4BJ6A

Crystal structure rif2 in complex with the c-terminal domain of rap1 (rap1-rct)
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
329
structure length
293
Chain Sequence
SPVKERVDHVFYQKFKSMALQELGTNYLSISYVPSLSKFLSKNLRSMKNCIVFFDKVEHIHQYAGIDRAVSETLSLVDINVVIIEMNDYLMKSDLMMMVMRKINNDESIDHIVYFKFEQLDKLSTSTIIEPSKLTEFINVLSVLEKSNNIAFKVLIYSNNVSISSLLSTSLKKKLNTKYTVFEMPILTCAQEQEYLKKMIKFTFDSGSKLLQSYNSLVTCQLNNKESNLAIFFEFLKVFPHPFTYLFNAYTEIIVQSRTFDELLDKIRNRLTIKNYPHSAYNFKKNQRLPLKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RAP1-INTERACTING FACTOR 2
publication title Rif1 and Rif2 Shape Telomere Funcation and Architecture Through Multivalent RAP1 Interactions
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 106
structure length 293
sequence length 329
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-04-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1650 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4bj6A01
3.40.50.12060 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4bj6A02
4BJ5A 4BJ1A 4BJ6A
chains in the Genus database with same CATH superfamily
3B89A 1C1HA 1QGDA 1YTLA 2ZSDA 3UG7A 4DNXA 3FUXA 3QBJA 3O9MA 4QQFA 1D2AA 5E3IA 2RBEA 1Q1AA 4AJIA 1OZHA 1BRMA 3IPMO 3FUVA 4B81A 3QELA 1HL3A 4JKOA 3G13A 3FN4A 3QW4B 5BYBA 3IT1A 4HRVA 4X1OA 3AM3A 1NFNA 1M10A 3FNIA 4H4DA 4XGIA 1M1XB 1QS0B 3PUVA 1DCFA 4MVYA 2X6RA 4RPCA 4KPFC 4PW0A 1SXJE 1Y9DA 4J03A 4LHZA 1W2WB 5C4IA 3L1UA 4QGBA 4DLLA 5DXFA 1VL1A 2BDEA 5KSYA 2E87A 4OIOF 1Q50A 3T6KA 1TIPA 2QSJA 3B1YA 4GMKA 3OUTA 7AT1A 2GPYA 4EYGA 3GVPA 3IB6A 4YQYA 1T6NA 3BK1A 1JKJA 3IAS1 3AUJB 2BYTA 1GSAA 4LOAA 4NC9A 1S6YA 4NTAA 4GLOA 2FZ4A 1S2GA 4N0MA 4J90A 3M3PA 4CG0A 1OWOA 4X5OA 1YIDA 4OBEA 1Y1SA 1XF1A 3HCPA 1VFPA 4IGGA 5IDYA 4FHFA 1P77A 2BM9A 4GRIA 2V3VA 4D3ZA 1SD1A 4PZDA 4AX8A 3U9MA 4D2IA 2B6HA 4GIBA 2XA1A 1VKJA 2I6FA 2Q5JA 1NIJA 3DZDA 3Q3HA 1MC1A 3MTBA 1GNPA 2IYAA 4DLYA 4JY7A 2VHWA 1BJKA 2OCBA 3C3PA 4KHZA 1QZXA 2REXB 4RV4A 3ROPA 3DEFA 3L6RA 1RT9A 1N92A 3IT0A 1VGRA 4D9IA 1EB8A 3MJHA 3GT0A 1LPBB 4TXJA 3QYFA 1SU6A 3O2QB 4WDRA 2I3BA 2C8LA 1JPUA 4OOFA 1RQ2A 3GLHE 1RQXA 3C8GD 4OLBA 3QKTA 5EFOA 4DDKA 4G78A 1WB5A 1RPZA 2R7QA 4HAYA 2L18A 3SZRA 1OC4A 2WFZA 3L8JA 3F7OA 3N8IA 1I4LD 5HTKA 2VBGA 2YLDA 3W6UA 4HUTA 5A62A 3W8HA 3P9IA 4KQIA 3CZMA 4BCBA 1G8KA 2QW0X 2XJ4A 2GDJA 2GGSA 3RNLA 3NFYA 4RW0A 1TYCA 2HCTA 2DETA 5EJ9A 3A7DA 4CG1A 2ISCA 1IXSB 1YZNA 4ASUD 4C7MA 3EB9A 5LNK1 3CKMA 2G88A 1S3SA 1Y6DA 2WA2A 3IT2A 1BROA 4L4UA 2YXNA 5C80A 1GSHA 4EVQA 5K0BA 4URVR 3U7EB 2R62A 3HV2A 2G82A 4ICIA 2GPSA 1RQLA 5H3LA 4J2HA 3I83A 3OC6A 4BQSA 2CFOA 2HJMA 4F97A 2RAUA 1JILA 3TLYA 5JTTA 1JAIA 1E77A 1GRVA 4FE7A 4HXYA 4OBBA 2FVXA 2GHRA 2F3RA 4Z9FA 3AGPA 4AF6A 1NUQA 4XIGS 2H1WA 3H9GA 1C14A 1P1CA 4RTLA 2R5FA 3MTIA 3FDQA 3HLTA 4QIHA 2MWMA 3VHQA 2BMJA 4N5NA 1UK6A 2VAXA 1NBBA 4CTJA 5F2NA 4MWCA 1DJPA 3BBLA 1XJQA 4UEWA 1ZGAA 4Q4DA 4MUXA 1RR6A 1VCIA 4Q4LA 3VR4A 3N2ZB 2A0WA 1F17A 4EHJA 2JH8A 5CH5A 3B8HA 3R3SA 5AHOA 1WEHA 4OY3A 1QS0A 5BUCA 5FOSA 5LDHA 2FWAA 1CEXA 3DMTA 1JMYA 4R8RA 4HH4A 4Z1OA 2EL9A 3NM5A 5DLPA 1W2WA 2IPLA 4RTOA 3DXYA 4R7ZA 2C1ZA 5FUVA 1U0TA 5JQGF 4ZCRA 4MEBA 1A7EA 3ADDA 1ECCA 3HY4A 2H2HA 3UPTA 4B4OA 1RXQA 2AE2A 2EJBA 1LZLA 4GQAA 2IYNA 1JFTA 2FEAA 4MPJA 4UUPA 4KSYA 1U9YA 3U17A 1GPKA 1XUOA 5HZKA 1KEPA 3AR5A 1A8HA 1P29A 1M8GA 3WQSB 3ZOKA 1RWBA 2HF7A 2DHRA 4MV1A 1RZUA 3GORA 2UZ1B 4J75A 2G28A 3G2JA 1B74A 4Y0VA 4EYEA 1MB3A 1YA8A 4L3OA 1CRQA 1XP5A 4JLMA 4UBLA 2PR2A 2C3YA 3BQMB 1U6HA 4HB4A 3NH6A 1IW7F 3JSAA 3RSGA 3GPLA 3TRJA 2ZYUX 2OFFA 4YJHA 3HACA 5DOZA 2ZBQA 1G8PA 1M6VB 1DSSG 3H4VA 4AXBA 5LOVB 1RWXA 2PUDA 1Q11A 3ZNQA 2IHJA 3U7RA 1A2BA 2WNSA 1XK7A 2OYRA 1ZN8A 2QNLA 4KAAA 1EM6A 5HMLA 5ARBA 1HA3A 2RAVA 4XR9A 4LPKA 3AR4A 4MP6A 2NXJA 4XSGA 1G4HA 4B33A 1NSTA 2NUAB 4F9FA 1G8JA 4A0FA 1EI9A 2BUCA 2V7PA 4QOGA 3QFTA 4RJLA 2J5RA 1CHNA 3ORFA 2WSLA 2PZJA 2KSFA 1FVFA 2OFXA 4YAJA 2Z6UA 1QHSA 4C1BA 3GJ5A 3GNSA 2JKYA 3NWBA 3D81A 1BS2A 4WECA 3LA6A 3M9XA 3QVYA 1CUSA 4AUNA 5CFNA 2ACKA 5K0GA 4LF6B 4R3NA 3UT6A 4MIOA 2YUIA 5IMSA 3IIJA 1NR1A 4MVXA 1K63A 5H02A 3WB2A 2B94A 3P4XA 1G8GA 3AQIA 1FSGA 1GPLA 4IQFA 4XTKA 3CYFA 3AP3A 3X2SA 1QAMA 4U6NA 3UJCA 1L4YA 4IV5A 4MVRA 3TG8A 2RONA 3TRFA 3G2KA 2O8VA 4O63O 1WMBA 3N3BC 4RZXA 1JEEA 1X7YB 1QOQB 2A1UB 3N87A 5ILOA 2Y05A 3HY3A 1V96A 5B7PA 1ZMTA 1K5PA 4B4VA 1L5QA 1GN9A 3PNOA 4LKOA 2QWXA 1JNYA 3T38A 2ZB2A 3ZZ1A 1XSEA 1XTBA 5KKCA 2FEOA 4KODA 1SA0B 3ZJ5A 1VYKA 1V95A 1QHFA 1LS6A 4NPHA 5MGBA 2UUCB 4M83A 2NUPB 1RM3A 1W36B 4FOSA 4R84A 2DX7A 2Q9AA 5ED4A 3LTNC 1WF6A 3CMCO 2GJ4A 3W5VA 3GA7A 1VL2A 3I6YA 1XN4A 3WQQA 1R5JA 3C6ZA 1BG6A 4V38A 5B7QA 4I50F 5HKKD 3VNRA 5BR1A 2XYRA 3AVQA 2DR2A 3ND8A 5FI1B 1Z07A 2QL9A 2Z1NA 3F97A 3T1OA 4I8IA 2ZATA 3LLSA 4CEIB 1MQ8B 2IF2A 1P5ZB 4QL3A 4W1PA 3QXCA 2M98A 4IBOA 2RHJA 4INOA 1XQWA 3HVUA 1YRYE 2WD7B 4MV0A 3GYBA 3DZJA 4L4RA 4O4HF 3JVUA 3AVYA 4XLNF 1UP6A 4OHUA 5ER6A 4B6FA 5K01A 2ESRA 1NLYA 1ZW1A 1OFTA 1CT9A 1QHYA 4LN1A 2OZLB 1FF9A 4MGZR 4IO1A 3UW3A 2QTWB 3PBKA 5JS1A 121PA 2VRNA 1AKVA 2UZ1A 1FP1D 4ON9A 4M53A 1YR8A 3VAZA 3WRYA 2OC9A 4FNAA 1I0IA 