4BJ6A

Crystal structure rif2 in complex with the c-terminal domain of rap1 (rap1-rct)
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
329
structure length
293
Chain Sequence
SPVKERVDHVFYQKFKSMALQELGTNYLSISYVPSLSKFLSKNLRSMKNCIVFFDKVEHIHQYAGIDRAVSETLSLVDINVVIIEMNDYLMKSDLMMMVMRKINNDESIDHIVYFKFEQLDKLSTSTIIEPSKLTEFINVLSVLEKSNNIAFKVLIYSNNVSISSLLSTSLKKKLNTKYTVFEMPILTCAQEQEYLKKMIKFTFDSGSKLLQSYNSLVTCQLNNKESNLAIFFEFLKVFPHPFTYLFNAYTEIIVQSRTFDELLDKIRNRLTIKNYPHSAYNFKKNQRLPLKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RAP1-INTERACTING FACTOR 2
publication title Rif1 and Rif2 Shape Telomere Funcation and Architecture Through Multivalent RAP1 Interactions
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 106
structure length 293
sequence length 329
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-04-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1650 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4bj6A01
3.40.50.12060 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4bj6A02
4BJ6A 4BJ5A 4BJ1A
chains in the Genus database with same CATH superfamily
1ID1A 1HURA 1JPJA 2ZRCA 2EP8A 3TL3A 3IV7A 2PUEA 2BF4A 3EZIA 1KAEA 1ZA1A 3IUPA 1BX3A 1COWA 5CNJA 4XM1A 1WV0A 4KPFC 5DM70 3WZMA 2NZJA 4PLPA 3PMRA 2GAOA 3TAXA 4C0LA 3EVGA 2WWHA 2GZRA 6REQB 3S8EA 1KC3A 3W0LB 5JSHA 3TTWA 3FTCA 4PO9A 4NLLA 2I9PA 5A69A 4NMLA 2HF9A 2C54A 1EGQA 4KFTA 1QFMA 2IWRA 3CY6A 4ENVA 3MWYW 3HMQA 4JWKA 4TT8A 2WWGA 1X7WA 2F17A 1AU9A 3TBHA 4NQRA 4Y3UA 3NHLA 1V37A 1SK8A 1Z29A 2JIDA 2YNMD 4TQAA 5I3CA 2J5BA 4O3FA 3LHKA 4HSEA 5JO0A 4QYWA 3GLHA 3GFFA 5K03A 2PKEA 2UZ1A 2WR8A 1B1AA 2G7ZA 1Z47A 4HLUA 4BFZA 1PJCA 2GN8A 2QUJA 2YWFA 1SB9A 3PTLA 4OBBA 5A6SB 1NUSA 5GVSA 3L1KA 4MV5A 1N2IA 1WSAA 1K5GA 2D0IA 3GLIB 3KPUA 5AM4A 4IRXA 1VKHA 1ZWKA 4E2XA 3AONB 2AC2A 4BV9A 3L6DA 3IMGA 5IBPA 2FTKE 3PDIB 1XWIA 2HRCA 1H5QA 3FLAA 1AO3A 4J16A 3JVIA 5FEUA 1PR6A 3D64A 3A27A 4E4RA 3WWDA 2HHCA 4PO8A 1EHCA 4GBJA 4AFNA 3JQAA 3ZIAD 4YH1A 2VQSA 5EIXA 2FR1A 3OFJA 1TZMA 2D5LA 3A1EA 5K3OA 4N03A 2DHCA 4HGQA 4YT5A 4EF5A 4TZTA 4M21A 2XL8A 1JJIA 1JHPA 4JBIA 1KIMA 1EWTA 4L27A 3AO0B 3OF5A 2VFAA 1JIKA 4MVQA 3H9JA 3LBYA 4J7UA 5A4AA 1P7WA 2OCAA 3W3ZB 2A9JA 2QPOA 1FRZA 4RD2A 2DFKB 2HJ3A 4ND4A 4A91A 4H7JA 3WWYA 3QLTA 3GUCA 4JENA 3TEJA 4GL2A 3T12A 2PGDA 4LF8B 1V71A 3T3HA 4TKUA 4ILKA 1EK0A 5JXHA 2WB2A 2F3PA 4ZODA 2C03A 4G26A 5E4TA 3IP3A 1ADBA 2XNHA 5ADHA 4PZ9A 2I5PO 1ZSYA 3I52A 4PM4A 4IV5A 4A5SA 3AEZA 3CCFA 4B81A 3MILA 1H94A 4BGUA 4B40A 5KINB 4HWOA 2GWHA 4CSAC 3OP4A 5H68A 1DIBA 2VJMB 1HNNA 1TVKA 1IWPB 2QSYA 2XNKA 3YASA 4GFDA 1UQUA 2XCIA 3R8CA 2RI6A 2A8YA 4C89A 5KHOC 3ZDBA 1GTMA 5A3QA 4KWCA 1G6Q1 1U0FA 2IELA 3DMDA 2OCDA 4LKOA 4GI3A 4EO4A 3DZHA 3M1AA 3ZCQA 1TVEA 3GY0A 4CM1A 4KXXA 3DVQX 2BTQB 3GMDA 5EWJA 4QVGA 3PEFA 3A4MA 1FMWA 2UUHA 5KYXB 5FHRA 3PG5A 1N2CE 1ORRA 1NVXQ 3H5VA 1WUHS 1KJIA 1JBQA 2VPTA 3BWEA 2ZJ7A 1YVUA 2R8PA 1P2TA 4EHAA 4BBAA 1CZLA 3QELB 5ES4B 1IJKA 4QU8A 3E1SA 3CINA 1YAJA 4FSHA 1SJ9A 2X58A 3EWSA 1WEKA 4R1PA 3ZQVA 3AEQA 1H0RA 1PJ8A 2NXWA 2XLHA 3RSLA 4GXNA 4JI7B 4MW8A 1WD7A 2OK7A 3ONFA 3I9NA 3UAWA 2DYSC 3I34X 1U7UA 4HWTA 3BDIA 4HDOB 2ZS9A 1ZJWA 5T5QA 3NAQA 1I2ZA 1Z9BA 3JSXA 4OM7A 3O3MB 1NW9B 1S9HA 5FD8A 4RCZA 4A6DA 3IEMA 1P6UA 1N75A 4NE7A 1Q0DA 3ZWNA 3T5GA 4CLOA 1V45E 4ZVVA 1Z82A 2I7XA 2B98A 4BY9E 1T0HB 2Y99A 4XB1A 2A1UB 4B3HA 3GGDA 2Z9CA 2WTBA 4RJLA 3PIRA 3WRWA 3I1YA 3ACCA 3QENA 3K0HA 4F71A 4B75A 3ABQB 4URUR 4IILA 4F7DA 1H1LB 3K16A 4QUAA 5D7NA 4M6WB 3WWEA 1AGXA 2A7QA 3ZC4A 3TPFA 1YDHA 3A6GA 4I5GA 4F4BA 4YL3A 1YZGA 4IH9A 2ZYRA 2IE0A 1U0LA 3PHCA 1KBQA 3ZWXA 4D8TA 1I51A 1WXIA 4RZUA 4M37A 3PL1A 5IC5A 4HWKA 1A5AB 5AKXA 3M3HA 3ZQYA 4RTJA 2QM0A 1DBPA 1S8AA 1SCKA 2VF2A 3H1EA 4Q9AA 2QLAA 4E17A 2NUPB 3NEAA 4N0DA 2VL7A 2HJRA 2JH9A 4YS6A 5JYDA 2HJGA 1JKJA 4CEIB 4XIJA 3G79A 1U9JA 2IHTA 4OEHA 1CX9B 5HUJA 4MRMB 5FO1A 1RJWA 5IU6A 1NP3A 1ISSA 5U4QA 3C87A 2HBZA 3ILHA 1DUSA 5HXAA 4X65B 4IOMA 3H0CA 3IQCA 5LP6C 2AUMA 3R6LA 1QIEA 3PIIA 3B78A 4RORA 2O5VA 4R1UA 4AMZA 5DNCA 3UOGA 4CF6A 4Q4DA 3TR6A 4TWIA 3SNKA 1K6XA 4TWZA 2FPUA 1TEZA 3QHQA 1GU7A 2Q5HA 4YFVA 3DDCA 5B1EA 1GQQA 2I80A 4IGEA 5JISA 5DI3B 1TCUA 3C8GD 2A5JA 3JZFA 1UH5A 5EL0A 1YIOA 5F3WB 4E70A 2HLDA 2JLVA 1LSSA 3C3YA 1PWEA 2WUWE 5ER9A 2VNJA 1OXSC 1EQ1A 1LPMA 3ZZMA 4NOKA 3JAKA 1FFGA 3DTYA 1XLVA 3ZS9A 2XB6A 1QC5B 4DL9A 4X44A 3TLCA 4BQQA 4ZI7B 1R9NA 3PFIA 2JB9A 1GAEO 2F90A 1IQPA 3ZD6A 3F3YA 4RKFA 2R3SA 4J1QA 2H1SA 1CZOA 2P9EA 3C3BA 1CS0B 4FX5A 4DE5A 2ZJ8A 3C43A 4GNKA 1AX9A 3QPCA 2FPRA 1V8OA 2Q0QA 4LLCA 4BNTA 3VQTA 1JH8A 2QN6A 4BMNA 3DNPA 2B92A 2OORC 1PR9A 3VO8A 1CWUA 4JJ8A 3AEXA 4X1IA 1JHVA 3ND8A 2ZUSA 3LYLA 4DZRA 1E94E 1I33A 4G5YA 4GYJA 3DWEX 2JJ1D 4UJ5A 4Q16A 3IQTA 3EJWA 1LU9A 1Y6DA 4LVCA 256BA 2ONKA 4HX2A 3PDHA 1EESA 4CDAA 3LSTA 5A5GA 2JBHA 3NEJA 3ZD8A 3NBZC 2J5KA 5C5IA 1YQUA 4ZHQA 3HP7A 3OEHA 4N3GA 3U56A 2X2PA 2FUG1 4R6WA 4OV6B 4C7OA 3ECAA 4O08A 1FLAA 4URFA 3G8YA 4XD7A 3KRTA 4J1NA 4NTZA 1VJGA 4DRZA 3WQRA 3B5IA 1LFAA 1THMA 2G6BA 2GXSA 1RLUA 1KI1A 4ZANA 3TW4A 3U5SA 3CVJA 5EA2A 1RQLA 3OFKA 4OK3A 1YQQA 3QVZA 2NXNA 4UHCA 