4BJ6A

Crystal structure rif2 in complex with the c-terminal domain of rap1 (rap1-rct)
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
329
structure length
293
Chain Sequence
b'SPVKERVDHVFYQKFKSMALQELGTNYLSISYVPSLSKFLSKNLRSMKNCIVFFDKVEHIHQYAGIDRAVSETLSLVDINVVIIEMNDYLMKSDLMMMVMRKINNDESIDHIVYFKFEQLDKLSTSTIIEPSKLTEFINVLSVLEKSNNIAFKVLIYSNNVSISSLLSTSLKKKLNTKYTVFEMPILTCAQEQEYLKKMIKFTFDSGSKLLQSYNSLVTCQLNNKESNLAIFFEFLKVFPHPFTYLFNAYTEIIVQSRTFDELLDKIRNRLTIKNYPHSAYNFKKNQRLPLKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RAP1-INTERACTING FACTOR 2
publication title Rif1 and Rif2 Shape Telomere Funcation and Architecture Through Multivalent RAP1 Interactions
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 106
structure length 293
sequence length 329
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-04-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1650 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4bj6A01
3.40.50.12060 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4bj6A02
4BJ6A 4BJ1A 4BJ5A
chains in the Genus database with same CATH superfamily
2CHGA 4BAGA 2XIQA 4BVEA 4BE4A 1RC1A 1CEXA 1Q14A 5GJCA 2EV9A 3GI1A 3DDCA 1MDFA 5IYZA 2FJUA 4Q0MA 4EMBA 5K0LA 4EY3A 4ZEWA 3I6MA 1LC0A 4AXXA 2BE5F 4NMMA 1SXIA 4UEQA 4ND6A 2D1QA 3QEMB 4IDHA 4IAOA 1WSBA 1T9KA 4GICA 1RYYA 4KGVA 3ER8A 4L15A 2VAPA 3V4FA 4AB1A 1K9SA 1B2RA 1UPTA 2HTEA 4QA9A 4BO0A 3DVSX 3ZLUA 3ZKWA 4PEVA 2ABWA 3AIKA 4O4LF 5HF9A 3MXOA 3NM4A 2IY9A 1LPEA 3L6OO 1RKUA 3K9HA 2AFVA 3LP8A 4DLLA 4QOHA 4IIBA 4KGDA 3RUDA 1SQGA 1EVZA 3H5NA 2CB9A 4RABA 5J63A 2EKBA 1NMQA 3HB9A 2F1JA 2GYYA 4HAIA 1UBLS 1KMIY 1P18A 3REOA 1HQKA 4MA0A 1G63A 2MHRA 4H4DA 3GEMA 6REQB 2ZRMA 4NC9A 2BHLA 2CLIB 5FHRA 2Q99A 4EY8A 4MMYB 1ZHZA 1EA7A 3Q0TA 2Q2OA 2BMFA 3OKFA 4I1PA 5B57C 1W34A 5JW6A 1NW7A 1J7KA 4Y1RB 4NDNE 2NX2A 1NG9A 4FBMA 2FSGA 2PUAA 4O6MA 1RXSA 2CVOA 1QIGA 1U8AA 1OI3A 4IWBA 4Z9BA 3PGJA 3PD0A 3OOJA 5K3FB 3NTLA 4U5QA 1YZLA 4N7RA 4Q5SF 3K9CA 2B2XA 1JJAA 2OYCA 3HN7A 2XCSB 2DJIA 3C7TA 1QBKC 1BXRB 1RI4A 2CVHA 5BYBA 2QD2A 4A4AA 2ZVPX 4WKCA 4FWIB 5GGYA 4HRYA 3HSKA 4HGPA 2ZYAA 5AIAA 3M83A 2ORVA 1E9SA 4R51A 4DUPA 2QTLA 4Z51A 1DB3A 3R09A 1S89A 2QSJA 1KETA 4IPTA 4QVKA 3FHTA 9MHTA 3MT0A 5KQGA 2BISA 2DBRA 3O90A 2I4LA 3FGOA 3SX4A 1YASA 1WBBA 2VRBA 2GA9A 4GXRA 2E55A 1PGPA 3NUGA 1T0JB 3C5WP 4L57A 4BO4A 5CT6A 5BWBA 2PS1A 2ZFUA 1F0PA 1WVIA 3ITDA 4D8TA 3JZMA 3CW8X 4XW2A 4O4LA 1I32A 1VM6A 4UHDA 5AO9A 3L77A 1THMA 4MQ5A 3OE7D 3F6YA 4NAHA 4KSYA 1G41A 4UU8A 2CL7X 2FLWA 3NHBA 3QVUA 4CM9D 2ZUSA 2QVBA 4JLDA 5EQJB 4HFJA 5CD1A 3BWBA 4G1EB 3WGUA 2BFEA 3NB0A 2D1SA 4ZC1A 2AN9A 3K05A 2W6OA 4RPHA 1E7WA 3EXIA 4G0HA 4OXNA 3IJPA 2D2IA 3VH2A 3R23A 4UHKA 5EJ8A 5DS6A 1QVVA 3BWVA 3WL6A 4YK5A 3DI5A 3AV0B 3C41J 2NACA 3I58A 2B4RO 3DT8A 3DJUB 5KVQA 1FUUA 1C7IA 2H00A 3WBBA 3ZK8A 1S3IA 1W4BA 3DF7A 4I50B 4LLEA 1V5WA 2O5VA 2J9YB 1VA5A 4E21A 3GUUA 4WHMA 2A30A 3WJAA 3QRWA 2CXOA 3TSCA 3A3OA 4RH3A 5AVYA 1M8JA 4YI3A 5T8KA 4Q1VA 1E2GA 2RIRA 3I09A 4XYEA 4JKVA 1EMDA 3V3TA 1MG0A 1OJ7A 1SXJB 5FP0A 2WKQA 4DIKA 1K3TA 4NZPA 4OBWA 4PYLA 3ZDCA 1U2DA 1I30A 4BBZA 3E23A 1A1SA 4YJ3A 3LQRA 2BZ0A 1EFPB 1M2OA 2X0EA 2EZ8A 4X1OA 1ZW6A 2ZBVA 1Y8CA 3CUSA 2G8NA 2FEOA 1ZI8A 4QODA 2VZLA 2EFEB 1INLA 4GPTA 4KZPA 1CY4A 3UBTA 1VBNA 5FH9A 4FONA 1HX7A 5MGNA 3U4GA 3VPAA 4C2BA 1NJFA 1EHCA 2DYKA 5JJLA 4OA5A 1IN7A 4FCTA 3DP7A 4O2BF 2AKAB 3MJHA 4MVQA 2BH2A 4NXMB 4F45A 3A27A 2A1TR 4FNGA 4ICIA 1H5NA 3RR2A 1M34A 1Z9BA 2XI4A 4E4RA 1EJ2A 1CP2A 2ZSDA 1PEYA 3OPYB 1CUFA 4XGIA 3QI7A 4H4KC 3PSHA 4DBQA 3TXAA 1L5FA 4OLFA 3MUEA 5AQ1A 1NWHA 4R31A 1V1MB 3T5PA 4FSXA 2DFKB 4PRKA 1PR5A 4DE5A 3F5SA 1CUAA 2H06A 1R4ZA 1SKUA 3VVBA 4F21A 3UJCA 4X8MA 2PT6A 4MYRA 2J3MA 1JEAA 1TUIA 4E5SA 3NYWA 4LBVA 1KYZA 5K0GA 1QK5A 1Q91A 3DVAB 4FFPA 4LJ5A 2J3JA 3V8MA 4FLMA 5BW4A 5COQA 1IQUA 3JQ8A 4BVGA 4W63A 3BT7A 2VF7A 2DKOA 4TS4A 1EESA 2O2CA 2FRDC 4XQCA 3C8GD 4HYTA 1VL0A 5K3SA 1LDMA 3T1OA 4GLFA 4KWHA 5AHOA 3TRFA 4K3VA 2YZSA 4FD2A 4JB8A 2LZ0A 1FNTc 3U5ZB 4LDRA 3FNEA 4MYHA 2IHTA 3W34A 3I53A 5CB4A 1C3OB 1XDZA 3FMFA 4ES6A 5BR4A 4L5BA 2AC7A 3D7SA 4R9VA 3MG9A 4U5DE 4GYYA 5AESA 2B92A 5E7QA 2RAVA 2XLOA 2PO5A 1Q5PA 4V1CA 3TCXB 1IONA 2QX4A 1W36D 3CISA 3LYLA 3MAAC 3DCNA 1U65A 3DXYA 4Q9AA 4XR9A 2IS2A 3PLAE 2DPMA 1JRAA 2IYZA 3T9AA 5F5HA 4O2BA 4P80A 3N8KA 3A1DA 4V0KA 3TLKA 2L6FA 1Y8AA 3ZUPA 2JA2A 1UJBA 1I2ZA 4P84A 1RYBA 3QXXA 2W6MA 4OQNA 1H6BA 5D01A 3I6BA 3KFLA 1ZOLA 3HCDA 2PKQO 3ZV7A 5LMUB 3AERB 2RE8A 4HNGA 4TSKA 1JF8A 3EB9A 3LPLA 1AGRA 4UMDA 4DQXA 3RAPR 2AZ4A 1BMFD 3LA8A 2NOAA 2P2LA 4BMOB 3WKAA 1YBVA 2HF9A 1B0AA 3PC4A 5EUQB 2ICAA 2IDKA 4N3GA 5DYWA 5CVDA 2R25B 4FMDF 3SOZA 3W2HA 2OXCA 5HHTA 1PQ4A 4V0SA 1R66A 5KX5A 3IP6A 4BRWA 2HSWA 1ES9A 5CR9A 2P30A 2YV2A 3HJAA 4DT1B 4LYYA 5IVKA 1H3FA 4OBBA 3TXXA 1TE2A 1LRJA 2WMOB 2PA0A 3MCUA 4G09A 2JCYA 5JZ9A 1J0CA 3KAKA 2J3LA 2AOUA 3I04M 5BSRA 1MGOA 1RMQA 1FSZA 3DMFA 4AMBA 3RV3A 3X1YA 5A1JA 2BDTA 1LS1A 5J5VA 1PJ4A 1Z2CA 2PQMA 3QVGB 3UT0A 4JP8A 2BKVA 5AGFA 3GJ7A 2HDHA 1Q15A 4F85A 13PKA 4DA6A 1AHPA 5LFAA 2I67A 1SIWA 1OF1A 2OXRA 1KH2A 1AM4D 1QYVA 