3DJUB 1Z0AA 2C4HA 4LX8A 4UZFA 3L8YA 4CQMB 4NV0A 2MSWA 1ULZA 4WBXC 1OAKA 2L6GA 1M6VA 4O79A 4HTFA 1X8XA 5LOVA 4C0XA 3TSCA 4GQHA 4NMHA 2GZDA 4EY6A 2IP2A 2P2DA 1N3IA 3THYB 5BURA 1SUIA 1QYRA 3NHWA 3GGPA 4PIMA 1DAOA 2O4UX 1O57A 1KI8A 2NUAA 1JG4A 2OJQA 5FLEX 2YYZA 1ORYA 3H18A 3MJDA 1HQDA 4K9QA 3RQFA 4FGSA 4RF4A 3PJDA 2BKVA 5C5EA 1VG9B 3VR5H 4PICA 3ZGNA 5IM4A 4J0FA 1T3GA 4H60A 3UR3C 3Q87B 3RUEA 2R86A 2P2CA 1W0CA 3C3AA 2RHRA 4WPGA 5L53A 1DRUA 1JZTA 5HEKA 4B7AA 4E07A 1LVHA 3NWPA 1QH8B 4JROA 1FQKA 4MX8A 5EHIA 1AMUA 1IWPB 1U2SA 4D1YA 3AX6A 4JBIA 2DBRA 4DWJA 1G21B 5FUWA 3AMVA 5E1BA 3D8RA 2YJTD 5FT9A 3GJ7A 2C59A 2C2YA 4Q1CA 1CYDA 3E1SA 3O8CA 1JA9A 5EXDA 4AB1A 2O2DA 3ESRA 1NJ5A 4LEIA 4F2HA 4QU9A 5EVJA 1X7YA 2GAIA 4QBHA 2A1UA 1I9CA 3OCZA 1XQYA 3NT2A 3Q3VA 4Z7JA 4L0MA 3D4OA 2V8BA 4Q1VA 1BZYA 4TV9F 3HKCB 1GEGA 4K6FA 4N0EA 4AMZA 3G0GA 2IYUA 4F3RA 2ORVA 1CPRA 3LP5A 3WGGA 5I9NA 3VTZA 5GPBA 5DIFA 4F72A 1SA0A 1SRRA 4GWKA 3ERCA 1KH2A 1GS9A 2N47A 2CVHA 2DH6A 2DF8A 2V7QD 4RPLA 2NUPA 1TOAA 1VI2A 5AIAA 1L3BA 1YDHA 4XYLA 2GYUA 4PYOA 5HOQA 4PONA 1DOAA 1NMXA 2M6LA 2AMLA 4ISCA 4F4BA 1ZL2A 4CVNA 4MKRA 2MIIA 4CIWA 2FR0A 3AR8A 5EQFA 3OPYI 3MJ4A 1P81A 4Y1FA 1CGNA 1MB4A 4OH1A 2IH2A 1XQXA 3WX0A 4CEIA 2HA3A 3ZD8A 1D1SA 1J23A 2ZIVB 1L4NA 4V0QA 3KKNA 5CH8A 4CKZA 3DBLB 2WD7A 2YBEA 1T2UA 5TF0A 3HGTA 1NBAA 3ZVMA 1G2IA 4FS3A 5LQCA 4LXTA 3E7WA 3TM4A 2ZYIA 1ABFA 1M75A 1G5RA 1Z8HA 1ZN9A 3UT0A 2OZLA 1HMYA 3HJBA 4CYMA 4D26A 4ZDKA 2WSBA 2RC6A 3UW1A 3D1VA 3QITA 4U7TB 2B7BA 3FMPB 2XUPA 4IJ6A 4RCVA 4RH1A 2OO7A 2VP9A 1TQ2A 3AG4C 2GEVA 5MN4A 4CQMA 3W77A 2EEZA 2OZKA 3DQPA 3HJFA 2DPMA 1X1EA 5H4HA 1FUKA 2O54A 3N2KA 4RO0A 1WN0A 1FP7A 4WBSA 2KPOA 4DE5A 4U5BE 3NRHA 2ECFA 4JNCA 1B42A 2MSCB 2GXUA 2GUWA 4L15A 3JAWB 5JIBA 1RAFA 3B36A 1E6MA 3A6KA 1JSZA 4LQDA 3THYA 1TM7E 1POWA 2Q46A 4QAJA 2GOYA 2EW1A 2Y6VA 3Q3JB 2G5GX 5JD5A 3F5MA 5EIXA 2W93A 4LGVA 1QQAA 2VPPA 1YO6A 1QDEA 1TYDE 2QPOA 2G4VA 1AB6A 2M32A 4IUYA 5C1DA 4L4XA 3AR2A 5ECWA 4WASA 2GCGA 4F92B 1Z4PX 2F90A 1FDTA 1KP9A 3NX4A 2OJED 3HB0A 2OCXA 3SGLA 4H1VA 1E5TA 4EW2A 3ZCRA 1KMHB 3IHKA 4MS3B 5JUAA 4RNDB 1QH8A 2JAQA 3B71A 3COSA 2C4UA 4MRPA 4FFBB 4YL1A 1O0BA 5KVCA 2H3EA 1J0XO 3FZYA 1ZUHA 5JH7B 3KT8A 3PD0A 1J8VA 3ZXIA 1G21A 1YONA 1PFKA 3F6CA 4RS3A 5C7OO 4B1FA 2R00C 4PEVA 3RVYA 2GZAA 3WKEA 4YUYA 1E69A 3A1EA 3CNBA 2CCKA 1BWPA 3HA7A 5JBNA 1WZIA 5B1EA 2Q1WA 2JB9A 3B6ZA 4WLNA 2XDQB 4ZQHA 1U3CA 4HNQA 5GV8A 5L7YA 4TLAA 5E9JA 4YO8A 3WKCA 3DEYX 2A30A 3HKCA 2O2EA 1DRKA 3A2KA 2FG7C 4JODA 1YQEA 1TWGA 1XMOB 3AHHA 4JEHA 3S6JA 4ZKDA 5TQJA 3UH0A 1M0TA 3FDJA 5FFMA 3AHCA 1IWOA 4GZLA 4NBSA 5AUNB 4RD4A 1KEWA 2JGJA 2Y1DA 2XECA 4Z99A 1RXEA 3SYNA 2QR2A 5DLJA 1ZM4A 1WWPA 2IITA 4JVNA 2YXBA 5BN3B 3T1YB 5E4TA 4UQOA 2FN3A 4IEEA 2I87A 2XGGA 2FGJA 4MHOA 5DH9A 1N32B 2J9YB 1ZVQA 4JP8A 2EF1A 2TMDA 4G0WA 3H87A 1U31A 4JYZA 2HADA 3ELWA 2C9CA 4F91B 4F5ZA 4Y2JA 2LFDA 4S1OA 3LDHA 5HKAA 4QWWA 3HB9A 5AUOB 4O4IF 3AQCA 1MQVA 4ZI7F 2H2WA 3T4RA 1PE0A 1GRRA 4RY0A 4ZO9A 3OEHA 2UUOA 1COWA 4U5CE 3ORYA 1MCZA 3A1TA 5T5QA 1T3LA 3LYAA 1IHDA 2ICWG 3KBBA 2CNWA 4DVYP 3HBNA 1IQRA 3K53A 4IDNA 4KVZA 3HXPA 4PHGA 5AM4A 5A71A 1HMDA 2GX6A 3NTUA 2NNLD 2I9PA 2D2IA 1ESZA 1TK3A 1J0EA 4BVAA 4DUGA 4KIWA 1C8KA 4M0EA 3QVMA 3GBPA 3E18A 3BWCA 3CUKA 4D9CA 2J4DA 2QX9A 2V03A 1XZCA 1DAIA 4QGHA 4N18A 3FB4A 4BMSA 1Z4NA 3O82A 4WDQA 4YMIA 3CLUC 4LERA 1JAYA 3QPCA 5TJ9A 4HYTA 1J9ZA 2JJ8A 5IYZB 2JCGA 2WJWA 1V54C 2E0IA 1ABBA 1MABB 4ZI5A 3PE6A 3IESA 5FA5A 1USIA 5AJVB 3ISJA 2A86A 1T2CA 5E9WA 4F5DA 3LF2A 2V7XA 1XHLA 5F4ZA 4ZVKA 3MQ2A 5A4FS 2VHCA 3PE4A 5IJ9B 3K4QA 2GPNA 1IDOA 3DFMA 1SBTA 1OGYA 4XTCS 3LP8A 1RZRA 4ZQGA 2PH7A 4POAA 1L4UA 1G59A 4QX6A 1N9GA 2NAFA 5FOXA 4PU0A 3VVMA 4TX1A 4TZ0A 621PA 4AQYB 3WIBA 1KMHA 4UC0A 1LDGA 3TUZC 3TGLA 5C5DA 2HMUA 1P61B 1M7GA 1XVIA 4FFBA 2HR1A 5ESRA 3TD9A 2CNOA 3QKUA 5JH7A 4EVIA 3VV2A 4JYCA 4P35A 1HYEA 4EKNB 1K8YB 3K6BA 1C7EA 3CSUA 4TXMA 1GV1A 1P2BA 1RTTA 2FHPA 3CN7A 4C7KA 4YRTA 1C9YA 1L8QA 1TZCA 1P4JA 4GPD1 1CIPA 1O4VA 2XDQA 2VN8A 3ECCA 1B6TA 5HUJA 4FZ5A 3TYXA 4YDSA 3FTEA 1KFEB 3TTWA 3OX3A 4ENTA 4IIFA 3MHTA 3HJTA 4FWTA 3L4BC 2VAWA 1YNSA 4MTLA 3UAYA 1U8XX 4RXUA 1P9NA 4DL9A 5CNKA 1HY3A 4OG2A 3DVLA 4JJKA 1FUIA 5JO9A 4JJEA 5ALWA 2GTHA 3LJBA 4RQAA 3HKKA 1AF7A 3OLYA 1C9JA 1CE8B 4P93A 5BN3A 2ASEA 1RW4A 3QEOA 3L8DA 1NKTA 3BIFA 4KWIA 1GDHA 1PTJA 1NN0A 3MUNA 3SBOA 4LWOA 2EU8A 2F3SA 3LCMA 2BCJQ 4O1IA 4UBMA 1UFVA 3P9YA 3IDZA 1RJEA 5CGQB 1HFJA 2H5LA 1Q20A 1Z6XA 2PLWA 3SM9A 1E6UA 2ZBEA 4S24A 4DOZA 2EJVA 5FUQA 4FDLA 4UTVA 4MQ9F 1Z3CA 4D3XA 1I6WA 3C3DA 1KWGA 5IDXA 2J9GA 2D1QA 2WE8A 2QRUA 1BEUB 1JBQA 3W05A 4WQMA 3PF9A 5KX5F 2CVOA 3PX7A 2QAGB 4Z4CA 4C0BA 1P7WA 2BOVA 5LZ2A 1XCOA 2C2GA 4N48A 4Q66C 2J3KA 4IOJA 3BQ9A 3SFVA 1SIWA 2BN4A 1KK2A 2NPOA 2D0PB 2LCFA 4P7JA 3DJNB 2PSDA 1PWEA 1DDGA 5KJFA 3GA5A 4PHFA 3DDZX 1TAQA 4KE7A 2DWOA 4M98A 3S2ZA 1S2OA 3T5BA 1M2JA 3ZE9A 5KYUB 3N5CA 4LBYA 5DGCA 5K8UA 5AI4A 4L0QA 3LL7A 2GWHA 3DZCA 2H54A 3FFBA 3CSKA 4DC0A 2JBAB 4UDOA 2OWDA 3ATPA 2RB4A 1VB5A 1MABA 4JI8B 4KYIB 1YZGA 1GTRA 1XXHA 2WIFA 2XUIA 5HMMA 1J20A 3VVLA 1GITA 3M8KA 2P2GA 2XLCA 3K30A 