4BJ6A

Crystal structure rif2 in complex with the c-terminal domain of rap1 (rap1-rct)
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
329
structure length
293
Chain Sequence
SPVKERVDHVFYQKFKSMALQELGTNYLSISYVPSLSKFLSKNLRSMKNCIVFFDKVEHIHQYAGIDRAVSETLSLVDINVVIIEMNDYLMKSDLMMMVMRKINNDESIDHIVYFKFEQLDKLSTSTIIEPSKLTEFINVLSVLEKSNNIAFKVLIYSNNVSISSLLSTSLKKKLNTKYTVFEMPILTCAQEQEYLKKMIKFTFDSGSKLLQSYNSLVTCQLNNKESNLAIFFEFLKVFPHPFTYLFNAYTEIIVQSRTFDELLDKIRNRLTIKNYPHSAYNFKKNQRLPLKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords RAP1-INTERACTING FACTOR 2
publication title Rif1 and Rif2 Shape Telomere Funcation and Architecture Through Multivalent RAP1 Interactions
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 106
structure length 293
sequence length 329
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-04-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1650 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4bj6A01
3.40.50.12060 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4bj6A02
4BJ6A 4BJ5A 4BJ1A
chains in the Genus database with same CATH superfamily
1ZJYA 3D2AA 4D1YA 5DE3A 4KXXA 1JA0A 4GECA 3BPSA 3GMDA 3IKJA 5LUAA 2OXRA 5A5EA 3IP3A 3UPTA 3IQGX 5JALA 3ZZ0A 4A6XA 2R1TA 2UZ0A 1XLVA 3FHDA 3PQCA 3BRJA 2A5JA 3OZSA 4JP8A 1D2RA 2NO1A 5IJXA 4WI1A 1S4QA 3GGCA 1ARZA 4NU5A 2KM1A 2BL4A 2L6HA 4ZI7A 5G4LA 2Y4NA 1LW6E 2NZ8A 3KJNA 3A6JA 1Y37A 4HDNB 3L84A 4Z49A 3SXUA 2Z8YM 1G0NA 3O6XA 2JD3A 1H3FA 1T9CA 2HXYA 3OCWA 3NFYA 1B1CA 2EJTA 3WL7A 4RIHA 2M6KA 2WIBA 1HT3A 1Q22A 4R84A 3IT0A 1PJLA 4LK2A 1ULTA 2GK6A 3JSAA 4DIUA 3EIQA 4B2LA 3WAQA 4U5BE 1KEEA 2VSQA 3ZYZA 1NLMA 3U19A 3KSAC 1ZLXA 2Q8PA 1M1XB 1NL3A 1EUCB 1Y9ZA 3K3PA 3DP7A 4FWVA 2Y2VA 3IP9A 1NC3A 2QDXA 2HHHB 4E2ZA 4YBZA 3IP1A 4H6WA 1FRQA 2W4QA 3HBLA 1E2KA 1W4LA 3TYXA 1I7QB 4AMVA 2BF4A 1SXIA 1E2HA 3K0EA 3UKDA 2ZBEA 2HUPA 2TMDA 1XYYA 3NI2A 3TOMA 2X15A 4C5AA 5DM1A 4G56A 2VP5A 2P30A 4BEVA 4AD8A 1VZ3A 2A9FA 4JJFA 2VAWA 2CN1A 1B15A 4D6XA 4LHVA 1RAEA 1JSCA 2NZWA 4ZEVA 2PH3A 1C8BA 3TZKA 1ORDA 4BEBA 1TE2A 1Q7BA 1Q74A 4AY2A 2GK7A 5COMA 3TUJC 5KEIA 1PBTA 1N2SA 4QDZA 3LC7O 4JGGA 3LOUA 3A4YA 3DSRA 3DEKA 4N5DA 3TCXB 4LJ5A 2P2ZA 4BO4A 4Y0VA 2CMHA 1WETA 2IU3A 4MUAA 4KMRA 2CVFA 2GN9A 4KQHA 5TS2A 3HVUA 4NJEB 3V7NA 3GEGA 2A1DD 4IO1A 3CEJA 3OY2A 1DCFA 2VQFB 3TBFA 4EFDA 2P0EA 1RBMA 2FMKA 3EDQA 1RKBA 2ZCJA 4KC9A 3UB4A 5EZYA 1QYCA 2DTDA 1U4NA 4PS0A 1UAYA 2WF9A 5JAZA 2XWJI 1T2VA 1O9BA 3B70A 3OCYA 3QTLA 1E1DA 1WATA 2D2EA 3SJ7A 1GAXA 2B2XA 3TGWA 1QP4A 4FYHA 1GUBA 2Q3LA 1FFGA 3HDQA 5C0OE 2Z3VA 1ZK3A 2JCBA 3PYLA 1FAPB 3WJ7A 3AY0A 1LVKA 1PZGA 3LUPA 3EAFA 5C4GB 4A0GA 4KR9A 4UAUA 4XSVA 3O0DA 4QDUA 1SPBS 4D0GA 3NDRA 3J81k 2P2GA 4JITA 2BM9A 4P4LA 3BMOB 3TLBA 4A2WA 1JKMA 1PW5A 4D56A 3F90A 1NXQA 4NBTA 4GKBA 3P2JA 3AVTA 1DAEA 3SC6A 1R8JA 2V0GA 1TW3A 4OATA 1FC0A 3Q15C 5LXTA 2KLBA 3IQ6A 3C7JA 3OEED 5KTOA 3JQCA 3WL5A 5DHPA 4F6CA 5IT9A 2J3MA 2LQGA 3B7PA 3TDKA 3I83A 4BX0A 2CNWA 2A2ZA 3WLTA 3EPPA 4QJ4A 4J2TA 3DZJA 1IJKA 2EFEB 4IINA 3U48A 3JQAA 2Y1EA 3GW8A 1ULUA 5AUNB 3UK1A 1QH9A 3MEQA 4XQGA 2ZSFA 4XKJA 1EE9A 2CMGA 3LLSA 1DBPA 3EX7C 2YRXA 4P86A 2WTBA 2NSFA 2YHAA 5K4AA 3Q72A 3JSXA 1DAMA 3HKBB 4I81A 4DVZA 4BP3A 2GJ4A 3RVOA 4CTJA 2VP9A 1MC5A 3BXOA 2FMUA 3KCNA 4OV6B 3T9EA 4AL4A 3F74A 2JPDA 2LKCA 3FVRA 4GRDA 3V33A 1W76A 3WLFA 3SXYA 3T4PA 2CMDA 2OQMA 3KFVA 3CEHA 3WXMA 1HYHA 1P61B 2H5EA 3UJ3X 3ROPA 3WRXC 2GNPA 1FFSA 5DTRA 5DNAA 3ACDA 4CUKA 1RZUA 1RC8A 2QGZA 2I33A 3V4RA 3CEMA 2WNSA 4CU2A 1KQFA 5BR4A 5AVUA 