1J8MF

Signal recognition particle conserved gtpase domain from a. ambivalens
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
295
structure length
295
Chain Sequence
LLDNLRDTVRKFLTGSSSYDKAVEDFIKELQKSLISADVNVKLVFSLTNKIKERLKNEKPPTYIERREWFIKIVYDELSNLFGGDKEPKVIPDKIPYVIMLVGVQGTGKTTTAGKLAYFYKKKGFKVGLVGADVYRPAALEQLQQLGQQIGVPVYGEPGEKDVVGIAKRGVEKFLSEKMEIIIVDTAGRHGYGEEAALLEEMKNIYEAIKPDEVTLVIDASIGQKAYDLASKFNQASKIGTIIITKMDGTAKGGGALSAVAATGATIKFIGTGEKIDELEVFNPRRFVARLHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the conserved GTPase of SRP54 from the archaeon Acidianus ambivalens and its comparison with related structures suggests a model for the SRP-SRP receptor complex.
pubmed doi rcsb
source organism Acidianus ambivalens
molecule tags Signaling protein
molecule keywords SIGNAL RECOGNITION 54 KDA PROTEIN
total genus 100
structure length 295
sequence length 295
ec nomenclature
pdb deposition date 2001-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF02881 SRP54_N SRP54-type protein, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 1j8mF01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1j8mF02
1NBMD 2OM2A 4DDVA 4V03A 1AZTA 5KHOC 3EXAA 3L8YA 4Q18A 1A4RA 5JEEA 5F9FA 1PLKA 2WWHA 1IN6A 1FP7A 4PHTA 2EFGA 1P9NA 1TF2A 1P3JA 3W6NA 4UNQA 1ZD8A 2WZQA 5A4JA 4RD4A 1G16A 2GA8A 3RWMB 1XZQA 4Q7LA 5FUWA 1M7HA 1KHTA 1OB5A 5KYKA 4EAQA 2XNSA 3AP3A 1KK2A 2GAAA 4LJ9A 1LF5A 2CL0X 5AWFC 3MJRA 4E03A 1S3SA 2LCFA 2O8BB 2VSFA 2ZYTX 3MJHA 1QG2A 3LXXA 4IKEA 4CRWB 1E0KA 3OFND 4B3CA 1Z5ZA 1Z0DA 4US0R 3MD0A 1G3MA 3LBIA 1UBEA 4Q47A 2V4ZA 2GVZC 2BBWA 2QT1A 3BRWD 3FYHA 2CXXA 4QNMA 4QM7A 2A5DA 2PX0A 3NH6A 5DI9A 4B3BA 3BORA 4UJ3A 4Q21A 3PQCA 4EFNA 3NC0C 4NCKA 5KPJA 3FGNA 4QM6A 4Q4HB 4AI6A 4QGGA 1WCV1 2ZRLA 4ZCLA 3M0EA 1OXVA 3U7GA 3PJRA 2LKDA 1KI2A 5JFGA 1P2TA 4U7DA 3CWQA 4NMMA 2BEKA 1WF3A 1YJ5A 5SZIA 3T1TA 4IDNA 4LHWA 4PANA 3S1AB 3CIOA 1N5LA 4Q1EA 1MOZA 2EFCB 4Q1CA 4MYUA 4QJ4A 4YMSA 2IBMA 3TVDA 5JRJA 4URVR 2YVUA 1OYYA 1QDEA 1SKYB 3HYRA 5C4MA 3M4YA 4TYNA 3AF1A 4B48A 4EJSA 1YRAA 3EPJA 5F9HA 1XTJA 1NMYA 3IHWA 3THXA 5JHHB 2PH1A 4KYIB 3AVUA 3FE2A 3AP2A 1D9XA 4CF7A 4C9BA 4D4MA 1W4BA 2DYKA 2IWRA 4BZPA 3U4QA 1P9RA 4M9XA 2HF8A 3R9WA 2ASEA 4TL7A 2JDIA 4GRAA 5D3QA 1RVDA 3X1WA 2IX3A 4DIDA 2QTHA 4UNPA 1Q1QA 3VR3A 3KQHA 2HJVA 1W7AA 4OI2A 1KK3A 3E5HA 4BRWA 3CW2A 3QKTA 2WKPA 3GLIB 2ERXA 1TAGA 1OH8A 4C2UA 3SR0A 3DO6A 3VR2A 1VKJA 2RKOA 1XEXA 1R7RA 2OBMA 2I3BA 1OXUA 2XB4A 1IN7A 1GKYA 4GZMA 1DAFA 3OFNA 1KO4A 5G53C 4S35A 5JCPA 2CL7X 5TDHA 4BFSA 2JJ2D 2V1UA 3CH4B 1UFQA 4HAWA 4OHZA 3UATA 4CZ2A 3B5JA 2PLRA 1Q22A 4YLGA 4QJ3A 1CKEA 1DPFA 2FZLA 4E07A 4GBMA 4URWR 4US2R 2FGKA 3BC1A 2XOKD 3TAUA 2WJJA 1IONA 2W58A 2FSFA 4M0LA 2GZDA 5L3SB 1MABB 4RD2A 2GESA 3IILA 3B60A 2QL6A 3QIAA 4B2PA 1JR3E 5L8VA 1Q1BA 1CF4A 2G1KA 2GK7A 1HURA 5LPNA 1N6IA 3CLVA 3THOA 2LWIA 4JT2A 5UKDA 2G77B 1JECA 5EP2A 3AVYA 4IXMA 5K8LA 3RRMA 1NSFA 2OFXA 3BH7A 2FFHA 4GMXA 1Z63A 2WPDD 2DB3A 2A5JA 4I1OA 5JCZA 1NVVR 2KWIA 2HJGA 4DLRA 1F3OA 3VR4A 2PJZA 2ZRJA 1LY1A 2VO1A 1MKYA 4KFRA 4LJ4A 5G3ZA 5DLQC 3WYGA 4XOIA 4A6XA 4RFVA 4BFUA 4C0SA 5EE9A 4PPNA 2J59A 4PO1A 2ZJAA 3W8NA 2MSCB 4WOPA 5KNBA 1QF9A 3QBVA 4QBGB 5B2ZA 4B3FX 2J0SA 1SXJB 1BYUA 3B6EA 4LOAA 4TN1A 5FR2A 1ESMA 5LB4A 5FUYA 1HE1C 1AK2A 1N2CE 4BLSA 2VEDA 2ZJBA 4TMTA 4HLUA 1EXMA 2VA8A 5CJ2A 1LW7A 4PC7A 4PQFA 4V0OA 2IW3A 2EWWA 1AS0A 3HP1A 4CIDA 4ZCMA 3QPVA 5KSYA 1EX7A 2JJ8A 4C7OB 4LJ5A 3THWB 2ZUBA 3O8CA 3THWA 1GZSA 3T61A 5KDDA 4O25A 4BQSA 2G0NA 2OCAA 1OB2A 2J87A 4JLPA 2ZVPX 1AQYA 4TYQA 1Z0FA 1IAQA 3FMFA 3RRYA 2P2LA 1QG4A 4LYFA 1NN3A 1WGWA 1XRJA 2OCYC 2CJWB 4YMUA 2QORA 5EZ5A 4LBYA 3RHFA 1VCMA 3O8DA 3DPUA 3OIWA 2W6JA 4FWTA 4D25A 1ZU5A 5TMPA 4X8LA 4TMZA 1OXTA 4P4SA 4TL6A 3EPKA 3W5IA 4XVQA 2IYQA 4QBIA 2DBYA 3RS7A 3WBJA 1HT2E 2ZITA 4PFSA 1ELOA 8OHMA 2HXSA 4AURA 1F6BA 5FPYA 2QGNA 3U7EB 1ZM7A 4B34A 1J8YF 4BUJA 1M6NA 2KE5A 2PEYA 1K8RA 3C8UA 4A8JC 1GAJA 1XXHE 3RS3A 1UKYA 3AVTA 3QKSA 4NPHA 2CEAA 2ZS7A 3TE6A 2ZJZA 2C99A 3FHCB 1G3RA 5TXGA 2OZEA 4DDWA 2C98A 1FNMA 3X1DA 2VBCA 3FMPB 3PUVA 3RRZA 2BWJA 2EFEB 1KY3A 2YWHA 1A2BA 4UJ5A 4QGFA 3X2SA 2XTMA 4DSUA 1RC8A 1FUUA 1F2UB 1E2PA 4LYJA 3SFVA 3NIBA 4F4JA 5LD2C 3CX6A 3NHBA 2BM0A 2YC4C 1FFHA 1NN0A 2FZ4A 1ZAKA 1J90A 1CP2A 4LZZA 5EXTA 3GFOA 2OCPA 1I4DD 4UXIA 2J1LA 1DO2A 2IYXA 3VFDA 4C0JA 3B82A 4LSGA 1ZJ6A 3HU3A 4KLZA 4AD8A 1CJUC 1MV5A 1TQ6A 2BEJA 4YXWA 1II8B 3VNUA 3LWNA 3T5GA 1JAIA 1XDBA 4MGKR 1GSIA 1HA3A 4KFTA 3AVXA 4RY2A 1N6OA 4II7A 2H5EA 1FX0A 4Q7MB 4I99A 1W5TA 1XF9A 4LHYA 2ZJOA 3GJ6A 1L4YA 4PC3A 1DAKA 1N0UA 4Z8XA 5J4VA 4JVNA 1BKDR 4D0NA 1E2DA 4KO8A 2PZFA 4QFMA 1E32A 4DLTA 2FMXA 1YU9A 1T5LA 2NOAA 3QVVA 2UVQA 5FBLB 2AWOA 1K5DA 3HDTA 4G0NA 1MR3F 1XMJA 2VP2A 1U8YA 4A0GA 1TADA 1R5NA 2J46A 2FFQA 1KAOA 4LHZA 5KO2A 4A8JA 2GDJA 5K8TA 4RKEA 1ODFA 4DLSA 3MG9A 2PZEA 3E70C 2JLVA 4EIWA 3I5YA 4CEJB 1VG8A 2QZ4A 1E4VA 2X77A 3PVSA 2RMKA 4LI0A 3UXMA 1T3HA 2X2EA 2HT1A 4DCSA 1Q1ZA 2RGDA 4M53A 1NIPA 4EKDA 2IUSA 3AV0B 1AS3A 1A2KC 3DMNA 2IEYA 1KI8A 4M1KA 4MH0R 4MRNA 4CEIA 3AKEA 3X1YA 4G5QA 5GVRA 2O8FB 3LRPA 1W0JA 1ESNA 3BWDD 3KKPA 