2VF5X 1VBFA 4MVJF 3L1MA 5IJ9A 3HTXA 5KSOA 3PPIA 1JS1X 4WCFB 4EHNA 2D00A 3UZUA 3TW6A 2Q5IA 1WTAA 1F9EA 3SMQA 3RKRA 2YQZA 2OQRA 4G8CA 1L7CA 2C54A 5AKEA 5C53B 5KYYB 1GL3A 4OQEA 3KSMA 3EW7A 1Z7WA 1H8HA 2CLHB 4S3MA 1UBLS 2X9NA 3MELA 5BVHB 4D7AA 3GFBA 2BGWA 2W2KB 1BMFD 5HJEA 4Z53A 5K0FA 4ZZ3A 2O2HA 1II8B 1IMJA 1XKXA 4CS7A 4UNRA 4YLYA 2X3FA 3PXUA 1FVHA 2WJHA 1THZA 1F4VA 3CU5A 1UOEA 5CIVA 3E1KA 5JECA 2HPZA 3LQQA 3KUDA 4XASA 3EY9A 3QYJA 1MAUA 2B4KA 3J81k 221PA 4X1YB 2AVNA 4GYJA 1QAQA 2GR9A 3PQFA 1ZJWA 1MGOA 1TVCA 1QUFA 3AHEA 3OFND 5HFAA 4L02A 4CIPA 1RLIA 1CE8A 1C0KA 4RHCA 3LA8A 2DTXA 3I1FA 2EYUA 2WTUA 3MUFA 1YL6A 3V7OA 3BWMA 4LG1A 3OTHA 3CLUD 4GOMD 1NY6A 3ZJ4A 5BSRA 1EHIA 1A1SA 1VIMA 1C7JA 4IX9A 2ATVA 1H23A 3IILA 3JCZA 1WHSB 2SICE 1FSPA 4RCYA 1N6HA 3H1GA 2CXUA 2QZPA 3LCCA 3IAM1 4D9HA 4GOLD 3GLSA 1RKEB 1U6KA 4ULWA 1WZEA 1Q2XA 4U0JA 4UM7A 2GXSA 2W9XA 3TAUA 1ZMRA 1CRLA 4P22A 3VH2A 4CNQA 3UOAB 2QAGA 4AKIA 1HBJA 1GQ2A 4A91A 1AKYA 3BD8A 4LLEA 2C7VA 4K0DA 1FEZA 3G5AA 1TKAA 1I3LA 4HQKA 1P1KA 5J47A 2FSVC 3L8HA 2XLDA 2W6QA 3GG9A 3B12A 3QG5A 1V9CA 3KJFA 5EEGA 5JUWA 1UFRA 3RD5A 4QARA 2VTEA 4K8RB 5DHPA 1DELA 4CWAA 1FMVA 2F22A 1MRZA 5AKYA 2YRWA 5G4LA 3EGVA 1I4EB 2IA5A 3OPXA 4F1WA 1G291 2NACA 5KYUA 2IXEA 1FUEA 2CXNA 1C3LA 4XYBA 1LLUA 2IF0A 5K6RA 2HA4A 2JBAA 2V5VA 3G23A 2VC2B 1DQZA 1ZOIA 1CQIB 4NULA 3GP3A 3DPUA 4KQHA 5JZOA 1Q0PA 2ZYHA 1XTUA 4HDAA 1G41A 1I0ZA 5K2OA 1F8GA 5JCOC 1N6KA 2IOFK 4RJJA 4R1PA 4BRSA 4WCFA 4AZ3A 1NXVA 2J59A 1L9XA 2ZAGA 1HURA 1O95A 2ZRJA 4U2GA 3ZHSA 2O3QA 3ZNOA 1QQTA 2IY8A 3QUQA 4EEZA 4BNYA 5C1OA 5KYYA 3EZXA 3JAKB 2WHXA 4DIDA 3SXMA 4HKTA 1ORVA 5FQNA 3HXOA 1GPUA 4RLFA 5BVHA 5JAIA 1HLDA 3V2UA 1O87A 1YF3A 3AJ8A 1RWMA 2W2KA 1NJFA 4BUCA 2F9FA 2UVPB 4EHBA 1L6IA 5THXA 1II8A 3S84A 2WUWE 3OVMA 2ZKIA 3M6MD 1AUVA 1T8UA 2HIMA 4Z8XA 4NBNA 1IEQA 3SICE 1XPUA 2NTJA 4OHKA 2VS1A 4M37A 1F48A 3JQ7B 5PNTA 5CX1B 1QCDA 1GV0A 4EDHA 3HFSA 3B7GA 4IHAA 2W2LD 3T5MA 4X1YA 3OCCA 4KMOA 3V9AA 3IR7A 4XYEA 1DBSA 3ELUA 5JP7A 3RTDA 4JBXA 4REOA 3VJLA 2PUFA 2QE7D 5G0WA 4MP8A 4MI3A 4C0AC 2G4LA 1L7EA 5AXDA 5B6PA 3AUFA 3S1SA 5BPHA 3EXHB 4PK4A 2NVOA 4KR9A 3AFOA 2C84A 3B60A 2VQ6A 1BN7A 5LP6B 3F5SA 3JVVA 4Z4FA 4ENPA 4UBIA 4DZTA 1BU5A 1BFUA 1C3OB 4B3CA 3QPBA 5HKBA 3O83A 4B73A 1C7ZA 2XEXA 3GC6A 3WLJA 4QEKA 1JFVA 3ABQB 5G40A 4CM8B 3K6JA 2VUIB 1G3RA 2H2IA 1ARZA 1WHSA 1TCAA 5A6SB 1SZDA 3W9SA 3WB9A 1E3DA 3D3WB 1WQ1R 1TQ6A 3DOEA 3TW8B 3IE1A 4MV6A 1FS5A 2JLZA 3O95A 1CDEA 2VWGA 4QPDA 1T34A 5KYKA 1QWSA 2ZIZA 4YP7A 3BQNB 4ZAGA 2YQ5A 1D2GA 3T35A 1F2VA 5EGSA 1A7UA 2XRHA 1D0XA 2YHUA 4JJ4A 2W4IA 2JLYA 2G06A 3DKAA 2MYSA 3H2JA 4W4TA 1W2HA 3LKVA 2V7WA 4BTEA 4EB8A 3DVRX 5IXJA 4G86A 3DULA 3U8VA 4QQNA 2PNOA 1NW9B 1DCMA 1GKIA 2OE2A 2YFHA 1JNXX 1MX1A 2H9YA 3W8RA 2FV8A 2VJYA 1X77A 4KYUA 1DMRA 1Z16A 5DEOA 3FPJA 1TM3E 4HAOA 1J97A 2JFZA 2K5UA 1L7VC 2WJZB 3FCYA 2XNJA 4YJ3F 1L7NA 5B3KA 1H6AA 2BELA 3O5AA 2ZIAA 3RF3A 3TL3A 4PG7A 3C8HA 3TZQA 2F17A 3OZUA 4MV5A 4KV7A 4UUMA 5A7FA 2ZBUA 1P6QA 4UATA 3CKKA 4IUBS 3ND5A 1ZRNA 2ORED 4K6MA 2K6GA 2HK7A 4NFLA 4G4GA 2NV6A 2EIJC 5ELLA 2DPXA 3DKPA 3G0OA 2IIBA 2A94A 4RD0A 3HHPA 2JHCA 1SEPA 1IBLB 3EIQA 2HI0A 1QYCA 1FDOA 3I3OA 5AW3A 5L4LA 2PFKA 6Q21A 2G4CA 5H70A 3W4YA 4QAQA 3D2AA 1FY2A 3JAKA 1PT9A 5AI9A 4G8JA 2NZWA 5CVUA 5IKOA 2P4EA 1ZUWA 4K9LA 1I4WA 3NHPA 2CB9A 1PYGA 5LLSA 2WUVA 2EBUA 2I6GA 3F7NA 4PAQA 5B30A 3A1UA 2QE6A 2P6NA 2YIVX 1YL5A 2R7KA 5EJ7A 2PRYA 1VM6A 3WYEA 5AR1A 3JYHA 3TOLA 2Q5LA 4EL0A 2YNMA 3MJSA 3NKLA 3V5NA 4DUPA 4WLFA 3IMCA 4DAOA 2OCKA 2JGFA 3JQ7A 4UHEA 2OK8A 2W2TA 5G3YA 3JD3A 1C41A 5C35A 2LIGA 3W3AA 3FTDA 1DTSA 4BPRA 3VNUA 4EY3A 3AZQA 1GPAA 3DH0A 3ZHRA 5FLXA 5JCXA 4ERXA 1KVRA 5TE9A 3C63A 4DLAA 3EXHA 2Q2NA 1VLSA 3DMNA 2V65A 5LP6A 1O6ZA 1V26A 2I3DA 2EKPA 3TXAA 2HY7A 1C3OA 4HVCA 1DFIA 4TYMA 3NHYA 2IPNA 3EG9B 3PXXA 4EHFA 3AL2A 1RYNA 3Q7GA 4CM8A 1GLVA 5DT2A 3HU1A 3NTRA 1OAOC 1RWNA 1QO7A 2FAPB 3IDAA 2VT6A 5A6SA 1SBIA 4YRGA 4LGMA 1BD4A 4BVHA 2EG9A 4RVFA 3GR6A 3D3WA 5FBVB 1OILA 3TW8A 1EWKA 4NHEA 1UJNA 2E89A 3MWLA 2QRMA 1HWYA 3SN6A 1N9KA 4AY2A 3DMDA 5AWFC 3L40A 2ONKA 3FKSA 3OZAA 4XR4A 2DRIA 2B4YA 1BEZA 1ZGZA 5HIJA 1UZMA 3RSQA 3WBKA 3COVA 1KK0A 1GNSA 4XIYA 2YJGA 2DJIA 4CDYA 3G0CA 3IC5A 1V1JA 1LA2A 1K0FA 5BT8A 3TQCA 4M1YA 3G6WA 4JMLA 4GSLA 1ZIYA 4D4NA 2XODA 4ID9A 5LC1A 1FMFA 1WUIS 4RVNA 2J9ZB 3WMXA 1LJUA 2HSJA 3STUA 5LKRA 1GNTA 3JSXA 4QODA 2NIPA 2J8WA 1HE2A 1N25A 1NDHA 3F78A 1H3EA 4N6OA 4YT2A 4PIVA 3D5TA 1V16B 1L3PA 5AVVA 3GQBA 1N2XA 1HDXA 1OPRA 3RPEA 1YVDA 1Z62A 3FMVA 3CTPA 3WQHA 1BU8A 1JZSA 3HDJA 1WTCA 4PAOA 4HWRA 4NAVA 2G8LA 4YDQA 3A4TA 4NBWA 1N3BA 4QICA 4BU0A 1SKQA 3QI7A 4ENSA 4Q1EA 3IBGA 1ISSA 1PRYA 2UXCB 3MPUA 5FPYA 2PY6A 2GFQA 3K9LA 3Q85A 1HTTA 4F9EA 2Z9DA 1MB2A 2UUHA 3FUUA 4QOIA 1PR9A 4JJAA 3M6AA 3HGQA 4YJHB 2J6HA 3D0KA 2ZRHA 5AT1A 3MGGA 4PTYA 4CR8A 5I4CA 2PCLA 1N6NA 1M8PA 3O2SB 3OJ0A 3WAJA 1HNXB 1R0RE 1RFGE 1M5RA 1I5OA 2B0JA 2XI4A 1M6YA 4JW1A 2I6TA 3E9ZA 3F73A 2YL1A 3WL6A 4DY6A 2QTVB 2IEZA 4QXQA 5CM8B 1USWA 4KSCA 3L1HA 3GM1A 2AQKA 3V2IA 1E3QA 3AKYA 5GWXA 1IPFA 4IXWA 2R7WA 3FOCA 5IC4A 1UKYA 1I2AA 3PE3A 1TMYA 1EFAA 4N5HX 