 3OCZA 2AOXA 5BNWA 4LYGA 5DCYA 4TYNA 4OXXA 2VPQA 2XMBA 1CUUA 1SYQA 5IJ9B 3PNMA 1XRPA 4TUYB 3HVJA 3AMVA 1BKDR 1UF9A 1D0VA 4H7DA 5EXSA 1Y1SA 3QYJA 4MUBA 3HJTA 1MQ8B 1VCNA 1KZ4A 3HEBA 3U4HA 1WB9A 3SHTA 4G0HA 2HI0A 1F2UA 1YH3A 4UTZA 2MYNA 4EHPA 3U9MA 2AG1A 2R1TB 1V1MA 1J8DA 1A0BA 3EOZA 4UATA 2HO5A 3L1UA 4D56A 1RXEA 3QENA 3I62A 1U3CA 2AHOA 3FNGA 2I1VB 4DMFA 5AKEA 1SURA 5K0TA 4CS8C 3FWHA 5BSVA 3AVVA 2B20A 2FR1A 2NW6A 2DGJA 2HWWA 2FG5A 1Y1LA 4KBYA 3V1KA 2H6EA 2QNBA 4KPYA 5EZ6B 3AWIA 3VV2A 3WMEA 1CU1A 2D8MA 5COGA 3OP1A 1T2VA 1QG2A 5D3ZA 3PNOA 2NU9A 1XDWA 2BP7B 4NY3A 1GP2A 4X0EA 2AD5A 3IBFA 3CNOA 3CLSD 4WZBB 3DLPX 2OCXA 1NQTA 3JSAA 1ZH6A 2ZR7A 4QHYA 4BQFA 1RHQA 2VYQA 3RRZA 2NZJA 1Z5VA 1PFQA 3U8VA 1VJRA 3WK6A 1VKHA 2FP4B 2WUGA 2D6FA 2FU5C 2F3UA 1J8MF 1XBTA 2YZNA 4CM8B 1S2OA 1G16A 4G86A 2H7VC 1LFDB 2O50A 2GA9A 4MUYA 3WGKA 1UBHS 5DEIA 2YHSA 1FUUA 5AI4A 2C95A 3U5SA 1HFEL 4I1PA 3V9AA 1A96A 4YT2A 2XOKD 3RU9A 1H9AA 5HQTA 3HJGA 3R8CA 1TU4A 2Y3BA 5KVSA 2NACA 4URXR 3U17A 4EVSA 4D0RA 2GS9A 4BIIA 3ZK7A 4J0QA 2E37A 4QQRA 3S5UA 5IEBA 5EE1A 1DEAA 3M79A 1G2OA 1WO8A 4D9FA 4ESHA 3PDWA 3H0CA 3N8NA 4BGEA 1LZKA 1OTHA 2REXB 4PYJA 1RWOA 2R4QA 3DEAA 3I1FA 1W4CA 4BXOA 1EWKA 1U89A 3ZCSA 2YYZA 2VCEA 5FF9A 2EX1A 4BNLA 1LY1A 4LHVA 4MV9A 4AMVA 3TL6A 1VGVA 4OKNA 1RBQA 1NDHA 5TGZA 2WF7A 3E3MA 3N2GA 1LH0A 2MWQA 3QXXA 5CK5A 4L6AA 3W0LB 1QM5A 4E5UA 1F3OA 5I4CA 1TQ6A 1WV1A 3DYIA 4NI5A 1EP3B 4BFUA 4B3SB 1ZK3A 4NMWA 3PFIA 4NOJA 3IT1A 5KU1A 3TB4A 3LT2A 1W96A 3DBIA 2F3SA 4G5FA 4KAAA 3GUVA 2OXRA 2QM7A 1RR6A 3T1VA 1S3IA 3ZYZA 5K01A 1IZMA 4KIJA 2WFLA 2PO5A 1KFBB 2I5PO 2IUUA 4GLBA 1W49A 1F9EA 5A9RA 1T0UA 4ZDJA 5EIBC 3JQBC 4ZRNA 1KBOA 3OE7A 3ZTTA 2Q45A 1CWUA 3DXZA 1SVIA 2VJAA 3B3GA 3TKLA 1LDEA 4DYHA 1D6SA 1Z15A 3I5AA 3ASYA 3O3CA 1P4GA 3QY0A 1TK2A 2GXSA 2H3EA 1I0IA 3JQ6A 3D6NB 2Y1GA 3A4MA 4JROA 2ZS7A 3I2FA 3ZOZA 5JZ9A 1GG8A 2GLUA 1Q0TA 1JILA 