1OIWA 1PJRA 4JL6A 4Y0AA 4FMCF 5CLLA 4A92A 4DLXA 2XZLA 4M8NE 1JEDA 1KZ7B 2F1IA 4F93B 4QGHA 2WJYA 3F5FA 4LWZA 4NP6A 1XMSA 4LYAA 1VPLA 2J5XA 2CNWD 2OLKA 4FN5A 4V0MA 2Z5FA 4X8MA 3VX3A 5J4LA 2B8WA 4LHXA 4QBFA 5FBRB 6Q21A 5JZVA 2F43B 3IQXA 1XPOA 3EPHA 1M34E 1S0UA 1VCNA 2OXRA 3BOSA 3B13B 4G1UC 3NDPA 5F98A 2IYWA 2ZSEA 4DCUA 2JDID 3BFVA 4H9GA 2PJRA 1XTSA 1T0HB 3ONWA 5JI3E 5IRCD 2GAOA 3ND9A 4NZYA 3K8YA 2WOJA 4I81A 1R0XA 4OK5A 1N5KA 2DPXA 2FV8A 1RRFA 1JAHA 2N42A 2MSEB 1NLYA 5JLJA 1JBKA 2BCJQ 3AUXA 1SVIA 3EG5A 3B2EA 2KJQA 4M1OA 2QP4A 3VKGA 1IY2A 4KVAA 3X1XA 4ACAA 5HKKD 1ZW6A 3DOFA 3QPUA 3ZLJA 4C0QC 4TZ0A 1M7BA 3CZQA 3RS5A 3H1TA 2VHTA 2XITA 3DOEA 4ZI2A 4HATA 2F7SA 3GPLA 4Q4AB 4HZIA 1P72A 4PO8A 1OPXA 3TMKA 4B32A 2J0UA 2V8OA 4OQMA 4FCWA 4FMCB 2QG6A 1KK1A 1OHHD 3LLMA 4HYYA 2ORIA 4DEYA 2RH5A 4IFEA 3I61A 3KTAB 3BXZA 5IK2D 1W4CA 4YXWD 3NBYC 4DEXA 3FOZA 3P32A 2GXUA 3LBNA 3V4FA 1Z06A 4JVSB 3WY9A 3GFTA 3Q3JB 2J41A 121PA 1UKEA 4NH0A 1E9BA 1MH1A 5J4YA 4UXHA 3AUYA 4YQFA 2CHGA 3MWKA 1KMHB 1DO0A 3W6OA 4N0EA 5HZHA 2W0SA 3A8TA 4ZCIA 4JLMA 1XMIA 5EXPA 2NZ8A 1V5WA 2WIAA 3DM5A 4MGZR 4RSGA 2AK3A 1EX6A 4CEJA 4V0KA 5HPYB 1NY5A 3N2EA 1E94E 3AGPA 2GJSA 2XNDA 4ZV4A 4V02A 4M21A 5FPTA 3CR8A 1R5OA 4ZIRB 2HXYA 4BLTA 4OJKA 3PXGA 3QXJA 4NONA 1Z22A 1S3GA 2ZI4A 4WVFA 5JRZA 1OKKD 3FTQA 2FF7A 2O8DA 2L0XA 3ZGXA 2HLDD 3V00A 1R10A 1RRGA 5ELXA 4BFTA 3K70D 2GVDC 1E9DA 2H18A 2EW1A 5G41A 3BB4A 3AF3A 2V7QD 4ARZB 1E2MA 1GWNA 4MYTA 1BMFD 2GK6A 1Z47A 5AUQA 4RZ3A 4TZ6A 4IHQA 1E2FA 1JQLB 4YC7A 3W5JA 2ZAOA 3SFZA 2IS2A 1TPZA 4MRVA 1QHHB 1CJVC 3FHOA 2OT3B 3IDQA 2QSZA 3P20A 1OJLA 5HKKA 4B76A 1Q21A 2BDTA 4KODA 4B33A 1CRQA 2RHDA 5GJWC 4BLRA 2BV3A 3IKJA 3W3ZB 2ZRIA 4LJ6A 3WNCA 1U8ZA 5C1BA 1N5JA 5CIWA 4DCNA 4EPXA 3LDAA 5EE0A 1U9IA 1G6OA 2W0MA 4A0FA 3W3AA 3T5DA 2OEPA 2NGRA 2C9OA 2DFNA 1WP9A 3L2OB 4HZUB 2W2VA 5G3YA 4EDHA 3IBGA 1TU4A 2IL1A 2YOFA 3SOPA 2JLYA 2RB4A 3OEHA 1TQ2A 3I92A 2QEQA 2R6CA 4TLBA 4XWAA 1VYUA 3JVUA 5EQTA 3ICQB 1P73A 2H16A 2CK3A 4AC9A 4Q66C 1G21E 5AJVB 3UMSA 1IM2A 2A78A 4DBLC 4ZI3A 2ZS8A 4TMWA 1SXJE 4G5SA 4OK6A 3WMEA 3Q9LA 4OQNA 4V0LA 4RJLA 5DO9A 4CT5A 4D26A 2FSIA 2FFBA 5FBQB 2IXEA 2OG2A 1OFIA 3A36A 4C0HA 2RGBA 2AN9A 5KDLA 1TNDA 3B9QA 5KSPA 1VIAA 1G3IA 1ZP6A 4JLBA 2NO7A 4TL9A 2K5UA 4BFZA 2QBYA 1VCIA 3WNDA 3LQQA 3A4MA 1E9EA 2JLXA 1CJKC 3R9XA 3H4MA 1W0KA 1EK0A 3BAFA 3P1JA 4LC1A 4K8OA 2CCGA 1FQKA 4GT1A 2ORWA 1JPNA 1GG2A 1KI1A 1PLLA 4CEIB 1GILA 4HLCA 4Z8YA 621PA 4IOMA 4HUQB 3QF4A 3OAAA 3ZZTA 1BO6A 2IA5A 3BFKA 1XNJA 3QY0A 1OH6A 3QBTA 1WQ1R 4POAA 3OF5A 3GLGB 1U99A 2FWRA 3ASYA 3SBDA 3NH9A 2GCOB 3C14C 2ZU0C 2J0QA 3G82C 3WMGA 4B3DA 3H86A 3UKDA 2AD5A 1DG3A 3OHMA 4TYWA 1RPZA 4JSYA 1ZD1A 3GLHE 2QNRA 2J45A 4IFBA 1R6BX 2ZRDA 5BWMA 2DWQA 3ZD6A 4QJ5A 4PZYA 5DGXA 3UWOA 2JLZA 4JJKA 2ZE6A 3EARA 1TQ4A 2O8CA 1JPJA 5L3QB 2O5VA 4YMWA 5AJZA 1S4QA 1X8JA 2F1JA 2REXB 3L82B 2OCBA 3BB3A 1HT1E 3NKVA 3V4RA 2QGZA 2XXAB 2WWWA 5CITA 1G4AE 2D4HA 5FL7A 4DRZA 1G5TA 1COWA 2FFAA 4NYMQ 4QHSA 4BE7B 3U7HB 1KMHA 1E2EA 5FFMA 1Q44A 3U5ZB 1WRBA 4FWIB 1SVLA 1XB2A 4RCYA 3KQUA 3EWSA 3LX8A 1J2JA 3I32A 4UKDA 2G9NA 2DWOA 1DG1G 4MKIA 2JATA 3ZVRA 1GNQA 2QQEA 4Q4LA 1T0JB 2VP0A 4M9SA 2GZAA 2FSHA 1FUKA 4BPBA 2GWHA 2JAQA 4H1VA 4W9MC 3C15C 2W00A 1NLFA 1XJQA 1AQUA 3VR1A 2BM1A 2JLSA 4US1R 1E0AA 5FOWA 5L3VA 1W48A 1S1MA 1ANKA 2W2TA 1NVUQ 4Q1AA 2Z0MA 4X8HA 4HDQB 3C16C 2YWFA 4DCTA 4Z54A 2FA9A 2ZRCA 2NO0A 4QXAA 2CDNA 1U2RA 3GCGA 1PVOA 4A15A 2CNWA 1KSJA 5AK0A 3MUFA 2QRNA 4V0NA 1RW4A 2GEDA 4EPYA 1Z29A 1N6PA 2YJTD 3PITA 2CL6X 3VU9A 4DVGA 2YINC 4JZKA 4URZR 1OFHA 2AL7A 3ZVLA 1TTTA 1HUQA 3TR5A 3ZD7A 3GLGE 4HAVA 4L4UA 4BEBA 1QVRA 2QMOA 2VHJA 4R2IA 4K81B 1ZCBA 5CB8A 2XXAA 1KO8A 4FMDB 1JR3A 1P62B 3IPXA 5CM8B 2VL7A 5FOXA 4F4CA 2WKQA 2FPKA 5EUQB 3CF0A 5H68A 3PEWA 4JKYA 1NBME 2WJVA 2NMVA 3H84A 4JLKA 1A82A 1PLJA 2ERYA 2X19A 4RD1A 4C3ZA 3EW9A 4EFLA 5JS7A 2B7CA 3ZZUA 3KJEA 2GBLC 5DHAA 5LDDC 2WWIA 4YMTA 4DT1B 3C5CA 4KFSA 2Z6VA 3U3OA 1I2DA 3ZYCA 5GADl 4DUGA 2IYUA 4Z51A 2ZSFA 1LVGA 3U61B 1HH4A 2IS4A 2WSMA 1DADA 1GRRA 3AKCA 2IHYA 4C0KA 4BLOA 1QHNA 5M04A 2PZGA 2D3WA 3TLXA 2C95A 1EESA 1X1RA 3SJAA 1AKYA 2OLJA 3MCAA 3KXLA 4C0AC 1KYIA 3K0EA 1KZGB 2GXSA 3KXIA 3HPRA 3P4YA 3I72A 1RYHA 1W4RA 5HCNA 4LJ8A 1KI9A 4ON9A 1XEWX 1E3MA 5B57C 1HTWA 4WAUA 3GJ3A 1W1WA 2GF0A 4B6EA 2JGNA 4MYCA 3U3RA 3OESA 1QHSA 3B1ZA 4LPSA 2V54A 3H0KA 1Z6YA 4YMVA 3O8RA 4G5RA 4R7ZA 2QAGC 3D6TB 5A0FA 2WPDA 1EFCA 3PV0A 4MRSA 4D0GA 2GILA 2IC5A 3IQWA 1U0HC 3E1SA 4LUCA 2F3RA 4AYWA 5BW8A 5FUVA 4LV6A 2GXQA 2JJ1A 5JJKA 2R6FA 1ZUHA 4CYMA 2ZAMA 1WMSA 4OJQA 2MSDB 3KKNA 2CVHA 2XAUA 4V0ME 3LVQE 4WIAA 1KSHA 5KSZA 2QE7A 5GVSA 4TSFD 3O8BA 1W2HA 4JLJA 2BBTA 3QXCA 1ZCAA 1FL9A 1MO3A 2RGAA 3RSLA 2GF9A 3EZ6A 2WMNB 4RD3A 1F48A 1II9A 2ZRKA 5JS8A 3GLIE 2PMDA 4ARZA 4CVNA 3U4QB 2PEZA 3NBFA 2BJWA 3VKWA 3PEYA 2LKCA 4TLCA 2R44A 3AF0A 3SDZA 1XXHA 2ZJ2A 1E9RA 1JNYA 4TYYA 1QHGA 1IOZA 1XMVA 2A5FA 2GBLA 2SHKA 3P4XA 1O3YA 1UKVY 4HB2A 5E7MA 1JQJC 3Q85A 4GMDA 1M8PA 3KKQA 2VQSA 1W0JD 1E2QA 4LCBA 2OFWA 4UNSA 2Q9AA 1MRSA 1VYVA 1DAHA 5KOYA 1ZC4A 5DIFA 3TKLA 2BCGY 1SXJA 4JL8A 1Z6AA 4Q7KA 4Q9KA 5J47A 1QVAA 5DN6A 521PA 