4BJ6A

Crystal structure rif2 in complex with the c-terminal domain of rap1 (rap1-rct)
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
329
structure length
293
Chain Sequence
SPVKERVDHVFYQKFKSMALQELGTNYLSISYVPSLSKFLSKNLRSMKNCIVFFDKVEHIHQYAGIDRAVSETLSLVDINVVIIEMNDYLMKSDLMMMVMRKINNDESIDHIVYFKFEQLDKLSTSTIIEPSKLTEFINVLSVLEKSNNIAFKVLIYSNNVSISSLLSTSLKKKLNTKYTVFEMPILTCAQEQEYLKKMIKFTFDSGSKLLQSYNSLVTCQLNNKESNLAIFFEFLKVFPHPFTYLFNAYTEIIVQSRTFDELLDKIRNRLTIKNYPHSAYNFKKNQRLPLKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Rif1 and Rif2 Shape Telomere Funcation and Architecture Through Multivalent RAP1 Interactions
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords RAP1-INTERACTING FACTOR 2
total genus 106
structure length 293
sequence length 329
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-04-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1650 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4bj6A01
3.40.50.12060 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4bj6A02
4BJ5A 4BJ1A 4BJ6A
chains in the Genus database with same CATH superfamily
3N2ZB 2HTFA 2YWRA 1OCEA 2PLNA 2WJZB 4GAEA 1F9AA 2W37A 3HR7A 5HTKA 2HQBA 1E1KA 1E3EA 3I37X 4PONA 1JIXA 3ZSUA 1E58A 1PVDA 2VAXA 2ZIAA 3FCUB 3B85A 2XOKA 4MQUA 3K9LA 2LKDA 1SR8A 3C39A 4NTZA 4Z9AA 1A9XA 3U56A 2ZETA 4AUEA 1VPVA 2FSSA 1SC3A 2QPLA 1E99A 4A0HA 4B4VA 4HDNB 4JBYA 1ONNA 2KLHA 1WBBA 4ND3A 5LA6A 3P5BA 4IOMA 3TZLA 3KJFA 1PJSA 3TBFA 2PQ6A 1AGNA 1OXVA 2BFOA 5FL7D 5DHUA 3I2JA 2QUKA 3UY4A 3VMMA 4HFJA 4E5YA 3IEVA 2AVNA 2IYQA 3L1VA 4MEJA 4AG6A 2EKZA 2Y2VA 3MLGA 2LE0A 5IF3A 1FNTc 1DPGA 4G86A 4GLFA 4I4TF 4YAFA 4EG6A 5CVJA 2RKWA 2I6QA 4JP5A 3UIEA 2JPUA 4QO7A 3WY9A 1BMFA 1W59A 3VBEA 1RZ3A 4OHRA 3CPHA 2OYCA 5LPNA 4J29A 3ZQ4A 1HZJA 1W35A 1WA5A 3TSCA 4UMDA 2O14A 4DLYA 3GH3A 3HNPA 2GRAA 4LGCA 4WVFA 2R4TA 2XQFA 5JMPA 2Q1WA 4MTOA 3EIXA 3HDJA 3L43A 3OX1A 1WXIA 1U28A 3U3OA 3GWNA 1I2CA 2XH8A 4NARA 3K0FB 1P8AA 1UOPA 4B7ZA 4CMBA 4IZHA 2AW3A 1SU7A 1J25A 1UBJS 5AM4A 1DTEA 3A2KA 1KO1A 4D46A 4NQZA 4EFDA 2WHPA 2VF7A 5CA1F 4MCHA 3ADCA 1VB3A 2I1LA 1YKSA 3JAMA 2PX2A 4FKBA 2X4LA 3LDAA 4TXJA 3RM3A 1TYZA 1C8LA 2W2OA 3KWJA 3NNNA 4A15A 5KJEA 1UP6A 1C3XA 3PC2A 3FIUA 2J5KA 2OXIA 2QDXA 1Y7HA 3E7FA 3LZDA 2ZXPA 2B21A 2VH5R 3EIOA 2B7BA 2B78A 1GU1A 2Y1GA 3G88A 3MB5A 4P31A 5DISB 3REGA 1FLNA 3FYSA 2CDRA 3AWIA 3ZWNA 1D04A 2D74A 2DGDA 2GUGA 2Z04A 3ENKA 4K8RB 4F72A 4RVSA 4PLZA 1IM8A 3LDHA 5FI3A 4DR6B 3V8RA 2ZTHA 4EUKA 1E89A 1JNXX 1KBZA 2C9ZA 1WCWA 2Q3JA 3EPKA 5I8WA 2C9MA 4GGPA 1VLQA 3WXBA 2FQXA 1EKYA 3CNEA 4WIAA 2ZZNA 1ORIA 3SI7A 4JMLA 4G0MA 5HNKA 4KQMA 4DC9A 1JLMA 3ZU5A 1EGHA 1XCLA 3ZW7A 1OTHA 1Y3FE 2F6RA 4ARZA 4BYGA 3GJYA 1ISJA 3UHFA 5DO9A 2KW3C 4BJ1A 1Z33A 3KFVA 1EH5A 3S29A 1EVJA 4DIEA 1XRRA 2HIGA 1YRBA 2O4CA 1HC7A 4C0JA 3M5DA 4EG3A 4YO8A 1ENYA 1DMRA 3I34X 2K7FA 3T15A 4U6NA 1QG6A 4HE8D 1BXGA 3DPSA 3MD9A 3H7IA 5KTRA 2FCAA 3GZTB 4X95A 3MT8A 1OH5A 1RPTA 5LJLA 3NORA 1TOAA 3Q9SA 3ENQA 1OWNA 3GRPA 3DCNA 1ZBDA 2C7OA 4J49A 3BXHA 3MWEA 1G7SA 3OEEA 3L8HA 1H3FA 3VM6A 3O2JA 3R3SA 4RCVA 3FWYA 3GT7A 4KXXA 1AHHA 4X1OA 4U3JB 4DCUA 1OI7A 4B8YA 1FBTA 5BVHB 3R7AA 4DLKA 2B61A 2N42A 3UQYS 4BMOB 1Z5UA 2SNIE 4HDQB 4IARA 4O02B 4Q3LA 4HX9A 4RIEA 4QUGA 3FZQA 5C46F 2RGEA 3GJ8A 1E1RD 3L0BA 1EXMA 1F17A 1Q5PA 4FDUA 1BD4A 3IH5A 4Q4LA 4P08A 4BMSA 3CISA 1XZFA 1MXFA 2GUWA 3V9PA 3ZOKA 3WTCA 1EWQA 2W2LD 4HLNA 4ID9A 1ZNZA 4AN0A 1BQ3A 4N8SA 3GJRA 2ONKA 2I2DA 3IEIA 4XRGA 2ZCJA 3IAEA 4BMXA 3VZPA 5IHXA 4PYMA 1M2OA 2OQMA 1CTQA 2QD5A 4RIHA 3M6IA 3VU9A 5JHHB 3CTMA 3NUQA 3O10A 1DIRA 4G37A 4PFOA 3CJQA 3KJEA 3DDUA 3DT9A 4F0JA 3GJXC 3RRMA 4LHVA 5JI3E 5JXJA 3F6RA 1FFEA 2VYVD 3C6XA 3JS5A 4IHJA 5LU8A 5LDHA 3DKRA 1L6RA 3PL1A 2DR0A 4UMFA 3HBAA 1FLDA 1DGQA 3ETEA 4CKXA 2D3WA 2ZRBA 4AB1A 4DRXA 2Q8PA 1JF8A 2N0SA 4YJHA 4I1MA 3JD2A 4F71A 5B36A 1V16B 3DE7X 1Q0QA 5HXAA 3O6XA 4HPJB 1T8TA 2W6ZA 1SKAA 3HJBA 4DCVA 4EO9A 3KYCA 3P5SA 2F00A 3ZVRA 3NHFA 4EG5A 3BRQA 1OV4A 4QVGA 2BH9A 3R9XA 1FYXA 1LK5A 5JXWA 4FR2A 4IRXA 3FXAA 4CM3A 3HS3A 2J6HA 3AILA 3MFQA 4OHFA 4KR3A 6ABPA 3TZQA 1H3EA 1IPEA 1RJEA 2E0IA 2NU6B 2QJOA 4BMDA 3HDHA 2E5FA 2Q4BA 3CLUD 2RH9B 1PR4A 1TZBA 2ZYDA 3TVDA 3ND5A 4KRYA 3NYQA 3QVGA 3M4BA 1WO8A 3I64A 1N25A 3G2HA 1O89A 3JCUQ 3ZLBA 2UU9B 2QE7D 1MUUA 1IN5A 1D1TA 3PYLA 1TGYA 1W94A 2PSEA 1GPAA 5F23A 4BGUA 4KI2A 3ORQA 3H99A 4NBLA 1OBVA 1TFUA 1U8AA 2JBHA 2YWCA 3HYSA 4HAIA 2WM9B 4JJ6A 3PGXA 5I8PA 4OREX 3L0SA 4JI2B 4OMFG 4XVCA 4X90A 5BSVA 4KYTA 1QV7A 4B7UA 4UHBA 4HDRB 1LDBA 3LSTA 3TB4A 1F38A 1M2NA 1TF7A 1ZUD1 3W8RA 1G60A 5FWAA 4M1EA 3BBPA 1JG7A 3GA7A 3P4XA 4F5WA 3KZOA 1UANA 4QFMA 1B0ZA 5SYNA 1C50A 1ZDMA 2HK9A 4PHHA 5FFMA 4UJ5A 3TTYA 3RIMA 2CWWA 5COQA 1JG2A 3AOGA 2JHPA 3KOZA 1KY3A 4MZDA 4HTAA 3HC7A 4QEKA 3S1LA 4Q7CA 1IHOA 2FPIA 1LS6A 4QARA 4QE3A 5HFNA 4B6GA 2RHTA 4BDSA 3ZG1A 3J80A 5DM0A 4C78A 1V16A 3NBUA 1I1QB 2LKCA 4R7GA 1N5OX 2CUNA 2RGAA 1B16A 2GEJA 4X8LA 4RIFA 1DTWB 2Y1KA 4YCLA 4N49A 2O8CA 3NTUA 2CDBA 4I08A 3M33A 1U3VA 4JJ4A 1YR7A 2EW8A 1HE9A 4P3OA 4UUOA 5C1DA 5IFLA 3THWB 4GR4A 1P29A 4YRAA 4FMPA 3ZJVA 2IHZA 4BGVA 4OQNA 5FBZA 