1L5QA 1Q1GA 2VF2A 3PJDA 2PE5A 3OWHA 1OPRA 1PV1A 3UJ6A 2R8BA 3PX3A 3QLEA 3ROTA 4J6EA 4DSNA 3QI2A 4EELA 3NYRA 3AL3A 3OA1A 2XM0A 2XTJA 3A9TA 3B12A 3WJAA 1ORTA 3C8HA 4Y9RA 1EFTA 3DFIA 1CQIB 5TNXA 4MV0A 3LDGA 7GPBA 3D8RA 2PIAA 1JG1A 3PGMA 4EEXA 2WZLA 3SLKA 3AJMA 1GFZA 4HCJA 3G5LA 2AX3A 2JKZA 3UOGA 4O29A 4RS4A 2R1VA 1KQGA 3GEMA 4I3GA 2AOXA 1N2EA 3CWQA 1KI6B 3HUFA 2WF6A 2ID4A 3WLMA 4M76B 3HU2A 3UG6A 3FN4A 1SXQA 3LX8A 1CVLA 4RVDA 3VTZA 1H0SA 3OMLA 3NR2A 5REQA 3AP3A 4UEQA 5CB4A 1KJNA 5E7IA 5HYVA 5TT0A 2NTJA 4N3NA 3RAGA 4RIEA 2PFKA 2YL3A 2JBWA 1Y6ZA 1E61A 4P38A 2UZIR 2QVLA 5LFAA 1FSGA 1TKAA 1X74A 2ZT5A 3DZGA 3ISJA 3ZE9A 2ONZA 2WHQA 3THYB 5IDWA 4QUAA 5LU9A 1ZGHA 2CUTA 4N82A 3X1DA 1C4KA 1N1MA 4KI2A 4Y9DA 2RG1A 4FIDA 4LX0A 1L5KA 3EB9A 4J9UE 2EKZA 1Z7EA 4LYGA 5JJBA 5DNDA 5TS3A 1MTOA 2I03A 3NBQA 1NUTA 4JW1A 2OFWA 5KSWB 2AH5A 4Q3DA 1C7JA 3TW0A 2Y67A 2YVLA 5J1SB 3DGFC 3I04A 2YKGA 4YO8A 1JDBC 5EA2A 1KEKA 2CLCX 4G1EB 4I9NA 1H6BA 2G36A 1MPXA 4TROA 1GN9A 4KKVA 2QX8A 2VSXA 3CPSA 1NYTA 5FTLA 4LYYA 5DW0A 3HZRA 1YTLA 2ZRLA 1ONNA 4XYBA 1AN0A 1UFOA 5ITZB 1RM5A 3JZAA 1RVDA 3A1VA 5JS1A 2GHQA 1E3TA 3KVOA 3BIXA 1KBZA 1FS6A 1G3RA 1KZ9A 3AM1A 1IFXA 4RM2A 1E8DA 1TF7A 3DHVA 2YJTD 3KOUA 3IR6A 1G5RA 1ORJA 1GTZA 4DMUB 2QN8A 5L9AA 3CQZA 5CG1A 1FVHA 1IN7A 3E9ZA 1LBHA 2HW8A 1LDBA 1ZW3A 5HNKA 4GWKA 3ZXUB 3EISA 4KV9A 5JVEA 4N7BA 1G38A 3TLEA 3D9QX 4GGOA 2WJZB 2H4FA 2WLTA 3OM0A 2FMXA 1WMSA 5BSTA 4NHOA 3KUDA 1GL6A 1WHSB 2VH3A 3B29A 4EVSA 1AEPA 2BP7B 1EI9A 1G21B 3R7WB 3K1IC 3GXOA 1WR8A 2IHZA 1WCYA 3PR1A 5DBOA 1HLDA 4CIHA 3UUWA 2VLBA 4MCAA 1POWA 3WKDA 1O94D 4MGZR 4O4IF 1F1JA 1K98A 1AQUA 1GGNA 3ESZA 1SKQA 3TB4A 1U1GA 1TFKB 1HDOA 3I76A 4NKRA 1JXQA 1VIDA 4O02B 3IQEA 1KYWA 4L75A 1UKCA 4WUVA 1CY2A 1QH8B 3UV3A 3G0HA 4RHYA 2P6MA 3HCEA 3IUPA 3C85A 3MJHA 5C51B 4MS4A 4LBYA 3EZFA 1KDZA 4QPZA 3UXEA 2NU9A 1XT6A 1DC4A 2CXPA 3IMEA 3TM5A 2VWPA 1HY5A 1NIPA 3TUIC 2C5HA 5CIQA 1ETHA 3GPDG 1Y81A 1X92A 4NU8X 2WF7A 2YJ4A 1QO0A 1PUIA 1QHYA 2BEVA 2PWYA 4OHWA 4B3GA 1MT3A 3PC4A 3KZNA 2EW2A 4EJFA 4YACA 5LNK6 4C4SA 1M5UA 4E5UA 3GOQA 1WOLA 3FSRA 1HE8B 3H2SA 1FCJA 3ZCTA 2FPGA 5JWRA 4Z8YA 3PNLA 2QYTA 3R3SA 1I6MA 5E1MA 5CITA 3ROZA 1GADO 1F8FA 1XJQA 3PV0A 1XZQA 1HPLA 2OPBA 4KGZA 1TZ2A 1T35A 2X0RA 3BEDA 1KSFX 1L1EA 3R7LA 5KDDA 4LXUA 5CU7A 1PJ3A 1OKKD 4G0WA 1U04A 1QP0A 5DASA 1N9GA 2KB0A 1V1RA 3FTEA 2XT0A 1GPMA 1Z2EA 4PAGA 3PFFA 1G4AE 3MJDA 4FFBB 3RRBA 1RT9A 1U0LA 2Z0MA 1H5UA 2AFVA 1ES9A 4EZIA 1DMRA 1FYFA 1IQ0A 6PFKA 2NU6A 2W6PA 1G42A 1YS4A 1CIPA 1YCDA 3PKIA 4MYSA 1T29A 1DIAA 3VKWA 2XMCA 3F4KA 4U2GA 4I5FA 2VCEA 2FW8A 4R9UC 2XLOA 4QHYA 2ODEA 4YDSA 3H9UA 5KJFA 1RE0A 3KSUA 4K6OA 3UPUA 2HZ7A 4QEDA 3NKVA 1L5ZA 2OBNA 3HFJA 1U0GA 3QFTA 5DHFA 3U8VA 5K3DA 2A88A 4V0KA 3R9XB 4E5SA 3LLVA 4BNWA 1EBUA 5U1PA 2ZXFA 3CZPA 4FD2A 4MP6A 1Y1RA 5I8ZA 3QYPA 1U5AA 4BLTA 3C24A 1D6SA 4U5FE 3EXHB 3K9NA 3CBGA 5BN3A 5CAEA 3C3YA 1PG0A 5CLFA 3STVA 1EAYA 4PU0A 5ALGA 3MFNA 3GX1A 1J70A 1WULS 4AJKA 4LEIA 1GPDG 2SECE 4AXBA 3QXSA 2VEOA 3JQGB 3I9FA 5L3RA 3GCDA 4XVCA 5JI2E 4PN7A 1XKXA 2Q5IA 4GLFA 1BCSA 4UTNA 3VHLB 1Z74A 1TWAA 3SBEA 4JQCA 1YKFA 4GOLD 3ZV4A 4EUEA 3I3SR 1H65A 1ZGBA 3MLAA 2BI8A 1CY7A 3GDWA 3POVA 2ICWG 4OCZA 2WU4A 3NXSA 1Q17A 4C0QC 4B81A 1Z33A 1AZLA 3QVZA 1F2TB 2B5OA 4K28A 3VUFA 1TYAE 1MQSA 4HVCA 1P4RA 1BHO1 3CF4G 5ALVA 3GLRA 3SICE 1MMAA 4LFBB 1Y9DA 4AX2A 1QG4A 2YOFA 2I7VA 4HGYA 4G5OA 2CBXA 2EFHB 3MRXA 4TGLA 4TXNA 2GCGA 1PR9A 3ICOA 1BU8A 2GN2A 2RGWA 3N9IA 2JGIA 1M2JA 4J76A 4Y2XA 4R3NA 3P9QA 2WAYA 2M98A 5JMWA 1YYJA 4CS8A 