5P8WA 1ISHA 2AJLI 3V7YA 1HLGA 4BNKA 5DSTA 1FBTA 4YAIA 1PJCA 1CCWA 2IV2X 4O4IB 3WQQA 4TWZA 1HC7A 3U3OA 1UL1X 5KQPA 1ULTA 2C7QA 2V58A 3IHWA 3BS4A 2YZ2A 1P1IA 3OTWA 5FBZA 2BR4A 1E98A 2P3SA 4F4HA 2NU6B 3D8SA 1XE3A 2JI4A 1UOEA 1VE1A 2IXEA 2IYYA 4F12A 3CLSC 4PCLA 2VXYA 5FOTA 2JHGA 2VRNA 3MA0A 2BHNA 1JVNA 3GT7A 4UHHA 1TMGE 5FEMA 2R6CA 1Q20A 4Z4EA 1D1AA 5DYNA 1WETA 3K0FB 4KE8A 1QCZA 3ZD6A 2YWRA 3JD0A 3IB6A 2RD2A 5EL0A 2LUOA 4YRNA 5F52A 4FMBB 3HNIA 3FJYA 3PI6A 4IP0A 5HZHA 1Z6GA 2B8JA 1QRDA 4N01A 1RWPA 5EGYA 2CLEB 1NRWA 2C8JA 3VYUB 1NN1A 3CNBA 2YR0A 3RUCA 4D43A 1XQ9A 2KHZA 2GUWA 4AP9A 3BE8A 3GL9A 3ZDBA 3EGEA 3QK7A 1K7EB 1US8B 4YECA 3CW2A 4C6RA 4EY6A 3T7RA 4D4KA 2I4OA 4PY2A 4W8KA 3MSXA 4ALNA 3UKDA 3GELA 4PTYA 2WG0A 4PRLA 4RD2A 5B3IA 2GI4A 4IGGA 3OZAA 1B73A 4X1IA 4XYBA 2FEPA 2MMGA 2PUDA 4GR5A 5KKCA 2RG1A 1ECLA 4M1OA 2HA2A 3FKSD 4O6YA 1K8RA 2UU9B 1BX3A 4FBLA 1E2JA 1FFSA 3A05A 5AQ1A 5G0VA 1GPBA 3AP3A 1OCOC 1O6GA 2QU8A 3EUWA 2EPNA 2P67A 4D9HA 4GFDA 1UZLA 2MWMA 1NYRA 4DBVO 5L3SB 1OXXK 3V46A 4ZEOA 3UK0A 2XBUA 1SCJA 2JKVA 4G84A 3MM4A 4ZARA 5G0TA 4WN9A 1U04A 2A92A 3O7WA 5F33A 3NMIA 4JL8A 2Z6VA 3P0HA 2J9RA 2PLNA 5DYWA 1N0IA 3D6UA 4LX8A 1JFVA 4QTTB 4URFA 2R03A 2VBFA 5HKAA 2C78A 1NJGA 5EGSA 3L8HA 2I66A 3I92A 3ZWAA 2GQ0A 1UBEA 4KAFA 3Q6IA 3HLTA 5KTRA 4EHBA 1T9GS 1WULS 2C2BA 5ETJA 4BPMA 5AW1A 1ZMTA 1QHFA 2Z3WA 3HL0A 5KC9A 2PSHA 3K5PA 2RHHA 5EKDA 5JYEA 2PKEA 1BGXT 1S9DA 1GDTA 3M15A 2I0FA 1SCUA 5E3HA 4MQUA 1AKTA 5BQ3A 4RNCA 2A5LA 5IWCA 1GG2A 2AOUB 1ORDA 4XB6B 3AESA 4OYHA 1VB3A 4MHOA 1CZRA 1C9DB 1H9GA 3EG9A 3ZV4A 1UMCA 3P2KA 3O39A 5MHTA 3I32A 2OR3A 1ZH0A 4C05A 2RJNA 1YL5A 3GWZA 3BD6A 2B0JA 2Q29A 4OHUA 4NOMA 2SECE 2W0MA 2IFTA 2NUBA 1SBCA 1RE0A 5E2IA 5GONF 4AW9A 2ZIVB 3FW1A 2IBSA 2QUAA 3SQOA 2BBSA 2H1LA 3FYHA 3KZVA 3NHYA 1H0KA 1CR0A 3RIYA 3HZZA 2VJOA 3DXJF 3T8YA 1RCFA 4KN5A 2ARKA 1FFCA 4OXYA 3I3OA 2HU5A 3RK0A 5DWVA 