4L02A 5JDIC 3ZD9A 3PUWA 1Z8NA 1MMGA 4IVQA 4XQ0A 5AD1A 2GHIA 3COJA 1HMOA 3UN1A 5M7EA 2G62A 1NU9C 1PS0A 2GFIA 3RYHB 1MAAA 4EBFA 1ADYA 3EN0A 4U8HA 1II0A 2ZRAA 4JA0A 4YFVA 1LPOA 3EXFB 5DOVA 5IUJC 2YJ6A 3DBIA 2DB4A 2J0XA 5HX7A 3HXTA 3A3KA 1AUEA 4TTQA 2FQWA 4QOSA 4WINA 1W36C 1DKUA 4PLHA 2DULA 3BQ9A 4WY5A 5C3MA 4Z8XA 2C82A 5EEGA 1P3JA 2DY1A 4Q3DA 5E1MA 3WAJA 4LMRA 3CY6A 2HLDA 3DOCA 5DN9A 2FWBA 1MTZA 1KDTA 4AE4B 1RAEA 2Q5LA 3DHNA 4IJUA 4MVYA 3DJFA 3U2LA 2ZAOA 4P98A 1ODLA 1QWOA 1VYHA 2QRUA 3SE0A 2Q7RA 3ZCUA 2V74B 3U5ZB 4MW5A 5JJIA 2KC3A 2YW9A 1D5WA 3GIDA 1O4VA 2CCJA 3HNJA 1V9LA 2BFFB 1XU7A 3AUFA 2HJ3A 3K15A 3N8GA 4G1MB 4RAOA 1ISIA 2FFAA 1E7YA 1K86A 2GH1A 1ISGA 1BXGB 1XDSA 1EUZA 3ONFA 4MYHA 3U4HA 2MSLA 1NSGB 3ONWA 3TOLA 2I65A 4K03A 3Q8KA 2J5XA 1Z22A 2YHIB 2Z3ZA 3OZRA 2FQ1A 4H1VA 1KQOA 1M2JA 4YAJA 3TLAA 4YJGA 2XMDA 4JKVA 2HM7A 3G9XA 1MMNA 1YVIA 3EQ2A 1DHTA 2ANCA 5CH8A 1TRKA 5KB3A 4HLUC 2H1WA 4CV1A 4R16A 2HBYA 3NHLA 4FR0A 2AB0A 4V0KA 5U1PA 2VI5A 2XWPA 4DQVA 1UQRA 1YL7A 1RHKA 4ZQCB 5K1ZA 5BUCA 1TE2A 3RAJA 3IQ6A 1W2WA 1H94A 2C4TA 2H7VA 4PWYA 4RHYA 3UG7A 4BTLA 4ZZ1A 5KOYA 5ALMA 3B0PA 1Q3TA 3ES9A 1EEHA 1OI4A 2YNMA 3I8OA 1G20A 3O47A 2GVNA 4TKMA 4PQRA 1JFVA 4XAQA 1JJIA 2YMQA 3BCRA 4FYKA 5I7RA 1UXJA 4CEJA 5LKAA 1LI5A 3GZNA 4IG9A 3OQOA 2PCLA 1GSHA 2GWWA 5JSZB 3NATA 3A9CA 2Q2QA 5I9TA 2PX3A 5HKKD 1NVFA 1GTMA 1TFRA 2H2WA 1LE2A 3OZDA 2ZJ5A 4NOKA 4WNIA 3E23A 1P5ZB 3DD5A 4E0BA 1RI3A 3ER6A 5K6AA 3MXTA 1CUJA 2DBYA 3W9BA 5IKEA 3B7PA 4B87A 1ILWA 3V2IA 1N8SA 1NQXA 1RWWA 4BN0A 1I5RA 4MJ3A 2D3TA 4OA5A 2RFLA 4GZ3A 1MAHA 4NBSA 4D0NA 1CLUA 2XMPA 1JAHA 1NSYA 3MHTA 2IYUA 2QUAA 3ZGVA 3DWFA 1Q2XA 4L0MA 3O2QB 4LE2A 4YCAA 4XWOA 3KRTA 4YPVA 5IS2A 2IU0A 4YPFA 1B6TA 3ZDZB 3D02A 3NM4A 5EXXA 4FB5A 1JV2B 4J7CA 3HSYA 1T4BA 3BSWA 3JXEA 4IH1A 2ERXA 5CFZA 3BILA 5HIKA 4KZKA 5FL7A 1RI5A 1PFYA 1ZMRA 3DMGA 1OY1A 1WB9A 1NI3A 2NT4A 4J4BA 3EIQA 3N2GA 4EA7A 3IKVA 5K3DA 2WJYA 4EMTA 3NRJA 4U2GA 2NG1A 5AMXA 5DT2A 4ZWNA 4EG1A 4UVDA 2FU5C 4V02A 3Q1LA 5HIMA 1R0ZA 2NQ8A 4RZQA 4X1KA 1YOVA 3OI7A 4B75A 4Y1EA 2ZIFA 5FR2A 3ZE6A 3HNKA 4Q7QA 4GI3A 2G06A 2X6RA 4B3DA 1NVXQ 2QRJA 1NLZA 1OOEA 2HTEA 5KOHA 2EPNA 3LA8A 4U6QA 5LA6B 4CM9A 5B3JA 4H17A 2O8FB 2X58A 4CKBB 4UHCA 3O4IA 5G53C 3LYLA 5CYOA 3RFFA 3RS5A 4H77A 1G42A 1TI7A 3B53X 3V6LA 2O20A 2V97A 3DFKA 3TXAA 3MF4A 3W7BA 4M53A 2C29D 3EUAA 5A5FA 4K88A 2QTCA 1LLQA 1TO6A 3V2GA 1VIYA 4MGZR 4YRQA 3UGTA 3L0YA 3PC3A 1UMBB 1DV2A 2CLOB 3LRPA 2JS7A 1OD6A 3STUA 2DMRA 1KZ4A 1EFVB 4RDHA 5HJ5A 2EYUA 1OJLA 3VI4B 4DG8A 4EOGA 4BEJA 4H7IA 4ABYA 3UXHA 4EKWA 1JSZA 3SXYA 4EB3A 3GJZA 2Z5VA 3PE4A 1Y82A 4N7RA 1AKMA 4D4XA 3LDFA 1F4LA 3FOZA 1SXJC 3U19A 1R0YA 3OTWA 4H1UA 1HLFA 3OJOA 2BMWA 1QH8A 1J4AA 1VXRA 1VM6A 2OQVA 4HQRA 4PGMA 4GO1A 4RLFA 5JAHA 4GICA 3P2OA 4FWTA 2H4YA 1KJWA 1LKXA 2YV5A 1GCAA 1QKJA 1USVA 4GUDA 4HDKB 2IJGX 5C9ZA 4PR0A 1VIAA 3TH5A 1WXGA 3BORA 4D45A 4JP2A 1P17A 4EAAA 4F2GA 4PHTA 3TN7A 4GXTA 5A5DA 3I5PA 3QA9A 2G4CA 4FFMA 4FGJA 2C98A 3LJKA 4FDTA 4LJ5A 4WXYB 3BXOA 5CH3A 4KSBA 1FNSA 4PR3A 4E5UA 1CR4A 2OECA 3AQBA 4RXMA 2XRYA 1JU3A 4G8CA 4Z0HO 1JDPA 2FLWA 4WNAB 1RAGA 1DQRA 3RUDA 3U7EB 4DCGA 2P0EA 2AWCA 3HDVA 2ONJA 1LEHA 2BP7B 3NH9A 4BO9A 5H80A 2L9JA 5C53B 2PX4A 1ISPA 1P7YA 3CF6R 4IYRA 3TI9A 2XA9A 1YFLA 1XD9A 1X1BA 3RC8A 1B8OA 1G20B 1JLRA 2OBMA 3FTNA 3TMYA 3TSAA 3A1WA 1DP4A 2CCKA 3MSXA 5EIXA 3G7SA 4YRMA 1WXQA 5JU6A 1GZ7A 4UAVA 2WHYA 4WK4B 4HMPA 4NU8X 4X00A 4NENA 3UMIA 2IOQA 3PFCA 3UFXA 6ADHA 5K0GA 1KGDA 2X42A 5HKLA 2BKUA 2XWQA 4NDAA 3B5JA 4Z9YA 1Q91A 2C61A 3HJHA 4KLAA 5KKAA 2H4ZA 3WO0A 4AJ4A 4ESOA 1FMFA 3B9QA 3OZCA 4GI1A 2BM8A 1R6TA 1DBPA 1TCVA 1Y37A 4PBSA 2M6LA 1T5DX 4FDAA 3IAUA 3BWBA 4RCYA 1DAMA 1F51E 1HNNA 2WVJA 2QZPA 3DE4X 1XEAA 4PY2A 4XLPF 1SOVA 2GEVA 3HDQA 3LUJA 3UMYA 2DKOA 4N39A 3B89A 4HAOA 4YAIA 1GNPA 1QIKA 3SF8B 1R0KA 4DREA 3JYNA 2PXAA 2RHMA 4OATA 4F9GA 4ZYYA 1TEXA 3NZEA 2C78A 2E4AA 4C08A 1B4DA 5BQPA 1WP4A 3FDZB 1KMQA 3MMSA 5YASA 1CEXA 2BKXA 3EFHA 3FUWA 3TEMA 2J4CA 1VSUA 2AT1A 4Q37A 3HA5A 3TE6A 4JUFA 4DILA 4F8EA 5A9SB 5MFPA 2HQ1A 4ZO7A 3U49A 4I66A 1KKUA 3GLHA 3RTBA 3QKSB 5FP0A 3LHIA 2JLBA 3UJDA 2RG1A 3A2LA 1GFWA 4JI1B 4BWFB 3RG2A 5LMZA 1HMPA 3PQEA 1D1CA 2DHQA 4X64B 4A3SA 3U9MA 1SG9A 3NTXA 3P1JA 4KNWA 1DRJA 1LW7A 3EZ6A 4JYPA 4PO9A 3S2ZA 1L1RA 1VJ5A 1FUEA 2AG6A 2ALJA 2JI6A 1EQ1A 1WMDA 3P4UA 5ANRB 3ZWMA 5IDXA 4Q7KA 5HR5A 4PFPA 2Y9MB 5LA6F 3RBXA 4EB8A 3WWDA 3EVCA 4BXOA 2A5LA 1JILA 4DVGA 3T4UA 1VKJA 4JIGA 4R0NA 5A4FS 1CJCA 4GR5A 1QUFA 3N0VA 2IYPA 2X0EA 4BBJA 2AIRA 3RJTA 2IM8A 3ISVA 3OJFA 1T34A 4J03A 3N28A 2J0SA 1GARA 2HMSA 1IH8A 4IX1A 3NHPA 3SF8A 1ONPA 4GKJB 4OJNA 3R7CA 5K0TA 3C6MA 3ZWDA 1PJBA 2Q3TA 5EGYA 2AMFA 2C84A 3AXSA 3CWQA 4KBFA 1W0KA 1OZAA 1Q21A 2A9PA 3JSAA 1WVIA 4HXYA 1AA6A 2WP0A 1OXTA 1QP0A 5AK3A 3R5XA 2LIGA 1B93A 1FMVA 1P1CA 1Y4ZA 5AVRA 1N7HA 3VOBA 3AJRA 3VPDA 4Y2VA 4OLFA 1OYWA 3AL0C 2XUKA 2HQRA 4NYIQ 3UHJA 4BGIA 3AUKA 1UFQA 3IP6A 4PX3A 3ZJYA 2YDXA 3FLMA 4F4FA 3H2GA 3OSZA 2OAEA 2NZ8A 2O8VA 1ZJZA 3H11A 3H6HA 3K94A 4QUDA 2TRSB 4CLOA 2PT9A 4Q9NA 2BISA 2A58A 4ID3A 2X8LA 3CLKA 3G50A 2YZMA 1GA4A 2FE4A 3GLRA 3NWJA 3SYTA 3HCWA 