3LIIA 2OV2A 2YY5A 1YJQA 2D5RB 3HPQA 3TQIA 4RDCA 1N77A 3HBNA 2WHYA 2WT9A 4PRZA 3NKEA 3WOVA 3DNFA 4D4GA 2P6OA 2CKDA 1IPHA 4PU0A 4QPNA 2NV6A 5HF6A 2NSYA 4KQ2A 4RZSA 1VCHA 4LSWA 1I6MA 2I4IA 3D3WA 2LWIA 2HO5A 4DXWA 4OIRF 2WL8A 2OM6A 2BDUA 3T1YB 4IP0A 1KI3A 2XCLA 4BEJA 2FPIA 3TSYA 5CXSA 1OZHA 2GKSA 2HR1A 3NJ4A 1GZUA 3M5PA 4UEWA 5KYWB 4U5QA 1ZX1A 5DM60 3RTAA 2H07A 3ICEA 4YRKA 1NMYA 1NE2A 1ODLA 2QLTA 2YTZA 4JYMA 1XALA 4D92A 2FN3A 4JC7A 3WDMA 5AM1A 4XPZA 3HWRA 4HQFA 1M56C 2YLGA 1ZHHA 4EF6A 3TTVA 4E14A 2Y66A 2IEAA 4XD2A 2LVBA 4B87A 5BNIA 3ESQA 2YW2A 4DT1A 3LS2A 3D2AA 3OE5A 1JEOA 4EHIA 4C6TA 4FHZA 4BEMJ 5T67A 4TL6A 4OM8A 5L9AA 4NABA 2LV8A 2Y3IA 1R3DA 2EQ5A 4JXJA 3QEJA 4AC9A 1ZN7A 1FTSA 4J03A 4YL0A 2B8JA 3U9MA 1HW2A 3WHNA 5JPDA 2WWTA 1PDOA 2JRCA 1Z8FA 4O4HF 4FFNA 1B0UA 1OC2A 2QTRA 1GPDG 4ZO4A 3P0JA 3MBIA 2QRLA 3PEEA 3GHHA 2YV4A 4I1PA 1YUBA 2WP0A 3FGPA 1Y6ZA 2QNRA 1RPNA 4QOEA 4DJAA 4ZPJA 1PNVA 3D3NA 3W2FA 1JBEA 3K70D 4WAUA 2H5LA 4JA2A 2PUCA 3T0GA 3JQ7B 5CX1B 4A2QA 1BJTA 1S7GA 2QVBA 4RVNA 1GV0A 2X14A 3U9LA 2WHPA 5AW2A 3K09C 5IC6A 5NULA 5CIWA 4V0ME 1BA2A 2X76A 1SURA 3KYJB 1DE0A 4HDKB 1DL5A 3CVUA 3CG4A 2REOA 1I4TD 5F9MA 1KK0A 1OC4A 1AHHA 2YFQA 1GA6A 1XOIA 4M98A 5F2OA 4EHLA 3LRTA 5B2FA 1NVEA 3UMFA 1VHJA 3I53A 4IMPA 4F4FA 4Y6QA 3V2HA 5DNDA 1HFJA 1OZ0A 1G41A 1QP8A 2Q3DA 1OAKA 5LQUA 4M0UA 1AN9A 3EDYA 1UIRA 1FUUA 1E2QA 4IHJA 4FKMA 2OC4A 1X92A 5FFMA 2FP4B 4QE3A 5C5CA 2IUSA 2QBYB 5TPWA 1BA3A 1BMTA 3WFJA 3EFOA 2BMJA 1EINA 1VBKA 2WSYB 4NONA 4HB4A 1KEKA 1QRDA 3SDSA 4QWWA 2JJYA 1WCIA 4P3KA 4FGLA 3C18A 4PTZA 3PHGA 4DILA 2C61A 4ILEA 1Z33A 5L3SA 1BDHA 1NN1A 2QR3A 3SQOA 1U28C 3KSUA 5D92A 1H4QA 3ZWYA 2FEOA 2VDVE 3A2LA 4YRAA 3RSZA 2IYFA 5BOSB 5CT8A 4CR8A 5DH9A 1MMNA 4YP6A 3PFNA 2BDEA 3H8VA 2V45A 2YV2A 2FSSA 4QOSA 4QYSA 3TQRA 1RQPA 2AEFA 1U2EA 1O03A 3EVAA 3N8GA 5BSTA 3MC1A 1YR3A 3P0RA 4Q00A 3SIRA 1ZGGA 3QE0A 3GGJA 2AMYA 1Q2UA 4H17A 4GLOA 2OO7A 1DOHA 2OENG 1MIOB 1FFEA 2VWHA 1AA9A 2PYIA 1P33A 1JF8A 3QFCA 1QVWA 3TVDA 3GT3A 1RMQA 1EWRA 3KDPA 1CE8B 1AUQA 1LPNA 5JAOA 4YK5A 4LMPA 2P2SA 5IJ0A 3D4OA 2HSQA 1E4EA 2R48A 4KIFA 4JJAA 1A9XA 2X2OA 1AA6A 4WABA 1NQOA 4L72A 4YAJA 1Z0ZA 1I3KA 5FQNA 3TPZA 5CI9A 1XCOA 1V74B 2OV4A 3THWB 2FGJA 2ZB7A 1VSBA 1ENOA 3UHFA 2FLWA 1SQSA 1JFFA 4YP5A 5JT4A 1IBRA 2MYSA 3DBLB 3KFLA 3DV0A 3DNMA 2XLDA 4FGSA 4Q21A 4HATA 3AL3A 1J24A 2B30A 1YCDA 1UBHS 3AQIA 2RGNA 1TF2A 3LPMA 1AQ6A 5CDTA 1NOJA 4GI2A 3QMWA 1XTKA 1E6KA 5M04A 4V1CB 3DQQA 2IXGA 4KPYA 3P0HA 3X0DA 5CITA 2QMEA 4KDFA 3FN4A 1FUEA 3BBLA 4ZQFA 4HFJA 1DWQA 4RVOA 2IEDA 5T7BA 3TECE 1OZFA 1QP4A 4FDUA 2WJ6A 5DU2A 1MC4A 2G3YA 3P96A 4R5HA 4QODA 2GA0A 1SKYE 2P1ZA 4IQ0A 1BHQ1 1E2LA 2QQEA 2IW3A 3RSFA 2OEVA 2XNDD 4IDOA 1PT6A 2XWQA 3C14C 1GPYA 2CUZA 1R0KA 2B8EA 5A9SA 1CUJA 4I1UA 1YLMA 3I05A 4BBJA 1X70A 1MJHA 1ZOSA 2O0JA 4MB0A 5C8ZA 4AURA 1K92A 2WTUA 3D1VA 1FP7A 3F3MA 1SU6A 3KP1A 2B7BA 1B41A 5DV9A 3E9VA 1NRJB 4C6HA 4RV4A 1Y8RA 4WBNF 2QTTA 2BFNA 1NFFA 4Z0NA 2UKDA 3OM8A 2ZXRA 4XA8A 4RS4A 3EODA 4DFDA 2UZ4A 3SS9X 1J2RA 5KYTA 1RLMA 5ERYA 2W2PA 2VH2A 4K05A 1B16A 4WOKA 2Q4TA 3K30A 3LDGA 1QHNA 4YIKA 4BJ6C 1EWYA 4AN1A 4W5HA 5C8YB 2C7RA 1BAPA 1E6LA 3GEPA 4YUVA 1P9RA 5GGYA 3AL0C 3HHEA 4PHFA 3ZI4A 4I66A 2W9YA 4UMFA 4CUJA 3IQGX 4KXUA 3GGSA 5FCDA 2FZWA 4ZAGA 4J1TA 3K31A 1TC1A 3UKJA 4FT4A 3NU1A 3ROKA 5F33A 2NU9B 1EJ6A 1AZSC 2JIZA 3GFSA 2RJ3A 5GIOE 5P8WA 1EXVA 2W2MA 3RB8A 4FR2A 1Q3TA 1CFJA 2WFLA 4AKTA 1FQWA 3UEOA 4JI6B 3ZE2B 3GELA 4JMLA 2TMKA 3R23A 4CFZA 1DBRA 2REQA 3OZCA 4LHSA 3VMFA 4D3ZA 4EZBA 2WDZA 5DW0A 1AUEA 4N01A 2W7TA 4G0NA 3P2YA 2C7BA 4TM8A 2H57A 1PJ4A 2P1AA 4EHFA 4LXUA 1K06A 4D45A 5CK4A 4DXHA 5K0EA 2CFCA 4H4KC 3VGJA 3CT4A 5F7ZA 1RFGE 1X1AA 3IVCA 1B1CA 3JQ9C 3TLZA 2YOFA 1KSGA 3RAJA 4BVGA 1AGYA 2DULA 4LHXA 2VEDA 4P58A 5IDVA 3ZU3A 4XCXA 4RJTA 5K0LA 3ZG1A 1E6EA 2JGEA 2IPLA 1M7GA 2HPZA 3NUZA 4DVGA 1P81A 3KJXA 4MGYR 3O8QB 1GD1O 3VR2D 2CNOA 1DOAA 1HL3A 2V6JA 2HU5A 3WS7A 1CEXA 1TVCA 4DBQA 1E6MA 3MT9A 1AVTA 2EZ9A 1U2DC 4XDYA 4G5GA 1V6AA 1TX4B 5DYTA 4DPMA 4EJSA 1W2GA 1IOWA 4UD6A 1KYTA 2GPBA 1Y5MA 4DC1A 2PLNA 2WRZA 3H5NA 2FEKA 5JNSA 1NTOA 3UB4A 3PK0A 4FWIB 4Q7QA 1DQYA 4PYLA 1SO8A 1KDYA 1OI7A 2X0CA 3WYEA 1K8YB 1P1CA 1GT6A 1OV4A 1RWPA 3OWHA 4J29A 2REXB 4KVFA 3OVMA 4HH1A 3INNA 4GU5A 1ZXLA 2E48A 2FZ4A 1ZVQA 4LNUA 1NXWA 4DW8A 3HE3A 1X1CA 3CLRC 5EI5A 2FRXA 1SMKA 1EUYA 3EBOA 4JSYA 3D3EA 3Q7IA 4AZ0B 3WO1A 4CTOA 2EZ4A 2C3UA 3JX9A 2J9GA 3ERCA 3GJSA 4YJFB 1KMHA 1TJNA 1ORHA 4MS3B 3MTBA 4GX1A 4BAZA 3DTVA 1B8VA 3F9RA 1AEPA 4ZXFA 1V41E 4MKZA 4KQ6A 2VYVA 1BW9A 2BZ0A 4CMEA 5H70A 4FE3A 1WLSA 1K5PA 4QUGA 3ABZA 4H3KB 5GY7A 4UM9D 1ODTC 3RHTA 1RI2A 4CM3A 4BIMA 3WQBA 3KSMA 3J06A 3SJZA 4HWGA 4HFNA 1W48A 2E1RA 4W5QA 3Q7QA 3IO3A 5PNTA 4BEVA 3EB9A 1KEPA 4MV8A 3ZBTA 1Y4ZA 3VISA 1ZNXA 5KQMA 2BFFB 5TJHA 4LRUA 5K0GA 3E7DA 3PWKA 1JT2A 1VYHA 3FPBA 2ZE7A 1HETA 4R31A 1NMQA 3FJOA 4D80A 1II9A 1YMQA 2OAQ1 1GSHA 3IV6A 3DULA 1T2AA 2O2ZA 1P4AA 4X8MA 1O4VA 5INTA 2XLMA 3VDMA 3HL0A 5JCPA 2FRVA 1S3SA 1TWGA 2RGGA 3PRYA 4UBJA 4S04A 1APCA 4X7BA 3PC8A 1POWA 4RSHA 2AKEA 1WAMA 4I9GA 3FF4A 3QKUA 1GCGA 2WKWA 4OTZA 3LVRE 2ES4A 3AG2C 