1U5CA 1W4BA 3EG9A 4DBRA 4DBLC 3FOAA 3QUAA 4XEHA 2NYRA 4IGAA 3QLUA 4RADA 1D04A 2EF0A 4OCZA 1U4OA 3CBQA 3NCTA 3HU5A 3WXMA 3EUAA 3H0EA 5A03A 4EABA 4OQZA 1WASA 3FWYA 3QVOA 3T8YA 1OIWA 1KMMA 2VG8A 4XJTA 3IBTA 5F23A 3G49A 3IOBA 4UXIA 3LLCA 4HDMA 4H7PA 1AA6A 3KXIA 3RTBA 2A7QA 1WV1A 2Z2XA 2W42A 5LBUA 4MZDA 4TMWA 4LBVA 1D0SA 5KNBA 4M1ZA 1IAVA 1GG5A 4PR3A 2VCAA 4UXJA 2ZG6A 4P6IC 5GGYA 2X19A 1DCTA 2E4WA 1APBA 3P9CA 3RFVA 5FKJA 1M8JA 1T10A 3NORA 1TQHA 2EL7A 1SHUX 2ZIGA 3HJHA 4Q3KA 1ATZA 2GETA 3Q7PA 3WBFA 4IHQA 1RMTA 4OQNA 3LUJA 5CP8A 1N2CE 5A5VA 2WVOA 1BFDA 5I7WA 1RI3A 2A7XA 1EAMA 4J0HA 1T9DA 1Z4QA 1ZG3A 2DLNA 4C6RA 4NMMA 3LG2A 3ESXA 1Y1PA 4EIYA 1YVUA 4MUBA 4PQRA 3ZVKA 2E18A 1V16A 3R5FA 1YB6A 3HDTA 1NW7A 2BR5A 3PC8A 4CX9A 4AKTA 2MHCA 4X1KB 3OLQA 4CXMA 3IV6A 3PQ5A 3ZE0B 2GN4A 4NS4A 1IK6A 1M0EA 4MVJD 4ZANA 1YBMA 1A8PA 4XTRA 4A3SA 1KOJA 1HV8A 1ISPA 4OATA 1KAGA 1PFGA 1L5LA 2IS6A 2IWHA 3M1LA 2A92A 4C2TA 2EJTA 4G5OA 2HS5A 4K9MA 3RG2A 3BWYA 1I6KA 5HE9A 1G5ZA 1QG2A 2ZVJA 2GHTA 2A9OA 2R5WA 3SJZA 2QLNA 2VCHA 3W1VA 4NBUA 3DXZA 3E9RA 1OU4A 4DSOA 1C5KA 2H1SA 4MHSA 5I3CA 1P2GA 4E5NA 5ICGA 1FRZA 4HTFB 1J39A 1SU7A 1DHRA 4U63A 2PU5A 4WFJA 1AKRA 4PZ9A 1MG0A 1W30A 1SC9A 2HTFA 5EE1A 3GEEA 4NQFA 4YACA 1SK9A 3UA4A 4V1CB 5AVSA 1QDLB 1U2TA 2DT8A 1HM5A 3UN1A 4FBLA 1RPTA 1USUA 3LX4A 4KXVA 4QU5A 3W6PA 4WESB 5C31A 2F6RA 3HLKA 3PEYA 1FJ2A 2APJA 4LYYA 1CQZA 2QTVA 3JWEA 4RGVA 1XDGA 2AF3C 2I22A 5IMBA 4C30A 1PZXA 5E7MA 2ZIWB 1E3IA 2IQIA 2NOAA 3DV9A 5BN1A 1A7DA 1Q7CA 1RKVA 4BLUA 1ECGA 4PZPA 1B6GA 2Q3TA 4OI0A 4M1WA 2ZSHA 4HFNA 1ZGCA 2HXGA 3TJZA 4JB2A 2X23A 4FT2A 3VR4H 1IXKA 4JLNA 4ZOCA 3UMJA 4KQCA 3PYLA 4Q7JB 1OF1A 1DKPA 2Q7RA 3PEVA 2Z5VA 1IATA 4JMPA 4YAIA 5TS3A 3C8MA 1R5BA 1PT5A 1JEQA 3DAPA 5TR9A 3HJCA 1NNEA 3S0XA 3MW8A 1NBWB 4IFIA 3KVOA 1A8SA 3EMVA 3KQWA 1ONBA 2HM7A 1O8CA 3JPYA 4UUAA 3EA4A 1JXOA 3PGLA 2ZREA 2R751 1PLJA 3VBCA 1V45E 3COWA 4QNNA 4DJJA 1CVRA 5AI5A 5J2UF 1QFMA 4CMKA 4QEDA 2A68F 1V6SA 3DKIA 4BG0A 1MKYA 4BLOA 2YXEA 3E7FA 4JURI 1ZWLA 5BOVA 1VLQA 2X1LA 5HGJA 4AJNA 4HWKA 2V7EA 3S9OA 1RI2A 3T1QA 3T3NA 3AFGA 5D6OA 4Z0TA 1K86A 2Q3DA 4CT0A 4KDFA 1C2TA 3BILA 4ZYTA 3QLEA 2QZZA 1H1LB 1UZAA 2Y3IA 2LD6A 1XJCA 3EZ2A 4DBQA 4ZAVA 2XNHA 5IK2D 3KQKA 4TN5A 4P5EA 4QQ8A 2I4TA 4E4YA 2G17A 4M76B 3KSRA 4X1KA 4CM9D 2AK3A 3ZWKA 1L2TA 2VK4A 3P8ZA 2FSFA 2H2GA 2GVZC 5HPYB 3PXEA 4B79A 4EY8A 1SK8A 2VTBB 3QOXA 2HGSA 2A5LA 3X2EA 2UUBB 5AKZA 3GUZA 4TYYA 1P33A 2C88A 3DOFA 2Q6IA 4R1UA 3U4DA 4FSDA 3G2LA 4IIHA 1T3HA 2O1EA 4MCIA 3SJAA 4U39A 3WLFA 4R2LA 1RI4A 1JQKA 1R5NA 3TLKA 4TUYF 4EI7A 4AS1A 4EW6A 1TGVA 4BLTA 4B45A 1W88B 4GRAA 1NVDA 4FQ5A 2ZCUA 1PBTA 4PAMA 3RCBA 4PFQA 1ECJA 2ZM5A 2A0BA 1FP2A 2O7SA 5DS4A 3DZKA 2QS9A 3QP9A 5A7HA 5K3DA 5F7OA 1LS1A 4U5GA 3N2KB 3M15A 1RIIA 1DRJA 3EGIA 3IT3A 2BY4A 3S7TA 4LGCA 1OCZC 3A2MA 3DBIA 2V3CC 2DQ4A 3KBOA 1QE5A 4V1CA 3WLOA 2X5JO 4J49A 3BMOB 5DTMA 4R4JA 4WESA 1P9LA 4BO8A 2IU0A 2NQ2C 4CETA 3W5SA 1IYZA 3SU8A 3KE8A 2JATA 4RY9A 3PUKA 3H0CA 4HT3B 1G7SA 3EXG1 3N8GA 5JROA 1EFVB 5L0DA 4IZIA 2GYVA 1TTPB 3IRVA 4MB2A 1AGNA 3LBHA 4A9AA 3RJMA 2XTZA 1TQ8A 2WMYA 3UWMA 1ZWKA 4OJTA 4P2BA 1GVNB 3I5UA 1I4YA 2Z30A 1RWPA 2Q7OE 4K9RA 1LW7A 1SBQA 4F93B 4FEGA 2XRMA 5C5CA 2F4NA 3FMSA 1BX1A 4W8PA 4EWCA 1Y6GA 3UMMA 4A73A 3C7AA 3RUDA 4I1SA 3H83A 3U48A 4M1TA 1WXGA 1L3CA 3T9DA 3LY5A 1CGME 4BMVA 1YR1A 4JBYA 4AM8A 1Z45A 2NTNA 4FDVA 1ADJA 2FUCA 4TL9A 3ODPA 4ZU1X 5T6BA 2GEKA 1P0MA 1HT1E 2W43A 3K6SB 3WGNA 2P3QA 1CY1A 5EIBC 4XCQA 5FUMA 1UPBA 3F3MA 1KY3A 2YZMA 4K9NA 3C6BA 3JQQA 4LC0A 3EXFB 4WZAE 1PTKA 3N7AA 2AA3A 3O39A 3GUVA 4KI0A 3JV7A 1KGSA 1VSQA 4N03A 2DXIA 1JYEA 4LTMA 4K2AA 4DRHB 4UAJA 1D1TA 4G1EB 3TTUA 4LRWA 1Z18A 4HR7A 4Q48A 3D5QA 1TKNA 1G5FA 5HIMA 1RJFA 5KDOA 4PYLA 1E32A 4FR2A 5I7RA 4XWGA 2XGSA 2ZUSA 5L95A 2YCBA 2E82A 3P9XA 1JDVA 1NBIA 1MA0A 3OQBA 4MVJI 4F4CA 2NXNA 4QDXA 5KOYA 5AHXA 1DO2A 3C3JA 3KXKA 1H1LA 4K05A 3RWMB 3L79A 1P1IA 3ECSA 1C29B 4Q7LA 1TVEA 3FX2A 2VYCA 4BP9A 4C2AA 2VSOA 4BZZA 4I1RA 5LXTB 1YB5A 3S2SA 1Z7BA 2R8YA 2GEFA 3NW9A 4YMTA 2VTBA 5IAAA 5IT5A 3PENA 4IXMA 3N8DA 5K0ZA 3KKBA 1UBTS 4N1AA 1KBQA 1DXQA 3OU6A 2ZBDA 4LJ4A 2WUFA 2GCNA 3QLTA 1T29A 1IN5A 1JMWA 2RB5A 5LU8A 3ECAA 4HDCA 2HLDA 5LZ9A 1JIJA 1LBSA 3TZKA 1Q7TA 1X15A 3KOUA 3CTMA 2QP9X 1W88A 1WCYA 2Z3ZA 4XDHA 2YWRA 1Q3TA 1YVPA 2ZJAA 4X63A 4HG2A 3E8XA 3Q8KA 3HADA 3SZGA 3L1KA 2A2ZA 4KE6A 2O3SA 3ABLC 5AW7A 5BOSB 1QZUA 2R4UA 2Q28A 1I3KA 4DEVA 3PB3A 4JX9A 1TYZA 4RIHA 4UNIA 1YRQA 1QF6A 4TTTS 3UC9A 3EUEA 4QYMA 3ZH9B 2QUJA 1I0LA 4Y2SA 3RRBA 2Y1LA 4FBGA 3EK2A 3BMOA 1U9ZA 4RX1A 1ZW3A 2GVDC 2HNAA 2IKSA 3DTVD 5BNIA 5CFRA 3OIVA 4NYIQ 5H0IA 5H9WA 1P4HA 3UMVA 2WVGA 1EFVA 2ZE7A 4EBJA 5FBWB 4L27A 3D8SA 4DM3A 3ZU2A 1B41A 3G9UA 1KJQA 3T3GA 1N9GB 4MUHA 4PR0A 1H1DA 2Q5FA 1NXQA 4FFMA 1RAEA 3R6WA 4P9NA 1ZH4A 3SF0A 4B3FX 3TR5A 4B5LA 3U3RA 2ZOSA 2XMGA 4PZ0A 1SR8A 4HQFA 4B83A 2R87A 3HCWA 4BGUA 1NI3A 2X9VA 3K5PA 3EHDA 2B4QA 4KNVA 4YRMA 2YINC 3F49S 4L72A 3QF4B 4GVLA 1RM4A 3QVVA 4G5XA 2FQQA 2NU9B 5CLHA 3EDMA 5B64A 1WVGA 4LBZA 2HQOA 1CKEA 1DEHA 1Q83A 3V4PB 4WZBE 2MMCA 3ZWQA 1R5ID 2V0CA 3JARB 1T6XA 3A4IA 4A82A 1TTHA 1RPNA 