3FG9A 1B8UA 4YLGA 1NRJB 2GJKA 4ZO7A 4XD2A 3UT6A 2QZ4A 2QM3A 5GVRA 4NXNB 2XOXA 3QZUA 3O4VA 4E7OA 2YYZA 1XUOA 3F9RA 3OKCA 4AP9A 3E8MA 1SFRA 3PXEA 2A4MA 2XT6A 1QQ5A 3DBRA 2RHHA 5BN5B 2VHEA 1PEKE 3WNDA 3LLKA 2E9SA 1N2IA 3UVEA 4OKNA 2VH5R 1YKFA 1IQRA 3GLGA 3L43A 3KYCB 4WZAB 2DH5A 4W99A 1F12A 1WXFA 2JJ1D 1C7JA 1I0LA 1T3HA 3HTKC 1QFSA 3DOEA 3HEBA 2AQIA 3G6KA 1U5BB 1P8JA 1VRCA 4JAVC 3H6KA 1ODKA 4YP0A 1FX0B 4QD3A 3RBVA 1ZMBA 1JHVA 2BBWA 4WVFA 3C15C 5EIXA 1UDCA 1A4UA 1YDEA 1ENOA 3JPYA 3CR7A 2PRKA 4TZKA 2FW0A 1T2NA 3WMGA 2IJGX 4JUBA 4OLHA 5FDFA 3R0VA 3CC8A 1TCCA 2WF6A 4LJ9A 5F3WB 1NRIA 4QOFA 3UHOA 3OT5A 5JD3A 3WQSB 3U1VA 3ZD8A 1XLWA 2GZAA 5EYPB 1PFWA 2VCBA 4ZT4A 4MI1A 1RJ9A 3NBMA 5DMHA 4RJKA 4RDIA 1RIIA 2OXIA 4DRXA 4UM8B 2W6PA 2YN2A 3STYA 2YWAA 3EXAA 1CGME 2Z95A 1I5RA 5IJZA 4GOJA 4LXIA 1GWNA 1MNEA 4WCFC 1NR5A 2QTBA 3I2GA 3LK6A 1IJBA 1QG0A 1SUWA 2O05A 3VR4D 4JLBA 2GPAA 3ZDLA 5MF6A 3EFHA 1J42A 1F8XA 5IAKA 2YZ7A 3NMJA 2FTKE 3L8IA 2G71A 2FFJA 2Q28A 4MQMA 4Q93A 2CXQA 1M6VB 3LEVA 3WDKA 5G0WA 4N8DA 4YRTA 1MB0A 2ZQ5A 5CAEB 1HQYE 2QUHA 3OEHA 5FL7A 4WDRA 1GQYA 3EZ6A 5K9ZA 1YOBA 2VAWA 3W5JA 4BPRA 1BVUA 2FZVA 2OB2A 3ESZA 1M6YA 3T6JA 5CMLA 3SYRA 1J2YA 1DEXA 2MYSA 3T1VA 2FJ0A 1DADA 1JHOA 4OQQA 1OLSA 2V7QD 3BEOA 3ROXA 5HXAA 2NU7B 5L4NA 1R10A 1UKEA 5BQOA 4KNVA 2ZBRA 2ASEA 4F4HA 1JQAA 5BXYA 4Q01A 5KHOC 1G8YA 3CFYA 3IBTA 1PEDA 2P4HX 3PR3A 1YR9A 2A9PA 3GLIB 2NN3C 4UAGA 2PVSA 3MFYA 2QRLA 3PUHA 1TM1E 4IQ8A 4EABA 5DLPA 4F56A 4MUKA 4AJKA 3OM8A 1ZUD1 5KNDD 1VFNA 4XVUA 4CL0A 1B68A 3R5TA 4OJKA 1KEPA 3ZVMA 4E5NA 5EP1A 5AIBA 4LFAB 3EUAA 4JEUA 2BFCB 1WQ4A 2TMYA 1Z5OA 1MQVA 1JWBB 3I5QA 1S4MA 2TMVP 2VWQA 3C8DA 4AJLA 3HR4A 4XPYA 1A8SA 1DKOA 2GFIA 4KXXA 1CR2A 1I6MA 2X3UA 3OD5A 2PX2A 2HF8A 4HF7A 5I6DA 5EIAA 2R11A 2E82A 2JX0A 1YV9A 4FN5A 1YQUA 2VJNA 2OHXA 1UK6A 4HEHA 3QF4B 3RWBA 2JFPA 5JTUA 3BFXA 4J4BA 5E1OA 4N0EA 4F8EA 5HVNA 4DDHA 3T54A 3GARA 1VIAA 2OO5C 1CDEA 1GTSA 4JUIA 1GN9A 1X94A 4QAQA 1E2XA 2DERA 4D4JA 5E6RB 5JATA 4OU4A 3OI7A 1G98A 4F84A 1J8YF 2I1VB 1DEOA 1TU4A 3GAAA 4JEHA 4OTZA 1BJTA 1HRKA 1KYVA 4YMGA 2WZBA 2JH3A 4JSYA 4B3IA 1TRHA 2RHBA 1ITZA 1KIMA 3L7NA 2R86A 3PDIB 2QG6A 1Y9EA 2BM9A 3PEFA 4QHTA 4M8LA 1V6CA 2Y3HA 5L7YA 3IEEA 3Q0IA 4M83A 2NYVA 3ZWYA 4OJTA 1M56C 1FMLA 3U3RA 5HJ5A 2NSJA 2HREA 2FLKA 4MVJH 2P67A 4MLPA 4GBMA 3SEZA 4BMYA 1JDBB 4ZA2A 4F5WA 3U7HB 4C2AA 4ZCQA 2VJMB 1TXGA 5K3CA 3ZU4A 1K4MA 5DHPA 2F9MA 2JLYA 2VYNA 1QHHB 2F3TA 1TO2E 3PV0A 4IVPA 4US0R 4O5OA 3WDLA 2J9XB 3G0IA 5F4ZA 4KBYA 4G5RA 3W79A 2ZREA 5CA0B 3TTTA 3K30A 4FI3F 4BFTA 3OOYA 3M9LA 2P68A 1JECA 2WFAA 1BU5A 4NKRA 5HG0A 4LNUA 3BXZA 1OVGA 3O8QA 4TN1A 3BWMA 3SQLA 4PC3A 4HDRA 3EDYA 2A6PA 2EKZA 4KXUA 3H0CA 2GZDA 1E3TA 4DABA 1S9DA 3AUTA 1IXRC 1YRBA 4UUBA 3EQ6A 3GJYA 3NBXX 1WN0A 1EPUA 1ZRSA 2H2HA 2OFOA 4RL6A 1YYXA 2CDAA 1ORHA 4EEZA 1FC0A 1RKBA 4X85A 2BSQA 3ZQKA 5INTA 3Q3GE 3K31A 1W0KD 1GLGA 4U02A 4EG3A 1S8NA 3WJ1A 1M0EA 3NATA 4ABYA 2NV6A 2ZE5A 1JIXA 2XCLA 4HZIA 1TYDE 5AXCA 5GP1A 4BGVA 4C5CA 3HKKA 4W6QA 3OZSA 5C5DA 2IELA 2BHRA 5L3ZA 1OFHA 4AZ3B 1QGDA 1YBFA 2ZXUA 5FOSA 2CUZA 1NYQA 3ZWBA 1Q3KA 1YVDA 2IZ6A 3D8HA 4C1NA 1EP9A 2FR0A 1VPTA 2OCGA 5BV8A 1MQAA 4AJ4A 3WMWA 2X9NA 2JGRA 2W43A 2D5AA 4BYGA 4CG1A 2WB7A 3TW0A 4BO7A 1NPDA 2XDWA 3L7KA 1UZMA 4M9ZA 1ZVKA 2J46A 2PGIA 5A0FA 3HZOA 4J7UA 3VKUA 1YXMA 1GZSA 3VSEA 4YXFA 4C21A 4JXZA 3C48A 7ADHA 3K9FC 3RVZA 4CN8A 3W3AH 4C0QC 5IM5A 3UB3A 3OOHA 1NDUA 1B7GO 3WLNA 4KPFC 4IIFA 2XW6A 1TCBA 3MLBA 2WK1A 1O95D 1FFDA 3VJLA 1EIZA 1U8TA 1PWZA 1JJBA 1JI0A 2I0FA 3WSWA 1I01A 2WVHA 3INYA 1VZ2A 1KL7A 2WPNA 2NUAB 5JQGF 5ED4A 5E4TA 4EUNA 5FLKA 1I14A 1X0XA 3IDZA 3RRNA 4UU1A 1RM0A 3VR5D 2IY7A 1V96A 5GJVC 3AB3A 3SGLA 3HPRA 2MSCB 1NQWA 4B3CA 1VE5A 1PRYA 1CR0A 4JLOA 5HCUA 2H7BA 2WJAA 3MCTA 1EJBA 3EK2A 4QYTA 2F3QA 1LPNA 5AVRA 3BZBA 3WGGA 4MLZA 4X7RA 1HE1A 4ID9A 4G4SO 2R60A 2V7WA 5ESDA 4GF5A 1R9NA 1C1XB 4FT4A 5AOBA 2JJMA 3BEDA 3F3KA 1AHNA 3I5AA 4FE7A 4NULA 3N87A 4KWTA 4FR5A 1E5XA 5FT9A 5BWOA 2ZPAA 4LGCA 3KC2A 3GRFA 2DRIA 2KK1A 1XNRB 4MRAA 5DNYB 1W1WA 4MVUA 4DREA 1E3WA 1WDWB 1XVUA 5C7LO 2QYSA 1P2GA 5DM60 3DDOA 4P83A 3HBAA 1D4ZA 4RVCA 2H4FA 3S2SA 4JR1A 4MKHA 4Y1GA 2DPGA 3TRJA 2J3HA 4WJKB 4CMBA 1JFSA 4ROTA 1BOOA 3I5PA 3NC4A 3X43A 4Q66C 3BFKA 5FPKA 2W2KA 2W11A 1ISMA 4IB4A 3X1KA 1CRQA 3ACDA 1ESCA 4MV8A 1KDPA 3D81A 3C3AA 2YNMC 3P20A 2C94A 3A26A 1QFXA 3SPXA 1G19A 2PA3A 3GVCA 5JQGA 2W5UA 1XRSB 4DR2B 4WW0A 1SC9A 1PJAA 4FKBA 2ADFA 3A4YA 2A33A 2VATA 3B71A 3SSAA 3C1TA 1C30A 5DLEA 3S2EA 2CSXA 1OLOA 1CUVA 1DQNA 4DXHA 2MU1A 2IPMA 1CVIA 3K1AB 3HPQA 2KC3A 3OY7A 1CDDA 3QVWA 4W8HA 3BSYA 1YS1X 5AVUA 3L8GA 4D82A 3AL0C 1UJ4A 1T0IA 4X84A 4RZ2A 3I5YA 4XIGS 1M10A 2G9UA 5I8ZA 3RSOA 1KTVA 1NW4A 3QZCA 5JXHA 5A7HA 1UT8A 1XJWA 2CXNA 5BN4B 5C5CA 3A9SA 4M8NE 1GNTA 5HFJA 1KDZA 2Q4FA 1LW7A 4ZALA 2XM4A 3FPKA 2QTVA 2H4JA 3MGBA 2PPVA 3PJEA 4ZQEA 3AM4A 3REFA 3Q3EA 3CV3A 3PKZA 4O2RA 1P1BA 1BX3A 1O7JA 4PGFA 1NJGA 3P94A 2P3OA 4YGYA 2HO4A 2QX9A 3BCRA 1SCUB 4FZJA 9ABPA 1VYKA 1UJ6A 4GKKB 1CIJA 4WKPA 3JD2A 1W85A 1Q0FA 1YKGA 2PYIA 3DD7A 1J22A 3REQA 1IVNA 2ASRA 3MTEA 3VYUB 3NORA 2R6HA 3KT6A 1WMFA 4HPJB 