2ZRLA 3C24A 4WN3A 4C0WA 4JLMA 2Q21A 4A10A 4F1KA 5KVAA 2C0QA 2HYDA 5CA1A 1TMKA 2FWPA 3GRVA 4KHZA 3S7TA 4OMUA 1VHDA 4GUAA 4X1YB 4CIPA 1CY2A 3PXCX 1Y9DA 2C5SA 4HEA6 4ND8B 2CN1A 2H4ZA 1JDBC 4QGGA 4JFAA 4LI0A 4JEHA 2QOEA 4BDSA 5K4AA 4A2PA 3N6VA 1PEKE 3H3JA 3T7DA 5LYJB 3D3KA 2ZR9A 4XWYA 2WI8A 2QW8A 1PG2A 4CLXA 2X3FA 3NIWA 5TXGA 4ME6A 4FS8A 4U2FA 3TZ6A 2RDMA 4EY3A 1A72A 3GLSA 2WDPA 1AHNA 5EPOA 2HV7A 3QQPA 3H1FA 1GEEA 5DSXA 5JANA 4IMJB 3PUYA 4Y98A 3VPHA 3DCNA 1HZZC 4PO3X 1YBHA 4EYSA 4CG0A 2OAP1 3X3HA 2VUTA 4AUKA 2X9NA 5H3HA 3TIGA 4PJMA 3C5HA 1K88A 4HUJA 1X0VA 3EC1A 3GRZA 1VI5A 2O1WA 3SZOA 2CXOA 4KR3A 1G42A 5FJJA 1FYDA 4QXMA 3UB3A 3GPIA 4ZVNA 4QQRA 3WLSA 2DH6A 2VHCA 3I6BA 4NBLA 4EYGA 1SXJE 5CGQB 2Q0XA 4X7PA 2YXEA 1JSXA 3BB1A 2QTVB 3O4IA 1JR8A 3ZNOA 1UK8A 1NF9A 3LT1A 3ZWOA 3B1WA 4Q1DA 4PZAA 1C0LA 1OXBB 2CWWA 4XRRA 2CVPA 3L3BA 4QWMA 4AO8A 2YWEA 1E2GA 1HMYA 2WWIA 1KQ3A 3OPYA 4ICIA 4ZTZB 2V1UA 1Q1AA 3TD2A 1ILEA 1MO6A 4C14A 1OX5A 3NB0A 2C8KA 1EZ1A 1DQSA 2OECA 4QECA 4HNAA 1XK7A 4DSZA 1X86B 1MVOA 3DVAA 3GLGA 1VPDA 2J33A 1JB9A 1BEZA 1WMDA 3OJOA 1QE3A 4TYYA 3EFEA 4OSPA 1PG0A 2GSDA 2UU9B 3EH2A 4TRMA 3V5XA 4TT3D 3N2NA 2PMEA 2GCNA 5CDFE 3ND6A 1TM3E 2TRSB 4RFSA 4KNYA 5K9ZA 4TX1A 2XQFA 2NAPA 1WATA 2I6SA 1G21B 4MDYA 3O8NA 4PYKA 3QXGA 4MV4A 5KU7A 1OASA 5MFPA 4DV7B 4NYMR 4O4JB 1NFQA 2BI7A 4OBEA 1SCNE 4P4UA 1YRBA 4G86A 4MDFA 1I0LA 3LUFA 4LTMA 4CS8A 2D2EA 1PTJA 4D57A 1RI4A 1V0JA 2P3OA 3GAMA 2FX3A 5LLSA 4YRQA 4P38A 4BP9A 2L69A 4LXQA 3N0XA 4CRWB 3FDZA 2VAMA 3VDRA 2OUIA 2X41A 3M6FA 3WODF 5JYBA 4J94A 4PLTA 2OQ2A 2LQGA 4RIHA 1PVDA 3ZGYA 2BEWB 4Q4HA 2ZB3A 1PZNA 3IMFA 1DKQA 3WVNA 2VCBA 2WWYA 4XPXA 3UWDA 5L3RA 2B37A 1BS1A 4LFCB 2G9VA 3LCJA 3RRJA 3K72B 3PEUA 2CLKB 3I01M 4BQPA 4H0FA 5AQ1A 1Q0RA 2QN2A 5M3BA 1U7ZA 4GUDA 1C3EA 3GFVA 2H1OA 4JI8B 4BLVA 2WZGA 1F3LA 2W4MA 2XRFA 2R1TB 2L18A 3E58A 5A2GA 3MFNA 2JIMA 1NYQA 3NAZA 1DCFA 1B93A 2QLJA 5D1NA 5T64A 3KXLA 1C9YA 2FPPB 3L18A 3TYXA 3ZY5A 3NM5A 1XNQB 3X43A 4C78A 3NT5A 3S99A 1V4NA 3W7VA 2FCRA 1ECBA 1RLIA 3H4VA 2HRBA 1TE2A 4CTNA 1URPA 5CAEA 2LP4Y 4DDHA 2X0IA 1A77A 1FFXB 1XXLA 4HAIA 4M99A 5EE1A 1A9TA 1PYGA 5BMVB 1T9DA 4GM4A 3H17A 3G2LA 3HVRA 1W36D 4G24A 4UCXA 5IWCA 1T3TA 5EJIA 2PWBA 4EYQA 3H83A 3IDQA 2PBRA 3S81A 1TJYA 1LDYA 1VA4A 2HCFA 4V0OA 4RPHA 4I5DA 3NW9A 3IVGA 4J2OA 1IAVA 3USES 4Q3AA 5LZ9A 4Y0VA 1N7IA 4N6HA 4L8FA 1LDBA 3IB3A 1BS9A 2GHQA 5FOUA 3ZWWA 2A1IA 3IMEA 1A1SA 1YVPA 5IEJA 2E21A 3E27A 1SBNE 2ATXA 2XUAA 3ER6A 4MKHA 3WLHA 3R7NA 3OLVA 1X13A 4PBSA 3WO0A 1K7YA 1E2JA 4E11A 4ALMA 1RMTA 4DABA 1E1CB 2J9FA 2XDAA 5DBIA 4Q24A 4UMVA 1WL8A 1PFWA 2GEFA 1DARA 4G5FA 4PIPA 2OXCA 1SZJG 4LDZA 3GFRA 1RC8A 3SBDA 2VPXA 2J9BA 2Q6IA 4AXXA 3MUEA 3JW8A 4FLMA 4NBVA 1LTHR 2WPDD 1DTEA 3TEFA 1LX7A 3VR6A 4E0IA 4E1AA 1CVLA 3L6EA 4HNVA 1H2BA 5DRYA 4OLBA 2X51A 1J56A 1E66A 4GPD1 3EVDA 2ZITA 3RF6A 4KVZA 3SY8A 5D86A 1FNTc 3SM3A 1WZEA 2J8WA 3C39A 3K6JA 2NPUA 3BM5A 2PN1A 3D9QX 4B3TB 2W0SA 4NV1A 1CUDA 1JQ3A 2GB4A 2GDZA 1XVUA 1ZAKA 1IEQA 5HG0A 4YN0B 1IZYA 2ABWA 1C30B 4EX7A 1N6PA 1A8HA 3DKVA 2KPOA 4DKXA 5J1TB 3THXB 2J7PD 4CJGA 4II2A 3UJ8A 1VECA 1JDTA 1SC1A 4XEVA 2HNAA 4FYJA 3FFTA 2WYIA 3AFGA 4YV0A 4DSNA 3DD5A 2CY0A 3KELA 3W9YA 2KQ9A 2Q5CA 3SS8A 3HDHA 3WTBA 2X6RA 2VLIA 4NZNA 1OF1A 1GPMA 3BAZA 4PR3A 3DDNA 4TLMB 5I5GA 1JBKA 2W48A 3NBMA 2NO0A 2O7QA 1VZ3A 1DPFA 3UXHA 4UARA 4DG5A 1ZMTA 5KX5B 3V8BA 2PJUA 3EJ6A 2C58A 3GCXA 2XAAA 2JKZA 1SXGA 5ALMA 4CS9A 2JGRA 3FPJA 3B52X 1LCIA 5BUZA 2POCA 2DJ5A 4XTKA 1YJ5A 3UWSA 1WWKA 5GQSA 3VZDA 2R7AA 1CF2O 3HQ4O 4MGKR 3BRWA 2CMHA 1ZP6A 3UPDA 4S1VA 3KG2A 6REQA 3WMXA 2ZJ5A 3NALA 4WDQA 5DE3A 3CM0A 1IBMB 1KYZA 1NVDA 2Q5LA 3HY6A 4MRSA 3HABA 2D0PB 1EFAA 1CDEA 1W34A 3MWGA 1FMLA 3G8AA 1AKEA 3DJNB 3KPVA 4AUMA 3G5MA 4EW6A 2HJWA 1DFGA 3DFKA 3JRMO 3TLEA 1IEWA 3QPWA 3K32A 3CC8A 2F43B 3I6QA 3ZLTA 4LE1A 5CVUA 1R4MB 3CZ9A 5EHIA 3LUBA 2OVBA 3HSYA 4O6MA 2XOEA 4F8EA 1MAUA 1Q0LA 4I9UA 4AN4A 4KFUA 1N2XA 4I55B 5BYKA 4Q7CA 1T6NA 5E6UB 1JDBB 3SHOA 5I9NA 4M0MA 3ZWCA 1NBIA 4ZYYA 1J9EA 4ESOA 3QW1A 3U61B 5A6SA 2EJBA 2JLXA 1PZEA 3BRSA 1E9AA 1SVKA 1ZMRA 2YS7A 3LUAA 1G4US 4JZKA 2C5FA 2LGJA 4GEKA 2A5GA 5KZMB 5B3IA 1EX7A 4B7CA 3UOWA 2FN9A 5FPHA 1QZZA 3G1TA 3TVYA 4AL4A 4UNRA 4IMIB 1XKXA 4IGGA 3E5HA 2X6QA 1H6CA 3E8XA 3M9XA 4I7EA 3KZMA 4G2TA 3RI3A 4GPEA 4A73A 3P9QA 3RVBA 4L4UA 2V9CA 2VNHA 5JP7A 4V2IA 3CPJB 2XQGA 1I3NA 1G1MA 3QEBZ 4NTBA 2GPSA 1UBUS 3TTXA 3B3GA 3CJTA 3QPDA 1EPUA 2O2JA 3HL4A 3DDUA 3VR3A 4JGIA 4RPKA 4LAFA 4LHZA 4YMWA 3R3XA 2ONZA 1NDHA 3M1LA 4MIYA 2H48A 2R1ZA 1FFWA 2PCLA 3UHJA 4P9FA 3ZDEA 2BUCA 5BSFA 4KBLA 2K2WA 4NHOA 1TPYA 4Y6RA 3L41A 2DSTA 1GYQA 3DKRA 4EMBA 4AI6A 2GAIA 3HCOA 4ZJZA 3UJAA 1JKIA 4OA8A 1O94C 1QGYA 3NHAA 3RG8A 2GZHA 3HA2A 2ZSUA 1K6MA 2MYNA 3CCCA 3FHTA 1VJRA 1MBZA 5HF5A 1Y34E 1PJSA 4XIIA 1LNQA 2O2DA 2PMBA 5G3ZA 1JG6A 3NNNA 3IX7A 2YQ4A 5EWMA 1V9LA 3AI2A 3NEYA 3Q8XB 4S2UA 3FPCA 5KNCA 1R4TA 4ND2A 3UHPA 2PT7A 1DAGA 4WZAB 3EZLA 4ASUA 5FP0A 1SVMA 1JAFA 1SCQA 5FFFA 4PN3A 1BG6A 4R8RA 2Y4OA 1RQRA 3EIFA 4G0WA 4ZCLA 4JC8A 3DQPA 1K05A 2PSDA 2H0RA 3KQQA 2FSVA 1M8FA 4K40A 3WWZA 3IR5A 4DCGA 1JXQA 2ZI7A 2AJDA 2VNKA 