1RRCA 3S1AA 1EFHA 4HB4A 2YZ2A 4Q1BA 4D6PA 4P4TA 1ZMXA 2H92A 3EZ7A 1MO6A 4JSTA 4BFVA 1YR8A 1R8SA 4Q4HA 1D9ZA 4Q01A 2RAPA 1NLZA 4D4LA 2C9YA 1G8HA 1RJ9A 4HSEA 4TTRA 1U0LA 5GJCA 4KYUA 4XD7A 1Z83A 1B23P 1G6HA 2YYZA 3ETLA 5BXQC 1EG7A 5L3RA 5FBVB 1P2VA 2A9KA 1GVNB 3SYLA 1OH7A 4PR0A 1DOAA 1MRNA 5KSOA 1ZM9A 2FJUA 2P67A 3LX5A 1FNNA 3AVOA 3OEED 1CU1A 4GDFA 4PPFA 4ILEA 3PIRA 4C0BA 2F6RA 2RGCA 1NVVQ 2C96A 1YZQA 3BERA 2D2FA 2VP5A 1GL9B 1MABA 4A9AA 4B3XA 2C2HA 1Y3AA 3ZIAA 1US8B 2RGEA 1Z8FA 4QKQA 2WWXA 3FMOB 4IEEA 3CH5A 1W2GA 1Q20A 2NZJA 1KSGA 3GJ7A 5DYGA 3U2QA 1N6KA 1G9XA 1X3SA 2PLFA 4C7OA 5FH9A 2R8RA 5DHFA 1WBDA 4ASUA 5FL3A 4ESHA 4E22A 4ZIRA 3SZRA 3CRRA 3QSYA 4GSYA 3R20A 1I4LD 3T34A 2JLRA 1GFIA 4D81A 5HR5A 4QHTA 4WA7A 2B8TA 4A6PA 3QXHA 3RWOA 3UG7A 1L7VC 1LS6A 1VECA 2RCNA 3K0FB 3IEUA 2EFDB 4D82A 2ZRPA 4ZO4A 3WHLA 1JR6A 3VR5A 3OEEA 3RS4A 1R2QA 2ZRGA 4HAZA 4WW0A 2O8BA 2OHFA 1ZINA 5CYPA 2QBYB 4XVUA 1KNXA 2VIIA 1ZUIA 2JASA 2GEUA 3OE7A 3U44B 5JJIA 2XOKA 1Z0IA 3KXKA 5CB6A 1ZC3A 1NN1A 4PAOA 2PBRA 1N6HA 1CS4C 1SHZA 1HYQA 1KMQA 4KI0A 3RAPR 2QMUA 1BOFA 3Q7PA 1JB1A 4IVQA 2HDNB 1WXQA 4TL8A 3ZS9A 1H8ED 4OKSA 1VYTA 4B43A 2GXAA 4OI0A 3U3MA 1KDOA 1NBMA 3FFBA 2DWPA 4KBFA 1XTRA 1JR3D 2CVFA 4AG6A 4QHYA 3J81k 3LH5A 4DSTA 1F5NA 2OFOA 3T12A 3O47A 1W0KD 1NMXA 4XTCS 4AKEA 4JJZA 1ONBA 1T3LA 2NO9A 4TLEA 1XD9A 5B64A 1XBTA 4A82A 3AVWA 2J0VA 3TQFA 3IO3A 1W36B 3VX4A 1NMZA 3TW8B 3KL4A 2IYYA 4H1UA 1U0JA 3U44A 5HE9A 1IN4A 1Y63A 2B21A 4KLNA 5AJXA 1G7CA 3MAAC 3H2YA 1R4AA 1LF0A 3A1TA 2ZE7A 3B1WA 4PC1A 2JLWA 1VIYA 4KVGA 4DT1A 2IYZA 4NHOA 2AFIE 1G20E 1RYFA 2D7DA 2ODWA 4UNRA 4CT4B 2J3EA 4DXAA 1YR7A 1P2UA 3K0FA 421PA 1XEXB 4KITB 4OHXA 3PUZA 5LB2A 2WJGA 3UIEA 4M4SA 4ZDWA 5DI3A 3G5UA 4M1TA 2XZPA 3EAQA 4HAUA 5FR1A 2ZETA 1XJCA 1JALA 1GDDA 1ZVQA 3HU2A 5FTNA 1WB9A 4TLDA 4DDUA 4GFDA 3I3SR 2IYRA 4BFYA 2P6UA 2WWYA 3DDCA 1GNPA 3BBPA 5EE1A 3TJZA 2WSSA 4TLAA 4MDEA 5SZHB 1QHIA 1OKKA 1FZQA 2XZOA 3FKQA 3CNNA 3GP8A 3WRYC 1FTNA 3CNOA 3AKYA 5JSZA 2GZHA 2ATVA 4HEJA 1XCGB 1G64A 1YZLA 5FOSA 3NDBB 3WP1B 3OZXA 2FDCA 2WAYA 1H8EA 4B75A 1P5ZB 3W90A 4F92B 4EFMA 3EC1A 3EC2A 4UNNA 4U5XA 1ZNWA 2GKSA 2HYDA 3C41J 2IYSA 2ZE5A 1G17A 1MO5A 1Z6TA 4W5JA 5SZJA 3WBKA 3LBHA 3EZFA 3D3QA 2KBEA 4Q7JB 2J7KA 2PT5A 3HPQA 1OH5A 1F2TB 1X8LA 4LHVA 5EJEA 1ZM2A 3GLHA 5ANRB 1EWRA 2GHIA 3SU8A 3IIJA 1HE8B 4IDOA 2ZYVX 1F60A 3FPAA 3CRQA 4F4IA 4AK9A 3KFVA 3PFIA 3SQWA 1GM5A 1B0UA 3LFUA 1RFLA 3HYTA 3QG5A 4URUR 2B92A 3DHWC 1CR0A 1H65A 4JLOA 4W7SA 4PO9A 2WKRA 1VTKA 4EPWA 1BYIA 5H1YA 2YWGA 4LY6A 4NYJR 3U7FB 3E2IA 1LFDB 2YKGA 2AXPA 5JHGB 1UDXA 2P5SA 1QHXA 4GP6A 1UPTA 5G40A 3KB1A 4A0RA 3VHXA 3SNHA 2C78A 3JZAA 2WV9A 3K9HA 2GNOA 3L8ZA 3MWJA 4PX9A 1ZBDA 2W6ID 3CF6R 2BC9A 3UG6A 3I1FA 2ZRMA 2X2FA 2C04A 4B35A 2UZ3A 2OBNA 1GL7A 4DLWA 1Q0UA 2JJ2A 4JYCA 4LJ7A 3ADCA 4BLPA 1FTSA 2WVJA 1OHHA 3A1UA 3CPJB 5CK5A 1EGAA 4A2QA 2GCOA 1TX4B 1ZUNB 3I8XA 4MGIR 2R6DA 1XU4A 1T3SA 3ZH9B 1KJZA 2ZRNA 3B1YA 3GFPA 1AN0A 4TQAA 1XEFA 5HTKA 1FQJA 4DSOA 4EJSC 1S9HA 3KKOA 3LA6A 4OQFA 2CE2X 2OAP1 2ZUDA 3WMFA 1KIMA 1KO5A 2FPMA 2NTYC 5FTMA 3CONA 4RD0A 1W5SA 2UZIR 3A1WA 1KY2A 3LAWA 4U00A 3CX7A 3NHAA 3PUWA 3PG5A 1OLOA 3KDSE 3TUZC 5KTYA 2ZR9A 2Q9BA 2Q3MA 3RS0A 5KNDA 3RS2A 5LD2B 4J0QA 4XTRA 3EX7C 3THYB 4NYMR 2G1JA 2O0KA 4RD6A 4ITRC 2Q0HA 3PENA 4I4LA 2GJAA 3B78A 2JIZA 3SHWA 3MLEA 1AA9A 3VNVA 1TMKA 4NU0A 2QMEA 2ODEA 1UBGA 1G41A 4IDPA 4I1UA 4G3XA 4NCHA 2Q3FA 4BLQA 4P4SB 2R6AA 1DE0A 5DYIA 2IXGA 2D74A 2RGGA 2ZRAA 2DFLA 3QEOA 3WXMA 2ZSDA 1KDTA 3IPYA 4PTLA 3T15A 1W36C 5JI2E 2RGNA 4P33A 2BVNA 1E9AA 2A3RA 3GQBA 4WXPA 5CM9C 5BN4A 1Q12A 4FCVA 4M22A 2QPOA 3OIUA 4OI1A 2PL3A 4IRUB 2YHSA 3F3YA 4IOJA 3EIEA 4LC0A 1OFUX 1A5TA 2Z4RA 3EA0A 2HCBA 2R62A 5IHPA 3RDPA 2QU8A 1ZNYA 3CPHA 1Z6GA 2ZR0A 3D31A 3BJIC 3QQ5A 2RGXA 3I73A 1E9SA 2PT7A 1JEEA 2Z43A 3C5HA 4HUQA 3KQNA 2VYFA 2ZROA 2QE7D 4LBZA 2JLQA 1S96A 2Q21A 2Y8EA 2JLUA 2H8KA 1RKBA 1FP6A 1N3BA 3R8FA 4AG5A 2JJ1D 3QUSA 1CBUA 4RFSA 3BB1A 1FX0B 1SVMA 1YZNA 2DCUA 4QL3A 1TUEA 5IF9A 3LY5A 3QOFA 4CGZA 4JS0A 4EPRA 4W5HA 1U8AA 2VH5R 4MYHA 5E7IA 1SVWA 3TAHA 2H57A 2NPIA 2OESA 3EA5A 1E2GA 2OBLA 4FI3C 3SHFA 1AZSC 1NJGA 1T9HA 2IYLD 3VU9B 3TIFA 5FTLA 4D0LB 2PX3A 4IOKA 1WDTA 3QE0A 4OHWA 1AGPA 1N0WA 2QAGB 3LW8A 1IXRC 3QXSA 2AWNA 4NKRA 4TQ9A 1A1VA 3CF2A 2DR3A 2IS6A 1S9DA 1I2MA 3RSOA 2FPLA 2ZYUX 3KZ1E 3LVRE 3AGQA 1GUAA 5DNYB 4DZZA 4RZXA 3A1VA 4PZLA 2OSBA 1C1YA 1GOTA 3K70C 2QPTA 3K0CA 4KV9A 4PAQA 4Q5IA 2KB0A 2Q6TA 1G291 2ANCA 2ZRFA 1G8YA 3QNUA 2ZR7A 1YVDA 2ZIAA 1SQ5A 4HZUA 3UK6A 4Q48A 5J4HA 2WSSD 3NXSA 5H70A 1TF5A 1VCOA 1HY3A 2NG1A 3GEIA 3N5CA 4DUGD 3OEHD 2ZS9A 2ZI7A 4GNKA 4RZ2A 4L9WA 4JVMA 1IXSB 2VRWA 2IK8A 3K9NA 5JJLA 1TUIA 1E0JA 1XTIA 3QJYA 5CIQA 5EE3A 1UF9A 3ZVNA 4NYIR 3QENA 4PHGA 5JWRA 2IXFA 3F0TA 1D2EA 3LNCA 3R7WB 1SVOA 2CMKA 1CULC 1AIPA 4DSNA 4K46A 3A37A 4LK2A 5KNCA 5DN6D 2F9LA 1EFRD 4DB4A 1YR9A 2IYVA 3CNLA 1R8QA 4IVRA 2C03A 1GRNA 5AJYA 4A2WA 3ECCA 4NCIA 1W47A 3SYKA 2I4IA 4OHYA 1YHNA 2EVWX 4MKHA 2QAGA 2QTFA 2O0JA 2I1QA 3K09A 1DTSA 1Z3IX 5SZKB 4KSBA 5KUTA 3TUIC 2XGJA 3RABA 2GJ8A 4NYIQ 2ZANA 2YNMA 1NKTA 2HLDA 4Q00A 2REOA 2XSZA 2HV8A 3LD9A 4QRHA 