2C00A 4QXOA 4ADSG 3TTYA 2QR5A 1DRVA 5BQFA 3EJWA 4D9FA 2XNJA 2AFHA 1LQTA 2VJDA 4Z1MA 1S2LA 4AT1A 3H2UA 5T64A 1CJUC 4P58A 3T41A 3A9CA 4CEIA 5AXBA 4QOIA 1YAJA 4LIPD 2AN9A 4NJMA 3NONA 2GD0A 1NMEA 4UDXX 2YL2A 1BZYA 2XAUA 2Y3DA 4DDMA 4X62B 4KXUA 5AOBA 4KTTE 2P4HX 3K92A 2ZVJA 5LC1A 5EHZA 2KWIA 2QRJA 4JUAA 4XM0A 4JKYA 5ANRB 3A10A 5L53A 2R62A 4F85A 3ZTTA 1G6KA 1XZJA 3DKRA 1ADJA 4NXNB 3T7IA 3B1JA 3VU9B 2HHLA 2PVPA 5A3VA 2QD5A 3WBBA 4PY2A 1XPOA 1OU0A 4OQQA 2A0UA 1GY8A 3AW8A 4G1UC 4QO8A 5JZ9A 2AMJA 4BVLA 5JXWA 1FTGA 1GZSA 1L9XA 4DABA 5ARBA 2OCXA 2QW1A 4W5TA 1UPUA 4MRVA 1SCKA 3FFAA 1JB9A 1PZFA 1QNLA 3SI7A 2CNLA 4LSMA 4XFKA 4Q1BA 1I6WA 3EGDB 2ZRGA 2OO5C 2WVJA 4BVGA 3PXAA 4WGGA 1BD3A 4G1BA 3P2EA 5F5NA 1ATZA 2PRKA 3SOZA 3WNBA 2H7OA 3KYDA 1SG9A 1IZYA 2JFHA 2XBLA 4M0CA 5LCXA 1UADA 4IYJA 3GUUA 4TV8B 4OL0A 3RIYA 1YWGO 1A5TA 2PR7A 2OD7A 1LSUA 4MW6A 4PQFA 3SK0A 2DLNA 4KZPA 3QEJA 5B1AC 1XKQA 4FDLA 4KPFC 2V8BA 4JU8A 4CJGA 5I8WA 3W5UA 5EEHA 3LX4A 3IVGA 1YA6A 3TLAA 5CDFE 3PEYA 2DSTA 1FLNA 3MIZA 3RVYA 3LUBA 3DYIA 3B6ZA 2H1RA 1NP7A 2DQYA 3PPYA 4F21A 1ZGZA 2HZBA 3R23A 3E35A 1Z18A 1VLQA 4MTFA 3P45A 4NE2A 2ECFA 4Q7MB 3JX9A 1C9NA 1K08A 2G63A 4BWGA 3IRVA 2IYWA 5JNTA 3AOEA 3ZU2A 5K01A 1LVHA 3DPSA 4Q3CA 1KTMA 1QV7A 3NHWA 2L7AA 4OHRA 3G85A 1F14A 2INGX 1Q6ZA 2DB4A 1E6MA 1UPXA 5A03A 4X0RA 1KWKA 5SZJA 1OBCA 3WLHA 5DT9A 1IXZA 1QJ4A 3J81A 2Q62A 3PPWA 2QI9F 5AVKA 4LF7B 3ORYA 4Z3KA 1ODLA 4AY4A 3W5AA 5B58C 2ZSIA 1EB9A 2EKDA 1DJLA 1UPCA 3UCFA 4CFZA 1FS5A 1YI0A 2WVGA 3FNEA 2DF8A 1H2RS 2R2GA 3CLRC 3H2BA 1SXJE 2DEUA 4NTBA 1NKTA 1W4RA 4UQOA 4WKOA 4TV9A 3PK0A 1RYMA 4XPYA 5DS5A 1V4VA 3KQWA 4MP8A 2VB6A 1TJPB 3HU3A 1DAIA 1H9BA 2YY5A 2PUEA 3P2IA 1VPEA 2NVOA 3ZHCA 3IVXA 3HADA 2AC4A 2P9BA 4KWIA 1Y5NA 3AOGA 4Z4EA 3TL2A 1I80A 3WNDA 3R3XA 5DLDA 2R00C 1U4OA 2CDAA 4B7ZA 4F4FA 2I4NA 4ES6A 2I54A 2C2KA 4JVSA 4F12A 1XMOB 3RSSA 4HNRA 2FSVA 2ZU6A 4FYWA 1PWXA 4YRDA 3VPCA 4LJLA 2HK8A 2O0JA 2LP4A 5BSWA 2Z8YA 2VDNB 4MQLA 2WVNA 3QNWA 4EFLA 2R84A 5CA0A 1DFGA 2K7ZA 4G1MB 1IEVA 1O2DA 2HH9A 4YRBA 4K03A 2ZRBA 5AKGA 1IHXA 2QW0X 4OQLA 2XECA 5JDCC 2B3DA 1KVUA 1Y4CA 2VTBA 1AS3A 1GAWA 1K3FA 4TZ6A 3DO8A 1NG1A 4PXSA 3VR6H 3AEUA 3OX1A 1QRSA 3GLUA 2IZ6A 4OIQF 1GNRA 2ZRIA 3G8YA 1E6KA 3EG9B 1A0BA 2B35A 5KNDD 1RYDA 3NYIA 4QULA 3VOSA 1JLKA 2WICA 4MVSA 1TUGA 1L4YA 4RNCA 1Q0TA 3JQBA 1QMGA 2DUWA 3T12A 4G0MA 1NMQA 3TQOA 5FL7D 2QE6A 2CVHA 4QJIA 4EKDA 1XCMA 3VV2A 5JSZB 3WICA 4MKGA 4BYGA 4Q3OA 2VN8A 2FSUA 1JIJA 4I50F 3N74A 4JUFA 2VDWB 3EASA 3V2UA 4EVQA 2AG6A 5LM3A 2GSWA 2DWUA 5IVDA 4DJDC 1S3SA 3QY0A 4EPWA 4JQOA 4FHEA 3ZSUA 4WGFA 2P9QA 4ROSA 1P2FA 4D79A 5JNLA 2HDNB 5LPNA 1P0QA 4HB0A 1DPGA 1EHCA 5MF6A 5EGSA 4JWTA 1MIOB 3X43A 1THTA 2O07A 3MFYA 3C97A 1LJUA 2IOFK 1Q0LA 1R8QA 4ER9A 5LYJA 1ZBQA 1MF7A 1ZN9A 1XD9A 3B3AA 4ZREA 1I30A 1PJAA 4OLFA 1RHKA 3K6RA 3ICQB 4G3XA 5H3HA 1NXWA 4LWZA 4I1VA 5HFAA 2X3UA 2Q2QA 1F0YA 1QCCA 3IT2A 5BQXA 4X7BA 5B1BC 2QAJA 3G79A 2HL6A 5FNVF 4XVUA 2HCRA 3AYZB 1OYWA 4LJSA 3AVVA 4OMFG 4X3PA 5BOSB 2YZ2A 5FI0B 4YMVA 4N6OA 1T34A 1PCXA 3MYRA 2F3PA 3ZW7A 1P3JA 5CI8A 4N5HX 1B0AA 1OLXA 4F4JA 4MVJM 3RJTA 5KSPA 4GMDA 2Z09A 3FWKA 1WCIB 4PZ9A 2QP4A 2BSXA 3EZIA 3DBHA 5KS2A 4K9PA 3IUNA 2GCEA 4JHXA 3RRYA 1SM4A 4PTLA 4M87A 3QU9A 3IX7A 5ISMA 1JZQA 1A9SA 2C4TA 2C7VA 2V7WA 3AR8A 1G64A 2XOKD 5CBPB 1CNMA 3AHEA 4F9FA 4LE1A 2P3LA 5FULA 4D9MA 3V7UA 1PGNA 3FPBA 5J23A 4HWRA 3CEAA 2ZRDA 4CCWA 3LS0A 1VKRA 1LF0A 3NOXA 3SHOA 4WOJA 4H7PA 1Q7EA 4IDAA 5EL0A 4ED9A 2WVOA 4PNZA 4ZGWA 1RWMA 1VSBA 1E3MA 1VCOA 4U5EE 4DBRA 4L4RA 