5DMXA 1MJFA 3E7DA 4G23A 4NYMQ 1ZM9A 1I33A 3K6SA 3UK7A 5DTIA 1QLWA 3H6HA 3ZGXA 1YDMA 4N0QA 4GHWA 3EXFA 3L0DA 2B99A 3GJ3A 4J9VA 2J9RA 1JR3E 4HBGA 4IZHA 1R0YA 1LPMA 1QLJA 5DGXA 3WYFA 5DSZA 4YP1A 4EGAA 1J00A 3L7KA 2JCXA 4X7RA 5JS8A 1GPDG 1IL0A 1S2DA 4LDQA 3C8DA 1W0KA 1F51E 4A26A 5I9BA 4YWHA 1X8LA 3ZI7A 5IVDA 2BDTA 2BI7A 4UVHA 4XQCA 2JGMA 4U9UA 4DC9A 2DUUA 1SKAA 1XAJA 5MGNA 5FV7A 2UYCA 3LI2A 3JWHA 1GZ6A 5EE3A 3I01M 4KJXA 3MGCA 5GVSA 4V2UA 1WV0A 1L5HB 4LKRA 2PSFA 1KU2A 2Y27A 1KO7A 2F7SA 1JF8A 2D7JA 3PQ6A 1SUAA 4S04A 2HQSA 1SBNE 5LXTA 3ILVA 1LDBA 1BSVA 2DBZA 4HPXB 1YI8A 4PFSA 5I8WA 3HVJA 1TR2A 1I7DA 3W79A 4WFIA 3F9IA 4MGYR 4FQ8A 1BDJA 3L4EA 3PVSA 3ZIAA 5IVPA 1N1MA 3VSEA 2QMUA 3LL4A 3ZE2B 4FFRA 4TWIA 1CJVC 1Z0DA 4JS0A 1Q2UA 2V7VA 2LTAA 4JR0A 4G5RA 1ZK0A 2Z15A 3NBUA 2BJWA 2XYVA 2ADOA 5A2GA 3FYTA 2ECPA 1OFUX 3RU2A 1JKXA 2YTZA 2O2IA 4E88A 1NMQA 4ZO4A 3TIIA 2ZQYA 4NL4H 3N8NA 5BOSA 1J99A 1HGXA 1DKRA 1OOEA 1BMTA 3BFKA 1UDBA 1YR9A 4ZCLA 1I1HA 4UUOA 3VVCA 2R60A 5TPZD 1H8EA 1F0YA 1U7WA 3PGMA 4MUKA 1L8LA 5CEFA 4AG5A 5EIBD 4JP5A 4M9XA 4D3SA 4IMRA 3B1WA 1LKXA 4ZPJA 1E7YA 3TIVA 3TH5A 3VFDA 3FHDA 2A1DD 3KV1A 2IV3A 4X9XA 2VBFA 3W5CA 2BTQB 4G84A 2HYDA 3LDUA 1KBZA 1XXHB 3K4HA 3W1EA 3PDUA 5ESWA 3T7IA 4HMQA 2C8JA 3O1HB 2IYWA 3OAAD 4HEJA 1RP1A 4V0OA 4FHDA 2VNKA 4O8CA 3B0UX 3KEQA 2HW8A 2D8AA 2LD4A 3B70A 4FC6A 4BUJA 3BH6A 1X19A 1RZ3A 3CSDA 5AJUA 5CTAA 3UXYA 3I01A 4Q3CA 3I5XA 2FWRA 2HSQA 3F71A 2DFLA 3MWEB 3L0SA 5E0OA 3KSBC 3HWRA 5JSKA 3QF4A 2O20A 3DWGA 3TQHA 4CL3A 3IQCA 2NU9A 4PSVA 4I55B 3A31A 3E9DA 1P1HA 4XRGA 1SXIA 3WDSA 3EWSA 1YFJA 1GQSA 3JARA 1SXQA 3BFJA 4REMA 4OHBA 5IANA 2XGMA 2CDAA 3UAXA 3F3KA 2X8LA 1VJTA 3S81A 1WKVA 4P4UA 2WYWA 4ITRC 1G4UR 1P0QA 3EVBA 1NWCA 4QQRA 2O0MA 4WCDA 2ISSD 2R3SA 4RIGA 1J1UA 1FYWA 1DRVA 2FPWA 4L8GA 2GPAA 4I9UA 1XI2A 3PQEA 1DQPA 5IM5A 2NP6A 2OG2A 2O1WA 5JHHB 3WJAA 1Z56C 3OCJA 8OHMA 1X7WB 3NDIA 5DYIA 1ZRSA 4KZPA 2YV4A 1CNEA 1TFOB 1MO2A 3ZWIA 1VZ3A 5DNVA 1YHYA 4MUFA 5KJ6A 3WLRA 4UMVA 2PO5A 1VGVA 5EL0A 4KHPB 4JUCA 5A9SB 1JPVA 5HCNA 1L5HA 3TW4A 4DR4B 2ZJ0A 5EIWA 4I99A 4ZP1A 4FMCB 3DAHA 1EWRA 4N12A 2YMQA 2CNNA 4IWBA 4KIUA 4OXKA 4YTEA 4WY2A 1EUQA 1VZ2A 3LHFA 2VATA 4E7PA 4N0DA 2X9LA 3GPBA 2DR0A 5HSGA 3KT6A 2O8NA 3ET5A 3ED1A 4EHPA 1UFBA 3HL4A 2EIMC 5JHGB 1I30A 3I4LA 5ITWA 4OD5A 6YASA 1SG0A 1NZEA 3PXCX 4COOA 5H5JA 3U4HA 3DZGA 1NNI1 1HW1A 3W8DA 4BNJA 5TSDA 4IDQA 2DUNA 2AHRA 3IDFA 1VJRA 2YYSA 1EVQA 1V8DA 4IZ6A 1UCFA 4TLMB 2GA8A 1JQLB 3DR3A 1GZUA 2J48A 5JSUA 1VLVA 3WQBA 1PR3A 4P2GA 3S1LA 3AR7A 7ADHA 4E32A 3G4ZA 1T0HB 4GBMA 2OVFA 3BGIA 4NNPA 4PJMA 1M1YE 1E1QA 3HBAA 1QR6A 1WUTA 1H66A 2HRZA 3DE0X 5T4BA 1QKJA 4ZJZA 3WYBA 1KYVA 5C1BA 4HWGA 5KDLA 4BGVA 2G6TA 1LI7A 2YKZA 2PLAA 3MJEA 2BTQA 1XXLA 4P83A 1I8TA 3R44A 4D42A 4IWYA 3VC3A 1XZAA 3QWBA 2XUFA 1W94A 2PMCA 1ZK2A 2PZEA 1KQOA 1YQDA 5B58T 2YZ2A 3WAGA 2VNAA 1IQ0A 1IM5A 1IXZA 3FJOA 4KPEC 4BX8A 2G9VA 4AZ3B 1W0JD 2B7CA 1EB9A 4X41A 4OOEA 4BOYA 2RKWA 2ZRKA 3WZMA 5AC5A 3QTLA 2E49A 4P80A 4KRFA 4IIJF 2Y76A 1S3GA 1Y4SA 1NUHA 2WWYA 1TU0A 1KO5A 5B1SA 4QDKA 5E38A 5MDHA 2QJRA 4FKMA 3UENA 3MJCA 4C3UA 1VCMA 2VYND 4FKBA 3C7CB 3MWEA 4AYWA 4PANA 1WJGA 3M0EA 2HWKA 2JAUA 4I55A 3ICVA 3H1AA 4CTNA 2OQMA 2CJFA 5BYKA 3AUSA 2H65A 4E6EA 3CVWA 2B3TA 5DYTA 3L7AA 3QU2A 3S0JA 1CF4A 1J22A 3IQXA 2CMDA 3QUBA 4DQVA 4Q7QA 4RLQA 4C7OB 4EF5A 4RM3A 1S0UA 1C9KA 3NV7A 4R1OA 1NQ5A 4TSFD 2PH1A 3G4XA 1J6UA 3VJRA 2F48A 4O0LA 1P2VA 3FWNA 2OBXA 3B5JA 5B1IA 2VDQB 1K04A 1XTKA 1QUEA 3IUSA 3K9FC 1G8AA 1MV8A 1X7WA 1CUAA 4NJEB 5HQ3B 3DEHA 1Z47A 4E2WA 2FGYA 4UHCA 1CUVA 3VU8A 2QSYA 4NCAA 3N2NA 5A9SA 4DR3B 4NENB 3WE7A 4ZXFA 3I9JA 1JL3A 1E62A 3VV3A 4N7JA 1I14A 1FTNA 4E4TA 3FDIA 3EFOB 4TQAA 1JVNA 5SYAA 5AUQA 4GUDA 2AOWA 5DQZA 1ZFNA 1H7IA 3LIPA 3ZXUB 1Z12A 1T3SA 4A1OA 4FQ7A 5DYWA 1FK8A 2XWJI 3RS7A 4GI3A 3UATA 3CUEF 3KRTA 1RSZA 4LHYA 4PNPA 3WNDA 1HE3A 4H2DA 4E12A 1K8XB 3DO6A 2WU4A 3ZU6A 4I6EA 4JB0A 3TKYA 4H3KB 3IBCA 2L0XA 4CKEB 1PSZA 1R0WA 3NP9A 3ZX4A 3ITEA 2VH1A 4X6YA 2VFAA 3HA5A 2XMCA 4M54A 3DLAA 1BVUA 1U7ZA 4ECAA 2Q8QA 1L8OA 2IUEA 4IY1A 3A9CA 1AKUA 4YPOA 1P0PA 4MLCA 1ICIA 3P9PA 3KWFA 2HZ7A 3CJRA 4YGYA 3RT7A 4G0OA 1LU9A 4K1OA 2WKRA 2UUPA 4IJJA 2JZCA 4RF3A 3GFQA 1F14A 3NR2A 3TNYA 4U9DA 5HVNA 2VDOB 2D06A 3L9WA 2CK3A 1QLEC 1KKMA 2W6OA 1LCIA 4PPFA 2JLSA 2OO3A 1SXJC 4FFOA 4R1SA 3R3VA 5LBTA 3O7WA 4J0EA 1KE2A 4LWZA 1ZP6A 3AIKA 4KLRA 5AW6A 1JHOA 2X4IA 2ERYA 4QXRA 4JGIA 4P3PA 3U8PA 4PTZA 1CS4C 1G98A 2PG3A 4CTMA 1YJXA 1Z88A 3G0IA 2CHGA 3T7CA 1AKEA 3FZGA 4DCOA 4YMLA 4HWTA 1MZVA 1E4YA 4FR5A 1L4BA 2HF8A 4G9BA 4NG4A 4KW7A 4H6WA 4DLTA 3DGEC 2IOFA 2AVKA 2GK7A 2SKCA 4BP1A 1HLPA 4BEJA 3ONNA 3CRW1 3H1EA 5AW2A 4U5FE 2DTEA 2YJ5A 1NF9A 3GRRA 3C7KA 2DEUA 1UBFA 2H7VA 5TDHA 4C7OA 1GIAA 2JZNA 5GP1A 3QY0A 4TXHA 1JWLA 2ZAMA 3RVNA 4KXQA 3BDAA 3IEXA 2HHAA 4BFTA 2R44A 4QHTA 3LS0A 5K2MA 3LV8A 3P71T 1E1RA 4S0XA 3L4JA 4BEWA 1XL0A 4HYQA 4Q6WA 4RYLA 2VC9A 4NJEA 5HQ3A 3SY8A 3NIGB 3R20A 1Z8FA 5DVWA 7ABPA 1WO8A 1V9SA 3L05A 1NX6A 5CX4A 2JIBA 1C7FA 4TQGA 2ZJ3A 1T8YA 5ALFA 4HEA1 4NENA 3NB0A 1NVVQ 4RTQA 3U4AA 3WL3A 2DUMA 5LYJF 1VRWA 4JVLA 2J0VA 3CQ9A 3EFOA 