2A5YB 2R6GA 2OILA 3BH0A 3L0PA 1CIPA 1QZXA 3W9YA 2WWGA 3L0SA 3NVAA 4XH9B 4PAMA 4D4JA 1OFTA 4QNRA 4EPTA 4P31A 4NBSA 1X8KA 1OSNA 3ADKA 4WZAE 4HDOB 2BMFA 2ZI6A 2ZI9A 3FDIA 4M2LA 4OQXA 3FVQA 2HEIA 3CBQA 5TV2A 2MMGA 4ZKEA 1GNRA 4AYXA 4PC2A 4GZLA 4IDHA 2EYUA 4M9ZA 1P75A 4IEIA 4IW3B 2BMDA 2F55A 4PQYA 4M1MA 2VLIA 1S2MA 1KI6B 2O8FA 2CCJA 2KBFA 1COWD 2QAJA 3VQTA 1US8A 4A4DA 4RKFA 4DC9A 4DIEA 4ZDKA 5JBQA 3GJ4A 4HB3A 2ODBA 1NI3A 2VF7A 3DKVA 1IN8A 3LQRA 3ND8A 3ZIAD 3CRVA 5EZ6B 2IF0A 3MWYW 2KI5A 2AXNA 5EP3A 2WICA 1E1RD 2R65A 2Q3HA 3SC3A 1XD8A 2IHBA 2V6IA 1K5GA 2H7VA 3CRW1 1N6NA 2QMHA 4ASUD 4M9QA 5FPHA 3THYA 1XFAA 2AKAB 2W2XA 3U3KA 1P61B 2ZYWX 1XPUA 1SULA 2IWHA 3F8TA 1AS2A 5J4KA 2J7PD 5EUMA 4X8OA 1W44A 4C4PA 1LNZA 3VMFA 1OIVA 4DWJA 4RCZA 2J0UB 3N70A 3SJZA 4LPKA 4TQUS 3MFYA 4TMVA 4KSCA 1F2TA 3CRMA 2WJIA 2ZUCA 1GRQA 2IT1A 4IOLA 2G0TA 4RFSB 1KDPA 4JKIA 5BQ5A 4HUTA 4GPTA 1QHHA 1G5PA 3ZQJA 3U6BA 1OIXA 4F91B 1CXZA 3A4NA 4BRUA 4Q1FA 1XPRA 4JVLA 3GJ0A 3NEJA 4Q4AA 3KB2A 5C46F 1SZPA 1YKSA 1P2SA 5CLQA 1IXZA 1DAGA 4XD7D 2CLCX 3T35A 4GOXA 2P6NA 1G19A 2QI9C 4TTPA 4YDHB 1RRPA 3QXXA 3CPEA 1ZNXA 5EXXA 4AY2A 3ZZ0A 5BYKA 1U90A 3K0AA 4LX0A 1UEJA 2O8EB 4BGDA 4BFWA 3K70B 4HAXA 3CWZA 5DE3A 1OYWA 4MKGA 1E2KA 1UJ2A 2AD1A 4TWZA 1GP2A 2BJVA 2X8AA 4D4KA 2P5TB 1XTQA 3VTKA 3LO5A 1KAGA 1XJ0A 2NO1A 5CYOA 4YONB 1J8MF 1L4UA 2AR7A 2WOOA 821PA 2R2AA 3U6KA 4BASA 1J70A 3GLFE 1NG9A 3NTUA 3ZDQA 4MGYR 221PA 4GOJA 4R9UC 4DCVA 5CK4A 4LJYA 2OV2A 4JLAA 2VPPA 5B30A 4L16A 2EYQA 5JWOA 1Z0KA 3FB4A 4QC2A 3WP0A 1ZU4A 1M74A 3JZMA 5IDVA 4XWOA 4B74A 1G7TA 2F1RA 3SJBA 1XP8A 4TT3A 3FMIA 1U94A 5E3HA 2W6IA 1J7KA 3DL0A 1E0SA 3B9PA 1N6RA 2X1VA 1AJEA 4G5OA 3DZ8A 4BWYA 3VAAA 1ZD9A 1D6JA 2WTUA 2VP4A 3MSXA 3B8HA 1D2NA 3PR1A 3CX8A 1D5CA 3ASZA 5GJVC 5CDFA 2WM9B 3AM1A 3A58B 3TVTA 2I1VB 2Q9CA 4AKHA 4BZQA 3BFXA 4HI0E 3OIYA 5C2JB 2O8EA 2O8CB 3VKHA 1NN5A 2QSYA 4IXNA 1FMJA 2BMEA 2EFHB 4U02A 2ZPTX 4AWXA 2QM7A 3AF4A 3HR7A 1NSTA 3QEJA 2DFTA 3X1ZA 4MRRA 2XTZA 3KJHA 1F2UA 3KUCA 4RZUA 2ZREA 1G7SA 1ZM4A 1UDWA 4Q9LA 1E2LA 3RLFA 1ZIOA 5FBWB 2G88A 1MT0A 2F1HA 4I1SA 2V3CC 4OI4A 3TQCA 4BFXA 2C9CA 4GOKA 1GITA 3QF7A 4CEHB 3IIKA 1Q1EA 3QVUA 4LDJA 2FOLA 5H8WA 1SHKA 4G5GA 4IDQA 4B47A 2ZU6A 3TSZA 4JBWA 1FPMA 5HE8A 3GJ8A 4NCNA 1E1QA 1WE2A 4FXPA 2GTPA 5EP1A 2UKDA 2O0HA 1II8A 1M2OB 3TR0A 2G6BA 1N5IA 2JA1A 4AKGA 2XTNA 4NTZA 4XSGA 1A7JA 3IGFA 1KKLA 1CR2A 2ZE8A 3Q5EA 3R9IA 5HZKA 2N46A 1YZUA 4ABYA 4HDCA 3P26A 3FFAA 4TMXA 1PV4A 1Z2AA 3K1JA 3NWJA 5FUXA 2ZI3A 5D3MB 3M1IA 4R71A 4W5WA 4MUBA 4P0TA 1ZIPA 1KK0A 2EWVA 4F38A 4WZ6A 2P6RA 3B1XA 5L3SA 3TSWA 1LS1A 1XCPA 2V55B 4KBGA 3C7KA 1AGRA 2IUUA 2QP9X 1W4AA 2CK3D 4Z1MD 1IN5A 3P27A 1XXHB 4BEJA 3R8CA 1NF3A 3SE0A 3Q8XB 3GEEA 2D2EA 1EFTA 4WXRA 1DEKA 4Q19A 2JEOA 1U98A 2PMKA 3NBZC 1NIJA 3GLFB 4HB0A 4B3GA 1OT3A 1CJMA 1CLUA 3K0AB 4KFUA 2F3TA 4O2LA 3UPUA 3NG1A 2REBA 2EQBA 2QT0A 4JLNA 5DH9A 2CE7A 1EWQA 2A2ZA 4DKXA 1G7RA 4LBWA 5DI3B 2AX4A 3IIMA 4UXJA 3CZPA 1T4GA 2IYTA 1IJEA 1ZM3A 1E4YA 5DISB 3BE4A 2OO7A 1WA5A 2F43A 3RC3A 3SYNA 3AVVA 1Z0JA 1IY0A 2PCJA 3ADDA 4NCJA 1JJVA 1BMFA 4QGAA 4P3YA 2XJ9A 3D8BA 4XJXA 1E98A 4OQLA 1PZNA 2D62A 1E2JA 4ZPXA 1L8QA 1DBSA 1N6LA 4B73A 5FI0B 5FL7D 3ADBA 3LW7A 2D7CA 3AQ4A 4ACBA 5KU1A 2FNAA 2OXCA 1CRPA 1AM4D 2YV5A 2O8DB 2ONJA 2XX3A 3IUYA 5E95A 4AYTA 3GEHA 2QPAA 1ZYUA 1Z08A 3PUXA 4B2IA 1DAIA 3QF4B 4MITA 5J5CA 2A5GA 3K0SA 4ESVA 3KKMA 3Q5DA 1E69A 1R5BA 2ZTSA 3OAAD 2WHXA 4PHFA 1NY6A 2YOGA 3SEAA 2IS1A 3B85A 2C8VA 1XZPA 1XWIA 2W83A 1NNEA 3GD7A 2GCPA 3DKPA 2FN4A 2WMOB 4TYPA 2ZSAA 5K8UA 1L2TA 4R98A 3RRNA 2KSQA 1UBCA 4KU4A 4IVPA 1J99A 1RIFA 3KJIA 1WBBA 2FE4A 1N0VC 2FU5C 1N25A 3ICEA 2QA5A 1KI6A 3I5XA 2ZRHA 5IK2A 3V9PA 5F3WB 5FTJA 5HCIA 2ZJYA 1KO1A 3K9LA 3TBKA 3BS4A 1LTQA 3CUEF 3EIHA 1U81A 3KTAA 4RVCA 3FKSD 5EE5B 1JXMA 1G18A 3FWYA 5AUNB 1DELA 2BBSA 3AP1A 3WYFA 3U60B 4Q9JA 2YOHA 1SXJC 4Q02A 1LB1B 2QROA 1T91A 4PHHA 5E4FA 1JI0A 1KTVA 2GRJA 4M1SA 4HLQB 2B6HA 2ZJ5A 5F2EA 1VG0B 2P3SA 5FPKA 3REGA 3JVVA 3OIVA 2RHMA 3TH5A 2J9RA 1EFUA 2QM8A 721PA 1UEIA 4KAXA 4OHVA 2FEMA 1BH2A 3SN6A 4FW9A 4N1AA 2VHQA 4EJSB 3HWSA 2ZJ8A 4Z1MA 4PXAA 2VTKA 2ZQ5A 1G3QA 2HT6A 4FCTA 1LV7A 3KFXA 2CBZA 2NPFA 1G8GA 2E87A 2ZXUA 4EPVA 1D8TA 3HJNA 4FD2A 1DAMA 3DVLA 4DDTA 3IBYA 1OXSC 4QOSA 5P21A 3ZS8A 1JXOA 5FPSA 4URYR 3T1OA 1UKZA 4MRPA 4AIIA 2Z83A 1HQYE 1YR6A 4P4UA 1KI3A 5TVKA 2HYIC 1TEXA 4L5BA 2V7QA 5E7JA 3WHKA 1O87A 1TL7C 3SS8A 1H8HD 5EP4A 1UAAA 4MQBA 4B44A 1JJ7A 3THXB 3CR7A 3SBEA 2GETA 1HV8A 1P6XA 5FOUA 1IBRA 1KNQA 4JLVA 2QRZA 2AFHE 1E96A 1Z0AA 2CHQA 3TW4A 1E1QD 1R0YA 2CLDX 3QPWA 1NJFA 5L3QA 1EFRA 1XCMA 2V9PA 2BMJA 4JL5A 4Q9IA 1CR4A 1T6NA 3K0CC 4ZKDA 3AB3A 4EQ6A 1XD2A 2GEVA 2W6JD 2QQ0A 4EQ6B 1V43A 4TSFA 4LV8B 1K6MA 1U9IC 2FSGA 4F7WA 1DVRA 1II0A 1XTKA 1OW3B 4FMBB 4M1WA 3FHTA 2CJWA 4YDSA 5AR1A 1HEIA 2QP3A 4HLUC 4P32A 3WNBA 1G5RA 1T8UA 3RVBA 4XIGS 3RNLA 2HF9A 1VHLA 1TEVA 3PUYA 5LBIA 4Y0VA 1P7CA 1UBFA 3BH6A 4C30A 1SGWA 3GMTA 4C0LA 2IUTA 4Q03A 1OV4A 4DJTA 2VSOA 4A0HA 3BD9A 2XNDD 3PEUA 3C4JA 3RANA 2B7BA 2DY1A 4WZBE 4HLDA 3B7GA 3EZ2A 3W34A 3T1QA 1R0WA 5TB5A 3UMRA 4JIMA 1Q57A 3KQLA 3I4LA 3MMPA 3K9GA 3UWKA 4MUAA 