1Q19A 3M6VA 3IAEA 4G5SA 3ZCUA 4NV3A 3ADDA 3AFIA 1F2TB 4Z7OB 1RRGA 4O2BF 3OAAA 1FNCA 2BTQA 1D6SA 2G3VA 2Q46A 3T1OA 2HTEA 1H2WA 1Z4MA 3WAGA 2JK0A 1JMYA 4MWTA 2EPMX 1YTLA 2BGNA 3DC2A 4WLFA 2CBZA 3PUZA 1K6IA 3RS9A 3ZU6A 1O5TA 3MWLA 3Q6NA 5BRAA 4BPRA 2CV0A 5FL3A 3TUZC 1KZ6A 3MWJA 1NSTA 4XUGB 2XW6A 4DIKA 2CW5A 3NV9A 2KI5A 2QPAA 4OQZA 1ENPA 5MF6A 1N6LA 2AG1A 4K88A 3QMKA 2ZSKA 2H51A 5DBEX 4RK1A 5G02A 4O59O 1OAOA 4GKVA 5IXSA 1CJBA 3EXHA 2PX6A 2HREA 3UJNA 4QASA 4DIEA 1YH3A 5AK5A 3ETJA 2E2WA 4DR4B 1GPJA 2XUZA 5K6TA 1A50B 4EJ0A 2A9RA 3OX2A 3UJHA 1D2CA 4MB2A 1E9VA 3GL9A 3MAGA 3NH9A 4PZZA 3ZNNA 4XX0A 2W2OA 4I3MA 4LQDA 3R0XA 4HLCA 2O4CA 4GR5A 3LCRA 4MS1B 3DL4A 3OT1A 4JTDB 5JBQA 1D0XA 1LQTA 1W76A 4B74A 2QL5A 5H7XA 2I87A 3BD7A 4IEFB 2HO4A 2XAUA 4MVJA 4L7QA 3L92A 1YQDA 4M36A 2DSNA 3GRAA 4J75A 5IG2A 4KHPB 4UM5A 3SZGA 5BY2A 4HEAJ 2FGYA 4MR9B 1QJ4A 2ZJBA 2G7MC 1NBMA 2PZEA 4KQKA 1QIIA 2DJIA 1O6GA 1GUDA 2QGNA 1EFPB 3K0CA 2P8JA 2DOKA 4C76A 1O95D 3N2ZB 1WULS 3R76A 1YZLA 2SNIE 2YDYA 1HX7A 3TF5A 2E6UX 5T3WA 2BELA 1PGQA 3D6NB 3PL5A 2ZCJA 4NU0A 3U2LA 4B6IA 1MEJA 3TD9A 1P0FA 3NUQA 2I1VB 4CEIA 1WQ4A 1ZNWA 2DHRA 4F9EA 4AKHA 3ROQA 2RBGA 2QN8A 1NIPA 3HXQA 3UAVA 1CY6A 1L5HA 5EJMA 2WW8A 2A30A 4YJ2A 5FF9A 3U1VA 1G60A 4WL0A 3RUPA 4ALIA 4W1PA 4EY7A 4EUKB 4Q82A 3F4LA 3H5OA 5LQSA 4UOZA 2AZ4A 3Q1KA 1Y1SA 3SZMA 4ABYA 3WLQA 2RAVA 2ZTLA 4PGHA 4TYMA 1HE1C 4ID9A 5FI3A 1RWVA 1ZCJA 1TYZA 1O97C 4S1PA 3EGDB 1P45A 4E1VA 5FWDA 4DA6A 3DPIA 4KJZA 3LZCA 1JAIA 2O52A 3LRPA 4Q7JB 1GFZA 4N7JA 2WSSA 3WOHA 3ZWKA 4PNEA 2BR5A 4HR7A 1CUIA 3GDHA 5DCLA 1JEYA 1DZ3A 5ALUA 4H16A 1Y5IA 4L5CA 4JK3A 3RU2A 3AM4A 2CLDX 1MIHA 3W6ZA 3ZC3A 3BB4A 1I5EA 2PWZA 3ITFA 3K1AB 1QC5A 3LXRA 4ZI7A 3JR7A 4DCOA 2XXJA 1F2UB 3VC1A 1B3RA 3GEDA 2BBSA 1YBVA 2HIMA 3U40A 2FLKA 3I6ZA 4WKOA 3STUA 1MPXA 2XT0A 4EG6A 1Y1TA 2YFYA 3VVMA 3DDSA 3UAZA 2RK3A 2AG5A 4KWTA 4NJMA 1PNTA 4JLPA 4BQSA 4MVJG 1UIMA 4WZBE 1ACMA 2FEMA 1DBQA 2VP0A 3BHIA 3LKVA 3WK5A 2QRNA 1OBCA 2JAHA 3MRSA 3O26A 5A62A 3B0VC 4DGSA 3SIPA 4TYQA 2P9FA 1SVIA 1S2LA 2RIRA 3W5DA 4CTMA 5CLFA 2FFQA 3IJRA 3KVVA 1UKAA 4L74A 5FLEX 4F21A 3R3YA 3R7SA 3ZNQA 3ZDQA 1TO2E 2CYBA 1KI6A 3LG2A 1CUWA 1UPCA 3OF2A 2PKCA 4MH0R 1G5QA 2HWYA 4C2TA 1KAGA 2I3GA 3S0XA 3SDZA 2FSGA 4DMHA 4TSKA 1Q1EA 1VLMA 5LWHA 1QHEA 3FYCA 1IW7F 4ZYXA 1R8XA 1G6OA 4GWKA 1PR3A 4TZKA 4AY2A 2V6IA 4FYHA 4BASA 1CERA 2BMFA 2JAWA 3PGMA 1GNVA 4RZ2A 4AF8A 1VOMA 4RD4A 4PPYA 3T7RA 1ZVMA 1TM1E 1FNDA 1KJZA 1QK5A 2FPSA 4D74A 2ZAIA 2WFZA 4GQBA 5B1HA 1ZHWA 4DLLA 4MLDA 5GMOA 1JTEA 2CDQA 1L5MA 3EEYA 3KT0A 3AKYA 3R5HA 4WLUA 2W37A 4TZ0A 1IN7A 4UBMA 5IHPA 2OJQA 1J9ZA 3AILA 1Z7YA 1FVOA 3ZJUA 2L6FA 1PT5A 1R66A 2VLBA 1RACA 1AUXA 2YL2A 2VNIA 1O58A 4GOXA 3CB4A 4OGFA 1ZOPA 2ZIEA 3ICVA 1BXGA 4XWGA 1N3IA 2P6RA 4HFRA 5JDCA 3PXAA 3I2GA 1DI0A 5I9TA 4RYDA 6ABPA 2AF3C 3U7QB 3PUVA 2H4JA 2JIPA 1J8FA 4MV0A 2NPIA 3U7EB 2RGEA 5KC8A 1U1IA 1K8XB 1FLVA 3KR0A 1ZCZA 4G56A 1PWHA 3S44A 2IXDA 4YGXB 1P1HA 5KYWA 1H0SA 5IF3A 2X8WA 2JGLA 3COSA 1OVMA 4NYIR 5EMNA 3MRXA 4XEUA 2J9XB 4IGAA 3SYTA 4G63A 5HIJA 4DCVA 3EW7A 2DB4A 4KFRA 3OSUA 1YBAA 4JLSA 3PYLA 2DTXA 3VRCA 3F6BX 2B9VA 1XDWA 1Z4KA 1R12A 1WA5A 1XU9A 3BE6A 3HMKA 4ZI2A 2EEPA 4INZA 4QYIA 4OHBA 5BQFA 1KS2A 1XXHE 4NJEB 2FK8A 4XR9A 1SKQA 1ZQ9A 5FBHA 4JKYA 1ZC4A 2AMVA 2XCUA 5DJ5A 4BP8A 1D07A 1YS9A 3KKEA 5CD1A 4E4YA 1DC4A 1WHTB 3EVCA 3E4DA 2EW2A 3GYBA 1P60A 4MXDA 4C2BA 3WTCA 5IT0A 2GHRA 4N48A 2PLAA 1JTFA 3VYVA 1LM3B 3LEOA 1G4HA 1YVRA 3H5RA 4FILA 2KNHA 3D7RA 1EGHA 3TKYA 2XL6A 4ZVRA 5IN4A 2YZNA 1SOUA 1OH5A 2CLCX 4DR3B 2FA9A 3T7IA 3ANXA 1EFDN 4NFLA 5LQAA 4QLBA 4GVLA 1MC5A 3KE8A 2PANA 4P92A 4WXHA 2IKQA 4MYCA 5A6KA 2OBXA 1R4NB 4AJPA 1JIIA 4J91A 5F9FA 5BSKA 3T9FA 5L45A 1L5WA 4A8PA 1X8XA 4PRKA 3UNXA 1JAHA 1SHLA 1UF9A 3V48A 3NWJA 2XIQA 4HDKA 2ZJ4A 2HSEA 4CSAA 2XTAA 4G0QA 3V8RA 4NYJR 2OG1A 4OP2A 2JBAA 2R7KA 4CJOA 3OFND 1I2CA 1BH6A 2Y2UA 5BRNA 4C7VA 1YS2X 4I1MA 3TTUA 3JSAA 1RYNA 4S1NA 2MCFA 4MW4A 1HE8B 1OR8A 3BH7A 3QQ5A 8AT1A 4UAVA 3TG2A 1OWOA 4OYLA 4W6QA 1CY8A 3VPAA 2PRYA 1RHJA 2WJGA 1U9ZA 4RH0A 1U3CA 4N5MA 3UXMA 2P11A 1BE8A 4N5IX 1R50A 5UKDA 4YRLA 2IEYA 5KNBH 3AUKA 4EMUA 2RG1A 1D5CA 3D43A 4W8OA 4JE9A 4LRWA 4JJEA 4JEIA 1U81A 5D6OA 4R5MA 2XI4A 4H6VA 1RXCA 2J5QA 3K94A 4V0QA 2ZBVA 5BOSA 4MSUA 1X0XA 1H9AA 2HA6A 3OOJA 2GRAA 2C4KA 1JE1A 3LCMA 2HU2A 3RASA 2G9ZA 1M8PA 4E0HA 1PQPA 2WJZB 3O2JA 2ZT5A 2ECQA 1L4BA 1L8OA 1R4AA 2AJTA 2VEOA 2IZZA 4EY8A 4IG4A 1ADFA 1NN0A 3NT4A 3ONDA 2A59A 4PSAA 4BAUA 3FHJA 1GDDA 5HYVA 4ZQBA 3TR5A 4AWXA 2P7VA 4RK4A 2FG6C 2BR4A 1CE8A 4EGFA 3QJYA 4KXWA 1KAHA 1W46A 3N86A 4HXYA 1BIFA 1L7NA 3V4LA 5G4KB 1ABFA 1GRQA 4MP8A 4N0PA 3F98A 3T1TA 3R7BA 2OQVA 3ZY4A 5BQIA 1G59A 4HP8A 4JBLA 2PD6A 4RCYA 1DOVA 1XD8A 3SHWA 3THWA 3SIXA 1BRTA 4D9IA 3EVEA 1GA1A 4ZYZA 3B1ZA 3DBLA 2VP5A 3G0OA 2PPVA 4DAOA 3H4MA 3TW6A 4R6XA 1G6HA 1QLWA 2PZLA 4DARA 1L5OA 3GLVA 3PHJA 4QPCA 5C4GB 4OG2A 4UHDA 4DG8A 4M89A 3O4VA 5LM3A 4Z6KA 4V1CA 1C7RA 1UKZA 2OXEA 5JCZA 2VNSA 1YZ3A 2H7BA 1UBJS 5EESA 3JD4A 5TPZD 1KXJA 3LD9A 1K2VN 1T2FA 3FSRA 4BLOA 3K9CA 3FI9A 3FTDA 4BMYA 4F11A 4S3MA 1ECCA 1J5EB 3CN7A 5KTRA 3AGTA 4A23A 2X5XA 