3F4BA 3KXDA 3ZE2B 2DB4A 4X44A 2Y2VA 4D41A 2OAGA 4RLHA 4GSKA 3AR6A 2R1VA 3I2YX 5EGSA 4CL8A 4WXPA 3K6SA 4RK4A 2HWKA 3M9WA 4WZZA 5JMWA 4RFSB 4LFBB 3ZHVA 3OQIA 2KBEA 4J9VA 1PR4A 5BSTA 3DKRA 1KDVA 2XNHA 3GNSA 2QQ0A 1M2HA 2OOSA 1E3IA 4UPVA 5J40A 2XM0A 1ZM9A 2ONCA 2I6GA 5LOVA 3BZUA 1ICEA 4XD7A 5K0CA 1QO7A 3LFUA 4GX5A 1O6CA 3V7NA 2R2AA 1MVNA 2C2KA 4X9XA 2OWDA 1J06A 1VL8A 2WMDA 2ZTVA 3OJLA 2PLAA 1C9DB 2HLDA 2HJVA 1NASA 4O7GA 5FXMA 2XVMA 3THSA 4ZDWA 4X62B 3N8IA 1M1YE 3GLTA 4U8HA 2XWSA 2RH9B 3SKVA 5JNVA 3F7TA 2PN1A 3AF6A 2A0FA 4GP9A 4OQDA 4RETA 2Y6UA 1Z29A 2I66A 2VCCA 4AQYB 4OEHA 2P2ZA 5EMLA 4FEGA 1LSUA 4RIEA 4JBLA 1AB6A 3O2JA 3IDSA 1YJAA 3KQKA 3AR5A 4HN4B 2H18A 3VDXA 2P4UA 1DG9A 1ADFA 3VV2A 3AEXA 4ARVA 3M79A 4N6HA 3ZS9A 4JU8A 2AS0A 4BMPB 3L4BA 4W9MC 4YQEA 1SUSA 4U3JA 4CM6A 1SVSA 2YC4C 4OIMA 4TL6A 2NPFA 1GZUA 2OSBA 3UK7A 1SBIA 2HA5A 3NFRA 4JP1A 2GJ4A 3RS9A 1JILA 2OGWA 4FC6A 4C7VA 1MQ9A 1IIBA 4UE2A 4DWJA 3CO0S 2W00A 1V5GA 4B7AA 4FN4A 1SN7A 2AJLI 1KRWA 3VDRA 2IIBA 4KO4S 3C97A 1JQKA 2Z3VA 3ZGNA 1KQPA 3KLBA 4Z1MA 1LF5A 4B4WA 9LDBA 1FNCA 5JS7A 1QV7A 4A1FA 3TFOA 4LI3X 3AVPA 3SF8A 4LQDA 3E70C 3HP7A 2FQWA 4BMCA 3JQFC 4B6GA 2W42A 4LE2A 1KR2A 2NU6B 3W6UA 3VR1A 3ZXXA 5JRJA 1A8UA 4WJLA 4H9GA 2A57A 4PZUA 1SC1A 2HJRA 2BHNA 5IT5A 3CZQA 4QYIB 2F59A 4C7MA 3MWKA 5HDQA 2QB5A 2GF0A 2QN7A 4N82A 1TIKA 4N65A 1N77A 1ZY2A 5F33A 3GFOA 1UADA 1H69A 4Q3EA 5JROA 5A7FA 4WY2A 3SK0A 3EEIA 4M89A 4BJ5C 2BM8A 3JX9A 2VDWB 1IE3A 2R47A 3UWSA 1IUKA 3LZ6A 3IQGX 3A7EA 3H6HA 5EG5A 4HEA6 1K04A 4LJ6A 3OKPA 3K0CC 1D1SA 1WHSA 3TE6A 4LG1A 3RHSA 3TLYA 1OCEA 4EHNA 1E4EB 2R751 4P5PA 4KC9A 5E9JA 4I3GA 1NQ5A 3DDWA 3C85A 4ZVOA 1Q77A 2XBMA 3RYCB 1AQUA 4GC5A 3LO8A 4M6WB 2XOEA 3L4JA 3PCXA 3T3DA 3MRTA 2WTNA 1RCUA 4NSNA 3M1AA 5FPHA 3TSYA 3C7JA 1MMNA 4UE3S 1IY2A 3H2YA 4ZCTA 3G0GA 1JMVA 3IPMO 3T7IA 1XWWA 3ILYA 4I9HA 5CFLA 2O8EB 3O7MA 4EAQA 3PYLA 4D96A 5FWDA 4LPKA 3DE7X 4HTFA 1HDGO 1IZYA 2Q50A 3DTNA 5JH7A 1DC3A 2FPSA 3LVBA 3G5TA 1U2SA 1K8ZB 4G67A 4LYDA 5ADWA 4NY3A 5F5XA 1VB5A 4HMOA 2BMEA 5JTTA 4KTVE 1D6MA 2V55B 4EWLA 1YA6A 1V9CA 3VI3B 4PJMA 2QAJA 1GL7A 2R00A 4EY5A 2VNSA 4FHFA 5AXAA 3QKRA 3T38A 3EN0A 2Q3BA 3H5VA 4NMXB 1FYXA 3EG9B 2DQSA 3WB1A 4RTPA 5I4CA 1G38A 1YZUA 1NI4A 2NUBA 5BSHA 2TMKA 3H1AA 3SHOA 2R97A 5JZMA 1F6DA 3A1NA 1ZCAA 2COKA 3RFUA 1Y89A 1VQ1A 2I2FA 4PFOA 1QIIA 4EHFA 3H4IA 4I81A 2FCAA 2WU8A 4KIUA 3DEZA 1M2EA 4KU4A 4KAAA 2YXEA 4GQBA 4ER0A 3AESB 4RCZA 4NARA 1QH9A 5LXTF 3RODA 2PRZA 3VR3A 1RXQA 4O33A 4J94A 5I7SA 1KI4A 3UUEA 1NVUQ 5JAZA 2D62A 4RAQA 2C03A 1ORWA 1SCIA 1Q0ZA 3NPAA 1RI1A 1NVGA 4UZFA 4B9AA 1L7NA 4MHSA 4HMPA 2LCQA 4XPIB 4YJFA 4YR9A 2ZT7A 4WOCA 3WRYC 3BMQA 3NW9A 1G21B 3NHMA 4M21A 2Y71A 2FGKA 3I52A 4CQNA 3ZZTA 4HQKA 5TF0A 1UOEA 2C9ZA 4MTOA 2IYUA 1T13A 3S9OA 2PDAA 3PXXA 2OMKA 3DXXA 2HV6A 1CR6A 1ZH2A 3ABQB 4XQEA 3IMGA 2J09A 2K7FA 1ID8A 4PZCA 2BKXA 5CXQA 4AWBA 2G82A 3HCOA 4NABA 4F2WA 5IJ9B 1OWOA 3OF2A 1N3LA 4I9GA 3ZWXA 1GFWA 2G0NA 3FI9A 4CV3A 2YINC 4MEAA 3MTJA 3WLOA 1NQXA 2QNBA 3H4VA 1OGJA 3VU9A 1T2CA 2B4KA 3KALA 1JDJA 3ETLA 1MO3A 2D5RB 2GEUA 3H1BA 4HR7A 2PQ0A 4OD4A 1V7CA 3MBKA 1LPAB 3ZTZA 3QU4A 2VJOA 4MVJD 5EXTA 3OWXA 1XI2A 2YC2C 1I2MA 4OFBA 4X8LA 3AUUA 3PGLA 1QPUA 4BNZA 1UM9A 1CJVC 4LN1A 2HJGA 3RRJA 1Q2UA 3ZZ1A 2R7KA 1GU1A 2A9JA 3AT1A 4BGEA 2WLSA 3D7MA 4XVCA 2NSGA 1KQFA 2W6ID 2FWBA 2H8KA 3CZ6A 5LZ5A 1CUZA 1WV0A 2EZTA 2XZDA 4D25A 2A78A 3JATB 1P7CA 2J6HA 2L6HA 2Q7OE 5DIFA 1XXHE 3N7UA 3FSRA 3NYMA 1FLAA 1E7RA 1TFUA 1NFOA 4G78A 4IV5A 2H3EA 3KKMA 1U90A 5ITZA 2DFLA 1ULAA 4UBIA 1HRDA 1R5OA 2C5LA 3LWBA 3ZJTA 1UMCB 1JL3A 2IWHA 1ODTC 5MDHA 2OHVA 2GMWA 2BUCA 3EZHA 1G59A 5TX7A 3LHKA 3M4CA 5BRNA 1M6HA 3LRTA 4P36A 1T29A 2FFAA 3QX7A 1BDHA 1LBTA 3KD2A 1T3GA 2C3YA 4FE4A 2VUTA 4MQUA 1ZL2A 1UBTS 2PV0A 1X7GA 3WIDA 3ABIA 3RB8A 4OGFA 5A3RA 3OCVA 1XP8A 3CF4A 1WNTA 1ANKA 1H2HA 3OZUA 1LPBB 3GA0A 1RU3A 2QIPA 1C7EA 1SVLA 3KQMA 3OWTA 2O2HA 3A6LA 4PR9A 7GPBA 1E60A 2WYUA 4LWPA 4FGWA 1ZD2P 3HKCB 4MR7A 1VDMA 2J4DA 5B53A 5AKIA 3IXQA 2EL9A 4R8MA 1IUOA 1CPQA 4PFPA 1YDGA 2WHPB 4D6PA 4BKRA 4DVYP 3UGPA 1YNOA 5EHIA 2IPOA 1AQJA 1M6TA 3TM5A 1HE8B 4PLYA 5D2CA 2X9GA 3LYAA 5JVEA 4EHBA 1ORJA 2OWEA 1PG2A 1E0SA 1M2NA 1GQOA 3NBFA 1FDUA 5TSDA 1P74A 1TMGE 4DWVA 5J2TB 3AEKA 1NW5A 3CEXA 3MMPA 1USVA 2F90A 4ZMSA 2V4MA 4NBWA 1BFDA 1Y1SA 3W3AD 1BGXT 4ZREA 1JKJA 4XGRA 4YWHA 1KS9A 2V7UA 4NU0A 1KC3A 3ZWMA 1ABEA 2O3UA 3VXKA 4AYTA 4N6CA 2ZUFA 4BO5A 4FHGA 1ISRA 3V8NA 1GCUA 3WA6A 4CM4A 2BUBA 3HXKA 4NFYA 1X87A 3N9IA 1XYGA 3S28A 1N9GB 2WG1A 4YT8A 3T06B 1TCAA 5J5CA 2ETXA 3R4CA 5DHQA 3FMPB 2C29D 4KG7A 2ZWMA 1U1DA 2YLGA 2IZ0A 2Z5GA 5AVSA 4UZSA 1UEIA 1C8BA 4PSAA 2FF7A 4JUAA 4CM7A 3V4LA 4RS3A 5EJ5A 3D59A 3K4HA 1I10A 5GTDA 2VPIA 1TI7A 3QY0A 4COOA 1HT0A 1ZMTA 1BQ4A 3NTOA 2VN8A 4D0GA 1ML3A 2Q49A 5CGQB 1FXSA 1NTRA 4EY7A 3W5HA 1VGQA 4DV2B 3CTMA 5KSPA 4YA6A 2EQAA 1PJQA 3ZBQA 3NKFA 3FB4A 1UANA 3ICVA 4E0IA 1BQEA 3LC0A 2QAGB 2JHCA 4UBLA 3ETNA 3QPWA 2CHQA 2VJAA 4DUYB 2QVZX 4D3FA 1IZ8A 3MIZA 3FNIA 1EGAA 4JY7A 5DK4A 5F51A 3EISA 1M0WA 1MC1A 4QC2A 4LZOA 2HSQA 1D0VA 4EGAA 2C0PA 3CSSA 1RBMA 3T9BA 4U2BA 1PNTA 4EYKA 1XL0A 2B1RA 3ZCRA 