1KI7A 1SKQA 2ANBA 3EPLA 4S2EA 3AVPA 2NIPA 2G83A 2QTVB 3CB4A 2VHCA 3IEVA 2V6JA 2WJHA 4FMDF 1E99A 1DAEA 3HR8A 2FEOA 5JEDA 1G1MA 3PEVA 2BOVA 3NC1C 1E9CA 1IY1A 5FOVA 3RYTC 4NL4H 2F9MA 5C4GB 2GJ9A 4E09A 4LRWA 5AUOB 1M1YE 1E79A 4JMPA 4XVRA 1CJTC 5C18A 1QBKC 4AKIA 5TARA 5D3MA 5FOTA 4PPGA 1BS1A 4KJZA 1DARA 1UADA 3AF2A 1OF1A 3MWLA 2OE2A 3NBXX 4KHZA 3I8SA 1CR1A 4TT3D 1X6VA 4G01B 4A36A 3QKRB 3AEZA 3AVQA 3WYAA 2BKUA 5AJWA 3MRSA 2C77A 1ZNZA 4N0DA 2GJKA 3GLHB 4EUNA 4DLVA 3A4LA 5IT5A 3KQKA 2NO6A 4NYJQ 4OK3A 1FMLA 3QKSB 4TMKA 2AK2A 3G0HA 2E1RA 2YWEA 4PPQA 4BZXA 4L9SA 2BKEA 3ZQ6A 4XSHA 1IHUA 1GKUB 1P4SA 3CO5A 5DSZA 3TK1A 5FI1B 4Q4JA 4ZDIA 1NG1A 4OBEA 4CEHA 1G4UR 1SVSA 2RGNC 4MA4A 3U3JA 3UMFA 1P9WA 2CCKA 4O3MA 1KKMA 1HQCA 5TY0A 2ECKA 4GI7A 3RC8A 5JSZB 4A8JB 3LV8A 2ODNA 4TTQA 3WRXC 1IQPA 4MDFA 2WWFA 3L0OA 1NL3A 3DZDA 1Z28A 3A1SA 1GKIA 3DEFA 2OUKA 2C5LA 2Z4SA 1QRAA 2JCSA 4BECA 2ATXA 1NVXQ 1GIAA 1S1CA 1TF7A 3HU1A 4OYHA 2PCLA 2BBOA 4JBXA 4R2HA 1W36D 1Z6XA 3I62A 3OE7D 2J7PA 3Q72A 3LXRA 2TMKA 1KJYA 1C9KA 3W6PA 3GLGA 2P0EA 1RZ3A 3SQXA 4FIDA 4ERNA 4A2PA 3Q7QA 1E2IA 2AHOA 5B58C 4PZZA 1KJWA 1E79D 5KDOA 4FINA 1I4TD 5JWHA 2NQ2C 4B6FA 4LBVA 4Q4JB 4KCGA 3IO5A 3ZJYA 4E5UA 1SVKA 2FGJA 1ETUA 3EASA 4GP7A 5CJPA 3UANA 2IEZA 1NP6A 1OE0A 2XJ4A 4LV5B 1KGDA 2HUPA 1VDZA 2QENA 4PC6A 3DM9B 2O52A 2N1BA 3TUJC 3CM0A 3W8RA 2XB2A 5BN5A 3AKDA 4LJAA 1KDRA 3QKRA 3CKLA 3GJ5A 3QG1A 3BGWA 2VSXA 1PUIA 2H17A 4LYHA 1E9FA 3BK7A 3FKSA 4MKFA 2WBLC 1E1RA 1TU3A 2P65A 4N3NA 2QY9A 1QHYA 2ONKA 1E2HA 3TSOA 1YE8A 4Q1DA 5K8IA 1R0ZA 1SKYE 5JECA 3TGPA 2MMCA 5JMTA 1YQTA 1NVWQ 5AUPB 4Q9HA 1IJFA 1DS6A 1Z2CA 3DMDA 2VP6A 1VG1A 1YZTA 2GCNA 1G3UA 1ZRHA 3ZVMA 1RE0A 4ZDJA 1RJ9B 1PUJA 2G3YA 4L15A 1P60A 2VHUA 4LGMA 2FG5A 2XSZD 1GTVA 5GJBA 3T1VA 3NEYA 1X86B 2DFKB 1Q3HA 3B1VA 2WAXA 1OXXK 5A5GA 4O2RA 3QI2A 4QG7A 1X1SA 1E6CA 2BIFA 4JBYA 2R9VA 4GL2A 2E9SA 4JLDA 2WIBA 4IJMA 2QN6A 1UM8A 1KOFA 1TQDA 1D2MA 1SXJD 3GLFA 3K09C 2YC2C 4NDZA 4DLYA 3KUDA 4DB2A 1W49A 1NRJB 5EXSA 1E2NA 3T06B 1VHTA 3IHLA 3A6PC 1Z07A 1KO7A 2JIZD 3SI7A 3GLIA 3L0IB 1MO4A 3TRFA 1H8HA 2OAQ1 2BHRA 3GJXC 3QKUA 1M7GA 2A30A 4PQRA 5BN3A 4OL0A 4D80A 4DHEA 3N2IA 3MGCA 3KJGA 2FX3A 4DLZA 4PSKA 2IF2A 5KPDA 3KX2A 1T5IA 3EZ9A 4CW7A 1G8FA 1YRBA 4QBHA 1YZGA 2FH5B 3AH8A 4B71A 2H1LA 4I1VA 3REFA 2CLSA 3VHLB 1KI4A 3L43A 4UQOA 1FOEB 1XD2B 4NE2A 4C2TA 2V1XA 5CDFE 4B2LA 2ZVQX 4WBSA 1T8TA 2D06A 2ZEJA 3BIFA 5J40A 1YZKA 1CTQA 1XEWY 1AKEA 1KSFX 4D2IA 1CEEA 2ZM5A 4L8GA 3TNFA 4PSAA 4HAYA 4JT4A 1Q3TA 2ZI5A 3LLUA 2EU8A 2ZRBA 5FTKA 3R7WA 1FW6A 1G8PA 4O0MA 4M1YA 1XX6A 3EIQA 2A7QA 2QUZA 2AKYA 4KXFB 2ORVA 1GL6A 1C4OA 3PCRB 2XEXA 5BYJA 1W46A 2VF8A 2VP9A 3SJCA 4URXR 3VR6A 4XWKA 3EWAA 1S8FA 2DHRA 1VMAA 4JYBA 3D7MA 1NKSA 2CHVA 2ZSBA 1BIFA 4CDGA 3M6AA 1VG9B 2HCJB 4PSVA 4DLUA 4A1FA 3K53A
chains in the Genus database with same CATH superfamily
1DDGA 1PI3A 1OVMA 1B41A 2D0OB 4EELA 4Q1VA 4LXGA 2L6GA 2F8LA 4V03A 4IG9A 2JF0A 2PD4A 4GGMX 3IHTA 4WNIA 3EVTA 5EWLA 1J0XO 2R8YA 4PLHA 2GVNA 4RMGA 5JEEA 5F9FA 5HEKA 2R8PA 4X3CA 2WWHA 4J16A 1J0AA 4P3OA 2B1JA 1JMVA 2Z8ZA 2VWQA 3UJCA 1SC4A 4B4DA 4F11A 1TF2A 1P3JA 1ZH8A 3QLUC 4PRYA 5BOSA 2GA8A 3BRSA 3ER9A 4XPIA 4I1PA 2QTCA 2YYSA 2HD4A 1SCKA 1M7HA 5FDFA 2PPLA 1PWHA 1KHTA 3SHOA 1C3OA 3WAQA 3M4JA 5EJ9A 2H00A 1FXWA 5EWLB 3ZLBA 3ZWVA 3N76A 2GAAA 1J49A 1O94D 4LJ9A 1LF5A 3C3DA 1BFUA 3MJRA 4MW9A 4S12A 5IJ9A 4C5CA 4CQMB 3VTZA 2GAFA 3SAJA 2VJDA 3PI6A 4U9IS 4UZFA 1HZJA 4G8JA 1A7EA 4Y6GB 5FB3A 1WX1A 4ARSA 1YNSA 2CY0A 3LXXA 1H2HA 1VP9A 4CRWB 4KZPA 5DEOA 1U80A 1Z5ZA 1UKBA 5JSKA 3LM8A 4US0R 4E11A 1HNWB 3G79A 1EGHA 1HDGO 1X1TA 2ZDQA 2GN2A 3H7AA 3LBIA 3MAGA 1A9XB 4I6EA 3AHGA 1R4ZA 4E88A 1GZ6A 4EOGA 1JDBC 3G6WA 2HK8A 4B3BA 1DJMA 2PSSA 4BNWA 3NC0C 2E4WA 1HK7A 1SQSA 3R7DA 1YTUA 5BT9A 4EITA 1WNFA 4Q4HB 2D1RA 3EQ9A 2XS8A 3KAQA 1BDMA 1WCV1 1H22A 1ZH6A 3M0EA 4QGGA 3O3CA 4ZCLA 5AW5A 4DA9A 1ECPA 4F3NA 4O2BB 1JFTA 4MIKA 1Y8QA 5JFGA 2COEA 1A8PA 4NMMA 1YJ5A 5AW3A 3HDHA 4DABA 4LHWA 3KZVA 1CDEA 3AETB 3G0IA 4TM7A 2DLCX 3X1KA 4R1PA 3A7EA 3HS3A 5HDBB 3CA8A 5ADHA 1KH3A 1KYXA 4IHJF 3EVCA 4Q1CA 3DVAB 3WWCA 1CUDA 2X8LA 3E15A 3OU7A 1C1DA 1QIIA 3H5WA 4IIJB 4URVR 5EHQA 1PJZA 1TM3E 2H51A 1D0SA 4BP3A 4TTAA 4MW2A 3ZWCA 4EJSA 1DMSA 4B0OA 5AKYA 3EPJA 5F9HA 3A6LA 1D7OA 2HWWA 1A5SB 2BR3A 2RHHA 2ZAGA 4G56A 1FS4A 3AVUA 1E1KA 3FE2A 2XWBF 3A2MA 3FPJA 1WTCA 3PWZA 1D9XA 3T4RA 5AKHA 5IVDA 4HGPA 4D4MA 3EZIA 1M0WA 3S2SA 1FZTA 2BE7A 2OYSA 2IWRA 1E63A 2DM6A 3H2SA 4RA6B 2HF8A 4XDHA 4UU0A 1NWCA 3X1WA 1L8OA 2DUUA 4DIDA 5HJ5A 4JCHA 1Q1QA 4JC7A 2OHJA 1NHGA 1O7JA 4S1NA 3VR3A 3KQHA 2H2DA 2C84A 2RG7A 1KK3A 3EFHA 3U3FA 4RH1A 2ZZKA 4KYTA 3WO0A 3VI4B 2YCBA 3I4CA 3F97A 3GRVA 5GOZA 1N2CA 3R6WA 3IP8A 1TAGA 1PFUA 4V1CI 1Q6YA 3GLIB 5DGCA 1JDUA 1OH8A 4C2UA 4QFDA 1VKJA 3UV3A 1ZIDA 3HCAA 1ZW1A 2DBVO 1T0UA 3HDJA 2CFTA 3I0ZA 4BN4A 1IN7A 1Y4CA 1X3LA 2WJ3A 3NO4A 4WKNA 1EVLA 1EGMB 3W77A 3OFNA 2F67A 1MZVA 1MJ5A 3SG0A 4GAEA 4MVJM 4S35A 2VJBA 2FQ1A 1JZQA 1N2OA 5K20A 3FPKA 4X1KB 1YFLA 4AJPA 2V1UA 3CH4B 3UATA 1YF3A 4YLGA 4KXVA 3MQ2A 4J0EA 1AQIA 4E07A 2FOIA 1DC4A 1RMQA 4GBMA 1RRKA 1A9OA 3TXXA 3MOGA 3U40A 4US2R 