3ZHRA 5EKUA 3HR4A 1QQAA 4Q1FA 4XGRA 3L40A 3RS5A 2GHTA 5JNWA 1IJEA 1SC3A 2C2HA 4P35A 4P53A 2IGBA 5LQKA 2CLHB 4PHTA 4OJTA 4OD0A 4ZC8A 2JDIA 2OKGA 4IZ6A 3M49A 2FUNB 3IP1A 4LKRA 5ECWA 4XGIA 3RIYA 1KH3A 3WYNA 1OVGA 3CYFA 4DMCA 1UAAA 4BN4A 1ZSVA 3RFXA 5HZGA 1RKXA 4RIEA 2WM3A 2FRDC 2HMSA 5YASA 4LJ8A 5ICCA 1RRMA 5EXXA 5KJEA 5F5NA 1WVIA 2GK3A 2NXEA 5FWXA 5HTKA 3IHKA 1JR3E 2RHOA 1YAUO 5KNBD 1A82A 3WMGA 2VYND 3BJIC 2V58A 5F1PA 5C8YA 3HB4X 2YYAA 3O84A 3RYCA 4GX0A 4DQUA 2Z2JA 4ZQCB 5I4BA 1AF7A 1PSWA 4HYEA 2PXCA 3EGIA 3SE7A 1LBSA 1RVV1 1NU8A 3ENVA 4RY9A 2VXCA 3E7WA 1KPGA 1GKKA 4OKNA 3AF1A 3GPBA 4PANA 3LY8A 2B2CA 4MGZR 2NU9A 2LCHA 1E6WA 4UM7A 4MB6A 5BSEA 1VKJA 3IMKA 4IBOA 4MI6A 1Z6AA 1M6VB 3EMDA 4AUNA 5K8VA 5FKJA 4CLRB 3V1TC 5F78A 5F23A 2N46A 5BNWA 2LR0A 2CL6X 4I1YA 4LWZA 3K0FB 5FB3A 3FY4A 3TZQA 2FPKA 4FN4A 2G77B 4CLDA 4YPOA 3D6TB 4M1OA 3WSVA 3AB8A 1JT9A 1POXA 4X6YA 3Q7PA 3QIAA 3T3IA 5P21A 2DYKA 3ZKAA 3RV4A 3O3CA 1IB6A 1MU0A 1HLGA 1WXFA 2CNDA 2R9RB 1VFNA 2PUHA 3BE8A 3R7WA 1UFOA 2XA2A 3O03A 5IKXA 1IQUA 1WSDA 1PRYA 3J81A 2E4AA 5ARDA 3Q3HA 3NPMA 2PMCA 4TKVB 1P2GA 4LYAA 3NWEA 2DWPA 5I9MA 2FXVA 2EX4A 2A58A 1ZU5A 3ZZUA 3NEPX 5CB8A 5LP6B 5D3KA 1HT2E 2A9PA 3B9RA 1FTWA 4F91B 1WZIA 2OCGA 1HSZA 3BVPA 3QVXA 3L7YA 4DUPA 2BSXA 3FMPB 1NHWA 3B1KA 3O8QA 3BKWA 3II6X 3PVSA 4B2YA 1CY1A 5CYOA 1M3SA 4NXNB 5KOJB 2II6A 3D3JA 4BB5A 4L8VA 2V6FA 3PDCA 4RTQA 5L40A 3AI1A 1TB4A 3T5BA 5L4LA 4OUDA 4BQNA 1Y7TA 3M4CA 4C29A 2Y0DA 2AN3A 1TFRA 3FOPA 1MA0A 2ICWG 3Q12A 1ODIA 3ZVLA 9ATCA 3DWIA 2F3TA 3KJGA 4LXGA 4RHTA 1WB5A 1RFLA 4F2HA 3IAHA 4ZVTA 3KD2A 2QRQA 4WY5A 2O8CB 4LSGA 4UUMA 3AVXA 1EBBA 2K87A 3A11A 5HRCA 1GQRA 1HTWA 1XWWA 3H99A 4PXAA 4H1VA 5DLPA 4YJ3B 2ONCA 3BDAA 3E3LA 3F8SA 1XHFA 3F6EX 5EQTA 5I45A 4RVHA 4JYCA 3WIBA 3F6SA 3FGNA 3RVRA 4G89A 3IC5A 1N2SA 3QZUA 1EUZA 3VX3A 1OJLA 2GFHA 3CPHA 3MCVA 1XDDA 2IRWA 3C6BA 1WN0A 4DUGA 3TXXA 4MS3A 4IINA 5TGZA 3AVWA 4CU2A 3GLFB 2OHHA 3RNLA 1MB4A 1AS0A 4MJLA 4D43A 4DY4A 4IKPA 3K8QA 2I62A 3GAZA 1L8LA 3K1IA 2YNMC 1DV2A 4RACA 2F1KA 1N2HA 2EWWA 3R5TA 4Z9FA 3FD8A 1J1ZA 3REOA 4IO1A 2D7JA 3JYOA 1H2XA 3AJRA 1I7QB 2VP9A 3IKTA 4GI5A 4OI4A 2XUGA 4KC0A 5A02A 1X7YB 2O6LA 1N6RA 5J2TB 3QBDA 1DAOA 2B7LA 4QBKA 3FVQA 4DKJA 1CGME 2ZJ0A 5I4CA 1TAQA 1EXNA 2B78A 4MO2A 5LL6P 2XA1A 4DQVA 3DYIA 4P7KA 4MA5A 4MIKA 3MCAA 3M6UA 4WKBA 5AW6A 5CT6A 3TDNA 3FDFA 3HB5X 1MOQA 1ISPA 4QSMA 2PX4A 5BN4B 4PBRA 4ZI5A 4AY5A 1W0KA 2PZBA 1T0BA 3FRIA 1V96A 4R16A 1GNTA 4WX2B 4R2JA 1U8UA 4TYPA 1ZQ1A 3C0KA 4D1YA 3KQLA 1Z7WA 1DAPA 5AM2A 3OTQA 1W581 1YS1X 1NPTO 3KOOA 3GNQA 3H2ZA 4RDAA 1I5NA 4ND8A 4B6OA 4P34A 3QX3A 4Y18A 3ABOB 3RR2A 1I3LA 3U7IA 1HFKA 4FX2A 5FPPA 4HQ0A 2LSEA 4EEXA 2YWCA 4G4SO 1EAMA 3BJZA 2P78A 4K3VA 1GARA 1WR8A 5FXMA 2ANCA 2PSSA 4WH0A 5C7IO 4LZWA 1BH2A 5LYJA 1TEHA 2HTFA 4ZK2A 4B35A 3PHHA 1YZFA 3U2MA 2Z09A 2V74B 1I7SB 4RIFA 1VPTA 4MAMA 1T9ZA 1BDJA 2P68A 4ETNA 3AKEA 3IAAA 4CL0A 1W1IA 3NHWA 3VH2A 1KEZA 3P9YA 1ZK4A 2JLBA 3EPVA 2M32A 3I9V6 5ADVA 4YEDA 1L1QA 4MPJA 3LE8A 3N0VA 3GGPA 4H3SA 2G9UA 4C87A 3OO0A 3SZ3A 4AZSA 2DB3A 1AC5A 3NRCA 2VP6A 4CCAA 2UXCB 5H83A 5FAKA 4IX1A 4F86A 2V3CC 4KQIA 3BZUA 4U5GA 4X90A 5FRDA 2VQDA 3EPRA 3P7MA 1IH8A 4ARIA 2ZJFA 2H6EA 3O4RA 1E7YA 4CUKA 3LHDA 5L4SA 4CM6A 3JQFC 1CJTC 1XQ1A 4CL3A 2FOIA 2YJ4A 2WJWA 5DB4A 2OBBA 4XASA 2YWRA 4Z3OA 2B5VA 2QTVA 3PFKA 1RS0A 2NYAA 2MYTA 2JW5A 5IAAA 2D2IA 4ESVA 5K20A 4QUDA 4DN6A 4D6YA 3GJYA 3SJCA 3WNVA 3NCTA 3HG7A 3PHIA 4LXHA 5FWYB 4LJYA 3Q3EA 2PTGA 2JLYA 5GZ1A 1BQ3A 4LXYA 1BR1A 2OHVA 2CJWB 5KPDA 1WXHA 2HGZA 1A4RA 1SCBA 3EN0A 3O0TA 3IESA 2WU8A 4HF7A 5E3HA 4KG7A 4TYNA 1AE1A 3DB2A 1ZL2A 2QW0X 1P77A 4JDUA 4PLCA 3T3MB 3SOZA 4C30A 3HJRA 1L8XA 1D6NA 3KUUA 3KZKA 4ARZA 1NUUA 1N5OX 4KUEA 3JQRA 3WGJA 1G3MA 3OP1A 3SYRA 1W5BA 1YJAA 2AN9A 3MJHA 5BR7A 4ZIRB 1Z4IA 4L1KA 3VHLB 4TRRA 3KQPA 3U49A 3MM4A 2HFKA 4EKYA 5B3AA 2IBMA 1SUSA 3R74A 3WSWA 2CHFA 4YJHA 2C0CA 4FD2A 5H4HA 3QXSA 3R5FA 3FXHA 3NJ8A 4IUCS 2PLRA 3QFHA 2Z98A 2JZCA 3WMRA 3ZPXA 2BCJQ 2VDJA 1U7TA 4KREA 3KIPA 1NBOA 3ZDCA 1F1BA 1XZKA 4GZLA 1ZGHA 3P32A 2OWEA 3W8EA 3AESB 2C7QA 3CUEF 4XWTA 2G07A 4XFKA 2YEVA 3KTFA 4K9SA 2BEWA 2QQFA 3R41A 4OIFA 1MAAA 1PBNA 1NUTA 2EP5A 2C99A 3ZUGA 2Z8YM 4F9TA 4CKCB 1VCMA 2ZT7A 3WGKA 4QJ4A 3E9NA 3PDUA 4EZEA 1ECJA 2GNOA 5A7HA 5C1DA 1E1QD 4HAZA 4RPGA 5M2QA 1M6YA 3LM8A 3DW3X 5E0OA 1EG2A 2VH5R 3UT6A 2P3LA 3AV3A 4WEQA 1QQ6A 5JWHA 4DMUB 2Q1UA 3FH0A 5BV8A 4R05A 3ZWDA 1ZKDA 4YAIA 2D0OB 1E2UA 4XJVA 4EGJA 5HFJA 1XQXA 4V0RA 2PNOA 5BUCA 1TAUA 3UMCA 5C1OA 1KVRA 3QBVA 1SIUA 1NE7A 4BU0A 5HKAA 3GGGA 1F5SA 2OA0A 2QTLA 2FPPA 2O23A 3KUXA 3KOMA 4KQCA 4XVUA 3L8HA 5ALEA 3K8OE 3LL7A 3I1FA 3TB4A 4V0NA 3L7JA 4EG5A 4W8HA 1E1RD 2B5OA 4A4DA 1FE8A 3C63A 5DNEA 4KXFB 4MVSA 2B0HA 3MMXA 1Z2EA 3DHWC 3SK0A 1FFXA 4YHBA 4L16A 1YJBA 1TUEA 1VCOA 1KKMA 2I4TA 1PD0A 2DG2A 4YYZA 3S8YA 4FP9A 4UAGA 3AUFA 5K05A 3X1DA 2DUNA 1YQTA 1NQUA 1GU0A 4F4HA 5CA0B 4DJTA 3ZHXA 5EZQA 3I76A 4M9RA 5TGTA 5BSUA 1L5NA 1QDLB 4BYMA 2PFSA 1UBTS 1R9GA 4RHYA 4DWJA 1EUCB 1PYOA 1DMRA 2HQ1A 1ESDA 2B0CA 3JD2A 4XVRA 1M0EA 3GJTA 3ZY6A 2ZIFA 5AVUA 1Y6FA 1ETHA 2BOVA 2J3MA 4XB6B 4DBLE 1SNYA 2WA1A 