3S2YA 2ZBVA 4C6TB 1ENOA 1NDHA 2FMXA 4LE0A 2EFEB 4YRJA 4YRKA 2A78A 2BHTA 3FGOA 2A6PA 3IDAA 3WIDA 1ZJ5A 2Z9DA 3F1KA 3PQ4A 4JDUA 1PHPA 1EVEA 2Q45A 4HR7A 2ZU0C 3UMGA 2CHFA 5CFQA 3AVPA 1A3CA 3AXTA 1PYOA 2ZQ5A 4F6LA 2WJJA 2M9MA 1P75A 2XD4A 2ZCVA 3UJ9A 3PC8C 2WF8A 4Q9KA 3V33A 1PD1A 1HWYA 3I0NA 3IRVA 3AETA 4S35A 3U4AA 4BGDA 2ZG6A 4PLWA 2HZ8A 3IQDB 4P5DA 1MRNA 2D0OB 3A7EA 3HBFA 4EVQA 4EGJA 4FFDA 4IZ6A 3VZQA 3N0XA 1T0PA 2F4VB 4TM7A 4YN3A 1MQVA 3TDNA 2V6BA 1XEXB 3JZDA 1TLTA 2WOOA 5FRDA 5IULC 3RK1A 4ICIA 3MUEA 4B44A 4D8YA 4MB6A 1VZ3A 5AIBA 5BV1A 2ZTVA 2P9ZA 3DJNB 2F3PA 2Y1EA 4MVJA 2EZTA 1KAMA 3LFTA 3DKPA 4KG7A 4R2XA 1E8DA 3BM5A 5T64A 2Q7XA 1M1ZA 3MJEA 3T41A 2GPTA 4NY1A 1BS9A 2QX6A 2XODA 1RE1A 3IQFA 4FZRA 1IQRA 3UJ6A 1ZR4A 3U2MA 1GCGA 3GDHA 3OZIA 5E9WA 2H1VA 1WDKA 5B1AC 1V7PC 4KDEA 4Y2XA 2M1XA 2EGGA 5IABA 4JCOA 4X93A 1R1DA 4BEWA 2PL5A 1TYCA 2W22A 4Y0VA 5ES3A 4RPJA 3MTBA 2QYTA 3LY7A 4G2NA 2UZAA 2A9KA 1UPXA 2NZVG 3W3ZB 4JB8A 2VVTA 3OX3A 4KWCA 4OQEA 4YASA 4MVSA 1P5JA 1OXKA 1VIMA 3WGHA 2WB4A 2Q5OA 2ZWOA 1JH8A 3S2SA 3W79A 4COKA 2X1VA 1HOXA 3PITA 4L57A 3NRHA 2VPXA 1X9HA 3OICA 1KAOA 1PT6A 3CGGA 1KJZA 2BW0A 2R8PA 3ETGA 2ZRCA 3Q8WA 2ZUCA 4JQCA 1TKAA 3C5CA 4MROA 2HLDD 5FPQA 5JFGA 3AW9A 4KQXA 3E27A 1ZS9A 3AF1A 2XNKA 3BDVA 3DTTA 3WI7A 2X5JO 4NMWA 1YI8A 4O2AB 5LOVF 2H59A 3LT1A 2ZVQX 3A9WA 1E5XA 2ZKIA 3IAM1 1T35A 1QHXA 3OFSA 3D4IA 3FRJA 2QDKA 3JT1A 2R7WA 1OE0A 1XDZA 2JK1A 4GX5A 4L7QA 3OPNA 4QHYA 3GFGA 2A5DA 4NFYA 4MVRA 4KO1S 1M10A 4REQB 4FYVA 4NULA 5SV2A 5GOTA 1XB2A 2ENWA 4RV5A 3K9WA 4C7XA 2V3WA 4HVCA 4IYJA 2BMEA 2A1DD 4LX0A 3S2UA 3RIYA 4R8MA 3RWMB 4Q1VA 2J3MA 3ZQYA 2IXEA 1K3FA 2O7VA 4DLPA 2J5QA 3EGXB 2C9OA 2QM8A 3OFKA 1CPQA 3KZCA 4KMRA 4XVQA 2VN8A 4ALMA 1CE8B 1WSBA 2AZTA 2JHGA 3LW8A 1MORA 1ZHTA 1VE9A 3OJCA 4Q47A 2VF8A 1E79A 3L1IA 3T7IA 5JNSA 1V39A 3JZIA 4JDPA 1L7RA 1EXVA 3RRXA 1SVLA 1TKNA 2XM0A 4M7PA 4JOQA 3WGYA 1PR9A 3HK2A 1H1TA 1X7WB 4WMLA 1CZOA 1LI7A 2BT4A 3QELA 1ZJJA 4L4SA 4CTJA 3ZJ5A 3H97A 3COVA 2EJUA 3KMIA 5A0VA 4OV6B 2R96A 1U2DC 1DCKA 4D81A 4YI5A 2JLXA 3EBOA 1MOPA 1TW2A 4BYMA 1UT6A 4GI7A 4E1BA 5JSKA 1NE7A 2JJ1A 5A6SB 2ID9A 2QN3A 1ISHA 4RVHA 2DECA 2AQHA 3B20A 3BCHA 5DM4A 4P9TA 3T9FA 4DJDC 4WW0A 3U26A 1QHNA 4EPXA 3T1YB 2GKGA 4XH9B 1K75A 2P6PA 4GPZA 3LVBA 4DQLA 2CVQA 3QIAA 1V9SA 2H16A 3ZY5A 1UXKA 3PP8A 2Q4DA 3INYA 4YRNA 1L3IA 4CCSA 2F8MA 2QG4A 2A6EF 1BA3A 3OPYI 4O3FA 1JZSA 1H0SA 2Q4FA 2P1RA 3ETLA 4O63O 4OQFA 4B4UA 5IKMA 2FPWA 1DVRA 1HDGO 3K5PA 1MFZA 4RGQA 1ORHA 5I9MA 5LP6C 2UYYA 3OCWA 1HSZA 4TYMA 2GRUA 2OHFA 2NSDA 2PU5A 1IMOA 1HNZB 2QQEA 4AIIA 2G5PA 5EHQA 3M1AA 3O39A 4X6UA 4ETIA 4TROA 1A7KA 3L1UA 4FFBB 3GT0A 2KHZA 1W4RA 1VYIA 3IIJA 4AZTA 1RQ2A 1BWRA 3ZTYA 3O9ZA 1GM5A 1SEPA 2VXOA 1CP2A 3ABQB 4UPVA 5JJCA 3L4BC 2ZWVA 4MRAA 2R7KA 4YTEA 2G63A 2IV7A 1M75A 2EQ5A 1WF3A 2QUBA 5BXQC 1Z5OA 3ZPXA 3CRMA 1NFFA 1X8LA 3G2OA 3OCXA 2WUVA 3NKFA 4MQMA 3UPUA 1PEAA 3GFRA 3R5TA 3GGGA 2P2SA 2WSSD 1BJKA 1U7HA 2HSZA 2YHUA 1Z6GA 3CTPA 3HLYA 5AK5A 1HE1C 2GX6A 2JG3A 4IJQA 4A8TA 3FTDA 3A70A 3H1BA 3N87A 1G8KA 4TWJA 5HZHA 5IAJA 1SHUX 2WVAA 4FZVA 7ABPA 1WB5A 4JB2A 2WD8A 1QM5A 4NENB 5IT4A 4WOJA 3J81A 1JBEA 3TOMA 3OP1A 4LMBA 2WTEA 5ED0A 5HW0A 5EP4A 1PG0A 4IWBA 2WYUA 1G6KA 2AGVA 2C3PA 3DJYA 3EEFA 3R74A 3WJ1A 4EARA 2VT6A 3KL2A 1GKUB 2C0CA 2KBEA 2ZI3A 4LRUA 5G3YA 4AY3A 3QHQA 3R6WA 2NP7A 2WKRA 4BVGA 5EPEA 5SY4A 3RYHA 2I66A 3PRYA 5AKJA 5K3BA 2E2WA 2ZIXA 5B1YA 1FZQA 1H6DA 4BOYA 4EWLA 1EZ1A 3ROEA 4F1WA 5HRAA 4JNKA 3W77A 5TQ0A 3E9YA 4ER6A 2C4NA 4PCVA 5M2QA 1A97A 2F9MA 3M4JA 5KSYA 4IFIA 1L4EA 2F4NA 4RL6A 1JDNA 1KU0A 1ES9A 3U4DA 2FR1A 2NNLD 3AF5A 3U6BA 4OH7A 4FWVA 3AF3A 4CM6A 4M8IA 3HTKC 4I8XA 3I9LA 3TPFA 3T7SA 2VDMB 2DPXA 5KX5A 4UDXX 1DXOA 2OB2A 2CSUA 3HUUA 3GM2A 5HOQA 1KEUA 1XKQA 3CNQS 1K4MA 2PK3A 4J0KA 3SQLA 2FEAA 2R6ZA 4ARAA 3AHJA 4TS3A 5JSFA 1JLLA 3WBBA 4D9NA 2V7UA 5C4GB 1DJMA 3DFIA 1MJHA 1MX5A 1MW8X 1QO9A 1S7GA 2KQ9A 4HNRA 4ZU6X 2BFBA 1J90A 2Q1XA 2BELA 2BMVA 2FUG6 3MM4A 2Q3MA 4RLQA 4XQGA 1D4OA 4BFWA 5F5LA 1HZZC 2PU7A 3SHQA 5KJ1A 5LMCA 1XZLA 2HSGA 1UJBA 4NNJA 2KLBA 2PXXA 3LC7O 1G7RA 1XELA 1E2HA 1Z2PX 4TPKA 1KE2A 2I3AA 3FPEA 3UTCA 5LDDC 4RK0A 1XRJA 3B38A 2XQVA 2XCUA 4N7MA 1U7PA 2HJ9A 5MN4A 4BWYA 2QY9A 2F9FA 1ZVZA 3WBFA 4DJAA 3JZMA 4Q5IA 3CUYA 1VB5A 5L3QB 3L0DA 1W2GA 2A0XA 3WGMA 3QYJA 4RHFA 3RTDA 2AXNA 3A9UA 3GQBA 5GGXA 1P3DA 2D0PB 4XQCA 3K8YA 3AEQB 2OD9A 4JURI 1T8YA 3FDXA 2QVBA 1P7PA 2NU6A 1OUMA 2Z43A 2Q0SA 3BCUA 4L74A 3R7SA 4KPUB 1O6FA 1TDJA 3LRTA 4XE5A 4BFZA 1XU9A 2PZ8A 2YTZA 1ZLXA 2PSFA 5CIYA 4ND2A 2IYRA 3QF4A 3H18A 4M0KA 1CUAA 4NFLA 3PTAA 2GM3A 3HCFA 5EKUA 1WVMA 2X0NA 2Z2JA 3A0RB 4BRSA 3Q3IA 4KMOA 3PUKA 3OE7D 4N54A 3IEKA 1M34A 3K5IA 1SVOA 5ITZA 2YWFA 4US1R 5BT8A 2PLWA 3L6CA 3S90A 5FZTA 1O9BA 2J9RA 3NBAA 4NR0A 5GQSA 4D8WA 1RWNA 4LQCA 4FB4A 2XMBA 2CVZA 3B52X 1POWA 3P2MA 4J0DA 2B2XA 2RSLA 4N40A 2Z3WA 2B8EA 2O0KA 3L4KA 1MJGA 3K70B 5CCBA 3C18A 5DX8A 2VTBA 3O1LA 2YV4A 5CMLA 3RYIA 2FZ4A 3ZEAA 2HHHB 4TYQA 4F4JA 3QG1A 3TQOA 4UZFA 1I3LA 3K1YA 3F5DA 3INRA 4DRYA 1TL7C 1QKKA 1IBMB 2JAWA 4FX5A 2HRDA 5A3RA 3MBKA 2D2IA 4E2XA 1U5BB 1UM8A 2ZYTX 1MPXA 1UPFA 1UZLA 