3GM1A 3ZWPA 3TAUA 2WJJA 1XZLA 3UMHA 1DQPA 3OBIA 1EMDA 4DDMA 3Q88A 2G62A 2GZDA 3N2YA 1E5DA 1LQ2A 4PK4A 4RD2A 1ODJA 2CHFA 4BO9A 3HADA 1OBFO 2QL6A 1ZSYA 3BRCA 3KEFA 5KINB 5COQA 5A3JA 4DLLA 1HEUA 2ZQYA 3P9RA 3CEXA 3R6GA 4OFZA 4ALNA 1IZ7A 5EIXA 1DQYA 5FUMA 3OY7A 4H16A 4RXTA 2A1DD 1Q1BA 2GHTA 5I7RA 5LPNA 1UBSB 2HAEA 4JA0A 4K26A 4WSOA 3THOA 5HZMA 3KT3A 4HWGA 4JT2A 5UKDA 2D7JA 1RD4A 3AVYA 1DIHA 3DMPA 3ZZMA 1VB3A 4BVAA 4RHYA 1DGQA 5F78A 1WUIS 2PXHA 3BH7A 2FFHA 5JFOA 1Z63A 2WPDD 2DB3A 3L4SO 1MHTA 1U31A 1XSEA 1NVVR 4HFRA 3GBVA 1A1SA 2DTEA 3L93A 5CTAA 2ZWMA 4HL6A 4C2AA 3HL4A 2X6RA 1FDWA 5JQGA 2N75A 1LY1A 4BNYA 1Z35A 2VJQA 3BGDA 2KC3A 3QU2A 4IIFA 3FF4A 4MB2A 4D9GA 4LTNA 4RANA 5CGZA 4FYYA 2AG1A 3QKIA 4PO1A 3T3HA 1QTIA 2Q3EA 3JQ7A 3OCWA 4RMNA 3QFCA 4K3VA 1YIDA 5KNBA 3ADOA 4B3FX 4HYTA 3GBSA 5FT9A 1EXWA 4HDSB 4HK4A 3I2FA 4ZVSA 1SCUB 1P1BA 2B61A 4IO0A 4NMLA 3Q7IA 5I3CA 1ZESA 4MS2A 2ZB8A 1YB5A 1ESMA 4JOCA 3IOCA 3A1FA 4K9NA 4ZU3A 4J75A 5KOHA 2ZJBA 4TN5A 2ZK7A 5CCBA 1DWPA 1EXMA 5K3FA 3M1AA 1P4RA 4XYMA 3HO1A 1A8UA 4ZCMA 1NURA 2OHGA 2Z2ZA 2VPIA 1L7XA 4FOTA 2CXNA 3UF0A 1C9EA 3K6KA 4C7OB 1OCRC 1NI4B 2P5YA 3AJRA 4MX8A 4TT8A 1GZSA 4FBGA 3FVYA 5KDDA 4O25A 3MLGA 1E6LA 2CLEB 2QU7A 2E6UX 1AQYA 2ZVPX 4RHCA 1E3LA 2RBGA 4LYFA 1NJ5A 1TUGA 2OCYC 3B0VC 1AKRA 2QLBA 5EZ5A 2A35A 2FG7C 4LBYA 1IZ0A 1EUCB 1ZO8A 3CXRA 4D42A 4FWTA 1PD1A 1XTUA 2Y1DA 4P4SA 5HIAA 3AV3A 3RU3A 1RAIA 3CNQS 5EJAA 5JVDF 3PKZA 3UUFA 4KIFA 4QBIA 4S1OA 3UKOA 3JX9A 3RS7A 2IHVA 1P9LA 3WBJA 5LNK6 1QFJA 3DBHB 3MMNA 2AEFA 2VUTA 8OHMA 2HXSA 3PFWO 1EH5A 3SYMA 3R2PA 4TKVB 3CY6A 5FPYA 3TDKA 4J29A 4YP9A 4F5WA 3DJNB 1SVNA 1OLXB 1CS0B 3TJMA 4YJWA 3BICA 4DCOA 3EDRA 2PEYA 4L2IA 5EIHA 1GAJA 1XXHE 4L6RA 1TZBA 3RS3A 3AVTA 2H3HA 1TVKB 5AOVA 4NPHA 2YY7A 2OJED 1WAMA 2FRDA 2I6GA 4EHAA 5L95A 4HD8A 3LUGA 4P1ZA 1G3RA 5AOCA 2R751 5TXGA 4GKJB 1C03A 3O8QA 4TVBA 3VGPA 4JOBA 3X1DA 3L18A 4K86A 3WYDA 2FUG1 5B7PA 2R1ZA 3RGWS 1HKUA 2XDAA 3PUVA 4BLVA 5BRJA 1DTEA 2YWHA 1Q7GA 3P52A 1A2BA 3FVVA 3VUFA 5LP1A 1B73A 2V6FA 3EZNA 3OZGA 7ABPA 2ZUUA 1E2PA 5KTTA 1BFDA 3LLKA 1H3NA 1MZPA 2RKBA 3DEYX 3NIBA 5SY4A 4BJ5C 4X6LA 4F4JA 3CX6A 3NHBA 1C7IA 5K0LA 1W5EA 3HNLA 2HCTA 4O2AF 5HIJA 4DJFC 1VRWA 2J9GA 2JGDA 3CINA 3R8XA 2AG8A 3VPXA 2OCPA 3ENKA 4R1TA 2CSUA 4DBQA 4MO2A 3B5EA 4UXIA 3ASUA 4B8ZA 4CIBA 4Z6KA 1SQGA 4X1IB 3PQEA 4MVJI 1H1LA 3T9AA 2X8JA 1JR8A 2CFOA 3SKXA 3B82A 1ZIXA 2O9XA 4FMPA 3H9CA 1ODSA 1CJUC 1MV5A 4NBWA 1YCHA 3LWNA 1CZHA 3I2GA 1BXRB 3T5GA 1NXOA 1ZXLA 4J94A 4EG4A 4MZXA 5I6DA 2DR2A 1HY5A 1R64A 2DH5A 3O2SB 4MGKR 1GSIA 1DTWA 1R66A 1ULHA 2ECOA 4EUHA 3I9V6 3TZKA 4RY2A 3QZCA 2PTHA 1ZN7A 1I3LA 4G4SP 2XB6A 4I1MA 1AH2A 5IW8A 3SIWA 1ETHA 2VYVD 2ZJOA 2VRCD 3KFLA 4MVCA 3WMWA 1DIGA 5ICCA 3E3LA 4PC3A 1N5OX 5CNKA 5J4VA 1BKDR 4KO8A 4OKIA 2R9RB 2ZUEA 1TA4A 4IH1A 1T5LA 3LFTA 5M7EA 3QEKA 5A62A 1WQ3A 2I76A 4FHCA 2GD2A 1NYLA 1V48A 2XGMA 3GUYA 3IDSA 1BGXT 2YHIA 4QODA 2VP2A 2JVJA 1JQ3A 3E82A 4RF3A 2R02A 3GANA 2NO5A 2Y27A 3DKKA 3DUFB 3REOA 2FFQA 4D8TA 4E09A 2P9YA 4LHZA 1Z8NA 1LZKA 5LFAA 3KYDA 3LPAA 2HMZA 3WLSA 4OF4A 1JILA 1JPVA 1Q0RA 2FLKA 5GGYA 1QX3A 3MG9A 3W5BA 2Y1CA 4ZVVA 2P7IA 1SBCA 1I7DA 2JLVA 4LZOA 1YARO 3UUWA 2AIRA 2PGXA 3M82A 2RMKA 3F74A 4ZQGA 5L0GA 1ZJJA 4K7JA 1SK8A 4YY3B 4QFCA 2IUSA 2OR3A 2Z1NA 2JFXA 4PHCA 1XZAA 1KI8A 2XWQA 1N9ZA 4MRNA 2I7DA 4B8WA 2H85A 4CEIA 1LBSA 1UM9B 2FVYA 4P81A 2ZWPA 2ZVDA 2ZBGA 1W0JA 1XXLA 4R9NA 5ECYA 3WGLA 3O84A 1I80A 2WQ6A 3CURA 1NATA 5IFLA 2XZLA 1JEDA 3JXEA 5BPHA 4KRFA 2C2BA 3E9RA 3L07A 3WGOA 3JZ0A 1PG5A 2ZT7A 3ZCPA 2OZLB 3GARA 4EPVA 4FGLA 2A9JA 2J5XA 4V0MA 3QU9A 3JAKB 5D91A 1FPQA 1OLXA 5BRNA 2QLMA 2B8WA 3BSSA 1TZCA 3W7VA 4QBFA 5JZVA 3DP7A 1PU2A 2DFVA 3FR7A 2F43B 4L6AA 4Z2AA 5E38A 2B83A 1XPOA 3EPHA 4B4KA 1VLZA 2ZXOA 4TMYA 4ULVA 1KXZA 2BSXA 4ER9A 5AHWA 2OXRA 3ICOA 2AZXA 5D84A 1XVUA 4G1EB 4N6GA 1AXRA 3PDCA 5A4KA 5BSVA 2PF4E 4LYYA 4DCUA 4OIPF 2JDID 3BFVA 1SO8A 1XTSA 3ABQB 3HBMA 1TTQB 1T0HB 4F6CA 3T6GB 5JI3E 2EP5A 1FXSA 3K8OE 4YRAA 2EIXA 4RVGA 1TWAA 2PFKA 2H0AA 4JC0A 3WZ2A 3MJVA 4BE9A 1Y1TA 3OOSA 4E6PA 1T8WA 3VH2A 1QU3A 3RSHA 4QAJA 1QTNA 4J0JA 4B46A 3WGUA 5IUJC 2YMMA 1KOGA 4OGKA 3IUNA 1FFDA 1JBKA 4HNQA 1WKBA 1H4TA 3CSKA 1QFZA 5B1SA 3ETEA 3B2EA 2KJQA 2Q1XA 4GSLA 5DW0A 4FYMA 4KVAA 3DAGA 1ZW6A 4RIIA 4LXUA 4P38A 5BR7A 2DI3A 1EQ2A 4BC1A 1ODLA 1T1GA 1OBHA 4ARBA 1R6UA 3SF8A 3RKUA 4GBGA 1FQOA 1YZHA 2GT1A 4HZIA 1TA9A 1P72A 4PO8A 4X92A 1OPXA 1EFVA 4V0SA 1EVIA 1HMDA 2QI9F 1MC1A 3Q87B 4K6OA 1VFPA 4CU2A 4FCWA 4J2HA 4CNQA 1SRQA 2WW8A 1CB7A 5A6AA 2HGZA 4HYYA 3UW3A 1UOQA 4BX3A 3KTAB 2I2BA 1N2JA 3BXZA 1I13A 4MWTA 4EG6A 4MGHA 4R81A 2SKCA 4YJKA 5TT0A 1XQYA 2YXEA 3AUUA 1GEGA 3VSAA 3V4FA 3GF4A 5KWEA 2IYAA 3GFTA 4U9HS 1JIQA 4UASA 3RG8A 5AO9A 2DJIA 1GTZA 2IIBA 4FNOA 2NYVA 5H16A 5JO9A 3RT9A 4L3VA 4OREX 2J0XA 1ORHA 1P39A 2VQ6A 4UXHA 2WHYA 2TRSB 1C1XB 1CUGA 3M83A 3ZBPA 1G4US 2WTXA 4NV1A 2YJ4A 3IUEA 4FIZA 2YKZA 2BEUA 5HZHA 3GWZA 4JLMA 2LCQA 3WSVA 4ZJZA 7GPBA 1XMIA 1E6KA 3MMSA 2WIAA 2WB7A 3DM5A 1NNI1 3OPXA 4MGZR 3RTDA 1O5TA 2M1ZA 5FLEX 5AJUA 1IULA 3W6ZA 4CEJA 3CPSA 4E4RA 3LEOA 4ND6A 3JR3A 3FJOA 5EGYA 5ALXA 1E94E 3F96A 1JH9A 3W4YA 