5DOVA 1PUJA 3VR1A 3DOEA 4YN3A 4KJXA 3CRZA 1QFXA 2P65A 4E6EA 3ZIBA 1OXMA 1SVWA 3RVNA 1O57A 2H8KA 5LA6B 2HMVA 1L4EA 3RSQA 1A2QA 2PWPA 3GRRA 3BXEA 2WABA 2SCUB 2Z43A 3HJHA 4G65A 1FNMA 1MO3A 1VLQA 1KOJA 4YPVA 2PGNA 2OHGA 1RM0A 2C9OA 2VF7A 1FRFS 2XADA 4CL2A 4OGKA 4F3KA 2JGMA 3TOLA 1OB2A 4QBIA 1LS1A 2G06A 3DEAA 2FP3A 2PVPA 1DCTA 5L51A 4TV9A 1HT0A 3CNNA 3HWWA 3LWDA 1S8NA 3RDPA 4E33A 5LQNA 1C8KA 1Y48E 1IZZA 3KQKA 3I2YX 3VAAA 4DLSA 5C8XA 4FOSA 2VVTA 5JT1A 3L4BA 3MWDB 4JD5A 2IYWA 4RC9A 1E9FA 1XCGB 4JT8A 1XZ8A 4EEKA 1J8DA 2C2XA 3DS8A 4IF6A 4ND7A 4KO2S 4OI0A 4PCUA 4BCDA 2VCCA 1IHUA 2W58A 5CXXA 4DY6A 3FCEA 2VN8A 2P4HX 5LNK6 4EARA 3DBVO 5FCLA 4QEDA 4ABTA 3N6XA 4F0JA 1T4DA 3PD7A 3E22A 3HRHA 4RQAA 5TEVA 3N24A 1Z6QA 2TYSB 4YLEA 4I4TB 4G01B 3UCFA 3T5AA 1XRNA 1ZCFA 4YRRA 2I55A 1F51E 4GMFA 5AVYA 1UEXC 1RC0A 1SG6A 4UEQA 2JFWA 4WK0B 2I76A 1RTTA 1NSYA 2CEKA 4BMOB 3IKVA 4U7WA 2YY7A 2B1IA 4X71A 3DFIA 4BKPA 1O3UA 3DR5A 4QDZA 3OX3A 1TMYA 3T9AA 2WOOA 3MRVA 1HDEA 4GYKA 4EJ2A 2OL4A 3CRQA 4KXQA 5EXPA 5A7GA 2PT5A 4D56A 1XVTA 1D0SA 1R6VA 2ZBEA 1M2WA 2I91A 2AXNA 4B6RA 4DRJB 1Z0AA 1DO2A 2OD2A 1I4WA 1RWNA 1P3JA 4ZMBA 1ZD1A 1ZGJA 2KYHA 2H0AA 3BH0A 2MWMA 3FAJA 4DCSA 2WU1A 3T7EA 4KRXA 2X8JB 4WGYA 1TRKA 2JFVA 5AT1A 2D4AA 2F43A 3THOA 4ARAA 2H2HA 2AWOA 2XE8A 1IONA 4JURI 5DDIP 2QX4A 3RU3A 1ICIA 1RABA 1C4OA 4EMSA 3TSWA 4QGHA 3TCKA 3HJTA 4QRHA 3PXEA 3G0CA 2PJDA 3P0FA 4OQNA 3C3KA 3AI3A 5E6UA 2HLHA 4L76A 4GE3A 3Q40A 3KHUA 3V4FA 2CF5A 3G0DA 1JHZA 1YA4A 4IXNA 3G0BA 3VHQA 3QI7A 4RLFA 3B7PA 2MMCA 4UPVA 4RTMA 1R6AA 3UKOA 3VYWA 4LZLA 3NHMA 4POOA 3FLEA 3D8TA 1YMUA 2NSJA 1OLXB 1HY3A 4S1TA 1QIMA 4QKQA 1XQ9A 2GO1A 1WDKA 2QYSA 4L3OA 3KZVA 1AG9A 1CUBA 4LZJA 3T4PA 1PFUA 4M0LA 4WXRA 5BT8A 4TSRA 1LI5A 1OYOA 1R0BA 3IJ5A 1UKBA 3GARA 3AIOA 1GVHA 3AEYA 1MX9A 3G5LA 5L3QB 3NHSA 1SZPA 1JIXA 4LY9A 5JSFA 4FIZA 4AM8A 1ML4A 1OMOA 2IS4A 2H4HA 1UP7A 2ONYA 1N0HA 1PT9A 4EBFA 1ZGZA 4HO1X 2Q00A 2D4UA 3KJEA 1Y8QB 3UCEA 2VTKA 5C7LO 4QTXA 1I7LA 4RWZA 1A7VA 1GTL1 3MIIA 3K1ZA 4KE7A 3G9XA 2Q5OA 2E7ZA 1QHSA 2UYCA 2HQOA 1VKNA 4LRYA 5GGXA 1Q14A 5E4JA 1KDVA 4HYTA 3M6IA 1RJ9B 4J7TA 4PC7A 2WHRA 1CG6A 2XT6A 3L04A 3X2EA 1NASA 3IOMA 5D01A 2PG3A 3LBFA 3C7CB 4D9HA 4WZAA 2XCRB 2QAIA 2HIGA 4GOKA 1YJCA 4A0GA 4CKYA 2O6HA 3RYTC 4ZK6A 1QK4A 2ZR7A 5AM0A 2OMEA 3IE2A 3B2EA 2HMTA 3EQ7A 3GLIA 4I6EA 2R1UA 2DM6A 1FFSA 5LPNA 1T1RA 4BEBA 2I2BA 4IJQA 2RGWA 4PGMA 3HJUA 3PDIA 4KYUA 4QO8A 4PSCA 1E3LA 1BMDA 3KK0A 4B84A 3ZZNA 3VYTB 2EYUA 3WDLA 3HYCA 1QO9A 1F2TA 5L4NA 5CD9A 4UHKA 3QNWA 2HSBA 3BFVA 2WJIA 4DANA 2Q1YA 4E3ZA 1QNLA 3F3KA 4FAPB 3CVXA 3TQSA 1R7RA 2VPZA 2PGXA 4XQ9A 1EVLA 2TS1A 3R8FA 2NIPA 5WRFA 3DGFC 1P7CA 4FFRA 1BDBA 1DQNA 4ZU3A 4RZHA 3WRYC 1B2RA 4J3NA 2VDPB 2NG1A 4F85A 1E9EA 4TKLA 1NI4B 1Q0QA 3O93A 4QJ5A 1GOTA 4PJJA 4KE9A 4E21A 2E4YA 1TIKA 1RYBA 5LZ5A 1OYWA 5BSVA 1J0DA 1A4IA 2BY4A 2LK4A 1YKFA 4RA9B 3O2SB 4H3VA 2YBEA 5M7EA 3UJDA 1WDWB 3RS2A 3L8ZA 2EIMC 2CHUA 3QPUA 3T06B 4WGGA 4U5CE 4Y9UA 3FB1A 2H1FA 1FR0A 3HJCA 1JG3A 2J3JA 3ICOA 1WB9A 2R66A 4N6CA 1ZK3A 2VJMA 2Q8NA 4BFWA 1M2GA 1D4FA 3IOYA 3W79A 4JIMA 3RUFA 1AHPA 4M1QA 3LEVA 1VSUA 2YHUA 4J07A 5SZHB 4MS1A 5ALWA 2V3VA 2XMRA 3LGSA 1H6AA 3T4XA 1MC8A 2AEEA 3RUAA 1ARZA 4PPGA 4QNMA 1XQ6A 3BXZA 3VR5A 3W5CA 4W9NA 1V5EA 4E46A 4OXKA 5BQPA 1ZVKA 2P9QA 4KLCA 3NCHA 1N7GA 5CU7A 4IEEA 1NYLA 2XMZA 5KYXA 1OPXA 3NTLA 1LE2A 1NL3A 1Z15A 1TL7C 2CE7A 2I99A 2VJKA 4FUQA 3BWYA 5DI9A 5K8TA 3QELA 2PKXA 1T0IA 2RGAA 5DSTA 2Y1LA 1WXXA 4F97A 1ZJZA 1LUAA 3AERB 1L4KA 4HUQB 5K0SA 1CZHA 1M72A 3NDJA 1B6TA 1IN8A 4R3UC 4MO9A 1T8UA 1Z6ZA 4U9IS 3OQIB 1K7FB 5EQDA 5HWSA 4E3WA 4PC3A 3LQRA 2A4MA 3TVTA 3SQLA 1JLKA 4MMYB 4FW8A 2R84A 4HMPA 5ERGB 4KMMA 4EUKA 3L4JA 4WESB 4ALNA 3ROTA 2ATIA 4ZGBA 2L9JA 4ZEWA 4XUDA 2WMNB 2HWUA 4Q3EA 3L7OA 4TLLB 2ZYDA 2HQRA 2X0JA 4GC9A 2A1UA 3U81A 3ODPA 1QG4A 1Z6XA 5L0DA 2M6LA 4OK6A 5B3LA 4E5VA 3KEGA 5CI8A 3DO8A 4BWGA 3F5QA 2G71A 3FJYA 5KJFA 4B32A 1YT5A 1XAIA 1H1LA 2P2DA 5FV4A 1AVOB 1GU1A 1SOAA 4M6WA 2HK7A 3HN2A 1PV1A 3NC0C 2C4MA 4JI3B 1F2UA 5K0FA 2ZRHA 3TAUA 5F5FA 2XZDA 4LTDA 1OX6A 3I3SR 3M9LA 5CCBA 3IP9A 1WXGA 3QHPA 2R25B 4HVTA 3IQDB 2TMYA 2CFSA 4MZXA 3DKIA 4YMIA 4M1WA 1WHSB 2J9RA 4B8YA 1KI4A 4JNKA 3CRNA 4G0ZA 2QLFA 3HKCB 5CGZA 2NUPA 1PNRA 5JMWA 3LP6A 1PFQA 1O6BA 1LRKA 2QR2A 4PHGA 2EZ8A 1BCSB 3LNCA 2ZU6A 3TJZA 3K6SB 4MRMA 2C42A 1ZM2A 2CKMA 5KDDA 3RRNA 2OGWA 1PJLA 4G5XA 3JXEA 3HV0A 3AWIA 1MMAA 1KY2A 3PTZA 2RHGB 1QGED 3G59A 2PFKA 4M8NE 4G2NA 2DUUA 1A9QA 1V16B 3DUFB 4AO6A 3GQBB 4XWKA 1OA1A 2ZQ5A 4GWGA 4H59A 3U4CA 4M53A 5HSGA 5BWBA 2Q0HA 1FU4A 5CVEA 1TCVA 3HJFA 2H4WA 4UBNA 1HMDA 2P0AA 2BZSA 2QVGA 4MVWA 4JZAA 3PE4A 1FW6A 4N6NA 2LFDA 4UHBA 5JNRA 3CFYA 4CG3A 5JAMA 1Y3CE 5DI3A 1Z2OX 4YCCA 5FA8A 5DBOA 4IIFA 5H4GA 3FWZA 4YONB 1V8PA 5B1AC 3I9MA 4MYUA 1VE9A 1XPUA 2CUKA 5EHNA 1Q57A 3S2YA 5BV0A 2ZJYA 4D7AA 2VHWA 2WINI 1OWNA 2QA5A 3AW8A 2JCBA 5JJBA 2DZDA 2UUIA 4QU9A 1M6WA 2PA3A 3MGGA 3KAPA 3LJBA 3SM9A 1H2HA 4Z3KA 2M6RA 3UY4A 3OKFA 4K9OA 4DBZA 1FSPA 3MLBA 1CS0A 3PJFA 4DLBA 1PL8A 3W3AH 5IK2D 2R7LA 1I4OA 1DC6A 3U7QA 3ZXUB 1DCKA 5ITVA 3WXBA 4HG2A 2R8EA 3L6BA 3GORA 1TM5E 4KSBA 4DBVO 