4BO9A 1ADFA 1L8XA 4M0FA 2E4AA 4IF4A 1GL7A 4GSYA 3WHLA 1ZM2A 1W87A 1YZQA 5IZCC 1P91A 3EZYA 2JGKA 4HXEB 3LY7A 4F5YA 4KVAA 3AP1A 3CCFA 4FOLA 1EXDA 2G80A 4S2UA 5JCJD 3T7SA 4ZDIA 2QRHA 4CSAA 5BR8B 1DV1A 3O93A 4V0LA 2BSQA 4F21A 3E9NA 3OBBA 2J3LA 1FAPB 1KZGB 3CE9A 4WZZA 4MCHA 2CYAA 3KOMA 3U7QB 4CKEA 5B2EA 4Q3BA 2HOQA 2SHKA 1TU4A 1I2DA 1FTQA 4KLCA 1MTZA 3ZWYA 4EW1A 3EFBA 5ED0A 2ZE8A 1STOA 2FOLA 3MCUA 4LZPA 2BCGY 3EPLA 4LS3A 2Q3MA 4JV5B 4Q1BA 1OGIA 3FSGA 3B0VC 4RSGA 1NQAO 1AT1A 1P1FA 2YUTA 4FIZA 1I80A 1L7XA 4X8LA 2E4UA 5ALGA 1YVRA 3A7EA 4DDHA 1EIZA 3WGUA 1TT5B 5IAEA 1P4SA 4LX0A 1PQYA 4UMEA 3ETLA 3BULA 3BE8A 3H8SA 3Q7RA 1NZFA 3GQBB 3MJFA 2VP5A 1IBSA 4ZAXA 2VXBA 3KL4A 2V6BA 1A76A 4AJPA 4B4DA 3AUXA 3BN3A 2UU9B 2FRDC 1ZL0A 2VPXA 3GEIA 1U2ZA 3ZTWA 2WLSA 4KFSA 5I9IA 4YL0A 1SIOA 1LPSA 5A06A 1YU6A 4E46A 3I39X 2OCIA 1JG7A 1N5RA 4PCAA 4EIWA 3K1JA 1L5OA 3I6QA 1EUZA 3ESYA 4CDAA 4TGLA 3QKIA 5CNMA 3CG4A 2KE5A 3D7SA 1T1JA 3D6VA 3IIKA 1EJ0A 3QUCA 3V9PA 1Y3AA 3WV5A 2LZ0A 3P9QA 3F2IA 3B6JA 2XUZA 2YMMA 4FFDA 3HZRA 3CLHA 4UTZA 5CW2A 4QUKA 4O4JB 4WKBA 2QKYA 3H9JA 4WOJA 3T61A 1Z2AA 1M6NA 4AWAA 2XKKA 2RMKA 4M7PA 3VX4A 1M6WA 4BX9A 1DX4A 2F9MA 3GLQA 3QF7A 1Z0SA 1NLUA 1OASA 1CB0A 2PX0A 3FHCB 4P0QB 5AJZA 2ZAIA 2ZRLA 3LUGA 2A1TR 4XB1A 4Y2GA 4KL8S 4L6IA 2JRCA 5CJ2A 4D6YA 1NF8A 4HEAJ 2I34A 5C8ZA 1PJRA 4FNOA 3PTAA 4ND1A 3C5CA 3MBIA 3PLNA 5FPHA 4OGKA 1CZLA 2JCVA 3HNLA 4F8YA 1XTVA 1NV9A 5FAXA 2C4VA 4I14A 3QTHA 4DJDC 1GL6A 4I36A 1YNOA 4EHKA 2EDAA 2OGSA 1NRJB 1W35A 4H3SA 5A5FA 4INZA 4AS3A 3C48A 1W8IA 5CDGA 3EQLF 3UHJA 3V5ZA 5GADl 3R5KA 4WK6A 1CCWA 4N3NA 1B1AA 4KNYA 3OETA 1AGYA 1RABA 1HNNA 2AL7A 5IKXA 2YHAA 2PMWB 4U2DA 4HS4A 2KQUA 1SXJD 1YZLA 5KTTA 1H05A 3O21A 4OXYA 2QV7A 3BRWA 3B8EA 1TIKA 5FTJA 2I8LA 1KWKA 3ZQUA 4HDMB 3ORRA 4HP8A 4N0PA 5H68A 5F77A 1EX7A 1VRVA 2AC4A 1OI3A 2HA6A 1L0BA 4MKFA 4M87A 2JS7A 2CT8A 4KJZA 2ID9A 3U7QA 5CFMA 1VL0A 4F4JA 4ROSA 4YAFA 1L1QA 1YE3A 2QIOA 4ENUA 4U1RA 3UGPA 3FLAA 5LPNA 4O8ZA 4UQPA 2X5OA 2DUJA 3ND7A 1M3SA 5FOUA 4OQLA 1VHTA 4O4LB 1Z4KA 3BF7A 2BMDA 3MB5A 3DXXA 1VKZA 3WL8A 2TMYA 5GINE 2VK8A 1KDTA 3LUCA 1EGHA 2VP2A 5BRJA 4C3BA 1UBHS 3QE3A 2BGJA 3EIOA 1UZUA 2OBFA 3JPWA 4Y9SA 3H4IA 5EZ5A 1VIYA 4IYJA 1TT5A 1W5BA 4H4CA 3KR0A 4QBGB 1OXKB 2IXGA 1WXDA 1HZZC 4PLPA 4A5SA 2WZBA 1L7DA 4P7BA 5DV9A 4MDEA 3GYGA 2BC9A 3OCUA 4LIPD 1P7YA 2Z5LA 1EGVB 4F45A 5H16A 5JISA 3NM4A 5JAMA 4WY8A 1GZVA 4N9QA 4A0SA 4IIXA 5EIHA 4AULA 3D3EA 3H13A 5IS2A 1N0VC 4ODIA 5KTNA 3W3AH 5TGTA 1R27A 3CE6A 1JG1A 3HJUA 4XDGA 1D1QA 1YZTA 1M5UA 5JDIA 1JH8A 3KSDO 5JBQA 4J91A 1DG1G 1GHTA 4M8NE 3V46A 2E9SA 1Y5IA 4E15A 5JALA 2CZQA 4LJ5A 1GPBA 2J09A 2VJBA 1MT3A 1F7UA 5ADHA 3THXB 2D5IA 1FXWF 4ENRA 3WKDA 1E18A 1UKZA 2LSEA 1GR0A 3TI7A 1ZUIA 4O4JA 2Q0QA 3VR3A 2UDPA 1QIGA 2W45A 1T43A 1X39A 5AXBA 1MXFA 3H2BA 2C9DA 3S8EA 2NW6A 3MS4A 4ZEVA 1CC1S 4NP6A 3VU0A 3V1YA 1V3QE 2OHXA 3H5LA 2YY5A 3IIIA 1E3TA 3UBMA 4AJEA 1E79A 4JL6A 3H9UA 4R2XA 3VPDA 1EDDA 1KTMA 5AKXA 4BJ6C 2ADFA 1CUDA 3MC1A 3Q7EA 3WBBA 3OJWA 4KBFA 2E6KA 1KK1A 1U8ZA 3IPCA 2C96A 5I7AA 4JI3B 2P7HA 2AXEA 3EVZA 2QL5A 4W9NC 4AJ4A 4DV3B 1IXRC 4XQ9A 4O6MA 3BWVA 1N57A 2VHVA 2XW6A 1B8VA 3FG9A 1DI0A 4HGPA 2W8BB 2FSHA 5FOVA 3A9WA 1FUUA 1Q7BA 1BJTA 1DJOA 3VR2D 1TTTA 1OCOC 2ZM6B 3PDCA 4XGRA 1RS0A 5EGNA 2OV8A 4KUGA 4B35A 3QIVA 3QE9Y 1SUEA 3ABIA 2I2WA 4DLNA 5EQDA 4A0QA 4EMBA 4NDAA 3QWHA 3LXUX 2F8MA 4KQ9A 5EG5A 3INRA 1JEQB 2H8GA 1BX0A 3ITFA 1ZJJA 1B0ZA 4RDCA 1U3TA 2B8EA 3D6TB 5K5EA 4L1KA 3G3EA 3JD0A 3HSSA 3RIYA 1NONA 5JCPA 1H0RA 4HTAA 1ONOA 3H86A 2FZEA 2HC9A 3NDJA 3F7TA 1N3YA 2P6VA 1FYFA 3Q2IA 2P1RA 2AZMA 4M8LA 2W6JA 1Y9ZA 2XOEA 1E2JA 5FOWA 4TYWA 4CJOA 3MM4A 3T3OA 4TMXA 4O4LA 2R8BA 4G41A 4RDAA 3COYA 3DFKA 3A3PA 4D3FA 2P1ZA 1IG3A 4BMZA 3EGEA 5DU2A 1TU3A 2NPUA 4HPWA 1YS9A 4XIIA 5AESA 1WW3A 4QXMA 2ZR8A 5EJ4A 1OXKA 4ANFA 4DADA 5LQUA 1D2EA 3H5AA 4NFHA 2QTAA 5AI6A 2Z6AA 2JD0A 2D2XA 1V2HE 1T5IA 3WGHA 3SIRA 4J0KA 1LFAA 3E0QA 4PG5A 4IXDA 4S1WA 5K0NA 5TQVA 2C2BA 2YZ7A 3RU7A 1B16A 3R8XA 3ZLJA 3PITA 4DLRA 2W2OA 3KPVA 1KEVA 4GG1A 2ZJZA 2H4FA 3GCDA 2R05A 1KEEB 1XWWA 3CEAA 1DAEA 3BHNA 4RANA 2IXBA 1E2MA 2P5YA 4UVIA 2O7NA 4BO3A 5L0FA 2EGUA 3MVEA 1B8OA 1JHZA 4OMFG 3THXA 1OZ0A 3HXMA 4C2UA 5C3MA 4B6GA 3OJOA 1ZR4A 3A4LA 1E20A 2QNBA 4C4ZA 1TPZA 5BNWA 3IYLW 3KAPA 2J3DA 5CR9A 1YD7A 3A4MA 1BQ3A 3LLUA 5LWHA 3ACDA 4Z4QA 2QU7A 3KAQA 1KDVA 1E60A 2Y3GA 1Z75A 1XR3A 1NQXA 5EFZA 4N47A 3VR0A 2M6RA 1V8OA 2KI5A 1T15A 1FFEA 3NVAA 2I7XA 1QG4A 4TRRA 1VKOA 3NYWA 4YS6A 5K4AA 3E1GA 2H9IA 4Z4HA 1NP7A 4H4EA 1YYJA 4CV0A 4BXOB 3DF7A 4IQ0A 4E1BA 4JUAA 3LUTB 3DJFA 5C9ZA 5KNBH 5JY6A 1ZN7A 3O8QB 3OC0A 3N2EA 2Q7XA 1T5TA 1RBZA 4DREA 3DLIA 3H6GA 4CODB 4EFMA 3CLVA 3T06B 5EE9A 1JDSA 6ADHA 2W8BA 2AUNA 4HE8D 1X8JA 4PWYA 1YRBA 4F4FA 2KC3A 3MWFA 4NZOA 4L6RA 4WXPA 4LRSB 2P3OA 2JLCA 4MKXA 3ZQ4A 3R74A 5GONF 7YASA 1U8AA 3M1AA 2D74A 3L8EA 5K03A 2A84A 4U7JA 5DNEA 2AX3A 1H2YA 3Q12A 1TVMA 2Y3DA 3REFA 1ZI9A 3WBJA 4XZ3A 3M89A 1XJ5A 4HX9A 2XMQA 5TQ2B 1JH9A 4OF4A 2FCRA 3I64A 3GRAA 4DQ0A 4NZ9A 5HF5A 5L0GA 2CDBA 4TZKA 5C37A 1GCUA 2DYRC 1YJ5A 4E11A 3RBAA 2PMEA 5DI3B 1FPQA 4ETMA 4KO4S 5TARA 1RDFA 