3H17A 3LKBA 3OLXA 3KL4A 2QTAA 4JSYA 4XDYA 5DVWA 4KGVA 5EC8A 3QXJA 3MTIA 1O95A 1FFGA 3L04A 4NXMB 5BV0A 3VNUA 4JJ7A 4PYIA 4LAFA 5BQXA 1V37A 4Z9HA 1NNLA 1TUGA 4IDEA 5FCDA 3VYWA 2A1UA 1GNQA 4RMJA 4A6EA 3D8UA 3LPDA 4OO3A 2IBSA 1GGHA 4JOBA 3V7OA 4HNHA 1V3UA 5KPJA 2J3KA 1FR0A 4CJGA 2NO0A 2ZUUA 1TYBE 3I9FA 4KXVA 1FSGA 2PE5A 1A41A 3FWZA 3MWLA 4OYRA 3TI7A 4ZVUA 3B70A 4RKWA 4BX2A 3DV0A 2JFXA 1ZU4A 3CF4A 3K9QO 2AL7A 3IQXA 4G0PA 1QNLA 3ZDLA 3O91A 3ZX4A 2OOSA 1B3BA 3I1FA 5EINA 2VCCA 3V32A 2XDAA 4UFOA 3ET5A 4U2DA 4G85A 2CK3D 5LD2B 4U9UA 1Z6AA 4MPPA 5HTOA 3KOYA 3GLGE 2X40A 2WU8A 5FWYA 5LQUA 5ELLA 5I3CA 3DUFB 3C4VA 4WTOA 4LRYA 1KQGA 1CF2O 4AKHA 2REBA 1KBOA 2YHIA 3KJNA 3R0ZA 4RWZA 2HRCA 1JNYA 1JRLA 5IT9A 2XE4A 3IS3A 1Z34A 1YRLA 3C4JA 4CR7A 4EHPA 1P1FA 4WLEA 1A71A 1SIUA 1JR6A 2UDPA 2ZUSA 4KYVA 4OJKA 4TMFA 4EKDA 5CA1A 3RYTC 2PGAA 2VDWA 3G1WA 3ONDA 4BQPA 4KODA 4NZNA 3FCOA 2ZYHA 4UTXA 1QKIA 2Q62A 1VK5A 1EFRD 1CERA 5DM60 3UJCA 2EX4A 1WKCA 4H6WA 4F4UA 3U16A 4MVJD 2SECE 3PNQA 3MGBA 3O38A 3R1IA 5JCJD 2HSQA 4KH1A 2AC4A 3NTQA 4CKWB 4DDMA 3FG9A 2H0AA 2B0HA 1YDWA 1S0UA 1H1LB 1KVQA 2BZ1A 2UYGA 3AFNA 3LUKA 4IDPA 1TVKA 1KMHA 3W8NA 4F5EA 4BEVA 4I55B 3P2JA 2ASRA 2QN1A 3CRQA 2X8AA 5ALJA 2WSSA 3ZK7A 3VA7A 4LYEA 1SIWA 2ZXUA 1UEXC 4ZOBA 3KUUA 4IRUB 4FDVA 4NC3A 3DXZA 5SY9A 5J59A 1M8PA 3BJRA 5GVSA 1D07A 1QVXA 2OG2A 4WOKA 3RNOA 3TLJA 3GY0A 4GH5A 3ROTA 2OBFA 4CG1A 1I7SB 3UT5B 4XGNA 2ZR8A 1KEKA 1JHDA 2DJ5A 3MCVA 2C2MA 1QVRA 4KX3A 5CB6A 1TM7E 2PL9A 3MCAA 4RVFA 1Z2NX 4ASUA 3K72B 3MAAC 4ZV4A 5I7FA 1DXHA 1DL5A 5LIPA 3AKZA 5F9FA 1DTWA 3CZ5A 4L50A 3RS8A 2DWPA 2G8NA 2O2XA 1W4CA 3UJPA 4DM4A 3ITEA 4MRPA 5IC5A 3HUFA 3A36A 4EMSA 1K7FB 4A92A 5CYGA 1U1FA 2EIMC 2FW9A 1U2SA 3SJBA 1SHTX 5TV2A 2AXEA 3NIFB 1QYDA 5HA5A 2R4QA 5KVVA 4DJ9A 1B73A 2OLEA 2VDPB 4D6PA 3TTWA 3ZXIA 3I9V1 4PPQA 1K5DA 3F5SA 4C07A 1ECBA 2WPDD 1FVFA 1ZCAA 5KYWA 3CPEA 3DFMA 1O97D 5LQAA 1ETHA 4GPTA 1GV1A 3E7WA 1N2CB 2Y1DA 4G7OF 2M32A 2P5UA 2VHVA 5FFNA 1LPPA 2J09A 1TGVA 2JCXA 3T1TA 5A69A 4X8OA 2B4KA 2NACA 3HCCA 4AZ3A 2AZMA 3NHSA 1SD1A 2ZR7A 3NBYC 4R2JA 1CHNA 4UQPA 1HR0B 4TV8F 3QH4A 4TN1A 4AY5A 2PAFA 1QZUA 4OHOA 3R7LA 3TLBA 5HIIA 5FCLA 3GEIA 1JXMA 2QPOA 4TL8A 3AB8A 1XPJA 2X4GA 1PEDA 1D2AA 4ARSA 1WS6A 2KI5A 1N2BA 1AN0A 4M9RA 4V2UA 2Q3LA 1P4AA 2F3RA 3GN2A 3Q7IA 1L4UA 4W8PA 1SK9A 3CUTA 4JLKA 1JALA 4MVJH 1WNFA 4MS3B 1WRBA 3UA3A 4NV3A 1A9XB 1F0KA 2BGGA 4NE2A 2ZS8A 5E3JA 1I1NA 3G4ZA 4RA6B 4KIFA 1JZTA 1XEWY 4YDQA 1OFGA 3TRKA 4KACA 3ZJUA 1UFVA 3FN4A 5IKXA 1NR1A 1RPJA 1YJ5A 1K7SN 2QV7A 3HP1A 3CVWA 2IBTA 4AJPA 3KYDA 1TQ6A 3OZSA 3OP4A 2BUBA 4KVGA 1VJTA 3KQUA 4DUGA 3IT1A 1X8JA 3TE7A 3WL5A 3BWXA 3JQAD 3CN9A 3AL3A 3PJDA 4QBIA 5D7NA 3MTQA 4YCJA 3B8EA 1X2BA 2VZEA 1M1UA 3U3XA 1HZZA 3TOSA 4ED9A 1NOJA 1SUSA 5EN4A 3RGWS 5KU7A 3TUZC 1YS9A 2HMZA 1IWPB 2W8ZA 4XOUA 2J9YB 5AQ1A 3PHCA 1FTSA 4ENVA 3BZBA 5AC5A 2QU8A 5ECGC 2QVCA 3EVFA 1S9HA 2LCQA 2PVPA 3U7RA 5JC1A 1F06A 2EFJA 4IIJA 2OFWA 5J2TA 4YT8A 1ZAKA 1Z4JA 4FWBA 1L5NA 3PIIA 2DT8A 4BJ6C 5IH7A 3IDQA 1EK5A 4J1NA 4QASA 3DBLA 4KQWA 1FDRA 1PUJA 2ZT5A 4OQ4A 3WLRA 3I92A 1SHZA 4DRJB 1LNSA 1J2UA 4OAPA 4QRHA 2ORVA 1KVRA 2P4QA 2ZTSA 3UWMA 2AG1A 4J7XA 1N33B 3KBOA 4DXWA 1KO7A 3IUQA 1E7WA 2BSQA 2B37A 5HDBB 3I45A 3LNRA 3FCYA 5CEEA 1IE3A 2BDTA 1YHYA 1ULTA 1K6JA 2LXNA 2MINA 3R3YA 4NJOA 1J0XO 2QU7A 4DF3A 3BT7A 1D8AA 4BO1A 3R2PA 1CVLA 2Y1XA 4UEJA 3RUFA 3EOBI 4XJSA 5K0FA 2UUCB 2WJ6A 3EWNA 4LJ6A 5E2AA 4JOCA 4C6SA 4LOIA 5D91A 1RD4A 1EBFA 1RC0A 3V1YA 2YCLA 3LKVA 4KWIA 5EHNA 1XF1A 4MCJA 3NHYA 4N12A 4BNKA 2C03A 2RH4A 2Y92A 3M0EA 4K1LA 3WKEA 4DN6A 3KFLA 1VPTA 4D9KA 4DG5A 5JI2E 1ZH0A 3SSAA 1FFDA 1UG7A 1W87A 1I9GA 1BXKA 2W43A 2OZKA 4BO0A 2CHEA 1IC6A 4UXJA 1W9MA 2H2AA 3H5LA 3NASA 3TG2A 1KFBB 4LXHA 3R41A 3DP9A 1Z47A 2O2JA 4XLZA 3KD3A 3MQFA 1T1GA 3ZHQA 2J9UA 1YXMA 4CFZA 4HB0A 3NBFA 3GR6A 1IY0A 5IJ9A 3GLIB 5JD5A 3GUVA 3V4LA 4R84A 5DNEA 4ILKA 1Y9JA 1P72A 1MA3A 1HMDA 2QRZA 2A59A 2GK7A 3DEZA 2HZ7A 3M1CB 3C41J 3NDJA 3OQ1A 4HYQA 4PYLA 1W1WA 4L1KA 4XB6B 5I8ZA 3FVRA 4D4HA 4UC0A 1E4VA 3AM5A 4X1YB 1MP0A 2FN7A 4I55F 5EZQA 4EZBA 4N3NA 2EHJA 1QLEC 4G5YA 2UUHA 1SN7A 2JGMA 4NNOA 5CIQA 4DV5B 4LNUA 1D3AA 1WHSB 2R8RA 3HV2A 1GITA 3O8RA 1T5HX 2OCPA 4WACA 1JWLA 1WWKA 4Q66C 5CI8A 4EA9A 4DJJA 1M7BA 3RSFA 2D8MA 2B3DA 2I0FA 3DE8A 1SQ6A 4CCAA 3LECA 3WFZA 4AF6A 3S84A 1IWBB 2CLCX 2FTKE 1R5BA 1YR2A 3T9DA 1VJDA 3F5QA 4A7PA 3EASA 5KYUA 1DB3A 2COKA 2HADA 5EKXA 2XHZA 1WBDA 5BQGA 3G5LA 4BFTA 3PQ5A 2GARA 3MS7A 5EK0A 4DBVO 1AMNA 2DBZA 3LJBA 4E3WA 1AF7A 3UJ3X 1CGOA 1SCAA 1Z9BA 1BTOA 2WT4A 4B83A 1DEHA 2V6GA 5FPTA 1MMAA 1P1JA 4E5MA 4PVCA 4HQNA 3HCEA 4KDCA 5JZ9A 5A7HA 2HWXA 3UV6A 4PZUA 1Y6DA 1PS9A 3OTHA 2A88A 4B79A 3FFTA 2CYCA 4HPXB 4YEDA 3WYGA 1KK1A 3LS1A 2ACEA 3RU7A 2QKYA 2IF0A 2HJWA 5C7IO 4OIOF 2QIOA 2W9XA 5IJ0B 1YRYE 5AHOA 1PJRA 3TLCA 1I4WA 1SU6A 2CD7A 2QJFA 3R0XA 1SMYF 1CZRA 1P9WA 4AJLA 1R6AA 4L22A 2PGXA 1VG9B 1M56C 3SHOA 1T25A 2NP6A 5KVSA 1G5TA 2XWBF 1RADA 3O94A 4I8DA 1O94C 4HLDA 3ZU3A 3HV0A 1P4JA 4ALLA 3N75A 2Q4TA 5CD1A 1I36A 1QRDA 1T2DA 4AUKA 4HO1X 4M83A 1NXTA 3MCZA 1NT4A 4PF1A 4ZO4A 3L1MA 2QM7A 3WL7A 4A4DA 4DDTA 