3AEZA 1I32A 4YTEA 2VK2A 4KJXA 4PLFA 5CURA 3B9BA 2WTEA 4KHZA 1CZOA 2HWKA 1YDWA 3CPEA 3RSLA 3ZIAD 4PGGA 3LHSA 3A32A 3P9NA 4O59O 2IP4A 3EIWA 2P2CA 1VM6A 3PPXA 3L8GA 3GD5A 4AP5A 1KPGA 3GP5A 5ERGB 5AT1A 3HG7A 2ZP1A 2ATXA 1E7MA 1ZH6A 2DCMA 4AJOA 5C8DA 2EIKC 3TTWA 2Y39A 4FFSA 5EYPB 4FEYA 2V5UA 4JP3A 2HEIA 3LGXA 3F0TA 4UPVA 4I4IA 1FNDA 3DONA 1LDYA 2HAEA 3TRJA 3U56A 1RI4A 3GL9A 5COGA 1UP6A 4AC9A 1Q7TA 2Y3HA 4KPEC 1NW7A 3CUWA 5EUQB 1Z9BA 1DQPA 1PG2A 5KVVA 3SS9X 3KKBA 5G02A 2OMEA 2XX3A 1Z25A 2XWPA 5DYYA 2X8LA 2A59A 3MLEA 5EI5A 1R9NA 4QT0A 1QVXA 3HNOA 2O50A 4UNQA 1Z75A 3BSSA 5A9TA 4CTKA 3JT1A 4CBEA 2ZYAA 1PZMA 2H1CA 3O3NB 4DGQA 1Y6JA 2PBZA 3WB0A 5IT4A 1W581 4JTAB 3G1UA 1X0VA 3MM4A 3RIMA 5KYUB 3VTAA 5EHIA 2AI2A 1YGPA 3PCTA 1RHJA 4TXJA 2PPVA 3U44B 1DBVO 1Z26A 1Z45A 4MR9A 3U16A 3O5AA 5JEDA 3EULA 4X8OA 3WO1A 3KQNA 1GGKA 3EK2A 1YVPA 4ACAA 2WNHA 1NT4A 1KE1A 1X1DA 4WOPA 1Z2OX 1MC1A 4PO8A 4GOJA 1CRZA 1TYEB 4GC9A 2PRSA 2CHFA 4LPSA 1BD4A 3STYA 1XZIA 4WNYA 3SS8A 4LZPA 2K6GA 4S24A 4LI3X 3LX5A 4I4LA 1TM7E 1E69A 2XDAA 1CZKA 3NH6A 1XMSA 3V5NA 4JYBA 3WI7A 3C3EA 3M1YA 2GBCA 2RK3A 1E1CB 2VUSA 3QY9A 3E3NA 3UAGA 2FN3A 2TS1A 3IMKA 4QHSA 1Q1AA 2C2WA 1G18A 1KNQA 3W3AD 2ZDHA 4RAQA 5ELMA 2QMUA 2GKGA 1Q1NA 4BVAA 4IZOA 3BB1A 2QIOA 4DYVA 3ITNA 1X7XB 2XXAA 4K81B 1G2QA 3O8NA 2B2CA 3GLHB 4MNTA 4BU0A 4X61A 3HKKA 4RXTA 1JR8A 2JZCA 4CL8A 3ZPXA 3UK2A 5LZ9A 1SHZA 4WZAA 2UZAA 4YWQA 4CT5A 1QSGA 3ITEA 3EMDA 1P2BA 1SQFA 5CNJA 3LD9A 3ZU5A 3PQEA 4AIRA 1JLHA 2NV2B 2W8BB 2CEAA 1NKVA 1XRQA 1VL5A 1YJAA 3GLIB 4QBGB 4ZAWA 5FD8A 4PCLA 1J2EA 1GXSB 4LRYA 3MLBA 1M8JA 1OW3B 3MC1A 1HEYA 3MJCA 5IWAB 3U62A 2F00A 5A7FA 2IHTA 1ZNYA 3E4CA 4QE3A 3I52A 1G9TA 1YQDA 2VK8A 2VAXA 4YR7A 5FR1A 3S2FA 3DYBA 2X76A 3ZHUA 3FTFA 3MGGA 1JHAA 3Q41A 1SYQA 3QPAA 2QJWA 3LF2A 1KQNA 5I9IA 3FYUB 3ZU6A 3GF4A 1U1FA 4B7AA 2J33A 2ZR0A 1E6EA 4NENB 5AKXA 2PKQP 2B92A 4L8WB 5JANA 3BJZA 4L02A 1YNSA 1Y8RB 3OEHD 2XUAA 4UHHA 5ALHA 1BIFA 3GFFA 1TWGA 5DI9A 2DHEA 2Q4DA 1O54A 4WLNA 1GHTA 2VXCA 4TWRA 4WCDA 5DYGA 4ZO8A 1X8JA 2IZOA 1DE0A 1OIXA 5ALRA 3DXYA 1ZI8A 1Z28A 5K0NA 5ALFA 3X2SA 2QWXA 2CL0X 2G7ZA 4E2FA 2OV8A 4YJ3B 2QPOA 1JHOA 1IK4A 1QVWA 5I7WA 4ND8B 1VQ1A 1T8PA 3MG9A 2QN7A 4GZ6A 3D6FA 2FW0A 4HGRA 3AG4C 4LOKA 2GJAA 2JBAA 5YASA 3ZYCA 4NJOA 1SBZA 5L0IA 4E4TA 1V55C 3JRTA 1PEDA 4GEGA 2C9MA 4Q66C 4NARA 2ID9A 3MBOA 1V8BA 1OY1A 4Q7EA 2AWYA 1WBBA 3LY7A 1OXBA 2NMVA 2ZRMA 4F3YA 3RTBA 4CMIB 4MYCA 3I6QA 1RJGA 1M0EA 5FTMA 4MJLA 4WFIA 1BROA 5DU2A 4P3XA 3QXJA 1KR2A 1KNYA 1QVZA 4FYPA 1CY0A 4LZAA 4EENA 2QZJA 5JYDA 2YDXA 3TINA 3CSDA 2BFBB 2CJPA 1IZ0A 1PHRA 3LKDA 4B4OA 4P0PB 1SC9A 1L7AA 1ODFA 2IXFA 3HY4A 4EPVA 3V5ZA 1M34A 1SUSA 3NEAA 5KWJA 1ST2A 1USIA 1T9GS 1WB4A 1RTTA 2EG9A 4CMBA 3BL6A 2HV8A 1LLUA 2FPLA 1PNRA 1FDIA 3A6KA 4PSVA 3ZY2A 1WF6A 4YAWA 4DA7A 2VYCA 3D1JA 4DHWA 1XLWA 4ZT6A 4UTPA 5JC8A 5JBQA 3X1ZA 4ZIRA 3AM4A 4GZ5A 1C7RA 1T2AA 4J0DA 3AB8A 2FJ0A 1PGPA 2HRDA 4BGVA 4RE5A 1VKOA 1R7RA 1A0OA 1W36B 1QFZA 1QGOA 4ZHQA 2EPLX 1QS0B 4ZO6A 1I9GA 5BWNA 1WDTA 3F97A 5T67A 4JVLA 3WE7A 4YHHB 2LCHA 1SKYE 5A4KA 4XRRA 5HKOA 4NHEA 4IL5A 3SMVA 2E1PA 1T36B 4ASUA 3JASA 4RA6A 4M54A 1UWLA 3K0FA 1LK0A 4Q03A 3QZUA 3UK7A 2DG2A 3R6DA 2J0UB 4KR2A 3RUFA 4NCQA 2JGEA 3HDVA 4INZA 2J0EA 2DFLA 1MIHA 9GPBA 4PFSA 4GP6A 3CNOA 2EILC 2JKVA 1BXKA 3OE7A 4HYTA 3MSXA 2XE6A 4OBEA 4H3VA 4I2NA 2YBEA 5IUJC 1AB6A 2O1EA 4ER7A 5CTAA 2WKPA 4Q12A 3K0KA 1FDRA 4JZKA 3EMKA 3DQPA 3F9IA 5FEUA 1B7GO 2HWWA 4JEUA 2Q5EA 3SJZA 3C8GB 2C07A 2PS0A 3ZQKA 1MAWA 3H1EA 4NLLA 3P71T 4G4SP 3KWJA 3CE6A 