3HY3A 1CUXA 3U4HA 3PR2B 2P9JA 1QYDA 4LC1A 1FQOA 4LVUA 3PYXA 2IU0A 3WTCA 4K6HA 3AIIA 3RIPA 5E4JA 3CZAA 4MW0A 3R44A 2P3SA 4Q00A 2VWGA 1U1EA 1SF8A 1ACMA 3GJ0A 4PU0A 2WBLC 3ECCA 1FDVA 4LSWA 2D59A 2GXQA 1ONSA 4QYXA 3D6MA 5B58C 3IT0A 4F86A 3T61A 2LFDA 3IS3A 1EX1A 5JDCC 5K20A 2HMSA 1S2IA 3IOEA 1CRPA 1POXA 3HA2A 4HLCA 1EFRA 3S5UA 1NT2A 1Q7GA 2P9GA 1NVDA 4XVRA 4I5FA 4LFCB 3OCZA 4HBGA 1YTUA 4XB1A 2QY9A 3GRYA 2VTDA 5IT9A 2P0EA 3GCGA 5PGMA 4GM0A 5K2MA 5AW7A 4HWTA 4ZAFA 1CXZA 5KJEA 3WGKA 4JP3A 4ZYYA 4C7OB 4WFQA 4KW7A 4D8WA 2JIZD 1W9MA 1JEYB 4EI8A 1ULTA 1RABA 2RC6A 1V2HE 3FZQA 1ZESA 1EWRA 2AVDA 4KC0A 1N5OX 3E53A 3FUTA 2PJDA 4OHRA 1BROA 1E79D 3GGGA 1H42A 4D99A 4GMHA 4IP0A 4BQSA 2D06A 4YC7A 2A58A 5EXEA 1DJPA 4KAXA 4IGIA 2FHPA 2OEVA 3QE2A 3GWNA 5CBKA 2GBPA 2ZXFA 2PCJA 3BQ9A 1XRJA 1PG5A 5C1OA 4U9DA 2W2XA 4GPZA 4IX1A 1PT6A 4CX9A 4KVGA 2R7VA 2PS3A 5FFMA 1OFGA 1S7ZA 4OHPA 2FSIA 3V1TC 4URFA 4LE1A 1R6DA 2Q5QA 4IHKA 1AN0A 5LD2C 1RWVA 2WEKA 1XLTA 4M1YA 3AXSA 4M1WA 3ZDZB 4JKYA 5BURA 4HH3C 3DLCA 3GORA 1ZQ1A 4OQFA 4CBVA 4ZCPA 2D3TA 3RS2A 1Y1PA 4C20A 5HOEA 3GT4A 2HM7A 1A7KA 1DHRA 3AHFA 3EOZA 3DM9B 3I2HA 3GGDA 3BIXA 5C18A 4AD8A 2HJ9A 3UMVA 5JBNA 3O8DA 2EKPA 3PYMA 1XTQA 1Q7BA 1P9LA 2FE1A 3GD5A 4AJ2A 2QTWB 3BIJA 4AICA 2GBLC 1IXKA 2OBBA 3PA6A 4B3MB 1V54C 1HQCA 3JCUQ 2QLTA 3B7WA 1V3QE 1JSRA 3DLBA 4Q9NA 5DVZA 5J2UF 1U3TA 2LQGA 1Y81A 3R0QA 2VHVA 1EVIA 2QRNA 3COWA 1SUAA 4GZ5A 4QHYA 4DUZB 5K8TA 2OBXA 5F23A 3QTHA 3HFGA 3EZNA 2QE9A 1SGWA 1ZVQA 3KSZO 2GCEA 2V8OA 1HTWA 1KO8A 3PRHA 4PNEA 1HYHA 3EFOB 3U6BA 1Y9JA 1KAEA 5BN1A 1OW6A 1U99A 2ZSEA 3AR9A 1GVNB 1Y1RA 4ZARA 3FCEA 3CSUA 2VDOB 3LBIA 2VTBB 4ILKA 2XZTA 4JDPA 3IP3A 5DT9A 5G4KB 2YNMD 4GG1A 1NVMB 4D8XA 2YWXA 4HN9A 4MQEA 3USCS 3CZMA 5ULLA 1X19A 1BIFA 1R74A 2QJOA 4DMGA 3OIVA 2PMEA 3TLZA 1E1DA 3C8GB 4X1IB 2RMKA 1WF3A 2B98A 5JCJA 3M6FA 2Y1EA 4RF5A 3M8KA 4IG4A 4ZAYA 3LLMA 3B6ZA 1YB1A 3MGCA 4UUMA 2HNBA 4J2TA 3W7BA 4UXJA 1NOKA 3NIWA 2R5NA 1NQVA 3UMIA 2ISQA 1UWLA 1V11B 4A8JA 1WMBA 3ENKA 4DJAA 3UCEA 1KKLA 4IGFA 1W36B 3KSUA 4L6AA 4QU5A 2WYWA 1FPQA 2PCLA 3RNOA 2FSPA 4IIGA 4RVHA 2YJTD 1C8VB 4B33A 2ERCA 1VTMP 4YHBA 5H80A 1TYCA 1AN9A 1YA8A 1ZH4A 1Q57A 1ZN7A 5J2UA 3O6XA 3RRZA 5DEOA 2F43A 2LR0A 3HBJA 4ZVSA 3BZWA 5EESA 1ZM3A 3B70A 5CBPA 3GH3A 5FBVB 4UM9D 4TXNA 5JFTA 4KUEA 5CIQA 1DBRA 4UCXA 1A2OA 2FUG1 3CWZA 5IKMA 3NYQA 2UXDB 5DXJA 3SKYA 5LDGA 1T9BA 4NU8X 3KYDB 4LKOA 3SBOA 4XAQA 4ZI7F 3LL7A 2UUOA 1XBTA 1KZ7B 1TYEB 1DIGA 4K88A 4AKTA 4Q7LA 3HUEA 1H94A 2AVNA 5H02A 1F5SA 1NKTA 3FMIA 5TF4A 1Z33A 4EF4A 2RH5A 1CY7A 3JQQA 1SD5A 4H7PA 5FWYA 1Q17A 3FYCA 5HGJA 1C0LA 2EJTA 4RGYA 1JTEA 3GY0A 2ESRA 4TT3A 1CPRA 2JIRA 4IKOA 2BSAA 3BTUA 1NUTA 4HUJA 1IB6A 2X5JO 5E95A 2PBEA 2JKVA 2Y9PB 1JIKA 1PL6A 5FI3A 1GA6A 3VZRA 4OXKA 1VLTA 3TLBA 2H48A 2YN0A 1QUFA 4GH5A 1EGMB 1LLDA 2GDCA 2YBEA 1EG7A 1QE3A 1JKXA 3BH6A 2JGAA 4Q9KA 4NBSA 2EWMA 3SNKA 3NVAA 2IEDA 4ARSA 2WYVA 3PTLA 4CEJB 2XLMA 5JRZA 4X45A 1DJOA 2OCDA 5E3HA 1ZW3A 3VDQA 4PNHA 1DAMA 4AX2A 2KS6A 1WBJB 2X2EA 1G66A 5E3CA 1G7TA 2XA2A 2IUSA 2XMGA 1YBHA 3U4QB 1O0BA 1BO6A 4G5HA 4ZVNA 3GJRA 4ZAXA 2B78A 3O92A 3HP1A 4DWWA 2HBYA 3QWFA 3NIDB 2R0QC 3OUTA 2CFCA 4CKCB 4EYGA 4J03A 4JT2A 3NOOA 4BN0A 3VYRB 3MYIA 3TSZA 4LQCA 4OM7A 5CTJA 2EEPA 1Q7RA 3JY6A 4BLQA 3AWIA 3OFKA 3IURA 1ZBDA 2FXIA 1TVEA 2IE8A 1Y4ZA 3CYFA 3BS4A 1ZXLA 4K9SA 3PQ4A 4OUDB 4ZXPA 3MCWA 4H1WA 4ZI7A 3S8MA 3UGOA 3NC0C 3CEAA 3DDNA 3NRCA 4JOCA 1EGVB 3TE7A 4A91A 4I0WB 5D8DA 1T9GR 1GQQA 3RSLA 3FPFA 1IZZA 3LQ1A 1EGQA 3RKRA 1L3BA 1UMDA 4PZEA 2CMFA 4R41A 4AMYA 5DVWA 3G0BA 2GZSA 5IRCD 3UJ3X 4I7EA 2QXUA 4FB4A 3MLEA 4LY6A 4XH9B 3T5MA 2Y0EA 3C4QA 3IC5A 2Q4BA 3NR2A 4RKQA 2VH2A 1H9TA 3C7AA 1VZ3A 3ZHOA 1E63A 1G6KA 1FSPA 3C3MA 4JI6B 1XZDA 3GR6A 5D3MB 4MTGA 3DC7A 3UO8B 3UOWA 3AFOA 1X39A 4EJSB 2NTVA 3LCRA 5LN1A 4BZXA 4EPTA 4CKYA 3AVVA 3U09A 2E4UA 3NT4A 2P35A 3V7OA 4DLTA 2R96A 1ODLA 3BQNB 4OV6B 2KW3C 4QGAA 4PNPA 1MIOB 2O2DA 3T0FA 4WK0B 4GWKA 2PGXA 4DVJA 1FBNA 3E81A 4RKFA 4HATA 3RK0A 3FVQA 4C0SA 3VPFA 5KNBH 3KJNA 4MROA 3OMXA 3GVPA 4DQUA 3UUFA 5CLJA 1M8FA 1JG3A 3ZDQA 4KFRA 1BCSA 4DC1A 2VHZA 4U1RA 4E2XA 3NOXA 4ZU1X 1EFKA 2XECA 1IYZA 1N7JA 5CJJA 3OX2A 4C1BA 1NLYA 3WKDA 2XA1A 1W96A 3OIFA 1X8LA 3TD9A 1W4CA 1WV1A 2PWBA 3DZBA 2B94A 3S2GA 1A9PA 1X7ZA 4RZUA 3OMWA 1SG9A 2GA0A 4X71A 2V7XA 4CGYA 4K6GA 2DBZA 3KZKA 1RFLA 2HWWA 3PGMA 2VK4A 3TO5A 4GMXA 5BVGA 3UWDA 3EXHA 4B1FA 4RDXA 5JDIC 1CHNA 2G5CA 4X6UA 4KLRA 2X4GA 4KMOA 5CHYA 1NBOA 5KYVA 2AKYA 2BBTA 5A05A 3QPBA 3NZEA 2ZQZA 2C5GA 2G4CA 4LSGA 3W05A 1U81A 3QXGA 1XZKA 3L0OA 1OAOC 3QU5A 4GR9A 1MBZA 3QUSA 4Q4HB 4A5SA 1IXZA 1EDBA 3S29A 3L02A 2G9QA 4YIKA 3PTAA 5ARDA 5DDIP 1RHKA 1V45E 3MRVA 4U7HA 4E2FA 5A6JA 1BX0A 1CUBA 1R6BX 3M1YA 2C97A 2JD1A 1EWQA 4BFUA 3TRIA 1FJGB 2C8KA 3HYTA 2WUEA 4AK9A 2PR2A 2BI7A 3QIAA 5F21A 1DKNA 3CX3A 4ZYVA 1WNFA 2NUTB 2BVNA 3PJRA 1BGWA 4U0JA 4LTDA 4HJXA 4WXMA 4RZSA 4Y0NA 4X7PA 4ZDIA 4YJGA 4JI2B 2I7CA 4BN4A 3H5TA 2SBTA 2JH8A 1RBZA 3DP9A 4MVXA 5JP7A 1LPMA 4LRUA 2DFTA 1LDBA 2YV5A 3AQ4A 2ZK7A 4Q4ZF 2VP2A 4HKTA 4RA6B 2C2BA 3EBOA 3HFJA 1TRKA 1B16A 5E1MA 1YZNA 3H05A 3PK0A 3WVNA 4OXYA 5P21A 3QKSB 