1DFHA 4JVMA 1WUIS 1C3XA 4FI3C 5TJ9A 3WNVA 5BVGB 2Q5OA 1UEIA 3RJ5A 2XMRA 5EE5B 2FK8A 3L79A 5FPHA 1LM3B 4QHTA 1TWGA 4KAJA 5SZIA 5KWIA 4BFZA 1H1LB 1QK4A 3ASVA 2YJTD 5IAAA 5K3FA 1T0BA 3VMMA 1GR0A 5HF8A 1TO1E 4Y1GA 2FSFA 4OEHA 5GOZA 3CEAA 1P81A 1QDLB 3EWIA 3ORSA 4GE3A 1XCMA 2F48A 5EJGA 2HD4A 4C7OA 3AF1A 4HLUA 5LUAA 1Y3DE 4UVIA 1FMLA 4M7WA 5HE9A 5JNVA 2AW5A 4CL0A 2K5UA 3Q3JB 2W2LA 1F48A 3ZQ4A 1VHQA 3C3PA 4R32A 4U2BA 3PQ7A 3TR6A 1KORA 4C7BA 3NMUF 2H4JA 1GS9A 1G3MA 3DUFB 3I45A 2XQVA 3IP8A 1L1EA 3L8DA 3GQVA 4UAGA 2CDQA 1BXGB 1Y63A 1ODIA 4MVJA 4YCNA 4Q7JB 4N4AA 1IWOA 2DUNA 1D4ZA 1NVUQ 1EK2A 4UQPA 3E5HA 4TMWA 1FRFS 3NM6B 4AY5A 3GORA 3RUDA 5DCWA 1MJGA 3IIJA 1UG7A 4CKXA 2YRWA 2YVKA 1X77A 4TT8A 2CT8A 3TWOA 4Y6SA 2DUJA 1GDDA 1ONBA 2J5QA 3OLZA 3EXEA 3WYFA 2WP0A 5FWAA 1T29A 1P33A 3OJLA 3UJDA 1I5NA 1QTIA 3TQOA 1VQ1A 4BUJA 3L6UA 3LFTA 2CK3D 1LI7A 3DWGA 4XLZA 2PT9A 3QXCA 1JWLA 3UUWA 5KYTA 3QYAA 1NBBA 1HSOA 4Q7LA 3KJZA 2WWVD 1WHSB 1KVTA 4HL6A 1FFYA 1W1WA 2G4VA 4JL6A 4DMGA 3G85A 3VA7A 3DONA 2W4MA 1GGFA 3I4UA 4EPXA 4D44A 3HCFA 4X7MA 4D4XA 4TV8F 1JU4A 1DAGA 3C85A 3PHLA 5J4VA 4GUAA 1UBTS 1ONSA 1Y80A 2KI5A 3TRIA 1NN3A 2JBAB 3VC2A 5JARA 1GAXA 3P1JA 2DWOA 5JYCA 4REMA 2X1MA 2YN0A 3VR5A 4P2BA 2C2MA 2HZBA 1Z5NA 1LDNA 1M83A 3ED5A 5B1DA 1T9DA 1OBCA 3SE7A 5IC4A 4GI1A 1EA5A 1P5RA 2H3HA 4N8EA 1SZCA 4C9BA 1SVUA 1S3GA 1MOSA 5AKKA 1Y4UA 1P5ZB 3W77A 5JAOA 4BVEA 3I0MA 2XMDA 4QGFA 1FQKA 3CWZA 3UT0A 2JGAA 2ZD9A 1XZMA 1BN7A 3NBQA 1B8PA 4JRZA 1POXA 1T8UA 4MIOA 3CN7A 4XH9B 4DMRA 3UT5B 1OX4A 1UINA 3WJ1A 5ITZB 3U1BA 3AHFA 1OC2A 4G9EA 1QOPB 3AVOA 4FFSA 5BUQA 3NHMA 1M1YB 4XX1A 4QYXA 1S1MA 2XRMA 1GPYA 3J7TA 3PNPA 1E1KA 4NZPA 4DV1B 4CG0A 1HETA 4EGFA 3FFTA 4ZT5A 3EFEA 1QLEC 1G21A 2WSSA 4W9RA 3PITA 4ENTA 3GZJA 4KJXA 1CQIB 4UZEA 2GHQA 1XXHE 5TT1A 4DVGA 3EFBA 4B4KA 1RJDA 3ID6C 4FZ5A 1F0YA 4XFKA 2G08A 5G41A 5KTYA 1LX6A 1Q57A 4GQBA 4QICA 4O2LA 