3V5XA 2ZJ2A 5TR9A 2WKSA 5ECYA 1W5EA 3VGJA 3TDNA 3DOIA 1ZK0A 1CR1A 3PUIA 1P9WA 1GFIA 3F3YA 1GV1A 3CTMA 1QXSA 3RHZA 4ZT7A 4AJHA 3SF8B 4YT5A 1XZBA 4YJGA 1BYIA 5A3JA 5HKKD 4IJ5A 3FYHA 4RPHA 4Z4HA 3L6UA 1N9ZA 1Z8FA 3L7IA 1HC7A 1G8AA 2A9KA 2GJKA 4MI9A 4DRJB 4E5KA 1JPVA 5TQ2B 5F98A 3KQTA 4CDMA 3Q2OA 5E4JA 1BAPA 3VXKA 1K7YA 4F4CA 5EE9A 4RMIA 5EXSA 4TMXA 2OP0A 5A1JA 4R0VA 1D4ZA 3SEQA 4G97A 5B4VA 2AOTA 5JSYA 5TIIA 3QF4B 4KITB 2EG5A 3LIIA 5LQMA 4W1PA 3ZC4A 1O87A 1LI4A 2BFAA 4EABA 1ZR2A 1BGVA 2TSYB 2KLHA 1LV7A 3FHOA 3I5UA 3C1UA 2P9TA 3H0KA 3RNLA 5KC8A 4TLDA 4Y7DA 4J7TA 2XMZA 4Y18A 5BYKA 1ZBDA 2FN8A 3KNZA 1TAGA 1VMEA 4TVSA 2BGLA 2KGOA 1RP7A 1X80B 2H5IA 1Q91A 4U7JA 1A7VA 2JFGA 3KDAA 2HWUA 5IXJA 4Q21A 3OU2A 1UXGA 1JYFA 5DEIA 1P4SA 2YL1A 4DJ9A 4QBIA 4WCVA 3MBGA 3PNOA 3DZDA 2QRVA 2VTDA 2XYQA 4ZARA 5H83A 1WM1A 5HS4A 1RKXA 2OXCA 2IU6A 3L1MA 4G0VA 3SC2A 2KQUA 5B4UA 1SCBA 1RE1A 4NQZA 1AU9A 1KYIA 3QWBA 3WV5A 4JLDA 4FN5A 4YRGA 2NNLD 5TQ0A 2RH5A 2E0IA 1G20E 4C2TA 3HHEA 2RGRA 1V7QA 1J5XA 1QF7A 1YFZA 4EY7A 2NTNA 5KAPA 1ODKA 4PZAA 1SU7A 2NSYA 3AFGA 1YCGA 1KO8A 2DH5A 1D8TA 2ATVA 1FMFA 2JF0A 3ZJTA 2WHXA 1MKYA 4HB3A 4OHCA 4UOEA 3R40A 1L0BA 3C5HA 4DMHA 1L7RA 3MT8A 3FCYA 3LNTA 2QEQA 4F86A 3DMTC 1HE3A 3L04A 5DBGA 4YMUA 1UAGA 3M4JA 3OMXA 3IAS6 1T3SA 4TMVA 1S01A 2NV6A 3Q88A 5I5GA 5EXEA 1GV0A 3NDJA 3ASOC 4RKEA 4U9UA 4K9DA 4PRZA 4JUBA 3UMHA 4P5DA 5K0JA 3ZWAA 3AM5A 5BMVF 3HKCA 3FAPB 2NACA 4LBWA 5FI1B 3LT5A 1H6GA 3OD1A 4QQRA 5FWYB 1U1DA 2GHTA 3R7DA 3VYTB 1N5KA 4CVNA 1AKRA 3WOVA 1M6VA 5TMEA 2XRMA 5BUCA 4N54A 1TF5A 4DJTA 1IL0A 3DMRA 3R7AA 3W8HA 3CLRD 1NJ5A 3MCAA 3DDZX 5BRAA 4WXMA 2PSDA 1L4LA 4TL7A 2QAGA 4HNQA 1XX6A 2CXQA 3DPUA 3R7FA 4YV0A 1T2NA 5A9RA 4EA6A 1CK4A 1UQTA 4RORA 2J9WA 4M1KA 2NTVA 4A0RA 2BH2A 2VTEA 4XD7D 1JIVA 1WW3A 3AHJA 3ROQA 1IM5A 5DFAA 2SICE 3FUWA 1GZUA 4NH0A 1W49A 1XVTA 5HRCA 2JLSA 2G77B 2BM1A 1H2ZA 4CDNA 1I13A 2IXNA 3CGWA 3M2PA 1P45A 1HFEL 4EEKA 3JD2A 1WMFA 3F8SA 3CUKA 2ZJ1A 4DLAA 1E6UA 4L9AA 3KR0A 1Y3AA 1NTRA 3W5CA 1HY3A 3T5PA 5K20A 1V3TA 1VCNA 5CT9A 2GAAA 3V7WA 2HU8A 1O7JA 1O94A 3BA6A 5F4BA 4Z9BA 4K5QA 3FZYA 2D6FA 1F0NA 4PRKA 3OT1A 1E9BA 3DEZA 1A9XA 2QTVA 3BX1A 3DVLA 4C7MA 2AUTA 4KPUB 2HREA 4ZZIA 4BPBA 2WM8A 4Y98A 2GD6A 4C76A 3CZ6A 1M54A 4IEIA 3TZHA 1NSTA 1U7UA 2NVUA 4GP9A 2GA9A 3LP6A 3FI0A 1N34B 3HO6A 1JLLB 2YWHA 4IUBS 3SAJA 5JQWA 1VIMA 4QYXA 1CBUA 1WQ4A 5H7XA 3ZE7A 2MOKA 1E98A 2FWPA 1UJBA 5FTJA 5DI3A 4Z0PA 5L7TA 3BB3A 3Q6NA 4KJZA 4KYTA 3I05A 1DELA 1HE5A 1SN7A 1RQGA 2BFEB 4EEZA 3CT6A 1TT5A 5AW6A 2VRCA 2I29A 2HNAA 3T1YB 2XCSB 4NCNA 1V2GA 1TL7C 1Z2CA 4JCOA 4G8JA 2FF5A 4DUGA 2WD7A 4NNJA 10MHA 2WMNB 1BEEA 4BVJA 1XN1A 3D64A 3ET4A 3ILYA 5DT2A 1JQKA 1L7PA 4PO3X 1J0AA 1R18A 1GRCA 2QRQA 2C9DA 1D7AA 2W2MA 2HK7A 3S55A 4I3FA 2RI0A 5CK5A 3H1AA 1J1UA 1BN7A 1TPYA 2ZTUA 1KQ3A 4ZOLA 1NJ6A 2X2PA 3QFRA 1VPWA 2EWMA 5GONA 5C8VA 3OF5A 5FR2A 1U0SY 3ZV7A 4LX8A 1YOVB 2PGOA 3PEVA 1AK1A 1P8AA 4EY3A 4CE6A 1NMYA 3G0DA 2YXPX 4GVPA 3A1DA 1K6JA 1GPYA 3FTCA 4KN6A 5F5XA 5MDHA 1TM3E 4WQMA 4GGMX 2ZJOA 5F2NA 3WB2A 1NC1A 1UP4A 1V4BA 1YJGA 4AIIA 1CUWA 4DR6B 2GZDA 1YZQA 1V5EA 4X1OA 5A4AA 2ILTA 2P9ZA 1U7TA 1PZEA 2XSEA 2VAPA 5BT9A 1KAHA 1DEHA 1Z23A 1JHXA 4AY3A 2CDCA 1P0MA 3X1WA 5T6MA 2OT3B 3KZMA 1LQ2A 5GJWC 1BA2A 4R3UC 1PR1A 1MQ9A 1RWOA 2WD8A 4ZAYA 1WXQA 4JXZA 5CEJA 5LB4A 1XC7A 4HLUC 3A25A 4U63A 5EQDA 3AMVA 3TKAA 1Y7TA 1ZL2A 1GN8A 4F4BA 4C29A 3FOPA 2PGXA 2JATA 4MR8B 5GZ6A 2PUGA 1Q1QA 4CDRA 3PYMA 3LQQA 4ZEXA 4B34A 1Q0RA 2WZGA 2ZIUB 1WXGA 1KIAA 2J4CA 1BE8A 2ATEA 3ZWDA 2WT9A 