3KDAA 3MTQA 1EQ1A 2CJYA 1DKUA 2SICE 3R8FA 4MW6A 3EPJA 5REQB 1OAAA 2NXNA 1E66A 1F14A 1T1IA 2FOXA 3UHPA 4UTVA 4IDPA 4OSOA 1OH8A 3UTDA 1FNDA 4PBRA 4E5UA 1F1BA 4Q05A 3U8VA 3CVXA 5IUNC 1GCGA 3S2FA 1X6VA 3EJWA 3VOSA 1N5DA 1O5TA 1YE5A 1G8PA 3ESYA 3QLEA 3E4DA 4OFWA 1HC7A 2ZS7A 3ZOKA 4O4JB 1Y8RB 3EZXA 1MJNA 3WDMA 2CFRA 2VPTA 3D0QA 5CYGA 2CYCA 1VHWA 4EMUA 1SK9A 3H1PA 5SY4A 4QXOA 1YL6A 4P32A 2PHZA 2XB8A 1MAUA 3QFFA 4JIOA 2C42A 3ZQJA 2C7VA 2X3YA 1SELA 4JDUA 3ZQ6A 1GPNA 5JSYA 4G86A 1Z7BA 4GBGA 4LBYA 3HEAA 3I3OA 4XLNF 3TUIC 1EM6A 1KEEB 5EHQA 3DMHA 5C4GB 1VJ5A 3RCBA 2AHRA 3BBLA 3QPCA 1H9GA 2AF4C 2EZUA 2AE2A 4CODB 5KVCA 2FDRA 1MRSA 3T5BA 4HDNB 4EA6A 4LLCA 2OESA 2OM6A 1LRKA 3GLHE 4FFNA 2FFRA 1P19A 2O52A 3QW2A 1Y9DA 4ZQGA 4EEXA 3BOSA 2AZMA 1ZGJA 1XQYA 4DIOA 3ESCA 4BUZA 4KJZA 1Y4CA 3TOMA 4LC9A 1H6GA 5K45A 1Z6TA 2WZDA 1OT3A 3D4IA 3OFND 4TVBA 3PRJA 1GY8A 4W8KA 4NVRA 4E13A 3MQ4A 1C3VA 1PN3A 4FS8A 1O9HA 2QLJA 2CFTA 2Q9BA 3O1HB 3B3JA 2P2SA 3H18A 2RI1A 2BFDA 1KY3A 1HDXA 1L8LA 1RKXA 1JE0A 3TIGA 2O8BA 3F6EX 3EDMA 3L0IA 1TAQA 2X1HA 5CDSA 4AROA 3L1KA 4PG4A 3ZJUA 1RAFA 1HORA 4OJQA 3ABSB 2H7CA 3BA1A 1FLDA 5SYAA 4ZOEA 2OCBA 3LGSA 5IVDA 2DM6A 4L5IA 1BEUB 4Q4AB 4JYZA 3E18A 2OR3A 4O63O 1CIVA 3PD7A 3M89A 4WGGA 1DJLA 4IDOA 2OLJA 3HLZA 3POVA 2LVBA 3RRYA 1N6KA 3I9KA 2BKUA 3UT5B 1QYIA 4CLDA 1SU7A 2YQZA 5F7JA 2XQFA 2XQJA 4YH1A 4H6VA 1I9GA 4PX9A 3O4JA 5AJZA 1Q0GA 1NU8A 3PC8C 1D9ZA 5FCDA 2ATEA 2QLNA 2XMQA 1DMSA 3RUHA 3ANYB 7REQB 5J3JA 3LFTA 1E2UA 3UGJA 5AM5A 3TKLA 2HR1A 1N1GA 1XYYA 4LRQA 1MB9A 2K7ZA 4OQZA 1NZJA 2OHGA 1TQ8A 3KJXA 4MI6A 2K2QB 4EHJA 2BYTA 2P4SA 3OURA 1TZBA 4IRXA 2CHVA 1ZVJA 3QVLA 1XRMA 5I7EA 1L4GA 3AR8A 3LHSA 1GRQA 3WBFA 3O9VA 4TSFA 4G0ZA 3CUYA 2D4UA 1TCUA 3NM5A 3VM6A 1NOIA 4IRUA 2Q6TA 1AGYA 3KOWA 4KIFA 1NN0A 2ZE7A 3OOSA 4A4DA 2E4ZA 2X15A 1WKVA 2YL7A 2VAMA 3NH9A 4BIMA 1FNMA 1GPAA 1MUUA 2XEXA 3ZX5A 2EW2A 3DV9A 1UKYA 4YACA 3VMFA 1DEKA 2GFQA 5B58T 4PANA 1A72A 4LDAA 2BMAA 3FPLA 3MWEA 4F4JA 4HAUA 3TTVA 3S68A 4E4YA 1J70A 2B36A 3L0BA 2AFIA 3P52A 1QLHA 3CH5A 5LBIA 2WJGA 1S9HA 3TNLA 1Z63A 2FK7A 5EXSA 3VSBA 3V1YA 1RJGA 4M0EA 4DLNA 3TW8B 1BXGA 3EE6A 5KUTA 5F9HA 2FUNB 3ROTA 1ZSVA 5BSEA 1D2NA 5JSZA 5DM0A 1V0JA 3O2QB 1U1FA 3SXZA 4ZO4A 3SJAA 1JI3A 4DSAA 2NU8A 1QUEA 4IQGA 1VMKA 5KTTA 4XB6B 4CEHA 4OD0A 5A5DA 3QOYA 3RU3A 5IFLA 2JFFA 2W58A 3JZDA 5DBIA 5DM2A 2X6TA 3A1WA 1J8DA 4S0XA 3ZVLA 2YMQA 4IKPA 3A1TA 1XQXA 1VYUA 3UEOA 3IKTA 1H2RS 3SQMA 4B5LA 4AM8A 1I1HA 4FYJA 4F04A 1G8MA 2QLLA 1L5ZA 2IOHA 4QSHA 1LBIA 4NPAA 5LMZA 5LKRA 4HFFB 2G63A 3U61B 4PHGA 3ZW8A 2OKUA 3TXYA 3DGFC 5BNWA 4RSHA 5G0TA 2ZDGA 1E0KA 1X42A 1XZBA 4G8JA 1JX6A 4OXXA 2GBGA 2O0LA 1MH1A 2X0FA 2BGNA 5BVHA 3SVZA 4NYIR 1Q84A 3E2MA 4FGUA 2XKBA 5JPDA 1KU2A 5HW0A 5ECYA 3BKWA 1FDWA 4RSMA 3OJ0A 4GEGA 3P2EA 4QNMA 3E1GA 1Y7HA 2Q5FA 1JR2A 4P3NA 3SE7A 2QENA 4ZVRA 2BF7A 2VZEA 3T6BA 3WZMA 1JHXA 3P5BA 1RHQA 4G1BA 1V8BA 3GFBA 3V4OA 3LCCA 1PTKA 4G2NA 4ALLA 1EDZA 3GMTA 1TOAA 1AUPA 2VPPA 3OPYI 3UWOA 3U7EB 4RBNA 3FHOA 4MKRA 3NWJA 3KCNA 2QMHA 2DSNA 2J0XA 4ZK2A 1J20A 4PWZA 3CUVA 4DMFA 3M9XA 2QRPA 3DOHA 4UBKA 1JQ5A 2CF5A 5LZ7A 4YAGA 2R7SA 5JS1A 2J87A 1CQPA 1RRKA 1T8YA 3LP5A 1KJNA 2ZRAA 3W4KA 4CWAA 1TQHA 2ADOA 4E7PA 4EZIA 4EYOA 5D87A 4HS4A 1RRCA 4BRZA 5T8KC 3NCTA 3X1OA 4NOMA 2OECA 3L7DA 4CTMA 5F78A 1DWUA 4CSAA 2XX3A 4LYEA 2X0KA 3LFHA 4CDMA 4PF1A 3OIDA 1DGQA 4NG4A 4UHBA 1U2DC 3PQ8A 1D03A 2X4LA 4WSOA 1DTSA 1T4MA 2BGRA 1G5QA 5IAOA 4DTCA 2QX7A 1PU2A 4IDBA 3ZQVA 3FOWA 1QIDA 2AL7A 1V1RB 3IDAA 4NJEA 5I7UA 4G4JA 4G6ZA 2PX3A 2O3TA 5LQCA 4M36A 5AK6A 3GQBA 3EODA 4S0ZA 3HJGA 3DHVA 2WWHA 4FOLA 1TKCA 1JIVA 1J5EB 2Z83A 5DBFA 2O1EA 1GIAA 1SBNE 1Z5ZA 3MJTA 4B7ZA 1KK0A 4E6PA 3E3NA 3NV7A 2PLWA 1XDUA 1VCMA 4N5LA 1E5VA 1PQUA 4EJFA 1GTL1 2P4EA 1LFAA 1RXVA 2CYAA 3PFKA 4OX9B 2IHKA 4XKJA 2GH1A 4Q16A 3T1NA 2FWRA 3VKWA 2AG5A 3WICA 1NPYA 3F49S 1CJUC 3QP9A 1TF5A 1R8JA 2UV8A 3LY7A 2W0SA 1CB0A 1P91A 1OFTA 4W1SA 1ZM2A 3BSSA 1U7UA 1I3LA 3D4NA 4XCXA 4PLPA 4B0PA 3EUEA 4OYYA 4WZBB 4YRDA 1QSPA 5HZMA 3VNVA 1KVTA 2RKBA 3GPDG 3VX3A 3H2JA 4J29A 4X1KB 4NBLA 2JH9A 2B7LA 3N39C 2B4YA 3EASA 2AYZA 2IF2A 4QM6A 2CD9A 3KEMA 5HFNA 4C6RA 3HFRA 1WZIA 4MQ4A 2VHWA 2F1HA 1QP0A 3E9VA 3CG4A 3U3OA 4DANA 5K8UA 1Z5GA 1WBDA 2P9ZA 4CLOA 2BR4A 1SZCA 1TTTA 1QGOA 3VZSA 3D5EA 1DBPA 1JG4A 5C80A 3PPXA 3EY9A 4EOGA 4ZT2A 5GWXA 2ACWA 4R7ZA 1OCOC 2UVQA 3IIIA 2KSQA 1EP1B 3K0BA 3A6JA 2HA4A 5IAGA 4BNDB 4KO8A 2WMNB 1P9OA 4KOAA 1Q6YA 3HXLA 1XV5A 3PNMA 4ZI3A 1JE1A 4DILA 3Q6IA 3W6OA 2I4IA 5BSWA 1F4LA 3T94A 3PWTA 5J1TB 2W2QA 3NWPA 2QSUA 5JNRA 1GPWB 1T5IA 4PCUA 3KQTA 3UENA 1TEZA 2Q9AA 3NOQA 3UJBA 1F51E 4IIJF 3NMIA 1P61B 2ZKLA 3VKGA 3O31A 3Q3IA 2QVCA 2P6NA 1SA0A 5K3DA 4YT5A 5DQTA 3AFIA 1IG3A 4PSKA 1GUDA 1LDGA 2BGWA 3UFXA 3ZXUB 3LQ2A 3VO9A 5KNLA 4CDRA 4FAPB 2PGLA 1VKNA 3GB9A 1H8EA 4DOZA 2QMQA 2Q29A 1ZONA 3V3KA 4S1TA 1RWNA 2XKAA 3RJZA 1U4SA 1UKZA 5EIBC 1HLPA 4JWTA 1OHHA 3DOFA 3T3IA 4LZPA 1OASA 3I42A 2FX2A 4L22A 4Q4JB 4ALJA 4ND3A 4ALMA 1NM5C 4BG0A 3RVQA 2WIGA 4V0ME 2WD7A 4RMGA 1YCHA 2JIBA 4YRIA 1VCOA 1FUEA 1V43A 4L6CA 5KNBD 1W5SA 5A6SA 3QENA 3KUCA 1TMKA 2HTFA 5CT5A 4V03A 2O7NA 1LEHA 