4RHTA 1BTOA 4FEAA 3KQLA 3TJZA 1L0BA 4G25A 4Q9AA 1C14A 3UH1A 4XEUA 1DOAA 3AQBA 3U3ZA 1JIJA 1UBSB 4F0JA 3N2ZB 4GF5A 5JVEA 3TG2A 1KAMA 1EJ2A 1RKEA 1J99A 1E62A 1QQBA 1C7EA 5JVDF 3LWZA 4BJ1A 3C8ZA 3UCEA 5EJ4A 1BE0A 3DXYA 9ATCA 3G82C 3IQXA 4LJKA 4S05A 2H63A 2DSNA 2FLKA 1FSSA 4GYYA 4LXUA 2VJMA 4TN5A 1TJ3A 4RO0A 2YICA 3DDZX 1UBCA 4ZYYA 2VQEB 1C8LA 3P9KA 3AR4A 2WFAA 4DRJB 1P61B 3F5DA 3VKHA 4G36A 3G13A 2BGTA 3GCDA 4EL5A 1USUA 2RJOA 6REQA 4L95C 3CBQA 5KYXA 5EQJB 1PWEA 4UMDA 4L8YA 5A71A 1U2ZA 3P9QA 1Q12A 5HX7A 1JFFB 1CUXA 2CMHA 1CP2A 2DBRA 1X7DA 4YMHA 5FNVF 1ETHA 1P4HA 1K86A 3FBTA 2DH5A 2BM8A 4Q24A 2ZI6A 3ONWA 3RUIA 2ZM6B 4MP8A 2OD7A 1L7MA 1ULSA 3VPHA 1YA8A 1DARA 3FPGA 1IXSB 3B20A 2DUMA 3FAKA 5AK5A 1G8AA 4O1MA 4DZRA 2HQRA 4AX4A 1BR2A 3ENWA 1RM3A 2GWHA 3FE2A 2EKDA 3K8QA 1JHUA 2OE2A 4DDMA 1ZH8A 4I50B 1Z5OA 1G5IA 1HPLA 5LQUA 5D7BA 3EHEA 3A3KA 3G2KA 2DYSC 5AHRA 2FR8C 1GUBA 1QH0A 4JSRA 1MXHA 3QUBA 1JP7A 4KP7A 3LO5A 1W8IA 1F14A 5GV7A 4PO3X 4G0WA 3RJ9A 4R9NA 2HK9A 4EPRA 4ID3A 1HMPA 4CQMA 3OQJA 4I4TF 4D4GA 1PZGA 3VSBA 1QYIA 4GWLA 3ZIUA 2B7LA 1OFVA 5E9QA 4BNMA 1U8UA 2PRJA 3AVPA 3HTXA 1XD2B 5E0KB 2PX4A 3DFKA 3LMKA 1IONA 1V96A 3BMOB 4XPZA 1XU4A 3KXKA 4BKQA 4L74A 5IXYA 2PN1A 3VPDA 1I0LA 3KX2A 3MJSA 1STOA 3SVTA 2BMFA 5MN4A 1MOZA 1XA3A 2D5RB 1A7KA 2CLOB 4KIUA 2WM9B 4R31A 4TMZA 1YBAA 4BMCA 4CM1A 3IUBA 1PTJA 1XZEA 5TT0A 1CY1A 3EXIB 3IEIA 5EAIA 3GJRA 1T6UA 1KKLA 2XZLA 3H1GA 4MX8A 4TRRA 1WCV1 3ZJTA 4PBTA 1DTWB 3WLIA 1L4KA 1O3YA 1PR0A 1QLHA 4A3SA 2QRKA 4C4YA 1WS6A 1DJQA 2CLSA 2X7XA 1HZZC 4KPUB 2Y4NA 3ZTWA 1U2SA 4ALLA 3PGA1 1KJJA 2I2CA 4DWWA 1QV9A 3ZS8A 3BDVA 4LF5B 1E9CA 4HDRA 3F90A 1P7VA 3JVIA 2WPDA 2NPUA 4MINA 3DZIA 3T5DA 5JO9A 2IU4A 2ZT8A 1C8KA 4CIWA 4GC5A 1KRXA 3PIIA 1N1EA 4WQMA 4E51A 4D8WA 1U8AA 5DRYA 4R3NA 3LPMA 2QL7A 2CMDA 3N75A 3LVRE 4I9FA 3CUVA 3NP7A 1UEXC 1VIAA 2R25A 4A16A 3B0UX 2HMAA 3GDWA 2JEZA 3MMXA 6LDHA 