5DN9A 3FHTA 3OP1A 4CM8B 3KT3A 1ZRSA 4Q7LA 3VYRB 3IOCA 1W34A 1OI4A 1UDCA 1OF1A 2FPXA 4FK8A 2ON6A 4UUBA 1YO6A 2G80A 2BY4A 2BFWA 3BGOS 3ZY5A 3TSZA 1JBEA 1OLOA 1WXEA 2BH9A 2WMYA 3RTAA 5BUZA 2DJIA 2I6TA 4DARA 2CKMA 3I1IA 1RXSA 3D6AA 1ZQ1A 4KLZA 4NFLA 4O33A 4RJTA 4B2YA 3KBBA 3AR3A 4IYRA 4C1BA 9LDTA 2A4MA 5FXMA 3ZQ6A 1HDRA 1II8A 4MVJA 3MAJA 1O95A 4JN6B 5EHXA 1ESEA 2HUJA 4ND3A 2W37A 2ZYGA 1KFKB 2NO5A 2ZXWC 4AP6A 4LRTB 1A7JA 1W88A 1DKOA 1QYXA 3EVTA 1Z2DA 5F1YA 1OLSB 3AQCA 3JZFA 3D6HA 5IJZA 1O0SA 1SKUA 3UICA 3HB1A 4BLOA 2R7WA 4BZZA 4EZBA 2PKYX 3VF0A 5JG7A 3G50A 4CM1A 3TLCA 1H2YA 1QCDA 4Z4QA 4Y9TA 1QK5A 4DPKA 4GKAA 4YDRA 4EARA 3OPYA 1I1OA 4QU8A 3ZQYA 3BCHA 1SVWA 2G1KA 5M2QA 1FFDA 1X77A 4CMGA 1KZHA 3K32A 1PZXA 1AZSC 4OIFA 5D3KA 2A30A 1A5ZA 1BNCA 3DUFB 1N7IA 4OHUA 4JUDX 1FTQA 1VSUA 4LTDA 1T3ZA 4E14A 1MFPA 4CTMA 4GLJA 4JOSA 4DJEC 2Z2YA 1PT7A 3JYNA 4FI3F 3TSAA 3TOLA 4FGJA 5EJAA 1W7AA 2H1IA 3P9YA 1W25A 1JQAA 2PLFA 4YDHB 1TD1A 1N5DA 3OM1A 1OW8A 3U4MA 4FXOA 1XMXA 1FDUA 4EF6A 3FYTA 3S27A 5ALYA 5JR3A 4RH0A 4REQB 5BSVA 4PK4A 4LDZA 4G2TA 3E1GA 3K8QA 1GNTA 2HBRA 3NAGA 3RBAA 4R69A 3HR8A 1ZUWA 3G0IA 3AO0B 5EIEA 1W0JD 3LXMA 1PWHA 3U2QA 4DAEA 2BSQA 4OP3A 3HCRA 4C3ZA 1CSEE 5EFOA 3R5HA 3CE9A 4CF6A 2YWGA 3KYCB 5JAOA 1E7WA 5AW3A 2G25A 1YHZA 2QTWB 1Z39A 2C0PA 4A8JA 3L1UA 2DHDA 3T7SA 5FBVB 1LKXA 2VC9A 1GCOA 3FZGA 2RHBA 3T15A 1V45E 3PVZA 3L06A 2G5CA 2RKWA 1YB7A 1K40A 4Q3NA 3CNBA 3IEUA 2HGZA 4UFOA 2GEJA 5A3QA 4Z54A 4NMLA 4BLVA 2IDMA 3F7OA 3N2GA 4YCSA 3VSAA 4B43A 1GGMA 1P1KA 3I12A 4DMMA 2JEYA 4QI2A 2C54A 1Q19A 3C5CA 5D7BA 3KLPX 3VO1A 4YCCA 3WNCA 3H04A 3H5TA 1VKZA 5A62A 1CR0A 1SHJA 1IPHA 3NBZC 1ZJ4A 3OQPA 4JLMA 4N0QA 2G1JA 4URYR 5L3SA 1GPKA 3Q0TA 4J03A 4CDYA 3U9SA 3CG0A 4OYRA 4ZWNA 1TQ4A 1YHYA 2OZEA 1TYCA 3CLUC 1WTYA 2NZYA 4QI0A 4CLOB 4A7PA 1D2EA 4KDFA 3O82A 3D6JA 2ZUWA 3VISA 2A69F 3CSKA 5BQPA 3AESB 4C7KA 2Y1FA 3BYZA 5DTEA 1HDXA 3O90A 2H0RA 3MGCA 3S28A 4JA0A 1HDCA 4ZXFA 2YW9A 3CNLA 1RQNA 4K9LA 3QJGA 4HF7A 3DEIA 4Y2GA 1CUVA 3A0UA 4JT9A 1TU3A 1JJIA 2JJ1D 1KAMA 3DLPX 3JWIA 3AY7A 4YIHA 2VK1A 5IF9A 4XEUA 4DBLE 2XVAA 4F2HA 3KOOA 1P0FA 3U4QB 2F8SA 4GKKB 3I72A 2FR8A 1LX7A 2BGJA 4B3JA 3PDIA 4RTOA 3QVWA 3M82A 4DA9A 1O9GA 5AKKA 1P3Y1 1EVIA 2L17A 3BJEA 4KWCA 1JG7A 2CVZA 1JA1A 1LE4A 4MIYA 1MOSA 1T8RA 5IABA 1KVSA 2BHLA 5CLGA 5FO0A 4G1CA 1UKVY 1MQ8B 2UXCB 4IWXA 1CULC 1XO1A 3I5MA 3I5AA 1P7CA 4FX5A 1PGJA 3C16C 1PIWA 1YS6A 1XRSB 2D1SA 4P7FA 1FLVA 3ZH9B 4TXLA 2PL5A 4QGFA 3PR2B 1I01A 1YB5A 3LEOA 4LF9B 3E22A 2V7BA 4RL4A 1FNNA 2G72A 2Q2OA 2QUAA 5AWFC 1L7DA 4REOA 4JB3A 1ZSNA 5BN4A 2FP4A 1JAYA 2C83A 4ZQFA 1B6GA 3BCRA 2W2QA 1L4BA 1PT5A 3RRNA 3EVEA 2C2OA 3ND5A 4AJ4A 3WLRA 3SY8A 4XEKA 3D5QA 3CISA 1H6DA 2VJOA 1NJFA 4PZLA 2ZKLA 3TZQA 3M6WA 1QTIA 5EZ5A 2H08A 3RROA 1ICEA 4H1VA 5DGXA 1SBCA 4M7OA 2GLTA 2G0AA 4J07A 1G55A 1RVV1 5AI9A 2XIQA 2R7SA 4IDNA 1AGNA 5TPWA 3IDAA 4OI0A 4ZEWA 4IIFA 4QPPA 3BFVA 1P44A 3RFTA 5CFLA 2RI6A 1D6NA 1O6CA 1CEQA 1TUBB 3MYFA 1J2YA 3VZSA 2VVTA 1CB0A 3QX8A 5KJEA 3FNRA 2QLBA 4XJTA 2W4MA 3HB9A 3GYBA 2I6FA 3EHMA 1YJBA 4RFSB 2EEPA 5F3RA 3KOMA 4NBWA 1DV2A 5JFTA 2Q6VA 3L6EA 4ZVRA 1GGHA 3ZHSA 2E55A 5HFNA 3PMRA 3LUHA 3AQ4A 2QOEA 4MVMA 4OG2A 2FNAA 5BQIA 4E4YA 2IUSA 3AIOA 2PBFA 1U0HC 3K2QA 4R0NA 3LGSA 3VU3A 4OQNA 3ZKWB 3JALA 2Q3HA 4Q7JB 4WSOA 5CA1B 1XZ8A 5K05A 8GPBA 4MAMA 5ES3A 3JRMO 1RRFA 1XQ6A 3NP9A 2BDUA 1N7JA 3U6KA 2RD9A 1U2QA 3VAAA 3X1MA 4KDRA 4C3BA 2VJKA 4F6RA 1L8OA 4BDSA 4G09A 1XD2A 5CXSA 3VKUA 5EWJB 5A4FS 1GNLA 2NPUA 3K7DA 2H06A 3PIIA 1HDEA 5HIJA 1QHGA 2CNOA 