4KGZA 4EQZA 1LF5A 4WUVA 1T9KA 3R0ZA 4OVKA 4LK3A 1FFCA 1NVWQ 4Q3DA 3FWZA 4Z9AA 4I4CA 3LOQA 3KKLA 3V8MA 2FN8A 3VSDA 1OFVA 1Z39A 3H42B 1X2BA 3QM1A 1BYIA 3DZFA 1ZU5A 1C9DB 2D3TA 3DO8A 2G67A 3O4JA 1NY5A 2M9MA 4MRMB 3N2YA 3OPYB 4MPPA 2KSQA 5LQJA 2PPVA 3QOFA 2GJSA 3TUIC 1C8LA 1PHRA 1H0KA 4TTAA 4X1IB 1ZCJA 2B8WA 4EY4A 3GV0A 1EDBA 1ZYUA 3OZ7A 3FETA 5JZBA 2FPUA 2GZHA 1F1BA 1RRGA 4DY4A 1UBCA 2BFMA 3SVLA 1GDDA 4LV5B 3TLAA 4MAFA 4OH7A 4E33A 1KEEA 1SIBE 3NAMA 3VZQA 1QO0A 4N6GA 4R1QA 2BGTA 3IIMA 2ZETA 2W48A 4GBGA 3W8NA 3AM1A 2IXPA 5LP1A 5EE5B 3ZHUA 1U9IC 1VYVA 1XCGB 4YC7A 1D0YA 1A7VA 4KSBA 2P9JA 1NRIA 4MRSA 1XTQA 1ZESA 5I48A 3FHJA 2FQ1A 3UIEA 1JU4A 3FWPA 3GMIA 2WKWA 4KH0A 3EA0A 2Q5QA 1E6LA 1A9OA 5K8TA 3FDXA 1FLNA 1Q84A 3IKJA 2DFPA 1KI6A 2JHPA 2TS1A 1JT2A 3TOZA 4UTOA 1EQUA 4PHHA 3W9YA 2PIDA 1ETUA 4FYJA 3VU1A 5C5IA 2MINA 1NAHA 3HB5X 4GDMA 1BHJA 2OAEA 2Q4BA 4NBKA 1KQ3A 3SI7A 2A5GA 4BXOA 3RS4A 1D4AA 2IZ6A 2OEXA 1WBJB 4G5SA 3I1IA 3O8QA 2FFBA 1VBNA 4W99A 4X6LA 1ECPA 2BF7A 2PUVA 3I9NA 4EFKA 3VKHA 3DD5A 4DMUB 5ICEA 3VPCA 4TXNA 1X7ZB 4D4XA 3AYXB 3G1TA 1NIPA 3Q4GA 4LXIA 4G7HF 1GUDA 5G1NA 4GZ5A 2IBSA 3PI7A 3FSJX 3MBGA 1K5DA 4PGMA 4PXSA 2Q2OA 1C9MA 3DCYA 2HMTA 2PDAA 3JVIA 2IK8A 3D7KA 3V4ZA 4UM9D 2FE1A 3MCAA 3JATB 1OVGA 3OA2A 5T41A 3SLRA 4L4ZA 1TF2A 2CB0A 4UMDA 4A23A 2IJGX 3CH6A 2AG1A 1WD5A 4Q01A 4FSHA 3WR5A 3RVDA 2PX3A 3IURA 4PG6A 5JWRA 5GY7A 5C8YF 4RD6A 2F43B 1ZDMA 3GRYA 5CK5A 5JS2A 2GAFA 4WEQA 3ZIDA 3NHUA 3I9MA 5EPUA 3FFTA 2VJOA 2RAPA 2B25A 5EI5A 1ZKDA 2ZWIA 5TQ2A 3TZ6A 6AT1A 3L2OB 5IP5A 4YJGB 4DIMA 4EGCB 3QNMA 2P6PA 3S8MA 3H4MA 4EA8A 5T8KC 3W9BA 1DADA 3MTGA 3G89A 1J70A 2CXHA 1D4FA 3GRFA 4CKBB 3BDIA 5C4GB 1XWIA 4I3FA 5CCEA 3QEAZ 5DI3A 4KQ6A 4P3OA 2IW3A 4KXXA 4GI5A 4E5YA 1LEHA 4FWBA 2WL8A 3RKUA 4YRFA 3QW1A 2WR8A 4QBTA 4X00A 3PS9A 1QFYA 5ES3A 2R8RA 1SOUA 1VL8A 4Q9JA 2B0HA 2PA3A 3VO9A 3R5SA 5TJHA 3BXZA 1T1IA 4J3NA 5CEEA 1ITZA 3QFHA 4RMIA 4CGYA 4F96A 3VOSA 1N2HA 4MRMA 4PZYA 2Q4EA 3OPYA 3SKYA 1U0FA 1B93A 1XC7A 4M6WB 1CRPA 2F1RA 2IE8A 1BWQA 4YMSA 2IIVA 1F5NA 4KPUB 1XEWX 1XDSA 1N5KA 5HJ5A 4X1IA 1OTHA 2RKOA 1XCMA 1ONPA 3EZNA 2CCGA 5E2BA 5JJ5A 2J5KA 3QVUA 1BDJB 4A7PA 2H4ZA 3ENKA 1TEZA 5C8VA 4TV8B 1ZXLA 2XLHA 2WIDA 1KRXA 1YR3A 4R8SA 4R8LA 4ZFNA 3UG6A 2J3MA 1I1NA 3OJFA 1E2QA 2FG6C 4KK3A 4ZVOA 3LLIA 4I1OB 1I5EA 2H08A 2NO9A 5F1PA 3DDSA 4YRKA 1M1ZA 1OBCA 2B34A 3CINA 4K1XA 3P5SA 3W5DA 2PUBA 4L0CA 4Z9XA 1T9BA 1LVGA 3V1KA 2AWYA 4EPVA 4U9HS 3FLEA 3GRKA 2XKBA 3KDPA 5T3UA 4A8JC 4PN3A 2YJZA 3DE2X 3GRVA 1TFUA 1OREA 2Q2QA 4EHIA 3A6EA 2PV7A 5A0FA 1VKHA 4ND7A 1D2CA 4IJQA 3JWPA 1XHEA 1PFWA 3QA3E 3H97A 3QXSA 3L6DA 2CUNA 4TKVB 1WCV1 1BIFA 1CETA 4NH4A 2ANBA 2QHXA 3P94A 4YMWA 5SYNA 3EDYA 1X7ZA 4WBNB 1KYQA 5BRNA 1IZ0A 1NU7D 1AGXA 3MIIA 4TS4A 5FTNA 2Z6VA 4FDUA 1H93A 5ENDA 1F6WA 1QM5A 3I52A 2FPGB 1OLUA 4V0KA 3LKBA 4WADA 4GZ6A 2XE6A 3JATA 3OQMA 1DLIA 1VDMA 1MFPA 3OA0A 5DHSA 3R5JA 5C8DA 3RASA 2QN2A 3X1KA 2E21A 3HR7A 3R0QA 2OORA 2YWEA 1QIIA 3FXAA 5LDGA 3IPAA 4JLSA 2BMVA 2F43A 3TOVA 5EIFA 2OECA 4KLZA 1XEWY 3K0KA 821PA 2O8BB 4KRYA 3RC3A 3YASA 4YJGA 2YV1A 1MIOA 3AJRA 3WWPA 3EARA 3ANNA 5FORA 3OQVA 1TLLA 2CV1A 3Q2OA 2HRBA 4I4IA 4CKBA 1WMDA 3C62A 5ERXA 3NOOA 2EX1A 3EH2A 4C4SA 3NUQA 5E0KB 1KVUA 3E22B 4EVRA 4RVSA 5DN6A 1YZCA 2I33A 4C7XA 3HZHA 2A5FA 3TF5A 2YVUA 2W37A 4MR9B 3MILA 2F3TA 2AJCA 2I3GA 4G5GA 1OXMA 2BIFA 2BGRA 2XTMA 1QC5B 2BFNA 4U9IS 4M6WA 4CMJA 4KQGA 1WX1A 5LD2C 5EC8A 3JQ9C 2F1IA 1DEAA 2X22A 3D6HA 4KPUA 2HWWA 4BS9A 4P0PB 3N24A 1QCYA 3EZHA 3AI2A 1ZGHA 1Q5PA 1S1MA 4DXHA 3HS3A 4PF1A 5K09A 3KJXA 1L7BA 1IB6A 4QHYA 4XLZA 5A0TA 4JDUA 2X86A 3UQYS 4BX2A 1XZFA 1YDEA 1WU7A 2A67A 2X77A 4KXNA 4TV8A 1W73A 2PRZA 4RPHA 3WI7A 5B4VA 3F98A 1XN1A 2LNDA 4E5VA 1WXIA 2GK3A 2YC2C 1E6EA 4HB2A 4QO8A 4I1OA 3H2IA 2OM6A 3ZE8A 2IBTA 2C7BA 2FTKE 3WYNA 2X2PA 2QPAA 4YV2A 5CIWA 3UJ7A 3HDQA 5CDFA 3I76A 2V4UA 1EG7A 2IUUA 4RMHA 1GP2A 3C6QA 3STXA 4Q7MB 2AI2A 5EAIA 4OHPA 1YL7A 3U9LA 1A0BA 4Q7KA 3N0XA 4LMAA 4U2FA 1PR5A 4Z4EA 3DC2A 3N6RA 4N5DA 4I8XA 2X58A 4GR9A 4Z0HO 4N8SA 4OMDA 3C74A 4JLJA 4BO4A 2ZAYA 3DFUA 3DLPX 5JNRA 3P2KA 2X0DA 3ICOA 3OZBA 4NFYA 4LI3X 2QGNA 2ZR7A 1AXEA 4E5KA 5FJJA 5LIPA 3SQXA 1KI2A 3S2YA 4MKZA 5BR7A 4TKVA 2W6NA 4UCWA 1NJ8A 4G0VA 2JJ1D 4BE7B 2QNIA 4Z49A 3KHSA 1EFLA 2I15A 4WBNA 2OP0A 2R6CA 2I03A 3A1NA 3SOPA 1E4EB 4JA0A 4DNQA 1HDRA 1X1RA 4IJVA 4PSUA 4B40A 2FPGA 4D57A 1KP2A 2UUIA 3OQIB 2GILA 3O9VA 2ZIEA 3M34A 1OBOA 1G8YA 4MVOA 1QH0A 1U2QA 4BNKA 1SXHA 2AJ8A 1LE2A 3FDFA 4GUAA 3T4PA 4H9GA 4TSKA 3KJQA 2O8BA 2C5GA 2H51A 5DRYA 1XLWA 1L4EA 3UGKA 3K71B 3QNUA 3WFJA 1OFIA 5JD6A 1MORA 4JXZA 1W4AA 1HK7A 4HLQB 5D3KA 1T2DA 3ZY2A 1PI3A 4JU8A 3H5WA 1TW3A 4CKCB 1L9KA 1NVMB 5E2QA 4DIOA 2ARKA 3QWFA 1LKZA 2VLIA 3E22A 4N7RA 1IJBA 1EXMA 1Q1GA 4ZALA 4CLDA 2E85A 4MR9A 3RSZA 2IUTA 2C58A 2QD4A 4ZEXA 1PL6A 1GPH1 1OR2A 1O77A 1XZ8A 2WF7A 4IWNA 4KUEA 2BFEA 1SZIA 2PKRA 3INTA 1O6BA 1QC5A 3F5FA 5KTOA 1QIFA 3K6RA 1VSTA 1DAKA 3X1XA 1F8YA 3JXEA 4D4KA 3PUZA 3VC7A 5CBKA 1AEPA 4RTRA 3IQHX 1OWLA 3ROEA 1XPJA 4PAGA 1HLFA 4RV9A 2WVQA 2D59A 4WXHA 4P5PA 1FDIA 1SUFA 1V6CA 2HAEA 4QGSA 2D4HA 4HQOA 3JQFC 3FBGA 2ZTSA 