5EXXA 2P9BA 2BKXA 1ECFA 1VL8A 4MUNA 4BKPA 1TTTA 5JD4A 2P6NA 2R97A 4BJ6C 4NARA 3X43A 3O10A 4I36A 5K3OA 3K5HA 4UDVA 1SAYA 4A0HA 4MSUA 4HNUA 3INRA 5AKIA 4L7QA 4YCDA 5CVTA 1Z82A 4HDNA 2PBFA 1DEKA 4E2XA 1XPJA 1QHIA 1GFIA 2Y3GA 4PLFA 1W88B 4GGMX 2FQWA 1XTJA 3K9FC 2GNOA 4OFXA 5HQ3A 2HMYB 3E1GA 1RPTA 1K2VN 5B4UA 4QC2A 3UWDA 5CEJA 1TIKA 3FSJX 2Q6TA 3N9IA 4Q1VA 4DMLA 4EJMA 4D5EA 1BEUB 2WILA 1G4AE 2NO6A 4LF9B 2FQXA 1ZCFA 3ICQB 1EGHA 1XTSA 2QD4A 2QRJA 1L5VA 2HF7A 3DOOA 2X3FA 3G23A 3GFTA 2PBRA 3IOCA 2N46A 3R5HA 1OXVA 1DNPA 1MAHA 1PFUA 4PX3A 4BMNA 2E1RA 3WLRA 1E1QA 5L0JA 3MB8A 3V4OA 2H9IA 3ZEAA 1N8TA 3M33A 1UJNA 3A1EA 2K7FA 4HZIA 5D3MB 2P6MA 4LCEA 4GZLA 3KV1A 5B1SA 2RGAA 3TTSA 4AL1A 4LYFA 2MSCB 4J32B 2I99A 5CBPB 2YDYA 1QH8B 2JIQA 5FEUA 1IBCA 3FCYA 3O1IC 5A6VA 1Z0DA 2EJTA 3VPFA 1R6DA 4NVRA 4W7HA 1QOQB 3ET4A 1O57A 1TAUA 8ADHA 4J1TC 1UJ4A 5KTPA 2HBZA 4OHRA 3KAPA 2QX4A 1DBWA 1CIJA 3NTVA 4BMZA 2YJNA 1G2IA 3DVSX 4F4FA 5HA5A 3HA7A 2P9HA 3NHKA 4A36A 1WD7A 2UVPB 3G0GA 1GZVA 1E5TA 1V2GA 3IHTA 1A7DA 2QP4A 3ADOA 4L2IB 3THXA 5IYZA 1MN6A 4QG7A 3W5DA 3Q7QA 4R3UC 5BSHA 5JSYA 1KJIA 2ATVA 3KZOA 1LFAA 1C1DB 2DT8A 5AKXA 1GJRA 1RABA 1XDDA 1IHYA 3TDMA 2YJ6A 2YRXA 1NJ2A 3GLRA 1IPFA 5LQAA 3IKVA 3HS3A 1NKVA 3VR2A 3UMYA 5IBRA 2YWHA 4PSDA 1IHOA 3LY5A 4GR9A 2O19A 2O1EA 4H7HA 3A9UA 1R4NA 3S2ZA 3DULA 4BZXA 4IVNA 5IH3A 3K05A 1K6MA 1N78A 2Q9AA 3VO9A 2HLDA 4ULWA 4P4SB 3BGDA 1P2BA 4MDYA 3OEOA 2NZVG 4R7TA 3LYAA 2BFWA 5JC8A 2Q1UA 4YAGA 1HKHA 4HVCA 3LLUA 3G89A 3ZDZB 1WPRA 3ZIDA 3N2EA 3NAMA 1DKLA 5DM60 1O87A 2UYOA 1TFKB 3DL0A 2LWIA 3V8EA 4A5SA 2XKBA 2A1UA 4H3VA 4DR2B 3NETA 1YQTA 2JGFA 3ROFA 3OCUA 2PS0A 2AK2A 5IKPA 4DEYA 1R5JA 2IYUA 4OX9B 3OX4A 4E4TA 1TRKA 2POCA 2VPWA 4QPDA 2DZDA 4HPJB 5FPPA 5K20A 5JMTA 2HU2A 5A4IS 3EDQA 4MB0A 1FB5A 4F60A 3SXJA 5TARA 1G4WR 2ZVJA 3RS9A 4EBBA 3L3BA 4O63O 4ESEA 3ZWCA 3RYHA 1U9ZA 2GK4A 1U3TA 2VDQB 1XCGB 4M36A 