2JJ2D 1RQLA 2COEA 2HMUA 5LVAA 1C0KA 3VRCA 5H8WA 2DMRA 1P6QA 2IP2A 2YYSA 1ESMA 5KOJA 3JALA 5DGTA 2Y3IA 3ZC4A 4MS2A 1PF7E 4K9NA 3RVOA 1XZLA 3SQXA 2HIHA 3Q7RA 1RXCA 3TG8A 2KHZA 2PMCA 2WJJA 2IWRA 4AJ1A 5AUNB 1EXWA 1FS4A 4HDOB 2POCA 1YZKA 1NYLA 5IZCA 3L4EA 1U94A 3WAGA 2UZAA 3HB1A 3CXRA 1P8AA 3BJMA 3LLVA 5BW6B 2ZQYA 4CIHA 5HOQA 2MT9A 1JEQB 1NA5A 2X42A 1JDPA 4X95A 3EULA 3UC5A 1XWJA 3AJDA 1W0JD 5K4AA 4RK0A 4G25A 3RIMA 1FP1D 4YK7A 2QM8A 2Q8NA 1KBZA 2PZGA 3M6XA 4K0DA 1F9EA 3DJNB 1RADA 3C4JA 1XQ9A 3OEEA 2FP4B 2Z6QA 1U7PA 1WABA 1TYZA 2G4VA 2ZRKA 3GFVA 5AM1A 1ZNWA 3VU8A 1SU4A 4JK3A 4HNAB 3G2KA 3ZWIA 2J41A 2HXYA 3A4IA 3OZTA 3ASNC 1UXOA 4COKA 4DSUA 3AHIA 1ZCBA 3OP1A 3CSDA 4DCGA 4BQIA 2OCCC 3ABKC 2HQBA 4IDQA 3VH4A 3H97A 1YA4A 2YIJA 3GBVA 1T1EA 4Q1BA 4PR3A 2J9BA 5T41A 2I87A 2W8BA 3ZDDA 3BRJA 2FW7A 4E30A 4D42A 5FFFA 3RQSA 3W7VA 3A1VA 3M6AA 1ATIA 5D7NA 1D1AA 4CR6A 3T0GA 1A7AA 5HWSA 1OD6A 5CFQA 1W5BA 4UTOA 4C7BA 1XZFA 3AEUA 5LU8A 1E7SA 2H1CA 2YWRA 3L8MA 4F5YA 4JBNA 3N75A 721PA 1B1AA 4KPEC 1N2CB 4NE7A 2NZ8A 3B1KA 5IJ0A 3CSKA 3V42A 2EJBA 4DJEC 5JY6A 1Y42X 2Q0XA 3ITKA 1NUAA 4NCJA 3LLSA 4J3JA 4MH0R 1ODCA 4WCFB 1JQLB 5IXJA 3VKVA 4GU5A 2EW8A 3UHAA 2Y4OA 5F2OA 3COPA 2WT9A 4NIMA 5EPUA 1X9GA 3K6JA 1P6UA 3IQWA 2JF0A 3K0HA 2ZSUA 4B74A 1T4BA 4QNNA 1J33A 3RC9A 4PW0A 4TVKA 3QOFA 4JVSB 1CB7A 4R3WA 3D64A 4C0BA 3SC2B 3HUUA 2P0NA 5IS2A 1BEEA 3GJ4A 3A6ZA 2G8LA 4IMJB 2WHEA 5LXTA 4G0PA 2XGJA 3LI2A 4II3A 2CT8A 1JDSA 2GKSA 1K6MA 2IV3A 3R9WA 3I4CA 3FWYA 4RGBA 4WI1A 3U49A 3E8SA 5K3OA 1UFBA 5K6AA 4LV6A 3ZS8A 4BV3A 1G4UR 3T4PA 3FSEA 2GLTA 1FW8A 4JCOA 3NYIA 1NZFA 2EBUA 3T3HA 3WO0A 4FJ0A 1DEHA 1DQYA 1TM3E 4MICA 1VMAA 3OQHA 4J4HA 2XUOA 4YQYA 1IRXA 4YAKA 4PBSA 2YVLA 2MCFA 2QM7A 4BKOA 4PICA 4R3NA 5DZSA 4YASA 4A8PA 2JKZA 1TF2A 3KKOA 3EAFA 1ADJA 5IDVA 3WLRA 3NTUA 4QPZA 5B4TA 4LZNA 5I9IA 1UF9A 2HSDA 4BZQA 5SZIA 3C3YA 2GSDA 4I2VA 1XRQA 2NO4A 3O3MB 4H7HA 4AS1A 1HKHA 1LWNA 3PXCX 5BWMA 2OORC 2VJPA 2H4XA 3D2BA 4L4XA 2IL1A 2FPOA 5COFA 1VBFA 1IMOA 1XCLA 1YAJA 3VNAA 1P0MA 4BTLA 3NTRA 1DBVO 1NLFA 4EYSA 2VP5A 3G4ZA 3HDGA 3TB4A 5ER9A 2V6BA 3SM3A 2AUMA 1JAZA 3JWEA 1P60A 1O96A 3I9NA 3AR7A 2ODPA 4UBNA 3VFDA 3SZMA 3AB8A 3RU7A 2KYHA 4CFSA 1DQSA 3W0LB 4D9NA 3HB0A 1O5IA 2QN1A 1YHNA 2AW5A 4KHZA 5DTMA 3CT6A 1MP0A 2O4UX 3O5AA 4M0FA 1SWVA 2WFLB 3RSZA 4WKGA 1T5TA 4BWVA 2FPIB 2ZUTA 4YP7A 5BWCA 4PAMA 2B8JA 2ZJZA 3CLRC 3G79A 4ZICA 2HLHA 1XMIA 1XRLA 4HDAA 1GUAA 3V4SA 3OZVA 4YAOA 3AKEA 3CRVA 5BUSA 1HMPA 3KVYA 2V59A 5L4SA 2HRCA 1DI0A 4LACB 2Y1DA 1MXFA 3A4MA 2C5FA 5ERYA 1E2MA 3G7NA 1Y4SA 1UZAA 2IGBA 5BOSA 2QMYA 4DV0B 4C4ZA 3ZDXB 3IULA 1ZOSA 2XNJA 4O4IB 4TQAA 1DCFA 4TS3A 3NXKA 3QVZA 4BQFA 1L7DA 5JNLA 1FMVA 1T0PA 1HW2A 2XUJA 1IAVA 4J1NA 4ISCA 3GJ6A 5IVIA 5HMLA 3UMYA 1RQXA 4FGLA 3VTZA 1E6MA 2CXHA 4CU5A 1ST2A 5I9TA 3A3KA 1NF9A 1QXSA 1GITA 1I0IA 3LNRA 5U9CA 2EEZA 521PA 3AU9A 3NBAA 1ULSA 3KZVA 2PBRA 2HK7A 3E5MA 5DN6D 5CNJA 3IESA 4PJLA 4JC7A 4Y9RA 1GR0A 3C7DB 4J0EA 2XVXA 4ED9A 1R2QA 4ZCMA 1ECBA 3VPCA 4J7AA 3RI3A 2WVAA 3Q11A 4IJQA 4MKXA 2R6DA 3HCPA 1DXYA 4FCWA 2VRNA 4ZOCA 4YRQA 4MS4B 1U6KA 4YCAA 3FTFA 4TTVA 5CIYA 3TRHA 4MVMA 2P11A 1D3AA 2XE8A 1GYRA 4B3HA 2GARA 1L4NA 1FRFS 4W5TA 2IBSA 1X80A 5F7ZA 2FQYA 2QRJA 5TMBA 3G59A 4QUAA 1U11A 3UNXA 1NG1A 2LIPA 3P0RA 2I22A 3B0UX 3DEIA 5LLTA 5K0ZA 3VSDA 3DVQX 2CJXA 4IJ6A 1A7VA 4M9SA 5AJXA 1Q0PA 3TDKA 1DWPA 3LUDA 2YW2A 1P1JA 1I7NA 3BSFA 2DT8A 5DLQC 5A6VA 3CN7A 4QGSA 1KMNA 1K68A 3FUVA 4KGZA 3KZXA 5SY9A 2V7PA 1Q0DA 4HFKB 2VRCD 3CVOA 2FV8A 1HYEA 3ZNOA 1OILA 2XOKA 2B25A 4QHSA 2C96A 4HRAA 3U44B 2GGSA 5FKJA 4FUTA 4QUIA 4ZKEA 1KSHA 3THYA 3W9SA 4Z8YA 4WQMA 5K51A 2QXYA 1L3CA 2YCBA 1VJCA 1XEXB 2VXCA 3PEUA 1K7EB 4YJKA 1JQ3A 2NO7A 1DRUA 1U2QA 1D2EA 3UMCA 1ADCA 2H5LA 3R8CA 4JUDX 5H0IA 4QU9A 1GGFA 2J9FB 5WRFA 1V37A 4YUZA 1OTXA 4FP9A 4OYRA 1L1EA 2WSSA 2PZFA 1AKWA 1DQZA 1YNSA 1J6UA 5TIIA 3T5AA 2GKOA 3V8RA 5EJFA 2L42A 2FNAA 5A4FS 2GDJA 4BS9A 2WJVA 2PUFA 5THQA 3V4ZA 1MJHA 1ZHWA 5C1DA 1WXGA 2VSNA 1D4FA 2R84A 1XZMA 3CAXA 3E9QA 4RO0A 2VCHA 4X66B 3FPBA 1XHEA 1HE1C 2MYPA 1DWQA 4X5OA 2Z4RA 2Y0CA 5FB3A 3JQBA 4H0CA 4LA4A 1P1FA 2YH2A 3SYKA 3VBCA 3FXAA 3NBUA 1GGEA 1YS2X 4I1YA 3UK1A 1FEZA 2BTEA 3TQFA 4RV9A 2D1TA 3FF4A 3KYIA 4KV9A 4GOND 4TLMB 4U9HS 3R3ZA 3PWZA 2GVZC 5I5EA 3AJRA 1QM5A 2BGTA 4F12A 3O4FA 2P61A 1XD2A 1E5TA 2JJQA 1E7MA 4FYXA 4P93A 4IOKA 2JNWA 1OW7A 3H9BA 1YB7A 2REOA 1C41A 2OV4A 4D9CA 3NEJA 3U8PA 2WNIA 3K9WA 1SCKA 3U16A 3M4JA 3HDHA 1MZPA 2F3UA 1H2BA 4D5EA 1PZMA 5AXBA 1Y9ZA 3DMGA 4Q3BA 3UMBA 4ZQFA 3D7KA 2REQA 1JLLB 3HYCA 1N5LA 2H9YA 4NS4A 1CJBA 3TYXA 5CT4A 2VJDA 2XMBA 4PRYA 3UIEA 2L19A 1XEAA 2CNBA 1FUYB 4HWSA 3KSAC 1RPJA 2CD7A 1YQGA 2NXEA 4UU0A 3HACA 1N6HA 6PFKA 3KPJA 1PT5A 2BL4A 3TNDA 3DPSA 3R7CA 5DTQA 3Q98A 2GCOB 1C5KA 4AL4A 3DL7A 5HQ3A 1P72A 3WV5A 3P9RA 4HEA1 1GPYA 3RV4A 4OM8A 1A2QA 3I37X 4MP6A 3FMGA 5C34B 1MVLA 4ZVVA 2WKWA 1P5ZB 1AV6A 1FNNA 1V25A 5TQVA 1G1MA 4MWBA 2AEEA 3CBGA 4KFUA 3B5EA 4HPXB 1F06A 5HRUA 1BDJB 3LY9A 3D7NA 3QUAA 3BWEA 3EC1A 1UBCA 1E3QA 1QV6A 4AZ0A 4M8SA 1XN1A 4CJXA 5BRJA 3TZLA 1VJGA 4Q24A 5DRYA 3BFVA 1THTA 3GL9A 1GCOA 2QRHA 3CF2A 3UV3A 1FYWA 