3EPHA 1V48A 1ZONA 4U02A 4QUBA 3HO8A 2GNPA 2IU6A 5E9JA 2ZROA 3FMSA 3RUIA 3KALA 3UMYA 2EERA 3NYRA 3H2SA 5IJXA 1SZIA 1IG0A 2FG5A 1WKCA 1GGVA 1KJ8A 5E2QA 3V8PA 4HNUA 2F1IA 1LRLA 1GPWB 2O3SA 1XZJA 2Q7XA 2VUHB 4TLDA 4PHHA 3C74A 4B6EA 1ZM4A 3ZDYB 4JKVA 2FY8A 2WHXA 1KRWA 5AJVB 2I03A 3LNMB 4Q6BA 3RUDA 2HMQA 4URXR 2IV7A 3K0KA 5EGYA 2R7UA 3VJMA 3D7MA 3DO6A 5AVRA 1E2KA 2EX0A 4D4XA 4FMPA 1PQYA 3IQHX 3NZEA 1XA4A 4F9FA 2ZSDA 1EM6A 4AJEA 1GKUB 2ZXEA 1P0CA 1XR3A 5AC4A 2W2TA 2OY0A 3PQFA 5E9WA 1VIVA 4QBTA 4HNQA 3FFWA 4ZHQF 4NCAA 4CM9D 2QL7A 3RQGA 5EYPB 3PI7A 4QHSA 3WYGA 4AQYB 1LV7A 4XI9A 1A3CA 3EGXB 1EDZA 4BX2A 2H7OA 1QAOA 4OIMA 1ZD4A 3RJ9A 1Y63A 5HM8A 4TWRA 1RAFA 1R4NA 5DN6D 1OSNA 3WK7A 2GCIA 3EOBI 1PD1A 4FZ5A 2GNAA 1QVZA 4JLOA 9LDTA 4FNAA 2RH8A 2IZ7A 4JB8A 3KLMX 2BE7A 2QZSA 1BFDA 3GEBA 1CIPA 3OIDA 1TUBB 1N8TA 3SJAA 1JXMA 1KKLA 1SCUB 5TS2A 3RTEA 1JIVA 1J8QA 1NG9A 4PPNA 1XZLA 4MUFA 4YC7A 1Q15A 4I9HA 3CH4B 2ZRJA 2WYVA 2RG7A 4RETA 3HVHA 1YZVA 4WDRA 2QE6A 1QRTA 1V55C 1T3ZA 3PQ8A 2CVOA 1F12A 4IIXA 3VOAA 2HKIA 3UN1A 4B79A 621PA 1M0SA 3A1WA 4ML3A 5IW8A 4Z9IA 1ND6A 2QP9X 5HCUA 1JZSA 3JPYA 4BNJA 1FDRA 3HACA 4ZT6A 5AKLA 3JALB 3B9BA 3W3AD 3CH5A 3A32A 3JARB 3OE7D 3USCS 1OBVA 2XR1A 4OIQF 1P4SA 1G2IA 2JFGA 3F74A 5ILOA 5TARA 2K6GA 4NY1A 2Q3MA 4BJ5C 1JNXX 5GAJA 3JQEA 1X3LA 4PGFA 2A0UA 5I7WA 2IPMA 1Q83A 4RLSA 4MQLA 3UB2A 2RGYA 2P6MA 1U7WA 1D2NA 1GLNA 1SBIA 2R5WA 1S1CA 4E12A 4O5OA 3JQ7A 5CX1A 4BNIA 5BW4A 1JL3A 1T43A 1TJ3A 2R8YA 3R40A 1S2GA 4HH0A 3KYJA 3JWGA 2AJBA 1YYJA 4M87A 2HHJA 5B1DA 5DLDA 4AJKA 2ASEA 5EHZA 5HE9A 2ET6A 3VH3A 4ZZ3A 1KJJA 3H2JA 2WIBA 1GQ2A 2NU7B 2HYIC 2GJAA 1VYVA 3FVVA 4ZVSA 4CWAA 3WGVA 1TQ8A 2X9QA 3V6MA 4MHTA 1F8FA 2VAPA 4I08A 3PQ2A 3N0RA 4D6PA 4RH1A 2FP4A 3KLPX 2QBYA 4YMLA 3QYAA 4EUEA 2IIQA 1X7GA 3DP7A 3ONVA 2QYTA 1P1FA 1XZGA 4DA7A 4D0LB 3LCVB 3JRNA 2X86A 3FUXA 1ZVJA 4F4JA 3I73A 2VDRB 1QE0A 3AOGA 4WTOA 3L7NA 1WPXA 3S27A 2WFAA 4UVEA 3W2GA 4JFRA 1INLA 1NQTA 2CXSA 2DFDA 2DHEA 1R37A 3HZHA 5IDXA 2ZJ3A 4U8GA 4JVLA 1Z0JA 4IHJF 3N7TA 3DZIA 3L0YA 3SKYA 4FI3F 4EG3A 1HNWB 3KAJA 4X6UA 3PC2A 5DZSA 3T99A 4W8GA 3PWSA 4NF2A 1CUUA 5ALJA 4XX1A 1VG1A 4Q7MB 5KMGB 3O21A 5K8JB 3PE6A 1MIOA 3Q1LA 3WGHA 3HZRA 2JGNA 5KDLA 2B25A 1L9XA 4M9CA 3NYWA 5JNLA 2XDQB 5CLHA 3B1JA 5K3DA 3PZRA 3K15A 5HJ5A 4CQMD 3U9JA 2HHLA 1N0VC 3A04A 4OQYA 5DXJA 1K8RA 4QQNA 3U4QB 1W36C 3QH4A 2DF8A 1F8XA 2C5EA 4BVFA 4AKSA 3LP8A 4IQ4A 1EE2A 1ZBDA 3CO0S 1CY4A 2AQIA 1Z6YA 4UQPA 1J6UA 1JQAA 5HUHA 1ZS9A 4OXQA 1C9EA 3MBKA 3WNDA 3TNJA 3H7AA 4R51A 2DBVO 2RKWA 4LHVA 2W0MA 3ROZA 3RH0A 4R41A 2CK3D 3TIFA 4ZCTA 3O8BA 4NBWA 2CMDA 3NYQA 4QUHA 5DGXA 1PK9A 3M4JA 2A4KA 1M6VA 4N3NA 4P3OA 2I9KA 1BROA 3QEKA 3GOQA 3MNFA 2Q3CA 3Q10A 3K0FA 3CZMA 4NBRA 1XHLA 4HQOA 2E87A 3U3JA 5EN4A 3IPCA 3FWYA 1Y7HA 1U2TA 5EZYB 3GLGE 3SSMA 4HAVA 4XPIB 5I8ZA 5ICFA 4JB0A 4RULA 1CEQA 3C7TA 2AVKA 1H8EA 2I8BA 2IYEA 2WLTA 1OX4B 3MLGA 3ZBPA 2QTWB 4D5EA 4MHOA 2HFIA 1TK3A 1TQ6A 1G98A 3SG0A 4LCEA 3P26A 2XT9A 3I1JA 3W6NA 1YB6A 5JADA 1KH1A 3RFTA 4QM7A 2EIHA 4TKVA 4GM1A 5AK3A 1P9LA 2R86A 4FD3A 5F3DA 2ATCA 3F6PA 4Q5SF 5LP6A 4YXWD 2Q1TA 2R7MA 1TF5A 3FWPA 3EEOA 1EFRA 3OETA 4YL1A 2C82A 1JFTA 2BF7A 5A3JA 3NPAA 3N8DA 3HKEB 1CP2A 4ALKA 2RGXA 5JSZB 3BWVA 4KZKA 3KKZA 4JOCA 3THYB 2E4XA 2F4VB 2BHLA 2ZUTA 1XFAA 2J0SA 1RKCA 1BO6A 3JYLA 2X19A 4QPZA 5ICSA 3FPGA 2ZYUX 2WTMA 4W5RA 5JHGB 1ZNZA 2ODEA 3HWSA 1CNEA 5EIAA 4GKAA 3W8IA 5E3IA 3FB4A 1Q77A 1ZRSA 4G1EB 3IP7A 1GFIA 2DPGA 1PCXA 4R9RA 2XUQA 1B00A 3LUGA 2FDCA 2QLBA 2A2ZA 3HV2A 4PAOA 5B30A 4JJZA 3CJRA 3LC2O 3V5NA 3FCYA 2ZI9A 5DXFA 4UM9B 1LZKA 4IXWA 2PWAA 1HM5A 5PGMA 2QXYA 3OBBA 3PC3A 3X1MA 4EKIA 4UNPA 3SE0A 2ISCA 1U0TA 4IJMA 4NZYA 3G8BA 3I5XA 3ZGLA 1RWMA 3V80A 3A1SA 4Q7KA 3U4HA 4BC1A 1J0EA 5AUPB 1OIXA 1P2SA 2OORA 2ZSIA 2IPOA 4YCBA 5CM8B 2REBA 4AP9A 1R5OA 4TQ9A 3STHA 3DT6A 4CN9A 4D9KA 1FC0A 1BBHA 1UBSB 3QVJA 1OXUA 1XZAA 3GLFA 1XVVA 1RPZA 1IBCA 3AVPA 3FUCA 3RKRA 4MRAA 4Z9AA 1ENZA 3W90A 2VXOA 4I5IA 2HU8A 4J7YA 1U0JA 3O8LA 1UMDB 3OSZA 2JNWA 3O74A 3WNQA 1I5RA 1T8RA 5J2TA 2NPFA 4FDMA 1V7CA 3WKBA 2WQ7A 4L0DA 2ZZMA 1Y9AA 4RESA 1OE0A 4QXQA 2AQHA 4JP5A 4K6KA 1EFTA 1QLHA 1P9NA 4AICA 1NNEA 3B13B 4PYRA 2C2KA 1FFHA 2ECFA 3D7NA 4GKKB 4HTAA 2YMMA 5F52A 2W6JA 3MVEA 3Q7SA 1J33A 4XEKA 5I01A 1BEUB 1XX6A 5BYJA 4IY1A 2IYLD 3ZV3A 2OHOA 3W8NA 3UV3A 3A0UA 1TM2A 5B7QA 4EBJA 3UMJA 4F3YA 2VAXA 2HA4A 3W5HA 2GETA 1EDBA 2NVUB 2C2MA 2XVMA 4ZYVA 1BFKA 4QYMA 1BHSA 1NBWB 1Z37A 3C8HA 1ZVVA 2GZ3A 5C3UA 4PZ0A 1GCAA 2PAFA 3GMSA 1BE0A 1KFJB 5HOQA 1F6BA 3AR3A 1PHPA 1QG6A 4RHXA 5FTMA 2H2FA 4AZ0A 1Z3CA 3TUIC 3E7PA 4HRAA 4PCAA 4EPTA 3DI5A 4XARA 1KRHA 4WJKB 3C8DA 2VZ0A 4MWZA 3BT7A 4YJFA 3JU3A 5IP5A 1ZG3A 2LNDA 2DPLA 3U8VA 3TKLA 4DJEC 1ZD8A 2VCAA 2EG9A 2ENUA 3D4NA 1EA7A 2IEGA 4AUEA 3KU1A 4FJ0A 2YDXA 5EJGA 1D5WA 1QCDA 4ZVMA 4RQBA 1XU4A 3EC2A 3TI7A 1MMFB 5KHLB 1J20A 5FQOA 3SSOA 5C8VA 4X60A 1LEHA 4FB4A 3TXAA 2Z9DA 1C8VB 2BFFA 1A8UA 4R2WA 5HDQA 3IGFA 1REQB 1JX6A 3QBEA 2FJ0A 1JG7A 3NHYA 3KV3O 2XWBF 1QZTA 1Q1ZA 4AJ1A 3OZIA 4G09A 4I1SA 3OJXA 3BHJA 4JBYA 1TD1A 4B4OA 3R2PA 1GPNA 1L7AA 1I0ZA 2ZBQA 5AKEA 5A6AA 1C7ZA 2CSUA 4BFLA 3PVCA 