3OOJA 4QM7A 1E5VA 1M34A 5DU2A 1SRQA 3GGCA 5K4HA 1P0MA 4ZJUA 1FZQA 1HKUA 2YV4A 1VXOA 3ZEIA 2AC2A 3VR3A 1OFIA 1JDSA 3MRSA 1OWMA 1ZVQA 4R01A 3NHSA 1C9JA 1EHIA 4L6RA 3CF2A 5F3DA 2OOSA 5IT0A 3QPUA 2QXYA 3B1ZA 4QTXA 3LFHA 1KQPA 2BI8A 4UTNA 3EVZA 3K0AB 1Q0GA 1UKVY 3SYTA 4EO4A 3T7DA 2B83A 3NXKA 2EQBA 5EZSA 4ZLDA 3AEKA 2ZUDA 3POVA 1MMGA 2WMDA 3FA2A 3TZKA 2WSYB 1VHDA 3TOMA 3FGNA 3W8RA 4HYQA 5FJJA 2MDTA 1CGME 3FFXA 5C8ZA 2PXXA 4KQWA 4DNQA 1QO9A 3BMCA 4TSFA 1G55A 3RYFA 4ZAWA 3BUSA 4IRUB 2WUWE 3CAXA 4UQOA 3VI4B 1RWNA 4MAFA 2X7JA 1YDGA 4D7AA 7GPBA 2ZITA 5F7JA 3KKLA 4FNMA 4Q21A 3H86A 1TQ2A 3UGKA 1JX6A 3M3DA 2A4MA 2F9LA 1PCXA 3OE5A 2OHFA 3SHOA 2OV3A 1NTRA 2E2WA 2QMOA 2AG5A 3P4UA 4NZYA 1GZ7A 2QX9A 4H4CA 1EWRA 3ZSUA 3LQQA 2EFYA 5A2QA 3NWOA 3TOVA 1W5SA 2HQBA 1DRWA 3HB5X 2W93A 3KXDA 4KR6A 1O5OA 4IWXA 4B0PA 1PT6A 2VJBA 4YJ3F 3GLFA 3PRKE 3QVXA 2FN9A 4LFCB 5JP7A 1BCRA 4TLCA 3RD5A 5B58T 1ZFNA 1JLLA 5ICSA 2R8YA 4F2WA 3NCHA 2EX0A 2FSVC 1W0CA 1FU7A 5DGCA 1CJKC 5BSMA 1QCDA 3VR4D 5I8PA 5EZYA 4CIXA 5LQSA 1XQ6A 5HKKD 2ZSHA 1XVUA 4B74A 4UPVA 1AK9A 1WMFA 5J2TF 3CS3A 2D3WA 1DCTA 1FX1A 1ZN2A 3S3TA 1PK8A 1ODCA 1S2NA 5AC5A 4PBSA 1P73A 3LDAA 4WHMA 1GPNA 5A7GA 3EHNA 3VSDA 1WXGA 3VX4A 4A91A 4UNIA 1AGYA 5IHPA 5A9SB 3KYCA 2JLUA 1EVJA 4II3A 2VPIA 3DTTA 1JUDA 1NW3A 2QW0X 1YZNA 4W9NC 3O5AA 4FJ2A 5HUQA 3OFVA 2CHQA 3BRWA 3RIEA 3OC6A 1W19A 4KTTE 1NY5A 1SQ5A 4UBIA 4DQDA 3TDNA 4QELA 3ICCA 1OI3A 3OKFA 3GP3A 4F3NA 3LGSA 2RHMA 1RIIA 3OQ6A 5LIRA 4JP5A 4CM7A 1EG2A 4QRIA 5E3IA 5B7NA 4D6XA 2ZJOA 4F46A 1Q0QA 1Y89A 1XZBA 4FDUA 1SG0A 4P58A 2B61A 1DAKA 2EQAA 4HUTA 3WHNA 4G4SO 1CT9A 5JWHA 1ACJA 5CI9A 1J90A 2H59A 2VHWA 2O4CA 1WUJS 2GVDC 3CW9A 3V8VA 3SSOA 4AKSA 3RSZA 2SKCA 4E15A 4ZT2A 4JBGA 4PXAA 2FXIA 5HGXA 2J5KA 4ACBA 5JSQA 2PAFA 1WN0A 1QGUA 4D9GA 4PQYA 3R77A 1Z26A 3RS5A 3S44A 3FPBA 5AW4A 4QLBA 2L6GA 4EVQA 4NCKA 2DQ4A 3KWFA 2UVQA 1G2PA 3QXGA 3W2TA 4B73A 