1JFFB 4DFDA 1KXZA 2OGWA 5BRNA 4KQ2A 2GJ8A 1U63A 1SVIA 3MD9A 4GMKA 3T3HA 5CMLA 3T5AA 2HHJA 1ZMBA 3V1UA 1E0DA 4Z6KA 2WC1A 3IPMO 1XDBA 3CRRA 1HURA 2XR1A 3LDHA 4F72A 4M6WA 4B71A 3KIPA 4WMLA 8MHTA 3N24A 3PDUA 1XCGB 3QU7A 1X9GA 2O0LA 1TEVA 1E64A 2DXIA 2NN3C 2FEPA 1GTMA 3UT5A 1Q57A 3QNMA 1XU9A 3E2PA 4N7JA 3QEAZ 4RELA 4E03A 3ZBUA 4LDAA 4YLYA 4JC5A 1J25A 5KQGA 2E5LB 1K3TA 2J3EA 5D7NA 3B52X 4EI9A 2V9CA 1UJ5A 2A6PA 2WZQA 2FN9A 3RVSA 4WBNF 2R5FA 3RVDA 4EGJA 3K09C 5IC6A 4HT3B 1X7ZB 2QN3A 5L0CA 2J9XB 1ONSA 2RCNA 5T3YA 4K87A 1Y1KE 5DGDA 4O63O 2B1GA 3G82C 1R15A 4F46A 3MS7A 3ESQA 3N6RA 2H8GA 2LCQA 3LY9A 3C4QA 3N0VA 3MTBA 4MPPA 4KO4S 1KFEB 2WKWA 1QHHA 3M5CA 4N8DA 1J09A 3M34A 1SG6A 4HTFB 5BUSA 4JC7A 1JBQA 4BB0A 1R4MA 4B87A 1SA0B 4X91A 4UE6A 1MT0A 4KO1S 5KOIA 4HGPA 3O6VA 1E8MA 2CB9A 3RYCB 4GYWA 4BGIA 4DM4A 2VQSA 4PIPA 3HBAA 4BUCA 3RSZA 4X1KB 2GTHA 1PT9A 3IQTA 2GPBA 3HPQA 3VPXA 3KR2A 1DOWA 2R6R1 2X1HA 5DHQA 4Y1FA 3F1LA 2DGDA 2KSQA 2ZPAA 5IMSA 5BW8A 3ZIUA 1ACJA 1CRQA 5EMMA 4IGEA 1A8QA 2C5FA 1JFVA 2AFRA 5DLPA 1KZ1A 2REBA 2XQFA 1NZEA 4K8RB 4NI5A 4OAQA 4IRUB 3OJ0A 4N01A 2WF5A 3RYFA 5K8LA 1ZSYA 1Z35A 1EJ2A 2WQ6A 4N6HA 2CYBA 2FDRA 3AP1A 5LVAA 1LLQA 3C7AA 4RD3A 1QWSA 1L5NA 2ZRAA 1Z15A 4Y6GB 5TJ9A 1IY8A 5IJAA 4L9SA 2Z98A 1KVQA 4C4ZA 1LTHR 1DWUA 1FYVA 4DBZA 1JJ7A 2V3WA 2I6GA 3I53A 3ZDYB 1V5GA 4TTQA 1AGPA 1N2CE 1J06A 2IT1A 4JNCA 2QR2A 1AHHA 1EX9A 4Y1RB 2ACEA 5ITSA 1KS9A 5CVDA 3SE7A 1W2WB 2PXCA 4HDMA 2IKQA 1M2NA 1JI3A 3EZHA 2XLHA 4NG4A 1YARO 2ODTX 5BT8A 3FA2A 4BE7B 3FSEA 2D4HA 3V8RA 4DHEA 2ZWPA 1A9RA 1USVA 1E3JA 3F3KA 3S8YA 4LRQA 4AZ3A 4CIPA 4XQEA 3LLUA 1ZA1A 4KVZA 1GA4A 3TOZA 4C7OA 2V59A 1XDGA 3OQJA 4PPYA 2IYZA 3FLAA 5L3QA 4CZ2A 2I1QA 2PRIA 1ODTC 2L82A 5BR8B 3ILVA 2A86A 2JL1A 3DBLA 4NATA 5KZMB 2CLSA 3B7WA 4YCLA 2EDCA 3SIRA 4HAWA 3CSUA 4HWTA 1U3TA 1TM1E 3ZTYA 3KELA 1R4AA 5LWHA 1YRBA 4GYJA 3ZWMA 4EKNB 2A9VA 3SDSA 1XRPA 5D8DA 3H18A 1JE1A 1ZH4A 3GJ3A 4ECEA 2VKTA 4M8LA 1HV8A 2WYWA 3I37X 1FJHA 2IEYA 2QK4A 1B8PA 3O1JC 5IJ9A 4NTFA 2W98A 4HAOA 4ENVA 1THGA 3JS5A 3FDFA 3HVJA 3DV0A 5KMGB 5AMXA 3HUEA 1LBQA 1R27A 2FZWA 5M29A 3EOBI 4KYIB 3MJVA 4MVYA 4JFRA 4NPAA 5NLLA 5CNIA 2G9UA 2ZB8A 4YGXB 4MI1A 2G4VA 1N1EA 3SHFA 4KVAA 3FM9A 3GPLA 3P4UA 2CF5A 3UWSA 4KYVA 1S96A 4BX2A 1MW9X 2X0CA 4V0MA 4M0MA 4IVNA 4URZR 3OLZA 4IWNA 1H6AA 3MNFA 2EV9A 4MP3A 5FFNA 2OVBA 4HH4A 5J2UF 2ZANA 2CF6A 4BNLA 4IIUA 5HKLA 3B1KA 2DE0X 3WSTA 3HDGA 5TVKA 4CM6A 3OM9A 1XWFA 4RSGA 3TOSA 2D5LA 3ICCA 3ASVA 2Q41A 4H27A 3PXGA 4FLFA 3RC9A 1XDDA 1NRWA 2GO1A 3E2IA 1RMTA 4F0JA 3GJ7A 1T25A 3H2VA 3D7KA 4RYDA 3ZEIA 3NOVA 1TQ2A 4D9NA 4I1UA 4KWEA 4DV2B 3RFUA 3SSNA 5IUKC 4BNGA 3HN2A 4MRNA 3FXHA 3ZLJA 3FD8A 1UC9A 1QORA 4TKUA 3LUKA 2VNKA 1XIVA 3EW7A 2EKLA 2Q5LA 4Q93A 3VR5A 2ECKA 1Z7BA 5BW6B 3LKZA 4R81A 3VH3A 1ZHHA 1U7ZA 3AILA 4ZJUA 3U39A 2O2ZA 2Q4EA 2FGYA 4I4TB 2Z08A 1USWA 1VKNA 2XD4A 5KWSA 4RVFA 1Y8QA 3HCAA 3NJ8A 3TW4A 3OQIB 4GC5A 4X85A 2R6JA 3ZVRA 1U0JA 3AW9A 4RV9A 4GS5A 4QAQA 1YB4A 4LLCA 2Q28A 4EA8A 3NKLA 4YROA 1PHPA 4G7OF 3BMCA 4YEDA 1S3FA 1KK0A 2VKQA 4OX9B 4FCCA 1ZUD1 3EGXB 2I3ZA 4PNHA 2HZ8A 5HF6A 3ZKAA 4G5QA 5I7FA 3G4ZA 4GWGA 4O4HA 2JLBA 3WYCA 2HMUA 1QGUB 3R6LA 4C6TB 1EESA 4AJPA 3FDQA 3WISA 2Q1UA 3H11B 2XMBA 4MYRA 4MVWA 3GK3A 2ZDQA 3K6JA 4NSNA 3ILSA 2D3WA 1GG9A 5GJVC 2YHIB 4XM1A 3FOOA 2FRVA 3GP3A 2BFPA 3EAGA 3WXBA 2WTMA 1V5IA 1LI5A 4YCBA 1T4GA 1GTL1 1IAVA 2DBRA 1LGYA 4BJHB 2LSEA 1YL6A 2H9YA 4JC8A 2BYTA 2XE7A 5IDVA 3RTGA 4QXQA 2BEUA 4GM1A 4H3KB 1HDGO 2AOUA 3N2LA 2FAXA 1H22A 4FNMA 4FSHA 2D54A 3NHYA 4JLVA 