1BVHA 1YDWA 4V02A 1D0ZA 2J85A 3LHKA 4F7DA 3PGVA 3JRTA 1YQUA 4PTYA 4AKSA 4XJVA 1UWCA 4YGYA 3HKEB 4POOA 2HGSA 3C62A 1NVGA 3DZHA 3KNZA 3PWTA 4IV8A 2I78A 2RFLA 3ZGXA 1W4LA 3NUQA 3BGOS 3ZLTA 5AW9A 3FBTA 3OO0A 3UT5B 5C4IA 5AW1A 5ELXA 2Y3HA 3NYLA 1MQ8B 2H18A 2WEKA 4R0NA 4UBJA 4ZRMA 4BIIA 2LCHA 4BV8A 2IIQA 2V7QD 4N03A 3DXYA 1E2MA 5BW6B 3NW9A 2B1QA 4ARZB 1GWNA 2D1FA 5K0CA 4ALIA 4RZ3A 5LR6A 1E3EA 1GG8A 4G1CA 1JQLB 4RH0A 4EA8A 1P1RA 1ULBA 3DMYA 5I7UA 1I51A 3N86A 1EVEA 3PF8A 5IN4A 4K1OA 3IDQA 3N2GA 5HMLA 2NSDA 4DLPA 3BBLA 3A2LA 1CRQA 4RZSA 5GJWC 4BLRA 4EA6A 1A97A 3TPFA 2BV3A 5A06A 4RH3A 1I4EB 3WSWA 1RXSA 3IMEA 5C1BA 3BD7A 3LDAA 3K1YA 1TFKB 1YL5A 1U9IA 1G6OA 4DNQA 1JNXX 4MYDA 1XU9A 3W3AA 2YL0A 3MILA 4ZOLB 4NBRA 2NZXA 2DFNA 5EPEA 2WYOA 1WWKA 4ZGGA 1JJIA 2ZBEA 5G3YA 4Y1RB 4AG5A 5B6PA 1BDBA 3JQAB 3KALA 2OCXA 1TU4A 2UYHA 3CH6A 1CIJA 2FK8A 5ALYA 3S0JA 1AF4A 3W7AA 3I92A 3TULA 5ALTA 2DZDA 4P83A 3FNHA 4XWAA 3GEGA 5EQTA 3ICQB 4WESA 3LCUA 1R0CA 2CK3A 1CK4A 4J91A 1G21E 2CDAA 3DDOA 4MP6A 4OB8A 1ZJ5A 1OI7A 2ADFA 4Q66C 5AJVB 5EJ6A 3MA0A 5U9CA 2GM3A 4K6HA 3CGGA 2A78A 2JKVA 1SQ6A 2V0GA 1Z62A 3G6KA 3F7TA 1SXJE 1U3TA 4G5SA 3KQSA 4U2KA 4XGRA 5DO9A 2FZEA 5K4HA 1QU2A 4PCAA 5DCWA 5IJ0A 1PEYA 3CUUA 3KBBA 4D9FA 5A5FA 1DLIA 2OG2A 3KOZA 3L1KA 2D1TA 3NT2A 1OFIA 3PIIA 4C0HA 1YDIA 2QN1A 4G23A 2A5LA 1T9ZA 2LIVA 2DYSC 3B9QA 3NTOA 1IB0A 4WESB 5KSPA 4DG8A 3MC1A 4L5JA 1M1UA 5DT2A 3VVMA 4UOZA 3BG5A 1FDOA 1V1JA 1ADYA 3DWFA 3MRTA 1VCIA 3OOHA 4RV9A 4TL9A 4CMIA 2HQSA 2ENWA 3EZGA 2P9JA 4CMKA 3A4MA 1SCNE 2WZBA 4INZA 3GVXA 1OW8A 1ZHYA 2AZTA 3H5TA 1FYDA 2XGOA 1EK0A 1D09A 3BAFA 4ML3A 4M9RA 2CCGA 4LK3A 4S1WA 4YUYA 3OE5A 4GT1A 4EVIA 4R2JA 5KB3A 2IBTA 2ORWA 3QNMA 3RU2A 2KLBA 2PK3A 1M0SA 1QNLA 3DOJA 4Z8YA 2JD0A 3UMJA 4IOMA 1JMKC 4HUQB 1BCSA 4G1VA 1IFXA 1PSWA 1SBHA 2IA5A 3ZY2A 3QY0A 5F33A 2WA2A 3O91A 4D8XA 3O8RA 1DJNA 3C74A 3JQQA 3L77A 5A04A 5IANA 2RHRA 4POAA 3OF5A 4JUAA 1PQUA 4HPXB 2FWRA 2JI7A 2WUDA 3ASYA 3B3JA 5CJJA 2GCOB 3A4VA 3C14C 2HJSA 3E53A 3HCBA 4V1CB 1ZR4A 4ITUA 2G40A 3WMGA 1Q0KA 4HQKA 3SSAA 3C18A 5JCJD 3UKDA 1T3GA 1EWTA 4D9JA 4CQMA 2AD5A 4J4TA 4MV7A 3NTVA 4ZQHA 4CLHA 1A3CA 2ODQA 2WUEA 2NYUA 4KQ9A 4UVEA 4JSYA 4ZD6A 3GLHE 4J1QA 1BE6A 3L8EA 2AVNA 1HSZA 4ZI7B 2J45A 3A3KA 4IRMA 1H93A 3E7XA 1R6BX 3HKCB 2O19A 3WFJA 2DWQA 1K08A 3FUCA 3AUFA 2OEVA 1UMCA 5HFJA 4WOCA 3W2VA 1F4LA 3NJ4A 3IJEB 5AVRA 2O8CA 4WCDA 4N8DA 2B1IA 4UUAA 3SICE 2O7SA 4AY3A 2AX3A 3LUPA 4MJ3A 1DRJA 3O8OB 4R51A 3SJUA 1BMQA 2AR9A 3DXXA 3KZOA 3NX4A 5CITA 2XE4A 2KYHA 1RQRA 4K9QA 2FFAA 4BE7B 1WDKA 5F1OA 4H4DA 1WXWA 1IBCA 2XMBA 3ESYA 1E2EA 3L8DA 1IUNA 5F35A 5FFMA 4ZHQA 1L4GA 3PJGA 2A9QA 3DO8A 3EWSA 3I1IA 1FFGA 3I32A 2BFFB 2G9NA 1WATA 5BORA 1Q84A 2OG1A 1ORVA 3ZVRA 1GNQA 1RWXA 4MLPA 4Q9DA 2BFWA 4M9SA 4M37A 2FSHA 3EVZA 5HIMA 2O06A 2LDBA 2CC2A 2QTRA 3VYUB 3MELA 4BP9A 4W9MC 5AFSA 5EIWA 3VYRB 3VR1A 5K3EA 2BM1A 3RYHB 4IWBA 3BCHA 5EIEA 1OWPA 5GM1A 5TJ9A 3ZNOA 4QPCA 1W48A 3AGTA 2C9BA 1XQWA 4TS4A 3G89A 1H2WA 2YLGA 4KI7A 4NI5A 6NULA 4Q1AA 4X3PA 4X8HA 4KDFA 4YPOA 2Q5JA 4Z54A 4OOEA 1CY8A 2ZRCA 5FPKA 8MHTA 4MJLA 1WW2A 3GCGA 5IEJA 4D3XA 3HXPA 1SJ9A 3DOUA 4O8ZA 5KNLA 1ULZA 1HFKA 4MV0A 3NNDA 3UJDA 4GQIA 4O4JF 2X9NA 5AK0A 4HLNA 2RH4A 4V0NA 1UJCA 2FKAA 5KQPA 3K32A 5SYAA 3GUUA 4G78A 1Z29A 2YJTD 3UPTA 5EUCA 5B4TA 2CKDA 3VU9A 3R0XA 1RDFA 2EF0A 4G67A 2DKNA 1T9BA 1ORWA 3V8PA 4DVGA 2FPXA 1NQUA 2ZIUB 2KMLA 2Q5EA 4URZR 4YIKA 3N2GB 4HAVA 3IUBA 1NJ2A 2QMOA 3ONVA 5LXTA 3ET4A 4C43A 2WDZA 4K81B 4WABA 1X8XA 3KZCA 3N53A 4GYKA 4L2IB 4AZTA 4UTVA 5GINE 1CJBA 2ASRA 3D2CA 1IHXA 2Q1WA 1YZYA 2QW1A 2VL7A 3HNOA 4R7TA 4GPIB 1W34A 4FB5A 4R1LA 2V7EA 3HCEA 3PEWA 4YJ3F 1AKVA 2V6MA 1CQIB 2PSEA 3H84A 5BMVB 1PLJA 3SEQA 2WU0A 3OHSX 3D9QX 3EW9A 3M4ZA 4YMHA 5LDDC 1VP3A 5DHAA 2LPMA 4N12A 3RVLA 4XUEA 4NE7A 2XUHA 1GZ5A 5ALPA 4DT1B 4F72A 3G2PA 2D8MA 1I2DA 2OWEA 1H2AS 5BP7A 2AZ4A 2FR8C 2NXWA 5GADl 4EK9A 4PLFA 3WKEA 2QNBA 4ES6A 3CVWA 3TD2A 4BZWA 2ZSFA 1O6BA 4LZAA 3HHEA 2IS4A 3WWDA 1F0KA 2WSMA 3OTIA 3NYMA 1GRRA 2LR0A 3AKCA 4DMHA 1LDMA 2BHTA 2FPOA 1Y89A 2CW0F 2DQ4A 2FCAA 2YZKA 3ICPA 3IRUA 4W9NA 1EJ0A 4C0KA 5LZ9A 1W87A 3OQ1A 3VC1A 2J3DA 5EI5A 3ONFA 1EESA 1U0FA 3W2EA 4KTTE 4GG1A 1GPKA 1NXWA 2BF4A 4RM3A 5C3MA 3MCAA 2K6GA 4AUKA 1XDSA 3IQEA 1U7ZA 3JW8A 1KYIA 3K0EA 3KBOA 4ZVTA 4EUKA 4N4AA 1M57C 3V55A 2HQBA 5LP6F 2HMYB 1YAJA 2QUJA 3CLTC 1OI4A 1EE2A 2EG5A 1JJFA 3Q3IA 4Q6WA 5EG5A 1XEWX 3T7DA 3ERCA 1U9ZA 4M0UA 3EH1A 3BTOA 3CJTA 2CZCA 3VVLA 3D64A 1LLDA 2VBIA 1DOZA 1Q14A 1PYDA 1QHSA 1RXEA 1W8IA 3OESA 4IKPA 2V54A 3H0KA 4RV4A 3WGVA 3ESCA 4Y2SA 4NICA 4YAOA 4YT8A 1FEZA 1A96A 3MYIA 1PNVA 2FDRA 2QAGC 4OIFA 2IUYA 1L5LA 3HR4A 3AR7A 1YB1A 4F5ZA 5IVHA 4BPMA 1EFCA 2W2LA 4M55A 2R0QC 3U48A 4D7AA 4D0GA 2IC5A 4DC1A 3IQWA 1A5BB 4IUYA 4EUFA 1U0HC 5KYYA 3DS8A 3SKVA 4H1TA 4EBBA 5IT0A 3E9QA 2V9CA 1XT6A 1B68A 3DDNA 5G1PA 1KEPA 4DAOA 2R7VA 5TMDA 3M5CA 3HB7A 5CA1A 4TTJA 3ASOC 1TCAA 1V9LA 4DA7A 1P1HA 3KKNA 4V0ME 3S3TA 4EFKA 3AR6A 1I0IA 5EIOA 2YFHA 5GVSA 2LP4A 3O8BA 5H3LA 3AOEC 1QE0A 2P2ZA 4JLJA 4B09A 4DARA 5BV0A 1Y3DE 2ZT8A 4BATA 4YGXB 2RGAA 2JFGA 2YZNA 2KLHA 3RSLA 4AUNA 5A4DA 3IODA 2WMNB 3IT3A 