5ICEA 4AC9A 1DTEA 1B6RA 2DFLA 2A14A 5A3JA 4LYJA 3G59A 2CCGA 1YTLA 2RHOA 4BBZA 4EDHA 3VPSA 4F2DA 1ZK0A 1VMAA 4K9PA 4LGMA 2VDLB 3VOBA 3I2GA 4BNFA 2QTFA 1NBME 1Y42X 3D64A 3PQ6A 4K9LA 3MGCA 2XOXA 5B36A 2YLGA 4D0GA 3NU1A 2PKRA 3G8CA 3KQQA 1SQGA 1SCAA 2JLVA 3IRUA 1NUAA 3SXYA 1SQSA 1PJ4A 1OZHA 4LAFA 3SIWA 6YASA 1U63A 4RJLA 2VQSA 3K0SA 3KO8A 5CW1A 1CUFA 1NP6A 4ZKDA 2W6PA 4M1YA 1H9CA 2ZBPA 2WEKA 2IY7A 2Y0CA 4IOJA 1T2FA 3A7EA 2WDPA 3IVCA 3O1LA 4DL9A 1VIMA 4U6SA 3QI7A 4RFSB 1W29A 3UWOA 3RYLA 2J4DA 1H2XA 4KOEC 3VAZA 3U81A 2HV9A 3RKRA 3E48A 1K6IA 2DGDA 5ALFA 1KVUA 1T24A 4GPIB 1RTTA 3DMYA 4QNRA 2HTEA 3H2YA 4GWGA 1ML4A 1NVVQ 3FLBA 4XJSA 2C4VA 3OP4A 4GX0A 4UMFA 5JY6A 3HNRA 5DYGA 4MR8A 2Q2WA 4MLDA 4TLMB 4ZVVA 4OPMA 4Y30A 2C5EA 2R96A 3CUYA 4U5QA 3RS7A 1QWOA 3JASA 5AFSA 2I4MA 5HTKA 1XTIA 4B6SA 4FFBB 2EEPA 2BSAA 3PUIA 3VFDA 4NULA 1RM5A 3L7OA 3FY4A 1HXHA 3BILA 4F4JA 2GZ3A 1T0HB 2WZLA 4LK3A 4OX9Y 3VU9A 3PXCX 1ZQ1A 4B31A 1S3SA 5IW8A 4FB4A 1T8WA 13PKA 3L93A 3QEAZ 1YRLA 2HSBA 1VG1A 5K99A 2VYVD 2PD4A 4DVYP 4MUMA 2B6NA 4DR6B 5B2EA 4LSGA 3DBLB 1M1UA 2GCOB 1Y9ZA 2FDCA 3U7FB 1JJVA 2ZYSA 4IIJF 2X2OA 4D3FA 3DV9A 4X65B 3GLQA 3WIOA 5GADl 1J0BA 2YKGA 1PJ2A 2RGCA 1JR3D 4BVJA 2C96A 4AY2A 3PS9A 1BHSA 5CFOA 1Y5IA 1IZ7A 1N2BA 4BY9E 4DVZA 1MDBA 1QFZA 3QHQA 2UXBB 2HZ8A 2LDBA 3U8PA 5CX1A 1Z8FA 1QKIA 4I46A 2JCXA 1T9HA 4WKCA 1BX1A 4D4JA 4TQUS 1YZQA 2BE5F 1BW9B 3MWLA 2GAQA 1U11A 2FTKE 1JFTA 1JDJA 5ICFA 1AH2A 2VRCA 2CHFA 1ZL0A 3GJTA 1Y6DA 1IATA 3WRVA 2DYKA 4LOKA 1T6IA 4FMPA 4ICIA 2BFEA 2CXOA 3PGKA 3IQTA 3OTHA 2E3JA 2EWWA 4KO3S 4QXMA 3K9NA 2QTRA 5K5EA 3ZU5A 4W63A 4PXSA 4BNHA 1XMQB 3IJEB 2VWQA 3MTQA 3NRBA 5M34A 4Q16A 2GSDA 2FRXA 1IYZA 2AR7A 1YB2A 3EMBA 3RSOA 2C99A 2O3SA 4MR9B 2XKKA 4DYVA 4XYMA 2EW1A 5DB4A 4CX9A 3V1MA 2CHVA 3D4BA 4L5AA 4IDOA 4AUKA 1JVBA 5FOUA 2HK6A 1OCZC 4YN3A 2RJ3A 5BYJA 1Z37A 1PKXA 4KNVA 1P9NA 4ND7A 3AFIA 3IHKA 1MW9X 