1U4NA 2ATCA 4MGEA 4NC9A 2DLNA 2B7LA 1L7AA 2FSGA 4OL9A 3B1ZA 2IP2A 3L41A 3UHAA 2KJGA 2AQIA 3AIMA 4A8PA 5KINB 3F8TA 3THSA 2JJ8A 2O50A 4D4IA 2FPGB 1CUUA 2J31A 3MZ0A 3DXFA 2PDAA 2V26A 2JFOA 3MLBA 4AWXA 1KI2A 5BOVA 2G28A 4EY4A 2I6XA 1O54A 4RL4A 2HY7A 1QDEA 3EUEA 3ZIBA 2P9EA 2X8WA 3OQVA 3TCXB 2Z2ZA 2B83A 3GMIA 3O8QA 4QO8A 1OI3A 3OKPA 4RW0A 3ILSA 2PUVA 1RQXA 1KI9A 2Q41A 3JQ7B 2D2XA 1L5HA 3PXBA 3VC3A 1KAEA 1FQWA 1FXSA 3I6MA 2PGIA 1NMQA 2AG0A 4AFNA 3V4SA 3KV3O 4Z0NA 4NYJR 4F3CA 4EENA 1OC2A 4U7JA 5C52B 1I4DD 5ALEA 1PL0A 2YWDA 2GD0A 1PX0A 2DPYA 2QMZA 3IPRA 4KN5A 3W5JA 3A6HA 1Z2AA 3JQ9A 4CG3A 4H60A 5JY1A 4TTSA 1V5WA 2O1SA 2TMGA 2BHSA 4ROSA 3D3JA 1WTAA 4G5QA 1D2RA 3K7EA 4V1CA 2QROA 1PS8A 3D2CA 3OIGA 2XF2A 4DLUA 1Y7TA 4EFLA 3SM3A 4CMAA 1ESEA 4WK6A 3QU2A 4BKMA 1OGJA 1QOZA 1XOIA 2DFLA 1GSIA 2VP2A 1I4TD 2C4VA 2V7TA 1J8VA 1Q7RA 2GPWA 3HWRA 4D57A 2O2YA 2PMBA 2PMKA 3D2LA 3DVAB 3LX5A 4WUVA 5B3LA 1BE1A 1VKHA 3NDRA 2WY2D 4MZXA 3W8DA 3IBGA 1N2EA 1W6UA 2GBIA 4C4OA 1USIA 2BMFA 1ZRHA 2EOAA 3EF3A 2OA0A 4BNYA 3L0IB 5KYXA 2AUNA 1Z4MA 3WV5A 1TJ3A 2EF0A 4BUCA 5GADl 1A4XA 2WG0A 1ECGA 4R69A 1SG0A 1KC1A 4D82A 1C8VB 1P60A 2WJ4A 3RJ9A 3U81A 1SUBA 2OFPA 1UKAA 3BRJA 2JFHA 3FPGA 1E9AA 3AIIA 4NF2A 3RC2A 3ZWWA 4AJ2A 3DKAA 1CCWA 1RKCA 2OZLA 2P4EA 2YIMA 4MVWA 3SU8A 3W0LB 5CA1B 1EUQA 2QTBA 1KZ7B 1GQQA 2C0QA 4JEBA 2PUWA 3OEOA 3AP2A 4OI2A 3U48A 3JSXA 3UCXA 4MVUA 2VWPA 5B1HA 3RS9A 3DW3X 4II2A 4LYYA 3H4VA 1RJ9A 1H0RA 3FI0A 3MTGA 2MHCA 2PIAA 3QUCA 4GIBA 4P1ZA 4JT9A 3D4OA 3JASA 4FQ7A 1H2BA 3JVVA 3EBLA 1JEQA 4IJVA 3CKLA 3NWBA 5HILA 1NZFA 5TPZA 3RVSA 1H4SA 2AWYA 3EDRA 4CMGA 4LY6A 3SZOA 3N2KA 1D6NA 4FBLA 3SHTA 4XB1A 4CIXA 3AH8A 4Z5XA 4C3UA 1SVIA 1IDOA 4JC0A 4UU0A 3HDTA 2HMWA 4ZJPA 1B14A 4ND6A 2PSDA 5T67A 4C5BA 4BJ5C 5EXTA 4EL0A 2WT9A 3RF3A 1QYXA 4QXAA 4AVYA 4NYMR 2EEPA 4HAWA 3E15A 4KXYA 2IWRA 2G09A 5AVSA 2FPXA 3PVZA 1UFOA 2ZI9A 2I5PO 3AFOA 4FONA 3LUBA 2PRZA 4H4KC 3NP9A 4JJGA 4KMMA 5DGIA 2VJNA 3ZU2A 4BVHA 2O5EA 2NO6A 3K1ZA 5C7YA 1B42A 2FWIA 2NYAA 1PZHA 4HRYA 1ORYA 4MYSA 1E2EA 5E6SB 1NUPA 3T7KA 1JLHA 3PENA 3GLUA 2ZS9A 3OT4A 4H18A 5DTIA 2FOXA 4JNCA 2C95A 3D3EA 1EWRA 1N6OA 5KNCD 2ACVA 4W5NA 1GVHA 1HH4A 1LPBB 3AFHA 3WK5A 4G7HF 4CS8A 2AK2A 3G3EA 5K3EA 3KAJA 4HDCA 3DVAA 4I50F 3SX4A 3M89A 2C7QA 1YUMA 1BDIA 3RBVA 1V35A 1JAFA 1K2WA 4B1FA 4U00A 2P11A 3KSDO 3WNDA 1Q84A 3GIWA 5F2NA 2XS1A 1FS6A 1I3KA 3CLVA 3ZLJA 3NMKA 4JW1A 4GEKA 3RYIB 1E3LA 3ACCA 1J06A 1WJGA 5IHPA 1ZI9A 5DNUA 2NX2A 1MV5A 3TYXA 1QK4A 3LH5A 4LV8B 4CLXA 4DQXA 3EPLA 2CDCA 3HXMA 1BE8A 1OT5A 4ZHQB 2CLDX 3IT0A 3RSSA 5F3WB 1Q7CA 3X43A 5ITZB 2OYSA 3A6JA 3RQSA 4Y1GA 4DT1A 4BO2A 3ELBA 4NZYA 2W48A 4V38A 1OA1A 5FNVF 3UAGA 5CDTA 3IXMA 3TZHA 1V95A 3IXQA 3N5KA 5LLDA 3EG9A 1D0XA 1HFEL 3UGQA 2NMVA 4J43A 1NTRA 4Q34A 1PF7E 1TX4B 3H0CA 1TUIA 4EW3A 2CJXA 3IL2A 3B1KA 2AJLI 4NCBA 1ZMXA 5C1OA 4DJ5X 1BGXT 3FXHA 5GGYA 3C6KA 3CC8A 1S2GA 1QQ5A 4OA8A 5IZCA 1VYVA 3CZCA 5ICCA 3QQ5A 2ET6A 5FPPA 1EI9A 1Q11A 2RHLA 4F3TA 4PZYA 3BRWD 2YFQA 3WK6A 1BHJA 4Q05A 4ZOQI 2JFPA 5A3SA 5CBPB 4HH0A 1TIKA 3OCZA 2CXUA 4X97A 2C04A 2Y3DA 1XTZA 1ZPDA 2XT6A 2HEIA 5LQDA 4JBLA 4MGHA 5A5GA 4CWAA 3C7DB 5AVKA 1TC1A 4N6HA 2Z30A 4OKSA 2A5JA 3UZUA 4LZOA 2TMVP 2FZVA 2X5OA 3KSMA 1E1NA 1H5UA 1QQ6A 3M2PA 3HPRA 1LV8A 3QK7A 4ACBA 5JQGA 3IQZA 4BVJA 4DMCA 1KC3A 1WMBA 5E2IA 4PS1A 3OQIA 2BH2A 4N0PA 5DYTA 1EK0A 3JZ0A 1HLGA 2EARA 2G9NA 4TWBA 2OGZA 4ZYXA 3IEPA 3I2GA 3RK4A 2I2WA 2QEQA 3UKJA 2J5RA 5AH0A 3HEMA 1S01A 1Q6ZA 3R7WA 5JFTA 3V34A 3N2LA 5ECDA 1E6EA 2ZJ0A 4MUGA 4FOLA 2FUCA 3LYAA 3FNIA 5FL3A 3OD5A 5B7NA 1J49A 3NNDA 3W6NA 5HRCA 4NXNB 2PXCA 2XM4A 1G5IA 5EHGA 3JWHA 5ESXA 3BGOS 9ABPA 1RKUA 1YK0A 2HZBA 1WIWA 2I2BA 1GDHA 3AF2A 5T8KC 1HNWB 1VFNA 2GCOA 4GMXA 1ACMA 1VKRA 1XALA 1ZSYA 4K9OA 4DEYA 3FD8A 1P6QA 3NMUF 4L5BA 3RUAA 2WQ7A 1L7OA 4C3OB 2QM0A 4V3CA 3LUGA 1Q50A 3G59A 3R0IA 1E9VA 1OVMA 2ACKA 1AHNA 4K28A 5B64A 1FP7A 1CULC 4CODB 1IHDA 5H0IA 1SCBA 2HU7A 5TF4A 1DTSA 1VLZA 4RZSA 3V42A 4TZ0A 1D4AA 1JQEA 3F3YA 4QTTB 1RMQA 3HKKA 1E2KA 2IYYA 1J99A 4MGYR 5CCEA 1G5HA 1XRPA 1CUCA 1GG9A 3BJIC 1RT9A 2WZFA 1XNHA 1NKVA 2JH8A 2Q6OA 5JSYA 1QZ3A 2X1LA 4ALNA 2RBKA 3GGCA 1KZGB 2IQ5A 4GLBA 5GM2A 2H8KA 3L93A 3M9XA 3NYIA 2A0FA 3SVLA 4BLUA 3PMRA 4YJ2B 2RHWA 2QZZA 3ZZTA 4ON9A 3ZD6A 4RD2A 5E4FA 1TLLA 3ILYA 5KNBA 4O3MA 3UK1A 4HN2A 4H59A 1GAJA 1VLHA 1X2EA 3QPUA 4H2DA 1V8BA 2E82A 4EJSB 5LP6F 1ADFA 3X1ZA 2OOKA 2ZANA 2XF8A 1A4RA 1EYZA 1J70A 1V54C 3PF8A 4AJJA 4DTCA 1T6UA 4FR5A 4D42A 4FYPA 1QAQA 5D86A 3ESBA 1E3JA 3SBOA 3BAFA 4FFBA 1YACA 1CZNA 3HA7A 3OCVA 1A7JA 4ZVKA 5EZYF 3QM1A 3C3DA 3KX2A 4JBXA 2VAPA 4UUMA 3KZ1E 4KAJA 1Q74A 3HU5A 2Q21A 4E07A 2QTTA 5AW6A 1HDIA 5BN3B 3EZFA 1J2JA 1XTQA 3W1WA 3CSUA 4C76A 2WU4A 1XWFA 1NLFA 5CAEA 2D0IA 3IILA 2J6IA 5CDHA 1XQVA 5KCMA 1N1DA 1F1BA 3B1FA 1NQAO 3G1UA 4RZ3A 1EX6A 3E9ZA 4N76A 4JUBA 4MQ6A 4YFYA 4C43A 1VLVA 4ZOAA 1ZC4A 3L7MA 5E6SA 1C7QA 2HWYA 2J9GA 3VX3A 4MLPA 3HCDA 1R74A 1KR2A 3O1HB 4R6XA 5EG5A 5JDCC 4L6RA 3KUCA 3S70A 1JR4A 4DBLC 4L4YA 4UCXA 3NBZC 4FPXA 1DAOA 3GT3A 1MX9A 1ULZA 1X1TA 2VRWA 2R11A 5G40A 5B2FA 1DJLA 1ZA2A 1U7WA 1EWVA 1FYDA 2PD3A 2R8EA 3KG2A 3MW8A 