5BSVA 4E3ZA 2GCPA 2Q3JA 5D86A 4UUPA 4ARUA 3S5JA 5J4KA 1N34B 1WTAA 1QU2A 3DMTA 2ONYA 5BNFA 1Y8ZA 2VNIA 4AZSA 2VQEB 2NVUB 1W4LA 3WL8A 1RZ3A 4W7HA 4PVDA 2B4AA 4BV2A 1L8QA 3L8CA 2GXSA 4HK4A 3P0JA 3KOXA 3CG0A 1JBQA 5LUBA 1YWGO 3A9WA 4RTMA 1RQGA 4Q47A 1N5RA 3RYFB 8GPBA 3AMVA 2JATA 4Y6QA 5IDWA 2W71A 1TWHA 1TM2A 5LP1A 2XHEA 4KRYA 4LMRA 4GECA 4AY3A 1JDUA 2HF7A 1BR2A 1FU7A 2C4VA 4UM9B 1TVCA 1QQTA 3AV3A 2AV6A 4TYWA 3ZI7A 2G80A 3ZIDA 3IUQA 5DYGA 4RY9A 3QEKA 4IX9A 1HKUA 4HFMA 4E0HA 5JUWA 1LS4A 3WWCA 4QVIA 2XGMA 3ECSA 2ZBQA 5FIUA 3KOMA 5B3AA 1MZVA 2CHEA 5ALOA 2VXBA 4HXYA 2VAVA 2H57A 4M37A 4N0PA 4B6EA 1HUQA 1VA4A 5LDHA 3X1XA 1NPTO 1L7MA 5FWXB 3QGMA 3Q7TA 5CW2A 1ZJYA 4XYMA 4BB0A 2VUSA 2M1XA 2HJWA 2EPOA 1WCIB 3MC1A 3HS3A 5HV9A 1IJEA 1LD3A 3UG6A 1E9BA 4LUCA 1AIPA 2JAOA 4XVQA 2WQ6A 2Q5LA 2XUQA 2B21A 3P2IA 1H6CA 4QTTB 1G55A 4O02B 3B48A 3DC2A 1JFFB 3WL3A 4MTCA 4N8SA 5KPJA 1F8GA 3T7DA 2F4NA 2QI9F 1OWLA 4F9TA 3H0EA 3L0DA 4EJ2A 3G23A 1P5HA 3KMIA 5JNWA 4JTDB 4PHTA 2RGAA 4R1NA 3A31A 3GMIA 2HA3A 4N6OA 1K6XA 3N2GB 3RW9A 3SQOA 3ZGYA 5J9FA 1J9GA 1WB4A 2R6R1 5I8PA 4NYIQ 4DQ0A 3WGVA 2J6IA 3D3WA 2VUIB 3L4BC 3SBEA 4JT4A 4OB8A 3OCUA 4L8FA 1LLQA 3U40A 4TV9B 3ANNA 3KJIA 2CMGA 4GL4A 1GS9A 4YWJA 2GERA 2H31A 4XJSA 1RS0A 2H1LA 3G8YA 3BGVA 3N2ZB 2Z1DA 5KYXA 4E22A 3ZD7A 4UUNA 5CI9A 1KKMA 2QP9X 5ILOA 4RM2A 3U4DA 2L82A 2HUPA 3GNTA 5CDUA 4PPQA 5IBPA 4IS2A 1ZH0A 4U6QA 4JGGA 1XAIA 1PHPA 4MUBA 4IIUA 2FGJA 4MQFB 2C59A 4MCIA 5E8JA 2JD0A 2WT8A 4NATA 1V39A 3BSWA 3WIOA 5IBQA 5BSFA 2ZSIA 4CMHA 2PD6A 4J91A 4EHHA 2GASA 3PFGA 3WIEA 4WEQA 1FL9A 3AUXA 1RAIA 5CGZA 2O1SA 5KVSA 4TKMA 2YYAA 3C98A 3TOVA 4TUYF 2RAFA 5AXDA 1JPVA 3TZKA 2R44A 3ZJYA 4CKEB 2FR8C 4B71A 2QTFA 2H65A 2BEUA 4BP1A 2C58A 1ZIXA 3ASUA 3SIRA 5JUAA 1QLWA 1VLJA 4L02A 3I9FA 1PW5A 3AVTA 3H2BA 4RKEA 1SMKA 1G2IA 3E6AA 1NMZA 1T2FA 4NENA 2VBGA 3KR1A 1RLMA 3KAQA 4FT2A 3FPSA 5KYGA 4DCCA 3KLOA 4L74A 1LPPA 3BK1A 3PPYA 5IKEA 1XNJA 2X1LA 2IYNA 2F1KA 1R9GA 1W1UA 3ORHA 3ELUA 3RC3A 4FJ2A 1A5AB 3A70A 1QC5B 5TEWA 5EFOA 3OT1A 4RZXA 4RAOA 3BXFA 1KOLA 1WZCA 5DU2A 4J7YA 3VMMA 3FH0A 5LQUA 3NJ8A 4HT3B 5HCIA 3TJRA 4DARA 4P6IC 2QN2A 5EY5B 5IC4A 1MOSA 1GTZA 5DTIA 2WY2D 1GN8A 1RYNA 1VC2A 2ORIA 4QBHA 3LC1O 2FWIA 3SLGA 1WU8A 3ZHSA 1K8RA 2HSEA 4C05A 3EIUA 3IE1A 1QIHA 2XQKA 3H9QA 4RLQA 1P29A 1XRNA 4KSCA 3GJ5A 5EIBD 5B7NA 5JI2E 5JNUA 1OBHA 3L8YA 3HP4A 4S1NA 4BTVA 2H4ZA 1DC6A 3KZ1E 2YVKA 4CKWB 5H3LA 2BLNA 4MDYA 1BCRB 1JQBA 2ZRNA 1U3CA 4IIVA 4OL0A 2B1IA 1QX3A 2GXAA 1KRHA 1EBFA 1GPMA 2R00C 3V1KA 1FFSA 2AWCA 4CTOA 3NT5A 2QW1A 4XA8A 2HQ1A 3L82B 3VGPA 5E33A 2IDZA 1T5LA 5ALNA 4BMSA 3K2EA 2PUJA 3B1XA 1YE3A 3CN9A 4ESOA 4XCQA 4P22A 1NBBA 3RAFC 2H8AA 4I66A 4NCHA 4AI6A 4HDMA 3C87A 4V0OA 1OFUA 4PG8A 3ORFA 1EFCA 4CXMA 2YZMA 3M4YA 4DTIA 1USKA 3D6FA 1D1QA 4YDQA 3AONB 4P7GA 5ALDA 3TTYA 1U7HA 4MWDA 2YHSA 1XNQB 2HJHA 4Z4EA 3K8ZA 4RY0A 3THRA 1N2HA 4ENSA 5JT1A 4KIGA 1AOXA 3SC4A 4EJ0A 1IBRA 4M1TA 2FDXA 3E27A 3ILHA 4DIUA 4K03A 3PWKA 2BMVA 4LERA 4WECA 1OZAA 4LHVA 4WN9B 3L6EA 3L8DA 2I1WA 1WHTA 4G8DA 2VPWA 2P40A 3EX7C 3G13A 3KHUA 4JRZA 4LDQA 4HLQB 2AFHB 5F5NA 4BBPA 1B76A 3QEBZ 1EE1A 2OPBA 3OG9A 1N6IA 2R6GA 4DMRA 2FRXA 3WKCA 2PGOA 3ABZA 3U3ZA 1BQ3A 1VKOA 5JAUA 3SM9A 5FYDA 2F8LA 3NIGB 5CH3A 1RMTA 4P3OA 4KQIA 4K6FA 1U0FA 3S81A 4HS9A 1G20B 2OHJA 2QZZA 2AD5A 3O10A 3FCOA 2V97A 3CA8A 1I51A 1NLUA 3RQGA 4HFNA 1F6BA 2B2NA 1MJFA 1SKAA 1GM5A 3FCAA 1B8VA 1LK5A 1GKKA 5H83A 3L5OA 3ICQB 5M5BA 1U1CA 2QZ9A 1CZOA 2GD2A 4ARZA 1T8SA 4PAOA 1GUBA 1Z8HA 2LW7A 2X77A 2WAYA 4AY6A 3HYLA 3DE0X 3I8XA 3DWWA 1JDZA 3LPMA 2UUHA 4BNIA 4G5QA 5DN9A 5TMEA 5ICCA 1MORA 5BMOA 2VHJA 3Q1KA 4ETMA 3HZHA 2WZCA 3KB6A 4M38A 4TV8B 1UL1X 1SVUA 1GADO 4NZOA 2WTXA 2XY4A 5FBHA 5ALHA 4E3WA 4R6WA 3ZVNA 4D9JA 3MCAA 2XDAA 1UC5B 5LZ4A 1FDTA 1V2GA 4EPWA 2HZBA 4OQMA 3BUSA 4B8ZA 1WW2A 4MX8A 3RF7A 8MHTA 4UDOA 2AZTA 3PNQA 3F3MA 3JAKA 4MW5A 3E58A 2EG9A 3QUBA 2YIVX 3NIBA 3GBSA 3IO5A 4FX5A 3AQIA 5JYEA 3D5TA 3ANTA 1X1BA 3KHKA 3C3EA 1WSAA 3PUJA 1F20A 4YJHB 1N8TA 2Q3MA 4MGEA 5IWAB 4QLBA 2R4QA 3HN6A 4HAZA 4YL3A 3U9SA 1Z8FA 2AJ8A 4R2JA 3GA7A 5ALTA 5EI5A 3JWJA 4X91A 1DQRA 3CX8A 3EVGA 4QXAA 4E1BA 1KQOA 3IQEA 2VJBA 3EPKA 1Y3AA 1RR6A 2H85A 3ZBUA 3ICWA 4FX2A 1XZNA 2CJFA 1ZGBA 2J5KA 2WJ3A 2R7OA 4OGLA 4N0MA 4PYIA 3KYBA 1U6JA 3D8RA 4I9FA 1HDEA 3I2KA 2EIKC 1L7PA 1O77A 1YH3A 1II0A 3I1FA 1M2VA 4RH1A 4RD6A 4D1YA 4FLFA 5A69A 4ZP1A 5TLSA 2WIDA 3HNKA 3UB4A 4JLUA 1Y6QA 2XMRA 1KY5A 1DS6A 3PCVA 3TJ5A 3FTPA 3A14A 3UJ9A 4DIBA 4H1HA 1WMDA 1EXVA 4TLCA 4N3NA 4RJTA 4MS3B 4YN0B 2WZLA 1DFGA 2Y3GA 3ZTTA 2RK4A 1XZQA 2Q7RA 3DWGA 1MHTA 4OP2A 3QWAA 1WIWA 2H07A 1HI9A 5IBRA 3JVDA 5AOCA 1CQJA 2P3QA 2YHUA 1ULBA 2BFPA 3D6UA 3PL1A 1C4OA 3AFHA 4YMLA 1T5OA 1U8FO 1PKEA 2QWXA 2QIOA 4JZAA 3DZ8A 3L3BA 2NU9B 2RSEB 1OA0A 3F6SA 3BE8A 5E6UA 3SG0A 3PHHA 3RGWS 1DOZA 3ZYZA 5HDBB 1PJLA 4XE5A 1G64A 4O2AF 5G53C 4ZEMA 4Y67A 1JQDA 4TYYA 3LCUA 2ZRDA 1TFKB 3EIQA 4H7IA 1JIUA 4E1VA 1JTFA 3CLTC 5JXIA 4BQQA 2QVXX 4RYLA 1EINA 2F17A 4DAEA 4QT4A 1ND6A 1XIVA 3AEZA 2J0UB 3E9RA 1V71A 1UAGA 1Y5NA 4FFRA 2V6JA 4NI5A 4L8LA 1OYYA 1AUXA 4BDSA 4MVZA 2VYND 2PD3A 2C95A 1KGDA 4IXMA 4J9UE 