1JIVA 1A5AB 5FLYA 3BORA 3QXHA 1RLMA 3KOUA 1UIMA 3QV1A 3ZHVA 4BCBA 2R00A 2Z5VA 4F5DA 1S96A 1W36B 4Z7OB 2VHZA 3E2IA 1QHHA 5AM2A 3Q7LA 2QLMA 2WUEA 4GIBA 4QAQA 3N3AC 1XF1A 1JEEA 1OBVA 5LXTB 4Q4ZF 4ZMSA 4B3BA 5L0GA 1F20A 2INGX 4O0LA 2O14A 4EWLA 2R6DA 2CWWA 1P1BA 1TVCA 4S1WA 2F1IA 5D1NA 5ICGA 1NC3A 2C5BA 4EB3A 1A72A 3N07A 3TI9A 1D1TA 1XNHA 4LLEA 4DPLA 1W0KD 3M89A 2JHFA 3MG9A 2MYSA 4IIBA 3RQGA 4FZJA 1CEXA 3ZHCA 1ZGCA 2ZBFA 1FBNA 3AL2A 3A4IA 3ZG1A 3GLKA 2JI8A 4D6YA 2RGRA 4R1PA 1SN7A 5C1BA 1XNRB 1PDOA 3MMNA 4LY0A 1NJFA 2KW5A 4FYVA 1QGOA 3NORA 3OOEA 1PL0A 3MSCA 3AIIA 3JR7A 3ZD8A 3N74A 4XI9A 1B2RA 2XCTB 2TMKA 4JN6B 1YCHA 3TLXA 3I5MA 4WOPA 1PF7E 1A27A 3ZHUA 3PC7A 1H9BA 1BDJA 5IJZA 4PAWA 4PZCA 4CLHA 1XMIA 4QBGB 1RAHA 5GTDA 3KDPA 3LUHA 3CXUA 3DF9A 3VJRA 3HJFA 4GH5A 2PL9A 4IMRA 5G0SA 4FE4A 3AR5A 3RC9A 4CXMA 4RFLA 1N4AA 4B7XA 3WI7A 5DNWA 2P5SA 1XQXA 1Z0FA 2XEXA 3W4KA 1D8TA 1Q0RA 1G2QA 2GXQA 2BBWA 2O2YA 4OFWA 1GGMA 4CT4B 2V9ZA 2RK4A 1NDUA 1UK7A 4PZDA 4QU0A 1Z9BA 1DVRA 2IQIA 3SC4A 4TL7A 1YB7A 3DM9B 1LSOA 2BLLA 2F90A 3H3XA 1O1YA 2Q5HA 5T6BA 4EZIA 3E05A 2BN4A 2AZDA 2FGJA 3P94A 3RSFA 3QPWA 3DDHA 4U7GA 3SGLA 3RCBA 3B13B 2VAVA 3QKSB 5JJLA 2M6LA 3W9UA 4URWR 4XCXA 3ZQKA 3GFRA 5CRIA 4RZUA 1FDIA 3DEZA 5CB4F 3N0XA 3AZQA 4G0OA 2AE2A 2PGOA 5IZCA 3FLEA 2O54A 1ZNQO 1QSPA 3QU4A 3FCSB 3TCXB 3B3AA 3P26A 1F6BA 4K3UA 3GN2A 1QIFA 4QKQA 2P65A 3UJ3X 3LXXA 3V32A 3KJQA 3HO8A 4UE6A 1EP2B 3SY8A 2JH8A 3SZLA 2H2AA 3PJRA 3L7MA 1KMHA 2FRDA 2XKJE 3EW9A 2FEKA 1U8EA 4HDKB 4MWTA 7MHTA 3FIUA 4W5JA 3ZY4A 3NJ8A 3QF7A 3K1ZA 4HVLA 3Q11A 3PCTA 4KFSA 4EKDA 4JXJA 4LZLA 2CXHA 1CB0A 2GWRA 1CJSA 2B2CA 1Z63A 2X13A 1YZUA 4I3FA 4FLFA 4RLHA 2A0UA 1BJTA 3G2QA 4DV7B 3ER9A 2WVHA 5ES4B 2XSEA 4L22A 1D04A 1VJ5A 2P62A 2W0SA 3QPVA 2PVSA 3WB1A 1FNSA 5DTRA 2VHQA 3BZUA 2Q2QA 1Z5ZA 2X8AA 4ZZ3A 2P4HX 2WPNA 4F5EA 1R0XA 1ZLYA 3FUCA 5DN9A 3F7TA 2M6KA 2ZYVX 4B3TB 5L6MB