5LYJB 3AKYA 3GWLA 1DOZA 3GVHA 1W0JA 1YT5A 2OCDA 4AAYA 4DLZA 3HVJA 1SBTA 3B6KA 3JTEA 1P1HA 1A04A 1X7WA 3QY9A 1V45E 5AW9A 3KOXA 1QG0A 5T3YA 2P77A 1K5HA 3SQDA 2VSQA 4TKUA 1PE0A 4F9TA 4RDXA 5LD2C 2UXDB 2P27A 3G9QA 1AVOB 3NHJA 2A1TR 4JVMA 1R66A 3ZNNA 4FGSA 4WCFA 3ZVNA 1P33A 1MOZA 1T36A 2F48A 2R5FA 5CG1A 1RAHA 2J7KA 2J67A 1GR1A 4OHWA 3MQ4A 3TQQA 1WU8A 1P44A 4GOLD 2JARA 1DAEA 1MB9A 5IYZA 4INOA 4I3HA 4YI3A 4JA2A 3SEFA 1CC1S 1PSWA 2FZWA 5FADA 4GF5A 3LBYA 3KYDB 1XAIA 4YJWA 1HTTA 1QMPA 3AG5A 4J1TA 4Z9FA 1QSGA 3KKNA 1Z08A 4RPIA 1YFZA 4U5XA 1AQJA 3QFSA 5B3SC 5A6BD 3E8MA 1YBAA 1QTRA 3HKCA 1A2KC 3PC8A 4YA6A 3RRBA 5LQCA 3UAOA 3A4TA 4BU0A 3LESA 2O9JA 1DDOA 2PMWB 1EX9A 1ZM9A 3LOUA 4LKOA 3WLTA 3B12A 2QD3A 3WA6A 2IU3A 4B4DA 1HE2A 3LX6A 3TAHA 1LU9A 4JVNA 5FF9A 4QPJC 4MRRA 3CWCA 4OEHA 3F47A 4Y2GA 4GDFA 1AUVA 1W49A 2Q6KA 3RAGA 5EI5A 3ZCRA 3DLPX 3INGA 4QX6A 4CG2A 2Z83A 3WLAA 1C1XA 2JEOA 1U81A 1XAGA 3CZAA 4H4CA 3HN6A 1CZLA 2R47A 4NEGA 3D7LA 2IYZA 1KI7A 2VC9A 2QE9A 3M79A 2GYWA 5T8KA 1CQJA 1QQBA 3J06A 1GG5A 1LSOA 4ZI2A 5GM1A 3CCFA 4CMHA 1MNDA 5K8VA 1W5FA 4YO7A 3TXXA 1D2EA 1OIXA 5SY6A 1Y8QA 5IDQA 4YGYA 1Z7WA 1N8TA 1UDAA 3UV7A 1E5LA 1WMAA 1FNNA 5AVUA 1C4XA 2B8JA 1B2RA 3VI3B 3IMCA 1I33A 4N4WA 3VO2A 2C8VA 3RSGA 2X3UA 5FNVB 4B84A 4H9GA 1UIMA 1MENA 2V7EA 4XM0A 1B0UA 4Y2PA 4ZC1A 3V80A 2GF2A 1MO4A 1Z25A 2DBVO 3L1JA 3BQMB 3TW8A 3V8BA 4BQRA 1WOYA 1LJUA 2J9XB 3ID6C 5LP6A 2ZE5A 5JROA 4G0NA 4CEHA 3CX4A 3E53A 5E33A 4Q5SF 1AZLA 2XUOA 4QLAA 5F51A 3AETB 3D64A 4US2R 5A62A 3OFND 2J4FA 1ODIA 2JCBA 3H8SA 2IE0A 3FYUC 5ALQA 1C2YA 5LYJF 3FMGA 1II9A 2G0AA 4YJDA 4JFRA 3ZHUA 1Z2OX 1U7UA 2O06A 1PL7A 4RM3A 1TVMA 2PV7A 1L7CA 2OP0A 1QGUA 1EP3B 1KFCB 4KHZA 2RIPA 2H07A 1L9KA 5KQMA 1NONA 1DAPA 4CIDA 5I45A 4K9KA 5FR1A 3KELA 4NVRA 3HVHA 1XMPA 5CW2A 4XX1A 4UE3S 3GCDA 5IEBA 4JB0A 5KQGA 3ZCXA 1Q0MA 2OU6A 3F4LA 3KAQA 3VV2A 2WZDA 3OO0A 3EFOB 1XVAA 2R8BA 1GZ6A 4HQOA 1ZCJA 4XJVA 2EFDB 3VJLA 3AOUA 1UK9A 4HNAA 5FJIA 3DJUB 5JALA 3PEEA 1WQ4A 1FMWA 4G5OA 2VAMA 4IICA 3VPSA 4CM7A 1YE3A 3OPYB 3WQSB 4TMTA 4IGIA 4YK7A 5CK4A 1HE8B 3I39X 3B78A 3L7YA 3N8NA 3THXA 2R1ZA 1HRDA 2DUJA 1YRHA 4Z7OB 1UM9B 1NF9A 2FRVA 5INTA 2A84A 3SZRA 1B8UA 2H4FA 1QHFA 3PKIA 4M4SA 3TUJC 4F04A 2P6VA 2XX3A 4RESA 5KC8A 4WJKB 1XVLA 1MF7A 2B9EA 1YA4A 1WW3A 3NRCA 3NJ8A 2XOEA 4QUBA 3HJFA 2DE0X 4IMIB 3FZNA 3G8DA 2Y67A 3OLWA 3PDJA 4CMKA 3QHAA 1LJ8A 2VHQA 4Y2HA 1OLOA 1EVLA 4RYLA 2AW5A 2RJOA 1ZC3A 1RBQA 1NVEA 3COYA 3FMFA 3G8CA 2FEMA 4LW8A 2CLHB 2QX7A 4RZ2A 2AKEA 2VJDA 5L3SB 4BMVA 1RBYA 2EBWA 3CVXA 4W1QA 1JJ7A 5JD4A 1ZK1A 2JGFA 4HN9A 5DOZA 1QH1B 1NV9A 1AGRA 1R12A 2QRVA 3FTPA 3PRKE 1DUSA 1QIEA 2AWNA 3A04A 4PFJA 1I4OA 4JQSA 4CMJA 4OHVA 1PDOA 4ZYZA 4GRIA 1TEHA 1S2OA 1P77A 3TX2A 3I52A 2B34A 1PV3A 1L4YA 3W8HA 2C99A 4EWCA 1I6KA 2BGTA 3JARB 4PO3X 2Y3GA 1MQAA 4B47A 4DMLA 2WJ3A 1NBWB 3UPTA 3TSZA 3GUCA 1Z68A 2ZSDA 2ZRPA 3D3KA 1BRMA 2WDZA 1UP7A 3FFAA 3ULKA 1W29A 3WMWA 1MT3A 1WCYA 2POCA 4BCDA 4DC1A 3QU4A 3QGMA 4HDOB 4J1TC 3IUNA 3TOZA 2ORIA 3OUZA 4KLRA 4FTWA 4AX2A 4M9CA 1IAQA 1XRLA 5DYIA 1YGYA 2RHHA 3F9CA 3R7NA 5CEJA 4Y98A 1WWPA 2HUNA 1NIPA 2E89A 1Z23A 1LW6E 2CVOA 1T2AA 2MSWA 3HXKA 4R41A 3QVYA 3O2SB 4JSRA 4I5GA 4D80A 1XZCA 3B9PA 3BMOA 2V6FA 4JL6A 2OILA 3GLQA 2HJVA 3ONEA 4YROA 5HMLA 1NF8A 1UBOS 3II6X 2VUTA 2MSNA 3GGPA 2QXYA 4QU8A 4DS3A 3FOOA 3GNTA 4NBTA 3FNQA 5CLGA 3OPVA 2HMVA 4RJLA 4R71A 3OKFA 3R0QA 4BVEA 1GGJA 1OHHA 4EPWA 4DBLE 5AKLA 3HFJA 5I9NA 1U90A 3KTFA 3AUSA 3IR5A 3FNRA 2P8JA 3GAFA 2M2IA 4MV7A 2HGSA 3ET4A 2ZT6A 4HFMA 5LSAA 3J7AC 3ZU4A 2VJAA 5EY5B 1NC3A 1QPUA 5A4KA 1EZZA 1PQPA 3AI1A 1UFBA 4QU5A 4WNAA 2WHRA 3UUGA 1IU9A 7REQB 7AT1A 1DBQA 4ZAYA 1MFPA 2NTEA 4EPYA 2PFKA 2OXEA 3PX7A 4UUQA 1DOWA 4ZYLA 3RUCA 4DOMA 1B8NA 4NTBA 1KQPA 1N6PA 2KM1A 2XQKA 1PBTA 4MUXA 4CIAA 4HEA1 3BWCA 1C4KA 4MUIA 4E2ZA 1J07A 1WCXA 1RYFA 1F60A 2I2AA 4BJTA 3PJEA 4P7BA 5LOVB 5A06A 3EXEA 3ITDA 1M57C 4AN4A 2X5XA 2G5CA 1PP4A 1GYQA 3EWIA 5EJ7A 5CPFA 2WM3A 2Y4OA 3PIRA 4N5IX 1EDOA 1RCTE 5JE8A 3TQSA 3LXMA 4BEBA 3GO4A 1QCYA 1Y3DE 2P2NA 2K5UA 3BN3A 3RFYA 3SN6A 2BZGA 4E32A 3FWHA 4U7DA 3NO4A 4C30A 1TT7A 2P65A 4DANA 5EUBA 3VXKA 2YVUA 3D2BA 1CEYA 4RH3A 4FOPA 2GILA 4MW7A 2OXCA 4YMLA 1YH3A 3RJMA 2Q07A 3L05A 1G5ZA 3MWYW 2FSHA 4I6JA 2NQTA 5K0NA 2QR3A 2VJPA 4CETA 3NM6B 1I7DA 1HEIA 2VRNA 2WZLA 4LRTB 3LQQA 3N39C 3D6JA 3AVTA 4WESA 1TW3A 2QLMA 4FS8A 5FDFA 4PS0A 2ZRQA 4MVJE 5G1NA 1Q0UA 2WK1A 5GV8A 2FHPA 1AURA 4JEHA 1P7VA 4D41A 2FA9A 1KSHA 2WPNA 1GGQA 2CDAA 2PBFA 3HKEA 4AECA 3ZHVA 4QULA 5F7XA 2MOKA 2OO5C 3HLZA 1J42A 2HJRA 2DYRC 3RG8A 3SVZA 4IGGA 2WE7A 1RLOA 2V59A 1V8ZA 2HRRA 4UBLA 5KZMB 4CIPA 2IYXA 2IXMA 5THQA 2YYZA 1DEKA 3TRIA 3VBCA 4P6VF 3FMPB 5DIZA 5TS3A 4D6XA 3EGCA 2VLBA 1YE8A 1ZQ9A 2JGAA 5K05A 2V6IA 3JPYA 2Q2OA 1EAYA 1N75A 2REXB 4FFOA 1B1AA 4FFWA 3WGZA 2R2AA 3O8LA 2VTVA 3RYLA 4F3KA 4GDMA 4MI6A 5F1KA 4ENPA 3CIFA 3DZCA 4MQFA 421PA 5HM6A 1NAHA 4O6VA 4NJMA 4NHOA 4E94A 4OHCA 2ATIA 4P5EA 3EDQA 1EHCA 3BD7A 1MR3F 3RKSA 3KQSA 1OW8A 2EIXA 1UJ6A 3WAQA 1SM4A 4JT8A 4LE1A 4WZZA 1YAHA 5F1OA 3HVUA 1QCCA 1S2NA 2IK8A 1XAHA 3DL7A 2GN0A 4KE8A 1QFSA 5SZKB 5D85A 3A3OA 2AFHB 2CNOA 2ZAGA 