1BX1A 4FGKA 2WD7B 3CNQS 3W7BA 2J85A 5DNWA 4QYXA 2V03A 2X7XA 1C9MA 1Q0MA 1G8SA 1V1MB 3V42A 4UVDA 4K8OA 3PLNA 521PA 3V4PB 2XX3A 1G8FA 2PKQP 2Y6UA 1T9CA 3U8PA 2H1VA 4JVNA 2CJWA 4U5BE 3K09A 4X1YA 1QG2A 2Y0CA 1X7XB 4N1AA 4HDMB 2QV7A 1GGQA 1I6KA 3DGEC 3T3NA 1JZTA 3P2KA 1EFVB 5JVDB 4JJ7A 4D8UA 2IFTA 3E9ZA 1WY5A 4S1WA 3FPHA 1TO6A 1H1DA 3CX4A 4HNSA 3O5AA 4TSFA 1IVSA 4B09A 1U6IA 1LDEA 3A2NA 4FOLA 1XDUA 5JJ5A 3PX7A 4W1QA 3KR2A 2XS1A 4CIYA 4R8SA 3LU1A 2BI4A 4MP3A 5CA1F 1UOQA 4AJJA 3EXFB 1ZK0A 1QTRA 1GNSA 3QTTA 2QI9F 1SUEA 2GXUA 2X4DA 3OLQA 3KR9A 3AR7A 3FGZA 1E0DA 1ZHYA 1W0JD 3DOIA 3HXMA 2MSEB 2WTNA 4GC5A 1RKQA 1VB5A 4OHMA 2UYQA 2XRMA 4PFSA 5F7XA 1PLLA 2OWDA 1U28A 2CC2A 5A6VA 1VYIA 4BRSA 2XBLA 3PNSA 3SYNA 3ASVA 4LRQA 3S90A 1FSZA 1V4BA 1U8XX 2ZRBA 1U3TA 5FPQA 4C0JA 4JYBA 4K5QA 3AESA 3GJZA 3SFTA 2KSFA 2AUTA 3CE6A 4XAQA 3NBXX 2ORWA 2XQVA 4RHCA 3BA6A 3KHSA 3QRWA 2ZE8A 4N9QA 1E8MA 3AM1A 4A7PA 1Y7PA 5BW5A 2JVIA 4CKCA 5DLYA 1OXBA 1YZYA 1IAQA 3DXFA 2OHXA 1UZAA 5C34B 1QE5A 2IOFK 1YOBA 3HEAA 4AAYA 3S2FA 3WK8A 3RUEA 3E3MA 5I8PA 3EHNA 1EZ4A 1I13A 2QVCA 2OLJA 3D5EA 3I64A 2FRDA 4MR7B 5ITSA 1QBGA 1O95C 5TMBA 4BP3A 4GPZA 2CJXA 1NKVA 5AVWA 1XFDA 1GUZA 4TQUS 1FNSA 1V2GA 3EWAA 3KJFA 1MGPA 4BQFA 5F73A 1W36B 3WLEA 4D4IA 3DOOA 3IR6A 5J3JA 1F1JA 3FZYA 5KTPA 5BQ3A 3GWLA 5AJHA 4F2GA 1YZHA 1UZNA 1G4WR 1GTJ1 3DLTA 4WZZA 3QX8A 1DHRA 4U2DA 3U62A 3QF7A 1G21A 3C6XA 1ZBQA 4UE2A 4UNIA 3HCPA 3J7TA 4IFEA 3ACDA 3R77A 4OQ4A 3UA4A 4JW1A 1UDRA 2VZ8A 1G64A 1T6UA 4HEQA 4O4JA 4P0PB 1JHXA 1QAMA 4ZO8A 5F1KA 4HH3C 3BF8A 3VKVA 2O57A 4BLWA 1BNCA 3NT2A 1VLVA 2CW0F 3GLHE 4WKGA 1X7ZB 5I9SA 3G2PA 1P5HA 2HRQA 3HJNA 6ADHA 3TRIA 3AM5A 3VZPA 2KW5A 3ID6C 1E4VA 4E15A 1RWXA 5CVTA 2YC2C 4U5HA 4MW2A 1XA0A 3E23A 2J9YB 3QEAZ 5BQGA 4Y2TA 1SOMA 1M75A 2WA2A 1LW7A 1WLYA 5A03A 4K9NA 1RJDA 3PNLA 5HX7A 3G68A 1E5VA 2H7CA 3C97A 1GGHA 4US2R 1YI8A 3Q9LA 2YIDA 3K2QA 1MOSA 2RH9B 2V7TA 4ARBA 1LSJA 1U2SA 3QOWA 3FZGA 4MQ6A 2VHEA 5SV2A 3OZWA 3NHPA 1QYVA 4IF4A 3US6A 4BJ6A 1D9XA 5FTJA 4O4LB 1K8ZB 1NI3A 2H9YA 4IOKA 3N8NA 2R1TA 3SN6A 2R7RA 1T9GS 1CT9A 1C14A 2V54A 2GJ4A 4Y6GB 2XMBA 1WQ1R 4LE0A 1KAQA 2IS6A 3JYQA 4CQLB 4RIGA 1E84A 4NTAA 1OFIA 2QGFA 3ABMC 2P69A 1K66A 1DG3A 1AKTA 2VT2A 4ZEMA 1VMKA 3MMNA 2IP1A 2XGMA 3WDKA 4RWEA 5DEOA 4H54A 3OF3A 721PA 4XCVA 5JVEA 4RKWA 3PC6A 1NVBA 3FPLA 4BLPA 3PLAE 2JRLA 1HDGO 1JDZA 2ZXFA 4CUZA 4DC0A 3RQEA 2VYFA 1ODJA 3WRVA 2GK4A 4CZ2A 5B58T 1DRUA 2GCPA 3MWDA 2FCAA 5CT9A 2EF0A 5BMVA 5T3TA 3KOUA 3OESA 3QU2A 1EA5A 3DMPA 1XN1A 3V1MA 1U2QA 2UZIR 5EE5B 1OJ7A 2GBFA 2PD4A 2NZ2A 1YDMA 3L8CA 4ZOBA 1J0CA 1QHGA 3THSA 3IQ6A 1ZOOA 4WIAA 1VGRA 1A69A 4B0OA 5F4ZA 1QYDA 3JQ9A 4CEHB 4HH4A 1GAXA 2NACA 4MQ9F 3WYBA 4BPBA 1D1AA 4MDEA 5A5FA 3PXDA 2RHDA 1D4OA 3T7TA 3CEPB 1QYCA 1NLUA 2ID7A 2WIJA 3WADA 4J4HA 1ZESA 4C43A 4O1MA 2YH2A 4UPDA 1E1CA 4DQKA 3G5TA 1E3IA 1U6HA 3ETNA 2UXDB 2WAAA 4COKA 3CW8X 1EK5A 3DAOA 1JEAA 1YA9A 3DE9A 2HS5A 2G83A 4YR9A 3O1HB 3IEKA 3MW8A 5B4VA 2MR5A 1YK0A 3OTHA 3MWEB 4HNGA 2NPOA 1X1QA 1U2DA 5B12A 3ZJ5A 4CEJB 4MMZB 1N2GA 1Z2PX 3HP4A 1U94A 5LMUB 4FFPA 3UANA 4NNPA 3WAJA 3QE3A 4BNFA 3D8SA 1D1QA 3M4ZA 2W5UA 1MHPA 2W2KB 2VSNA 5DBGA 1WW8A 5SYMA 3PJDA 1FZTA 3WQHA 2V96A 3G8CA 2ZRMA 4EVQA 4MW0A 2QM8A 4FMDB 3E6AA 1ZL0A 2AMJA 1VXRA 1PKEA 1Z6TA 1PVVA 3LTNC 4LY3A 1C30A 5HV9A 1FSSA 4G78A 1WX1A 1XL1A 3THXA 1ZUIA 2P9TA 5MDHA 2QD1A 4J43A 5CBPB 5EINA 4L78A 3TZLA 1KVQA 1M1ZA 1UJCA 1W73A 2OXRA 1KFBB 4OH1A 3ONWA 3TK1A 1NX6A 3MUNA 5FLYA 1AS2A 4MS4B 3EYWA 3HSKA 5CVCA 4LJAA 1CQPA 4CJXA 5AICA 3R7FA 3U37A 4OY3A 2I6UA 4F72A 4BV8A 4A0SA 4OBXA 4NFYA 4UVGA 3D2CA 5T4BA 3UAYA 3A9CA 5CG2A 3HXTA 1OLXA 3OIYA 4S0XA 1R8SA 5KX5A 1JECA 1V5IA 3EQ9A 1M1NB 4DQDA 2JAPA 2JLUA 5B1YA 1A71A 3RIXA 4ID3A 2WD8A 1ZJ5A 2HF7A 3B82A 3LO8A 1N1MA 1JJAA 3MD9A 1J2JA 3AHIA 4KLRA 1LRJA 2MHRA 5KNDA 3I1IA 2L6GA 4JJGA 2BJVA 5GPGB 3U7HB 5D6NA 4C0QC 1QORA 4H18A 1Y8QA 1DNPA 5COMA 1AGNA 3ABIA 5EMHA 3ND5A 1O0CA 1CNMA 4LGYA 4ZOQI 4YNBA 5AXBA 4M7OA 1T25A 3ANYB 2PXXA 3OOHA 1R4MA 1E2DA 2E82A 2NW6A 3IR7A 4AS2A 2IV2X 1RJ9A 1ZY2A 3W78A 3TO5A 4MWBA 1THTA 1Y98A 4MWGA 5SICE 1KI7A 4QDUA 1PZHA 4Q48A 4I55A 1DDOA 4G8JA 1LIHA 3VXKA 4X92A 2WV7A 4YRPA 1USIA 1YCFA 1IM5A 1K5DA 3IMCA 4ZP1A 2HN9A 1PWZA 1KMMA 5EIBD 3T5CA 3IUSA 1M0TA 1R5JA 1DIGA 3RU7A 3AQ4A 3G02A 1OH8A 3MGAA 4MICA 1KO4A 2QTBA 1CNFA 3A4LA 1DEHA 2W43A 3SMQA 3E61A 4PZCA 2H9IA 3E35A 2AUNA 3K70C 4KPEC 1FZQA 4NZ9A 4HJXA 4QUJA 4M9QA 1MX5A 2YKZA 1HZZA 3IQXA 2P1RA 2XF2A 4FVTA 4DREA 1GQSA 1IQRA 2CHVA 2PUAA 2GZDA 3PV0A 5IBRA 3RC1A 2JGKA 1D2AA 5JZMA 2AKAB 3IEEA 1QXSA 3IQZA 4F3NA 5JFTA 2IJGX 2UVDA 3A6PC 1H8HD 3OZAA 1E59A 4MV1A 4MTCA 2JASA 5FZTA 1QU2A 3AR5A 3S29A 1U0OC 1UDCA 1ESZA 3NOOA 2OESA 4A92A 5KNLA 3O8CA 2MINB 4J8PA 4TMTA 4FSXA 1XP5A 3LWNA 2H06A 3CWZA 5BSMA 4RA9A 3W2IA 2IS2A 1NU9C 1TYEB 1MJGA 3C6QA 1ZNQO 2R11A 4EAQA 4EYKA 4Z7NB 1SYQA 1JHDA 1WIWA 5IULC 1GPUA 3CRVA 4W5NA 4NBTA 2GKGA 2AHOA 3GXOA 3K3PA 3MOSA 5HK9A 3H0EA 3JRTA 1DRKA 2H2DA 3FJ1A 3R5KA 5LZ8A 1V6CA 4GYWA 4AXBA 4CL8A 1ZWLA 4KLNA 3IUYA 1E1KA 1KERA 3T0IA 4DMLA 2AL7A 1AK9A 3LBIA 3H1AA 1MAHA 2JFOA 2CZQA 2GR9A 1Z68A 1HQDA 5AOVA 3TD6A