3OMXA 3OZVA 3G82C 5G1PA 3B5EA 5DP2A 1XZBA 3ZHZA 3H84A 1GZSA 2H2FA 2PIAA 1S2IA 4P8RA 2W2MA 2ZBGA 4Z3DA 1PEDA 3JT1A 2FETA 2BKLA 1RHQA 4M21A 2DYKA 3MTDA 2FW9A 1FFXB 2OQIA 5B4TA 5I7HA 4UTPA 4AMYA 1NP3A 5JZ9A 4C3OB 2VH3A 3OUUA 2D5BA 4F46A 2CZCA 4LVOA 2J41A 4PLTA 1QH1A 2QVXX 2EC5A 4N82A 3MFQA 5A9RA 4TL7A 3PDMP 1O9BA 4OD0A 4HPJB 3FRIA 1NDUA 5A6BD 3ZGOA 5A4IS 2D3WA 1E9BA 2JJ2D 3A6DA 4IMPA 1M9NA 2O5EA 2VOJA 1LH0A 1FNBA 2V58A 3W1WA 4LQCA 2XBUA 4FFPA 4DBZA 4FI3F 3DZ8A 3U37A 1GJRA 1GG8A 3JYYA 5IN4A 3UCEA 4DG8A 4OXIA 3FKQA 1CJBA 1O89A 1NJ1A 4DA6A 1MO4A 3M5PA 4K9PA 4R41A 2GM3A 2QQGA 5UKDA 1AM4D 3COZA 5DTEA 2OKGA 1HE5A 1E4EA 3PWSA 1ZISA 2F3QA 2FMTA 1E96A 2COEA 4YFVA 4K9OA 3LGAA 5IT0A 5HBGA 1TE2A 1IIBA 4RY8A 2GI4A 4NECA 2AVDA 2YWGA 2BHSA 3D6JA 3OQIA 4QU0A 3UB3A 1TM1E 1CPQA 1M2KA 2ODBA 1VIVA 1BDHA 1JIKA 4Q1DA 3X1YA 2VK1A 1UWCA 2C8KA 2XMZA 5GZ6A 3BS4A 4HRXA 1U94A 1QZTA 3DEIA 1HO3A 3K20A 2JHGA 3IBFA 4LF5B 2FMXA 1NMZA 4K0RA 5ALUA 4KE8A 3V34A 1ODJA 4GC5A 1P5FA 3A3KA 3KCQA 2PD6A 1KPHA 2WAOA 1N5IA 2GD2A 3C7DB 2GAQA 5INTA 2IEAA 4OHFA 1EYZA 4F85A 3TLEA 4BEVA 4GX5A 4YJ2B 3D7LA 4PC1A 4GH5A 3ENWA 5JFOA 1HETA 1OMOA 4CKCA 1ORIA 3WL7A 1EIWA 5A05A 2H3HA 2PGXA 4KB5A 2R84A 3C3YA 4OXXA 2VHUA 3AKZA 2V9CA 2WSMA 3AUUA 1MC8A 1LBIA 4RVCA 4YGXB 4UPDA 2OAQ1 5THKA 1IM8A 4OIQF 3QE0A 5ALEA 5HKOA 4CDVA 2I76A 3OUZA 2W4QA 5AM0A 4BNIA 3CH4B 2QUAA 1FPMA 3DWWA 1N6LA 3PZBA 5EUCA 1HW2A 5EUQB 3KELA 3ENNA 2ZAOA 2WWWA 3B1KA 3KT0A 3RIGA 2ZTHA 4G81A 2DM6A 1BA3A 3R0VA 4ARBA 3BRSA 4NFSA 1VB3A 4Q93A 5CU7A 5JU6A 3SQOA 4B3TB 3ZDFA 2R7TA 2CVPA 1V8ZA 3FHTA 1PG2A 1LRKA 2G70A 2Z57A 1GGQA 1XZDA 4YRAA 1MAWA 2PTHA 4WK4B 1JFLA 2EWWA 3G8CA 5CA0F 4K3VA 4CHTA 2R1VB 3I2IA 3CRMA 1OHHA 3LT0A 5F64A 4PYNA 3F74A 1T2AA 2WSYB 3HR8A 4RORA 1FFXA 3AGQA 4GX0A 2NUTB 2PBEA 3IKMB 2FW7A 4BB5A 4OHWA 1B6RA 2RGUA 3ZVRA 4PSAA 3J7TA 4YCDA 2V96A 4EZIA 4D0SA 5IULC 4WH0A 4WIAA 1ZGJA 3U13A 2P0NA 1ZD5A 3CEMA 2ZZNA 2WI8A 2H8KA 1WY7A 3AJEA 4E17A 4KDEA 8ABPA 3AR3A 1U2RA 2P0YA 5JPIA 5CCDA 4UFOA 1GWNA 3V97A 5BMVF 4M7RA 3C1OA 1PJLA 4JEUA 4G0UA 4ISBA 3PPWA 4HQ0A 3CQZA 2E4XA 2O5CA 4BMYA 3Q9LA 2Y67A 1SVMA 2X51A 4HATA 5IVHA 3O55A 5IJ0B 5SV2A 3JAMA 4PNZA 1E0AA 2OLJA 1S4MA 3HQ4O 1AH2A 1PJTA 4G37A 1E3LA 1IJFA 3DP9A 4D4HA 2Z09A 2IGTA 4QGGA 4OGGA 4RC9A 1T2VA 4XLLA 2UUAB 1RAIA 1KZ7B 3G9ZA 1SBHA 2KGOA 2QN6A 5CB8A 4BMPB 2R2GA 4MGKR 3O90A 2VYFA 3OOSA 4XRRA 4RMNA 2I1WA 4AROA 1PQUA 4R5HA 3WGIA 1L5ZA 3KYDB 5HIAA 2GZ3A 1T4CB 3RS8A 1XLTC 2X8BA 3C6YA 4OLAA 1HZJA 3U5SA 3IUEA 5U1PA 1SF8A 2QEQA 1BWRA 1RHRA 4L8WB 3PTZA 2OENG 2HSGA 2OHFA 5EMLA 3MPOA 3OP1A 2Y4OA 3LC7O 4YJ2A 5DWDA 2JI7A 3BSYA 3U61B 3GFOA 4L28A 4YCJA 3GP5A 4WHMA 3GJSA 5EKUA 2GK6A 5CXQA 4J4BA 3ZV4A 1QPBA 3LT5A 2ORWA 1NASA 1W52X 3CO0S 1IK4A 4ZO6A 1Z23A 1BMQA 2OKUA 2IS4A 3P4YA 1BQ4A 4OMUA 4KO3S 3RUIA 1WQ4A 1E98A 1GARA 3Q0TA 2NZVG 4UAVA 3EGCA 3FUCA 3B9RA 1BCSB 3KZOA 2RGWA 3H04A 3BE4A 1KJ9A 1B0PA 4IG9A 1N36B 4KQ1A 2QR3A 4C43A 1K98A 2JIZD 4D0NA 4YBRA 1U63A 3C70A 1UMCA 3R8CA 1NN5A 1WXXA 3I6ZA 3E3AA 4QGAA 1U3DA 1B26A 2VYVD 2QZ4A 2QPTA 3S2GA 4QXPA 4NSNA 3IEMA 3PI6A 3M1CB 4EBKA 3DFIA 3EZLA 1R15A 1W4LA 4ZVTA 3QHQA 5L3QB 5JCZA 1R9NA 4KQKA 4YP6A 3VH3A 2TYSB 4ARUA 2YIDA 2R1VA 4BGIA 1W44A 4P4GA 1NC3A 1FMLA 3RABA 1VIDA 1HKHA 3OKPA 2QYOA 2GT1A 1AE1A 3RVJA 4JKVA 2RBGA 2NUTA 2RCNA 1XRSB 1UJMA 1I94B 2QLTA 3QRWA 3IAHA 1D4OA 5HK8A 4JQYA 4N3AA 3RFCA 4Q9NA 1Q44A 1SNYA 3R9XB 1T5LA 3QIAA 4LJKA 2BBSA 5BRAA 4PYRA 2JVJA 5M3BA 3UICA 4QYIA 1ODLA 5DHUA 1QDUA 1E85A 2EOAA 4ARAA 2VHQA 4LHEA 1JU9A 2QDKA 3IVCA 1KHTA 4WSOA 2QN7A 2Q21A 4OGLA 1XFDA 3AGTA 3FCOA 4PC7A 1A9QA 4G0YA 5TIIA 4QASA 3G2QA 3EF3A 2YWFA 3SEZA 5IJ0A 4K1LA 4QFMA 3A37A 1GTL1 4R9RA 1XELA 2B8TA 3TULA 2QY9A 2JF0A 1UODA 1V9LA 2PWBA 1R4TA 2ETXA 4YV0A 1YS1X 5F5XA 3Q11A 2NO4A 2CFTA 3V7WA 3I3SR 1CGOA 2CLSA 2RH5A 3DAOA 1I32A 3LWNA 2M2IA 4HCJA 4AJHA 3FYUC 5GOZA 3ZQ6A 3FVQA 1NVFA 2FW6A 2E7ZA 1RCTE 4WXMA 1YZAA 1TI7A 3GODA 2PD3A 3KYDA 4JGBA 1T4CA 1J0AA 2AG8A 5FH9A 1AGRA 3WKAA 1DWPA 5DOVA 4EPWA 5ALRA 3NHSA 3OE7A 3OBIA 1T6UA 2Z95A 4I5IA 2CE2X 1MG5A 4Z9JA 2YWCA 3UO8B 4OFBA 4Q3EA 4JL8A 4MV8A 2C94A 4I9NA 3OH8A 1NU9C 1W7AA 4LXXA 1U02A 4MYUA 1N2SA 3R6TA 1MZPA 3GVHA 2QMZA 1G16A 2J3QA 2ENUA 4URHA 4MV9A 4AL0A 2I2CA 3U5TA 3LX8A 1Z68A 3WV4A 1HMOA 2Q29A 1JKFA 4GI1A 3EEBA 4W5WA 4URWR 4FI3C 3U2QA 1ZD8A 1YS6A 3IVXA 1K6EA 3IJPA 2OVBA 3H6KA 4XWKA 3V4RA 2EDCA 4RF2A 4KNWA 3FW1A 3OLWA 3I34X 1YJBA 1TA9A 4X6UA 1L5WA 4H27A 3MF4A 2ACWA 2Q6TA 1DZ3A 4KG7A 1BCSA 4QJ3A 4ND2A 4PLZA 4RELA 4W5OA 1ZITA 4GVPA 4R8VA 4MLDA 2O52A 1SOMA 4PE5B 2JA2A 4ZVPA 4AXXA 3FHOA 3WJ1A 5JOQA 4GWGA 1TUBB 4KPGA 2QE9A 1KJJA 4Q16A 3HNPA 1B7GO 1GGFA 1M8KA 1WGWA 4MJ7A 5ALOA 3FOOA 1IHOA 2WTXA 5G0SA 2FR8C 2YFQA 5JAQA 1KYXA 2JIOA 4CIYA 4BMOB 5L3QA 2I8CA 2O2JA 3GCGA 4RL6A 3SPXA 1OW6A 4JLBA 4NOKA 2Y4NA 2YWAA 3ICCA 1VE6A 4GWLA 3V80A 1II0A 3ZZMA 2HMWA 4DUZB 1CB7A 1LBEA 4KO8A 2O50A 4C3ZA 1U1EA 2ZXRA 5BW4A 3OM1A 4FOOA 5KC8A 1N0HA 4YRDA 3R9XA 3VBEA 3OTWA 4X92A 4IKEA 1M7BA 4EO9A 2J0EA 1XTSA 4XYGA 3KZXA 2TMVP 4U7HA 1UOPA 4H17A 4INPA 4W82A 3ZDEA 4M60A 5SYMA 2ZITA 1QE0A 4H31A 1R18A 4HQ6A 5CA1A 2CJXA 5KJEA