1M54A 2B36A 4LYHA 3WLEA 3S81A 3UMKA 4K8OA 3SR4A 1M1NA 2BFAA 3DWGA 3D7RA 4MMXB 1T2UA 2NUAA 1IY9A 1KO5A 3SNKA 3UT5A 4TLMB 1AOXA 1Q3KA 3BB1A 5BWOA 2XL8A 3T34A 1U0NA 4LY3A 1GN9A 5JZMA 2IYOA 3CVVA 4CMIA 1XXHE 4U7GA 4K26A 4LZJA 3WB1A 1IQUA 4QDOA 3OOJA 1Y7LA 3WLOA 4LHSA 4DLLA 5GJBA 2QRKA 2ZYSA 1X70A 5AHRA 3EJWA 3QX9A 4OK6A 1ZL2A 2MSCB 2BCGY 1N3BA 2IV3A 2BM1A 3T6JA 2LSEA 3DD7A 2FR8C 2GM5A 1Z6PA 2ZUVA 4NU5A 4XLLA 5P8WA 4BNDA 1U2GC 2DBQA 4BDTA 3BEOA 4PV7A 1BX1A 4B33A 1O8BA 1NXXA 4G8BA 3KYJB 1NV8A 4QU9A 3KHSA 4IOJA 1L5MA 5A05A 3GMTA 1W2WB 2E7ZA 2IIQA 4W5HA 4K2HA 2F43A 3ASOC 4M7OA 4QQKA 1GYRA 3QTBA 1OHHD 1P2VA 5BSMA 1WETA 2JLSA 5D6NA 2X7JA 1H6AA 2C4MA 3SIRA 5J40A 1RHRA 4LYDA 3ZDEA 1YBFA 4YAUA 4QHSA 3N05A 4B4KA 4MQEB 1A7DA 2MMGA 3FCAA 3TPCA 2GZ3A 3FPHA 5JQGF 3CLSC 4EQ6B 5F77A 1F2DA 4D3XA 1LS4A 4U5CE 1UFKA 1KDRA 1Y63A 3DUFA 4GRDA 4L0DA 1KQNA 1H4TA 4ZXFA 2X9VA 1CZKA 1DKPA 1TTPB 4PWZA 3H4IA 2O1WA 1JHPA 1LBEA 1JXOA 1N7GA 1OIWA 1G8SA 4JVSA 3GFTA 3GROA 5CM8B 3W3AD 2Q5QA 2O8EA 1CT9A 3P26A 4G0OA 1CDEA 3ZC3A 3Q2IA 1CV2A 3CYFA 4LERA 4AE4A 4J6FA 1NQWA 1GOTA 3GRKA 1NHGA 3MAJA 3SQNA 2BUCA 3VSBA 1FAPB 2CNBA 4F3YA 4IH9A 4C7KA 1FDWA 1OBFO 1TM5E 2HQOA 4M1ZA 4XSVA 3O4HA 4EB6A 1ONSA 4HRXA 1M8GA 1SXJE 4ZOLA 3NJRA 3OF5A 1F2UA 3PXUA 3QIVA 4EJ6A 3CH7A 1F5NA 2NU9B 3AGQA 3HZHA 3M1IA 2W2TA 2KSFA 2FX2A 3L7JA 3K1IA 1SHLA 3IMGA 2X8JB 4FINA 3WL6A 5JCJA 3GJ7A 1LCIA 3NTVA 2EWWA 4MGKR 3W1EA 4BWGA 2Y68A 4KRGA 1TA9A 2FLKA 3FOPA 4XIYA 4ZQEA 5FXMA 1ZI6A 3U0CA 3AR4A 4K7BA 4JCCA 1GUBA 1UL1X 2XLDA 1JJBA 4RENA 3GJTA 2QQ0A 3U4GA 5KUTA 4MTFA 4DYHA 4ESVA 4C89A 1DO8A 3DLCA 4KPYA 1NOIA 1O58A 4GBMA 3LCVB 4WCDA 3UG6A 3FKJA 5B6JA 2OK7A 1KNXA 1JTVA 2R7LA 3FKSD 3WIEA 3JU3A 2P3OA 2FWJA 3W5AA 5A5VA 4KMSA 4F9EA 2R1VB 2BFMA 4XA8A 2VQSA 4KB5A 5JVDB 2GXAA 3JD0A 2JA1A 4MV1A 4DARA 2ID8A 3T35A 4DMUB 1Q7BA 2BRUA 4HKTA 4HFKB 1NM5C 1HETA 3EC7A 4F11A 5IFKA 3AI3A 4GPAA 3NANA 2II6A 3RUEA 3X1KA 4E7ZA 4M89A 4CCYB 4P80A 1FTQA 1NKSA 4URVR 4TKVA 3KAPA 5BSWA 4RVUA 4QM7A 2XHEA 3D8TA 4NMXB 4QJIA 2PMEA 3WNZA 2AF3C 3RLFA 3UGJA 1FNCA 3ZJTA 3O31A 4LJ4A 3MMPA 4W6ZA 5DWDA 1FYFA 1FNDA 5BYBA 4UTNA 3W05A 5ISMA 1CLEA 4YL1A 2OAGA 4ZKEA 3FAJA 2R87A 2RHJA 1DWOA 3PUYA 4IXWA 4E5DA 3QXSA 2JIZA 4BBAA 1GPLA 1I7PA 1H2YA 2RGNA 4L7VA 4D96A 3NC0C 2ID7A 4UASA 3UF0A 3MPOA 3RBAA 5J2UB 3DB2A 1U3GA 5EQJB 4HDRA 3RS3A 3A11A 3GQBB 3RTGA 2BC5A 1CDZA 1QPGA 3PD0A 4BS9A 5I48A 9MHTA 2BFEA 2VHZA 1DAKA 1OLSA 4NQRA 4EYOA 3RQEA 1XCBA 1GA1A 5CVDA 2DPGA 2R6HA 3VPAA 3T3OA 1Y4DE 2H1SA 4MAMA 1IEXA 1PEKE 2W45A 1R88A 4CKEA 3A3YA 5AT1A 4GE3A 5H16A 2X0CA 2GLTA 2QL7A 3LWBA 3FHLA 4O4LB 4R2IA 5D5QA 2FGYA 3MGKA 1I6MA 3SCZA 1YCDA 4DLRA 4IV5A 1EP9A 1OR3A 1KXJA 3QVUA 3PD1A 4JLOA 2YX1A 4Q82A 3DVRX 4G6ZA 1PFWA 1S3GA 4J0CA 1KP9A 1VJ1A 3PCTA 4IGFA 5J9FA 1UC4B 2ILTA 2MJLA 3VSAA 2YN2A 4HT3B 5DQTA 3D4LA 4YAKA 3CLHA 4WT7A 5C0OE 4CCYA 1Y5MA 1GDTA 1OFTA 1VGRA 3OE7A 4G67A 1TO2E 3KM0A 4G0WA 3GT4A 4ZCSA 1E4OA 4XIJA 5IMSA 1E0SA 3AM3A 3A2MA 3VTZA 5ESDA 2ZZKA 2C94A 2C2HA 2QQGA 2CJPA 2IXAA 1RM0A 4PO8A 2VOJA 2OM2A 4AO6A 1QZTA 5I7WA 4M0MA 3U7GA 1F8YA 2NV0A 3RIEA 4IQ8A 1Z0FA 2QMUA 3IKJA 5E8RA 3JQCA 3HYLA 2RONA 2JLAA 1J0DA 2ZP1A 4GL4A 4JB3A 5CRIA 2E1PA 3CZQA 4GM0A 5EP1A 3SPXA 4HN4B 1QC5A 4DUGD 1M2OB 3VU9B 2EU8A 4KH0A 4MPJA 2PUEA 5D3KA 3Q3EA 2VNIA 1NW4A 1T9HA 1DAFA 1JVBA 1R5JA 2D2EA 2CC2A 5JASA 4CV0A 4E88A 1FE8A 2OD7A 4G1UC 1VL0A 2OV6A 4PZAA 1TEZA 1QU2A 1MAWA 2QG6A 3SBXA 3SICE 1GCOA 1PL8A 2G7MC 4J7AA 3UOGA 4UM7A 3AK4A 2FEOA 1COWA 5FLXA 4M6WB 3QG5A 3GP3A 4GNKA 2Z08A 2D4UA 1W5AA 2IY7A 1NR7A 2PUHA 4EB6B 1HYEA 4ITRC 4X6XA 4L4XA 2O7SA 1YJQA 2A57A 1LSJA 1GTRA 1RXQA 1NE2A 2PX5A 3FIJA 3MK31 2X19A 4FOTA 4GZ6A 3PLAE 2QN7A 4YCBA 3WK8A 2XKBA 4ZFNA 1RJWA 2CW0F 2OCYC 5FBKA 3RS4A 4U02A 3RTAA 2LV8A 4HVLA 2Q6TA 1OGYA 4P2BA 4Q93A 1L7XA 3T9OA 1VHDA 1NX6A 3FLAA 3AI7A 5CIVA 3CZ4A 4WLVA 4PC7A 1NSTA 2JX0A 1QDLB 1QAMA 3CPSA 3CH6A 3B1JA 3QVTA 4OJYA 3R4CA 1XV5A 1SKYE 4XWTA 3AJAA 4ZDWA 5AYVA 3ROGA 3TL3A 1SKBA 4UVGA 2NQ2C 2PVCA 5KNDD 2BCEA 5KHAA 2QRHA 4ZI7F 1CB0A 3RH0A 4XEKA 1LTQA 3G0OA 5IC6A 4IIXA 2EZUA 3AV3A 3LDGA 4BMNA 1HNXB 2W0MA 1G20E 3P0HA 4B3IA 4PSCA 1E2JA 2BONA 3VZDA 3G2NA 4D0SA 1RWBA 4H7EA 3DBRB 1K06A 1GNVA 2PLAA 3CRZA 4MUBA 3OC0A 3KETA 3UFXB 3T4RA 2YKGA 1VYKA 2R03A 1WV1A 4WLFA 2W4IA 4MRMA 3LLSA 4F2DA 2EFHB 2VWGA 2C3UA 3OM1A 4BQSA 2ES4A 3IEEA 3L7AA 5ESWA 4EUKB 4UMEA 3I73A 2PZMA 2GZRA 4Y9SA 5BP7A 2FPLA 2FKNA 2Y77A 4NPCA 3AG2C 2R5WA 1TEVA 3I9V6 2B2NA 4OJMX 3PQ8A 2HA5A 1JIUA 1UFRA 3K0AB 4J3FA 4P33A 3DMFA 4OLHA 1B1CA 1POXA 1C3VA 4NSNA 3ZQJA 3H1TA 2P6MA 1I30A 1MV8A 2RGBA 4ARBA 2P0YA 2QZSA 3ZHRA 3CVYA 2BTEA 1OROA 1ZK3A 2IBFA 3CUSA 3E48A 4X3OA 1T9ZA 2SHKA 5IVDA 3WG9A 3WICA 4B17A 5L4NA 2FWAA 4Z4QA 2J45A 1GKIA 5LP6B 3IESA 1ORVA 1YDEA 4FMCF 1JQAA 3RLIA 4LC0A 4MJ7A 3WBJA 5D5HA 1NW6A 2BGWA 1WZ2A 3IUJA 2AR9A 3GN1A 4GKKB 1VJGA 4P0QB 2AMJA 1DO0A 4D43A 2WUFA 4X0RA 2CYDA 3TJRA 5DP1A 2IUFA 4KYUA 4BX0A 1F20A 4UHDA 4FGZA 3K2IA 1DINA 1V4BA 1DT3A 3NCHA 3VKHA 4QGGA 4F85A 2H9IA 2AKYA 1YYJA 5ERGB 4CW7A 2QVXX 1U6HA 3IODA 2PD6A 3PPIA 3QOXA 2OCIA 2GZDA 1OFVA 3DVLA 3IQWA 2F67A 2K4MA 4YT5A 2C5FA 