4RUKA 5BN3A 5DLJA 2YN4A 1A9RA 4M46A 1IBLB 4J07A 3RFVA 5AKGA 3QM1A 4DKJA 1CU1A 4HRVA 3KX2A 1JSCA 2H59A 3MJFA 3GWLA 4HUQA 2UZ1A 1CUSA 4OHXA 2ZYIA 2R6AA 1P9RA 3I34X 3RIHA 2QYTA 1R50A 3U31A 4DNOA 1ZOOA 2HU8A 3IJRA 3SC3A 3EDOA 5C8VA 4JI3B 2YWCA 4NCQA 2XH8A 3IKMB 1Y34E 4J2HA 1K75A 1A41A 2GUGA 4X93A 3TM4A 1R64A 1LVHA 4AIRA 1J1IA 3BMXA 3CX6A 3ZR4B 1EM8A 1R4NA 2X0JA 4I6EA 2R8RA 3EG5A 1CS0B 2VRWA 3WNCA 3M4XA 4N5IX 3EAGA 1ECCA 3UJAA 3N76A 1PI3A 4L27A 4BLOA 1TA4A 5BQHA 1WCYA 1LGYA 3HU2A 2JD3A 3EEOA 4DV3B 3DFKA 3UQZA 3UOAB 1UP6A 1SB9A 1RWBA 1ZUNA 1F0KA 3C6QA 4TQ9A 2YXBA 3AHGA 4XOIA 1SD2A 1XQ1A 3KIPA 4NTZA 1DU4A 4LOHA 3D2CA 1Y3IA 1HE2A 5D6OA 1UDXA 2JGJA 2FG7C 3HBFA 3I6ZA 1R0YA 3LYUA 3WK5A 2ROQA 5B1HA 1AG9A 2VL7A 4BUJA 1H2EA 3RADC 5F73A 2RGRA 1FCJA 4BQOA 1ZEJA 3BMNB 4RH0A 4UUOA 1QTQA 1WTCA 1XO1A 2OLKA 2MINA 4QDZA 1X0VA 2K87A 5HSWA 1NTOA 1J39A 1WS6A 3UJDA 1YCGA 4TTIA 2CVPA 1F3LA 3SI7A 3PEEA 3L0SA 3C3WA 1GNLA 3EW9A 3UOGA 4DBVO 1Z07A 2C99A 4EWCA 4DJJA 4UFPA 2JCBA 4S35A 1YS4A 2HF2A 1N5KA 5B3JA 2WZFA 5FUYA 4YPOA 4AF7A 3LCMA 3DE1X 3R6GA 3FCXA 4KE9A 4E18A 5LB4A 2BTQA 3UGKA 4EHDA 3NNDA 1PS0A 1YS6A 3WHNA 1BVHA 2BE7A 3IELA 3LP6A 3WA7A 4ZT5A 1ZJZA 1K4YA 3K32A 3R75A 1N9ZA 5F76A 3L1JA 1LLUA 4ZI5A 3GWGA 1H1LB 2QX6A 2ZRHA 2RH8A 4XLLA 1NL3A 3OU7A 1QQ6A 1CGOA 2CF6A 3HR8A 1JBKA 1KZ4A 2O5RA 3U26A 2XDQA 2PT9A 3DPUA 1W25A 3TK0A 3NAMA 1GRRA 5SYMA 4R8VA 2R1TA 2BHSA 1NF8A 1ZJ5A 4A0RA 1DQPA 2D2XA 4FOTA 2ZJAA 4S1VA 3NKVA 1CSEE 3P1JA 4K6KA 5G02A 3KM0A 3DEFA 3WLSA 1DRWA 2VCYA 3AXTA 1GGMA 3DAGA 4NTBA 2Q27A 4I1RA 1LQUA 2ODTX 1JHAA 1U3GA 5K0FA 3ID6C 2HKIA 2W37A 4R6XA 3SHVA 5LD2B 4BMNA 3FIJA 1JJ7A 4FKZA 4JJEA 3KPHA 3EC7A 1RHJA 3AIOA 3PFIA 2L2QA 3CRRA 2DR2A 1OWNA 1ST3A 1OCRC 1LLCA 2UYOA 5JJCA 3RBXA 1N8KA 4P9TA 5AT1A 4RHXA 3MINB 4DG5A 1G60A 2H63A 2BEWA 4JYMA 3HLYA 5T7BA 2VLIA 3T5CA 4FFVA 4DV1B 3DYIA 1LS6A 3UB2A 2GD6A 5IAAA 1V16B 4ZYZA 3DNMA 4QOSA 1AXRA 3LLUA 1RWXA 2HO5A 5EKXA 1C7FA 3N8DA 3TL2A 3SOPA 1SOAA 4ZJZA 3BYZA 2Q7XA 5TJ9A 5JAMA 4ZEVA 1VHQA 4NK5A 3R3SA 5JU6A 4MAMA 5I7WA 4BU1A 3MELA 4A82A 2A1TS 1N36B 3DOOA 4UFOA 4IW3B 3I9V6 4OK6A 3EHDA 1PK7A 2DPXA 2CN1A 1YK0A 2C00A 2XGSA 2EBFX 4YFVA 3CLUC 1I4DD 1S3SA 3D8SA 5JQWA 1ZNXA 3UMHA 5K8JB 2CLOB 5DI3B 5DNDA 3FTDA 2IDMA 2HRZA 1Y3FE 4TKUB 3F1KA 4J0QA 3VC7A 1NSGB 5DYYA 3GRPA 2WJ6A 4L8YA 4DM7A 1HFJA 3AUJB 1VKHA 3D6TB 1P7VA 4WRRA 3INNA 3BCUA 5TQ2A 2NUPA 4H2DA 4A8JC 2F3RA 2JI9A 3OH8A 3W8EA 3PUYA 2FB9A 3IQCA 2BEKA 1XEFA 4IIEA 3L0PA 5I9BA 4KXLA 2I2AA 3EHMA 2O1WA 1WJGA 1EK2A 1GPJA 1CDOA 3PPIA 3QSYA 5AJHA 3TS1A 1MXHA 2DR3A 1DAKA 5DYTA 3RTDA 5LP6F 3PF9A 2ZJ5A 4B3RB 4BNVA 3KPUA 3T7RA 3KJFA 3EQLF 2R1UA 4R2KA 4F1JA 5M34A 3ADPA 3S2UA 5ALVA 3K0AA 3AR2A 3RUFA 4LRSB 2VQDA 1A4RA 2HMZA 4IARA 4PAQA 2YLIA 1MABB 5IEBA 1VGRA 2WILA 4EB6B 2Q4EA 4XCVA 3IBGA 5A3VA 4RCYA 3OCJA 2X9LA 4G0NA 2B9VA 5F1PA 1E0JA 1C9KA 2V6FA 3COVA 3FKSD 2A1UA 5CYFA 5COGA 3IP7A 1EFLA 1XD8A 4EIWA 5D5PA 2ZULA 3K1HA 1C80A 1Y6ZA 4MA5A 2G1KA 2W2OA 2L17A 4WV3A 2ZVJA 4BV9A 1QPZA 4ZXFA 4BCCA 2IBTA 2EJUA 2I6QA 4TYPA 4L16A 4AL1A 4B09A 3KR2A 4F9GA 2ZXPA 3CR8A 3AZOA 1RMVA 3F5DA 4I4TB 3WYGA 4A6EA 2I62A 2CJPA 4FOOA 2Z5FA 4ESEA 2WTEA 2Z6UA 1C3EA 2IQ5A 1GZHB 1RZUA 3WC4A 1MW8X 4ND2A 1QFZA 2ZE8A 3LW7A 2ET6A 4W82A 3NJRA 2Y0PA 4RORA 3SR4A 1PSDA 1ZW1A 1JNYA 2SCUA 3LWDA 5EZYB 2JBWA 4OO3A 4KLAA 1M1YA 3T34A 4O2LA 1NNI1 1KI7A 3O38A 4OXIA 1QNLA 1LDNA 4QDTA 2C7OA 3T4RA 1NVEA 3UKOA 1ORSC 5JE8A 5LP6A 4C0KA 2Z2JA 3PD1A 2NQ2C 3B7GA 3TR5A 1GV0A 2ZI7A 3OM1A 2GKGA 1UMKA 4S1WA 4BX9A 3U7GA 5JC8A 2JLXA 1PWYE 1H5QA 3WIVA 3W8IA 7MHTA 1NC3A 2ZI4A 2C61A 4CRWB 4IIJA 3S6JA 3ZE1B 4KQHA 4BLUA 3GRAA 1NBAA 2QP3A 4TQGA 3JARB 1H2WA 4M7PA 3H8WA 2NSLA 2X22A 3LBYA 3JYLA 3STXA 3PQ7A 1KJ9A 3GWZA 2BFBB 5GV8A 4P4SA 4GT1A 4UTNA 3EJ6A 2W2TA 2HRDA 3V8EA 4N5HX 3VPBA 2YFHA 1XKXA 1UBSB 1NU6A 1J24A 4LMAA 3T1QA 3WO1A 4ADSG 1FA9A 2OBMA 4D6XA 4JSTA 4G4IA 3T9DA 3EVEA 1CE8A 3D3QA 4KITB 1XALA 3K94A 1NW6A 1I5EA 3KL4A 3KP1A 4K8OA 1VKZA 4Z9HA 1JTVA 3HL0A 1KMMA 3ZUGA 3LV8A 1PK8A 1WASA 5DGXA 1GILA 3EJNA 2RC5A 5FPTA 2EGUA 3K33A 1U0LA 4LF9B 4UNIA 1GUFA 2DR0A 1WO8A 2WF9A 5JVDF 4J76A 1LVUA 3AVWA 2I4MA 4WVLA 2ZWOA 5CI8A 1ZX1A 4PN3A 1E1CB 2A5FA 3BFJA 4ETWA 1DJNA 2OAQ1 1Y0BA 2HWXA 4JJKA 2BFNA 1NBME 3OU2A 4C0LA 2XEDA 4NRDA 3OOEA 3RASA 1QCCA 3QW0A 1WZ2A 3QELB 3SD7A 2Q8PA 2BGKA 2HPHA 1XU7A 1AZWA 2WQ7A 1B23P 3T5DA 4CCAA 3E35A 2D5IA 4D8UA 2GN0A 2AEMA 3PXAA 4IHJB 5KMGA 3RK4A 3FNRA 4IY1A 5CG2A 4A27A 1U9YA 2AJBA 1N1EA 3EPLA 3PIDA 5TT1A 3QYFA 3ZY6A 2FWPA 4YREA 3SIXA 1SO8A 3U62A 2CL5A 4EVQA 2J3KA 2JB9A 1WXEA 2AI1A 2HBQA 1TZCA 1FFHA 1H3NA 2RKWA 3LRXA 2LP4A 3ZHZA 2R3SA 1QHYA 4XX0B 3LU1A 3ZIBA 1AKVA 3N8NA 4BNFA 4MV6A 3MJCA 1WG8A 2P6OA 2LCFA 2AK2A 4GPAA 1SVOA 2DPHA 3EXHC 2ETVA 1S2NA 2E1RA 1G2QA 2YVQA 1AZSC 5D3KA 4HVLA 4MVRA 2DF8A 1YIAA 1A5TA 2AWNA 1EFTA 4U4AA 2QK4A 2ENUA 4V0MA 1VB3A 3RABA 5T1DB 4UKDA 1P39A 1MW9X 1YRAA 2I3AA 4LVCA 1U28A 4AS2A 4MJLA 5BSUA 1PZGA 1NAIA 3HCEA 3WIUA 2C4MA 1JPUA 2AEFA 1O57A 1LY1A 2AX4A 2IHBA 5F2KA 1PL7A 2YQ5A 2FFBA 2YHIA 4L8WB 4U2DA 1ZCZA 3EQ8A 5F7OA 1R9MA 4F4UA 2CWWA 4LF6B 5FUBA 3NAZA 3JRWA 2P8SA 4MV0A 3KKEA