2P5UA 1T43A 2PMDA 3KP1A 4QQKA 3ZWWA 4RHUA 4YCJA 2BJWA 3VKWA 1OREA 3HJGA 5J43A 2LKCA 1QYVA 2NU8A 4HVLA 3AF0A 3CO0S 4AMUA 2ZJ2A 3L41A 1E9RA 2OGSA 4PNEA 2Y0PA 4TYYA 4FHDA 4W63A 2GBLA 2O6HA 3NUGA 4Y2QA 4QNNA 1O3YA 1JQJC 3Q7RA 2NACA 1LM3B 1DMRA 1M8PA 2YQ5A 3LPDA 3ZWOA 1W0JD 4Y2VA 4FZ5A 5J2TB 1YJBA 1I1NA 5A0TA 4GF5A 4QARA 4O4HB 4WHMA 2Q0XA 3CH7A 4JC8A 4PLWA 1M2EA 5KOYA 4HNAB 4X44A 2ZB2A 4N47A 3TKLA 1EVKA 3OFSA 4Q7KA 4JL8A 4WDRA 3UMKA 1YL6A 4HH3C 4CMBA 1QVAA 3T52A 3OCYA 2EW2A 4JTCB 4UEWA 3S1AA 1QG6A 4BVJA 1EFHA 5L7TA 1AUEA 3ZV6A 5F7XA 4KMSA 2NPFA 4B3SB 3LX4A 3AFIA 2C83A 1J8DA 1ZMXA 4P4TA 1BE1A 3UAZA 2I2DA 4BIMA 2EPMX 2Q2NA 1IVNA 4JSTA 4BFVA 1O6FA 1YR8A 2GBGA 4KZKA 3CEHA 5J5AA 1R8SA 2G17A 3D4IA 3V7YA 2A84A 4LMRA 4GX5A 4ATNA 1LE2A 1KVRA 4QXOA 3V8QA 4LTDA 4CE6A 2C9YA 1ZRNA 1G8HA 3F78A 4OQ4A 4BGUA 1NXVA 2FHPA 4KYUA 1SXGA 1VSVA 2ZCUA 2ZQZA 1KL7A 5G0TA 3P9SA 5IFKA 1U5CA 1EG7A 1SB9A 5FBVB 4AY5A 3OIGA 1GVNB 1HMPA 2K7ZA 4WDQA 5F7ZA 1DOAA 5LA6B 4BEWA 1MRNA 3E84A 4AZWA 3ZBTA 1ZM9A 3MS2A 5C5CA 2Q5OA 3IPRA 4XPYA 2FAXA 3LDHA 3LX5A 2HOQA 2HWKA 4S3MA 1FTWA 3OEED 4WY2A 4YK7A 5ESXA 1UQRA 4G5YA 4HUJA 4NS4A 3EAGA 1E61A 1X14A 2P0NA 1NVVQ 2C96A 3U4DA 4UM7A 1NQTA 3UKJA 4LNUB 4QI2A 1CVIA 2Z5LA 1XDWA 3IP9A 4IILA 4U8HA 1P4AA 1Q92A 4GDMA 2OTCA 4JN6B 4A9AA 5AM3A 1TT5B 3ZIAA 3I1JA 3PC2A 5C9ZA 1Z8FA 3QLTA 1HSOA 3DVAA 3CH5A 3GRRA 5I01A 4OJMX 3C85A 4C22A 2NZJA 1X7WA 3HY6A 4ZZ1A 1ZCJA 1EFAA 3U2QA 3H9UA 4HRAA 1FP2A 2Y1WA 5KJ1A 1L8XA 4FYHA 2O48X 2R8RA 3IBTA 5DHFA 4C4YA 2JI6A 4B6PA 3PD1A 3D2BA 3JD2A 2CNLA 3LY9A 3OJXA 3SZRA 3Q2KA 5GV8A 1U7HA 1KE2A 1G8MA 4BNHA 1M8GA 3CCFA 4GSYA 1I3MA 5AK6A 3T34A 3HGTA 4BGVA 1FU8A 3KSUA 3C4VA 4WA7A 4WKGA 1ZKMA 3SQOA 3AG3C 2B35A 1O8BA 2XVMA 3NI2A 3P2MA 3GJTA 4F2WA 5EESA 2D0IA 3IEUA 2EFDB 2J07A 2V7BA 2XWSA 4JA2A 3OEEA 1AB6A 2FW1A 5EIBD 2VDNB 2KX7A 2DFPA 1R2QA 1AB5A 2QLAA 1ZINA 3UTDA 2I34A 1ECLA 1KNXA 1O1YA 1W4ZA 1XCBA 1Y7IA 2FN9A 2HEGA 3AI2A 3O4GA 3OE7A 4NFLA 5T7BA 1Z0IA 5JJIA 2W4BA 5ILOA 2XD4A 1QGYA 2X0JA 3DYIA 3BFJA 1EAMA 4PSCA 1VOMA 1ZC3A 2B34A 5KNBH 3KK0A 4LZPA 3ZKAA 4PAOA 1C9NA 4FR5A 3K15A 5EOVA 1J5PA 1P4GA 2PBRA 1N6HA 3HVUA 5E9QA 3Q8LA 1KMQA 4KI0A 1BWSA 4JP5A 1VLMA 3MW8A 1JB1A 1ZHZA 1V4NA 1WXQA 1BQ4A 2ACKA 2ZUWA 4HDMA 4IVQA 3JZDA 4R16A 4F1JA 4MXDA 1KDOA 2PMCA 1QK4A 3BEOA 3PC3A 4OHPA 4RZHA 1XTRA 4Y7CA 3TBFA 2GO7A 4RVOA 5F7OA 3HYCA 1ZJZA 2GYWA 3WK9A 3J81k 1T5OA 1ICEA 1M5UA 3LH5A 1AV7A 3QY9A 3O7WA 4DSTA 5BUCA 2M6LA 3R76A 3LLVA 4KIGA 5E2BA 2IZ5A 1JHAA 5CEJA 5LL6P 3K31A 2WJPA 1GDTA 3Q3VA 2IXNA 2XVZA 3E0XA 4LRXA 1CCWA 1ZS9A 3JQCA 3DZGA 1KEWA 4PRLA 1LDGA 3AVWA 1Y37A 1E5VA 3O4VA 4HRVA 1LBIA 2WTMA 5SYNA 3VX4A 1ONPA 3C5EA 5AVVA 1JHUA 1G55A 2H4JA 3GJZA 3IQHX 4XWJA 4MCIA 3JASA 3MD9A 3SX4A 1ULUA 1GR1A 2WFAA 3H2YA 4OHKA 2XMDA 4UVDA 5HK8A 4DKJA 3GELA 3A1TA 2JLWA 1HDXA 1GXSA 3RREA 3QJGA 4NEQA 4DT1A 2IYZA 2XQFA 1G20E 3IJ5A 1ND6A 2CLKB 2YV2A 2PBZA 2EZ4A 3P45A 4MQEB 1W581 4UNRA 1YR7A 2PIDA 3ADPA 3PHBE 4OHXA 2Z56A 3PUZA 2O2XA 1PZHA 4IUDS 5JSHA 4X60A 1UBUS 2FUKA 2G3KA 2WJGA 1H0KA 2PX8A 3SEFA 4ZDWA 4BVBA 4JGBA 4O1MA 2VATA 3PXDA 4M1TA 3K6SB 4F46A 1OJ7A 2EBFX 4G09A 1RI2A 3GGOA 4P0QB 3D8UA 3AUSA 3E05A 5KYWA 1GDDA 1YGPA 4I4CA 1PBTA 2B69A 2PBLA 1PGNA 4QLAA 5CVJA 4GFDA 3LI2A 3IVRA 1OWOA 1SCQA 5C35A 1QS0A 3W2HA 1E83A 4EI8A 5BUSA 2HWUA 2WSSA 4RPIA 4TLAA 4BBPA 5L51A 1TZ2A 2ES4A 1X0VA 3D0KA 2BHLA 1T25A 2XZOA 4JBHA 2B78A 5CI8A 4CS7A 3CNOA 3WRYC 5HF9A 3TDMA 3AKYA 2OO3A 1W93A 3GPDG 4MW4A 2CUZA 1XCGB 4HEJA 3WP1B 5IDXA 3NDBB 4N0QA 3OZXA 3NWPA 4YP5A 2WAYA 3IAEA 1H8EA 4B75A 3MJDA 3W90A 6LDHA 4NK4A 3BWVA 3EC1A 2A86A 3EC2A 3I0MA 1TM4E 2QTAA 1TCCA 1ZWKA 4BMPB 2H2IA 2IYSA 2ZE5A 1G17A 3YASA 4L4XA 4W5JA 3OX3A 1O5HA 4W82A 3WDLA 1NBEA 3VR4H 3QUCA 1Q7CA 4KDRA 2V5VA 2YFKA 4FJ2A 3RRBA 4EH1A 1TYBE 2J7KA 1FX1A 1RJFA 2QUIA 3K2EA 5FADA 3E9DA 2C59A 2P2YA 1F2TB 4LHVA 5A6SB 3RD5A 4BDSA 5CDHA 2X1LA 3EFOB 3GLHA 2R05A 2EKLA 5E8RA 2POCA 4D4HA 1HE8B 1LX6A 3EIWA 3MWDA 3AWDA 5H59A 2NZ2A 3WSTA 3BA6A 2YWXA 1XQXA 3LS2A 4JR1A 1FYVA 1ZOLA 4NOLA 1BN6A 2YZGA 4AK9A 3IDAA 3KFVA 3LC0A 3DNFA 1KDVA 3FTPA 4Q4CA 3DBHA 3W2TA 3JRXA 1SXHA 1RFLA 3MFNA 3HYTA 1Q7BA 5B1IA 4JLOA 1H65A 3SHTA 1MU0A 2GD6A 2XRMA 3VR5H 4JQYA 3PC6A 4EPWA 3T0FA 5H1YA 2YWGA 4KO2S 4NYJR 4WVLA 1ST6A 4FFLA 2YKGA 3TSAA 1UDXA 2AJCA 2BH2A 2DULA 5E1DA 1YBVA 2JA2A 4LOHA 1MJHA 3NGXA 4J43A 4D1YA 2GDZA 2C78A 5ARCA 2Q8NA 3L8ZA 1XROA 2WV9A 3K9HA 4PGHA 4PX9A 1ZBDA 2FK7A 1MIOA 2M1XA 1G2IA 2BC9A 4YAWA 2ZRMA 2X2FA 1QIMA 1D0IA 1GL7A 4RF4A 4X54A 1BHO1 2JJ2A 2W37A 4DLWA 1H0SA 2ATIA 4XIIA 1FTSA 4L8WB 5IBCA 1D0YA 4C7JA 3GNQA 4CM5A 5BWCA 3DV9A 1IZYA 2GCOA 4XWTA 1ZUNB 3HRHA 4AN0A 4LI3X 2R6DA 1XU4A 1GTL1 1F9AA 1T3SA 2FQYA 1PN3A 4MW7A 5F73A 5HTKA 3K9CA 4DSOA 3A3NA 2VJMB 3K1IA 3AFNA 4EX6A 5B3KA 4ZJPA 4D98A 2E37A 4P5DA 2XECA 4OQFA 5JNSA 1XKQA 1ZONA 2CE2X 3TCXB 1GA4A 2ZUDA 2PS3A 3WMFA 4CS9C 1PKEA 1KO5A 2NTYC 3AHJA 4HEA6 5ENVA 1JQBA 1X39A 2HLPA 2UZIR 4TTTS 1C9DB 2VDVE 4MQUA 5CLHA 5COMA 3CX7A 3NHAA 3PUWA 4MUXA 3PG5A 2I1WA 5F2OA 5AW4A 3C3JA 3KDSE 2OA0A 3TUZC 2L7AA 1KVUA 1R0BA 1YS9A 2Q9BA 2A8YA 1YULA 2XVAA 1YVRA 3ISTA 5FBHA 5LIPA 1ZVZA 2EPKX 4J0QA