4MQFB 3IR6A 1W44A 1RYYA 2IPNA 2J3HA 3BD8A 3O0DA 2IVZA 2ECQA 2G5TA 3IHWA 3LPCA 3PFBA 1ID1A 1TWHA 1LWNA 1G8AA 1SJ9A 4KXFB 2GPNA 4M1QA 2XUJA 1AA9A 1R15A 1UBHS 2Q29A 4F5YA 4BU1A 5BW8A 4CKZA 1Z7YA 2X0JA 4HGOA 1HKUA 4W82A 2G80A 1HRKA 1VG1A 4IIEA 1PK7A 2CLKB 3L79A 1E62A 4LS3A 5AW2A 1ZWKA 2JKZA 4WKOA 4MV6A 5ALOA 4BV2A 1EQ2A 1FPMA 4YJ2A 3S55A 2XSEA 1CRZA 3TLGA 1I24A 3IEUA 4BFLA 3IE2A 1F4PA 1OC4A 3FRIA 4MYCA 3OOSA 4TTVA 5KOHB 5KTSA 1N3LA 2FZGA 3I61A 2UXCB 1FDVA 4ZV9A 3RB8A 1JPVA 1S5PA 1KJYA 1QHSA 3HO6A 1PR0A 2Z5GA 3GNLA 4PEVA 5LDGA 1KDZA 3H8VA 4L2IB 3CPJB 4DVZA 2NNWB 4F12A 4HNUA 4JT4A 1MDFA 2KPOA 4X60A 3SEZA 1Y1TA 3UANA 4WESB 3QMWA 4EFNA 3QXHA 1WB4A 1C30B 3MOSA 2V4MA 5FBVB 1G21B 1SFRA 1VP9A 2CHGA 4LTNA 3WGQA 2PR2A 2D1FA 1LGYA 3BFXA 2Q3FA 2XUQA 4L9WA 4IF6A 1WUKS 4II3A 3T9EA 1A50B 1C3OB 2YLIA 3F3SA 1AQNA 4ZQBA 4DV3B 4WN9A 5JVDF 2IC5A 1Y8CA 4TS4A 3WSWA 4OCZA 4G26A 1YMUA 1IHYA 2Z9CA 5I7EA 4S05A 1QBKC 2FEKA 1QKRA 3FNEA 3VYSB 2HF9A 3DEHA 1XAJA 1FXWF 1TWCA 1MRSA 4JC8A 4R2KA 5EZ6B 1NF2A 4U7WA 4QIHA 2AJDA 2Q4OA 1E2XA 2WFZA 2Y0CA 4BLOA 1YZTA 1DXQA 3IFSA 4RY8A 4BZXA 4L6AA 3AI2A 5TC4A 3JAWA 2GSDA 3CNLA 1KY5A 4ZA2A 4EX6A 1NP7A 1QORA 4E4RA 3I01M 3ICOA 1T9GS 5BSUA 1RXSA 4R83A 2Z2IA 3MYRA 4I1PA 4XVHA 1HT1E 3HXLA 4JP3A 3E7XA 1N5DA 3A9VA 2Q9AA 3LHDA 3LL4A 5HJEA 1Z4KA 1ZZGA 4G1VA 3ATPA 3QXXA 3G6KA 5BSEA 3ZE9A 4CEJB 3AZOA 3NB0A 5ALFA 4A2PA 5CDUA 2GN4A 2QRPA 3A14A 3KALA 5CXXA 1RZUA 1VDMA 4OYLA 1XHFA 3QW1A 5C8YA 2EPMX 3P97A 1SZDA 2I78A 2RMKA 3E22A 1JKJA 4OBBA 4P8RA 2F3QA 4U5HA 3DZDA 3VH1A 3WQHA 4E5NA 4ZI3A 4ZI7B 2RGRA 3LF1A 1E18A 2G25A 5EMNA 2W4MA 2C4KA 4Q4JA 1PK8A 3TTXA 1KIMA 2LD4A 5IF9A 2QTRA 1Y5LA 4AC9A 1WLSA 2FGJA 1YL6A 3NFRA 5ALSA 5GIPE 3CX6A 1GU7A 1EM8B 1QIHA 2XOXA 2BJVA 4L4UA 1E1CA 3VDMA 3TAXA 4MKZA 2AJCA 3FPAA 3W34A 4NAHA 1JAXA 2CL6X 4Q12A 2KMLA 2FNAA 4N18A 3EWAA 4L07A 2J9FB 2Q8NA 4CMCA 5L7WA 3EH1A 1KS9A 3GLHE 4WXRA 5FTKA 4BTEA 1MN6A 3BIWA 1KKLA 3KQOA 2P5YA 4O4JF 4YPOA 2QUHA 2X9LA 4IEEA 3UC5A 2AYXA 3OMLA 3PR3A 1O3YA 1WUHS 4IINA 1M2GA 3T1HB 1X7DA 2ODWA 3FR8A 4LDQA 5EVCA 1ANKA 1UPAA 1VCHA 4CUZA 1CYDA 3E84A 1C9MA 4JR2A 4POOA 4BV3A 2BEWB 3BL5A 1LPNA 3I5YA 3D8HA 4PG7A 5ILGA 2WFLB 4I14A 2RDMA 1YU9A 1T9KA 1ZG3A 3LXXA 2XUHA 4Y9TA 1RHJA 3U5SA 4H6PA 2C2BA 3D8BA 4DFDA 4ECAA 3KTDA 1MIOB 4I5EA 4IIYA 4MVCA 3T6KA 4AXXA 2KYHA 1GPMA 1XCPA 1JYSA 3N8IA 4HLQB 1HORA 3K4HA 3BIJA 3UEOA 4OMUA 3GANA 4RY9A 2PY6A 3IEXA 4BGEA 4MKFA 4EG7A 3TQFA 2J0UB 4EBBA 1IBSA 4H7KA 4QBGB 4CCWA 2V7BA 1NXVA 2HF7A 4CI9A 1F14A 1MKYA 3E9DA 3ZWVA 2CZCA 3HPQA 3B6MA 3HRHA 4XYLA 3I42A 5DSZA 5AM0A 1X1DA 3ZQVA 4ULVA 3V1UA 4KC9A 3E3LA 3MVEA 3DF7A 4MINA 3VF0A 1Q7GA 3DYIA 3FM9A 1DKRA 2W2PA 3MILA 5K51A 3K20A 2H18A 3N3BC 2UZIR 3DKVA 3BJMA 4XEFA 4CS7A 3EQ8A 4RJKA 3O9VA 2O8CB 1IEVA 1OMOA 1CR6A 3ZY4A 4F5ZA 3GGSA 3W1VA 1FJ2A 4GYWA 3TQTA 1WKVA 4G1BA 5ALLA 1D7AA 3GLTA 3K66A 3G5MA 2GB4A 5D3ZA 4CIYA 1A5SB 1YZYA 1T1IA 1D0IA 1M66A 2ATXA 1MMDA 4MDFA 3L3BA 2FPIB 3WZLA 5IZCC 3Q0TA 4J0HA 4CRWB 2DVMA 3X1WA 2QP9X 4HY3A 3U3ZA 2H3EA 3B6JA 3G0DA 1QGOA 3KNZA 3QVKA 3UGKA 3EMVA 3EY4A 3E7DA 3OEYA 3PPYA 1UT8A 5DMHA 4ZARA 4XLNF 3V7NA 4V0QA 4LWPA 4RA9B 1Y8AA 4I5IA 1JR3E 4Q9LA 2C8KA 4JYBA 1WXFA 2ADOA 1X74A 2IEYA 2NIPA 3AHEA 1VHWA 3UPDA 4F91B 1K92A 3R3ZA 4Q24A 3FGNA 3OHMA 4UREA 2C1EA 3DDNA 5JVEA 1P1IA 4FOOA 3QMPA 4LQLA 4WWHA 4C29A 1OQAA 3JRXA 4YREA 4CEHB 1Z6QA 4K6CA 1CY0A 3IVMA 3QBTA 5EOVA 5IAKA 5CFOA 3H9GA 2ZEJA 3C85A 1GTJ1 4IDFA 3TR5A 2E87A 3DZKA 4D7AA 1INLA 1CUVA 1JHZA 2KBFA 5A5EA 1G5PA 1U2EA 2EL7A 4NONA 3L7NA 2I67A 5KNBD 4EIYA 1GT91 1E60A 5JT1A 4IS2A 3VMFA 2EW2A 2HRZA 1E0DA 1U3FA 4D8XA 2XNCA 3EPJA 4M1YA 4FIDA 4ENWA 5ALPA 1A98A 2P9HA 1DQNA 4G25A 3NHRA 3QFCA 4G5GA 4BMYA 1HLDA 1IZ8A 5K0IA 1H9AA 1QBGA 2V45A 1OAOA 1JECA 3LXRA 2HPAA 4GWGA 6NULA 2I9KA 2OEXA 1ZYRF 4KE6A 3PLNA 3JVDA 5CFPA 1R00A 2FB9A 2FYTA 3AIOA 4LGVA 1OREA 3R76A 5K8IA 3LBNA 1N5RA 4RVCA 2PUBA 3EIWA 1PGJA 2FN3A 1Q77A 3I1IA 3RSOA 4ZHQA 4H4DA 3VOSA 3EZXA 4RKEA 3QE0A 4YJHB 2CNLA 1XTTA 2WKQA 3CMMA 3GRUA 1AN9A 3Q12A 5K3OA 4LZZA 2EIKC 2JLRA 3MBGA 1ZHFA 3SQMA 1NJGA 1R8YA 3KQHA 1NRWA 1YZNA 1ZM7A 1U7OA 4TRJA 1T4CB 1FEZA 1UJ4A 4TWIA 1PL6A 4WKGA 1IBLB 1GLNA 5C34B 4E15A 1U6KA 4NK4A 3BWDD 4OMDA 1ML3A 5TX7A 5JUAA 5IT5A 3P71T 3X0DA 2CKDA 1JYEA 2TSYB 3KYIB 1SGWA 2YXPX 1TQ8A 3AEZA 2X0DA 4Q9AA 8ABPA 1CUWA 4V39A 4CHTA 3BICA 3K1AB 2XLOA 2CCGA 4EHJA 3T9BA 1RWVA 1L5ZA 4CLDA 1V5EA 2GCEA 2RHDA 4K0KB 2VG8A 1NATA 5KNDA 2AEEA 1MH1A 3AG3C 1Q1NA 1ZM3A 1KARA 5FUBA 1SMKA 3CLTC 3GJ4A 4GSLA 3B2EA 4KQEA 4UD6A 3TVYA 4WBNB 3FHOA 2J0QA 4GU5A 1DC4A 2W6OA 3N3AC 4LNAA 1NNEA 2ZKLA 5CG2A 4RPLA 2A92A 2E9SA 1AC5A 721PA 1M67A 3N07A 4S0ZA 5KQLA 2G4LA 3GUHA 3A4LA 4C1NA 2XBMA 1R8XA 4RS3A 4R8LA 2W93A 4DM7A 5CXQA 4P7FA 1W46A 4IDDA 4HRAA 4IKEA 1T15A 1YRQA 2WU1A 4FE4A 4I6GA 3LVRE 3CGWA 4KCGA 1AQ6A 2OVBA 3GPDG 4GQHA 5FI5A 3VR3A 1BEZA 1MQ9A 4D8TA 1MNAA 4DXHA 4HQFA 5KSZA 1EHYA 2HCRA 5JSLA 3L0OA 4KK3A 2MDTA 4N5NA 4YUZA 4S04A 2IHUA 4P36A 4F93B 3CAXA 1OWLA 1RYZA 4HUJA 2GQ0A 4YMVA 1G66A 1RTTA 6CHYA 3HKDB 1QMGA 4MUHA 3SLKA 2B8WA 3UH0A 3ZXXA 3D7NA 3AL2A 4JLMA 1JT2A 1CDDA 2O2EA 3AUAA 3T4XA 2G3YA