4MUEA 4IIVA 4RPCA 2BM0A 3EFHA 4ZVLA 4CDVA 5CH3A 3NTRA 5AVVA 1O03A 3OP4A 4HPWA 1U6JA 3D43A 5IM5A 3G7SA 1CETA 4C3VA 4NC9A 1CGNA 3IVCA 3D2BA 3IIMA 2ZTLA 3HI6A 1MQAA 2HC9A 3OPMA 5CT6A 1VSQA 5IAEA 1ELOA 2Y99A 4BLSA 3I92A 2GEVA 1KYYA 1YE8A 3P0FA 2AMVA 2HPHA 1QIMA 1JMYA 5TPZD 4NULA 1IG3A 1DT5A 4Z5XA 3RF7A 2QUBA 1LCIA 5B37A 4BJ6C 3FIUA 3T5TA 3EVAA 1PKEA 4ZQIA 3T5CA 3V7OA 2ZRQA 3N39C 1EVEA 3G13A 3A2NA 2R25B 5LP6F 2BUAA 2B7LA 2GPAA 5C81A 2V6GA 1F48A 1AV7A 2AI3A 2RSEB 4B6IA 2D00A 1R50A 2HIGA 1P29A 3ATPA 4D43A 2AEEA 4PLHA 5G0UA 4RV5A 5LNK1 4Z8XA 1QPGA 1QTNA 4CKBB 2WWTA 4AUEA 2C0CA 4MSUA 2IPNA 5FOTA 3S1AA 1OR8A 3QVTA 3D4NA 2VBCA 4P81A 1C9YA 3PXEA 5A7GA 4HY3A 4UDNA 1QK4A 4IDEA 4PEVA 1RC1A 1GKLA 3WDMA 4XPWA 4JI2B 2IXDA 4L74A 2Q9CA 1K2VN 2E48A 1JEAA 3SN6A 3RQSA 1V9LA 5T8KA 1BH2A 5GPBA 1EA8A 3SU8A 1QAMA 3QPVA 1VLSA 3RRZA 3AU8A 5JCOA 4XPXA 1MB9A 4PVDA 3Q3CA 5JYEA 1SURA 4JV5B 4IIJB 3GH3A 3ROEA 5D86A 3NHUA 3TGPA 1GGVA 4ZQHA 3PQDA 2VTVA 2PZMA 1CS0B 1BFKA 3V80A 2P8JA 3L0IA 1C5KA 1Z3CA 4JYAB 3OLXA 3RK4A 2HXSA 3N2NA 4DKXA 4RIIA 4TM8A 2Q6OA 2RGUA 4R2WA 3JQ7B 1PYDA 1NVUQ 5ECDA 4PC2A 2C4UA 3O8QB 4HK4A 4RVOA 1XRNA 3GLVA 5GMOA 1WB6A 2C5GA 1QAQA 3MTIA 4IKEA 3EUAA 4OMDA 2HLDD 4M0PA 2X5NA 4MQ4A 2J3IA 4K1OA 3W6NA 1YFLA 3CS3A 1XZAA 4UXHA 4B79A 1L3IA 3GFPA 1OV6A 1TQHA 1VHLA 3JWHA 2E5FA 2J6HA 2JNWA 1B3BA 4OA8A 4NCAA 4BO8A 3DEHA 3UW1A 4YRLA 1JAFA 4RKYA 3RT7A 1DWPA 1KC1A 2FLVA 3PX2A 3WQQA 3TK1A 2VR1A 3HB4X 4MVOA 2SCUB 4LJYA 4ERXA 3DWEX 2IYAA 4DOMA 4Z9JA 3THWA 4JI7B 1TM2A 4J8PA 4ARAA 1I2BA 1IXYA 3DCNA 1FEZA 2FEXA 1N75A 3ABLC 1J8VA 3B78A 1K06A 1LS1A 1R12A 4UCWA 4KXFB 2MYPA 3T7DA 2HMWA 3ZIDA 2BGGA 2MSKA 4YUVA 3DVQX 3IQXA 4ZV4A 1GGJA 3QW0A 3F6SA 3GLQA 4N65A 4QUKA 1SCJA 4UQPA 3FMPB 2OXFA 4ZZ1A 2ADOA 3F2VA 2REOA 3COYA 2HMQA 3Q3IA 4RJJA 4DIBA 2H51A 1W19A 3B8EA 3PUXA 3D0QA 1AUXA 1V1JA 3N0RA 1W5BA 3K1HA 2ZI7A 1GEGA 5JAPA 1YDHA 2G5GX 5F76A 1IEWA 1NBWB 2ZPTX 3CLUD 1UH5A 5BWOA 3JQFC 2WOOA 5BSMA 1LJ8A 5KSYA 2HYIC 1FFXB 1KDRA 3AF2A 4FYMA 4BMDA 2CCYA 3SD7A 5K03A 4I8IA 2X5XA 4GDMA 4WADA 4C0JA 1BJTA 2AV6A 3D8TA 1PN3A 1XAIA 4LZWA 3GUCA 2J9ZB 3DD1A 4MWGA 4YT4A 5AHWA 5JU6A 3HTXA 5BN5A 1MCZA 4DPMA 3DL7A 1ORVA 3IO3A 1NBMD 2IW1A 2LR0A 2Z5LA 4HYYA 3VR4D 4OSPA 4L5JA 3PGJA 4JR2A 1KI2A 2MR5A 4OGFA 4Y30A 2WFZA 2WZBA 2RAFA 1QP7A 4RD1A 2VHXA 3OPNA 5E95A 1DG1G 2E4WA 2R00A 2WWVD 2DKNA 1CPRA 1TVKB 1Y34E 4EHAA 1B4DA 2AXPA 2PSJA 3FR7A 3KT0A 4S0ZA 1JMVA 2C2ZA 1ZWKA 3ZGVA 3IOMA 2Q21A 3HCCA 3OEEA 4YAOA 3DCIA 4IGIA 1EI7A 3FWYA 3V5YA 5JPCA 4WUTA 5KJ1A 5GZ1A 4QEZA 5ADWA 4NNPA 1MO5A 4IIBA 1RR6A 1LB1B 1LSOA 5AJTA 3B9PA 4CKEA 1CZUA 2W2VA 3HJCA 1R0KA 2H00A 2OXEA 2X7HA 1GNVA 2JCXA 3SVLA 2VH5R 3RREA 5B3JC 3JATB 3ZD9A 2HKVA 1LTQA 4LY6A 5T57A 3OQOA 4B3IA 4TUYA 4RDHA 5CEFA 4AWBA 3NKEA 5CK4A 3NHAA 4HP8A 1FYDA 3U13A 3C43A 3TQRA 1JEJA 1ZP6A 3IUBA 4X20A 1LEHA 1ZM2A 3U3ZA 1MMFB 4ZDIA 3JARB 1K7EB 4MARA 4QTYA 2Z2IA 4I2VA 3GT7A 4D4LA 2JJQA 4PC3A 1NUPA 2VP2A 4N48A 3W4JA 1DTSA 4KQEA 5BVHA 3GNSA 2R6DA 1AQNA 3K1ZA 1GUAA 1OMOA 4IJJA 4CCYA 4MKIA 2JFVA 3E81A 1MDBA 3ABIA 4CL3A 2P2NA 3D8UA 4LGVA 3OIVA 3QUCA 3GAFA 3WHKA 3PITA 3LQYA 1S7CA 4LN1A 3R3JA 5K3EA 3IMFA 3VR5H 4TN1A 2O48X 4JC4A 1T4BA 2JIBA 5JH7A 2EPOA 1IJEA 3OETA 1XU4A 4FWIB 4D3ZA 1K6XA 5C52B 2M1ZA 4Q7KA 3S2IA 3SZOA 4IO0A 2JD0A 3WIVA 1T91A 5EK0A 4XQ0A 3VPFA 1LC3A 4U7DA 4AS1A 2XJ9A 2IUYA 1YRYE 3G2MA 2GHIA 1B6RA 2XWSA 1AMUA 3ZI4A 1EXWA 4O4JF 3U80A 1EFHA 3QVGA 5E3AA 4LSWA 3NP7A 2EZ8A 1SY7A 2PTHA 2Z57A 4JJGA 3CV3A 2QD1A 1G5FA 3BOSA 4E07A 1UMDB 3O39A 3A3YA 3A04A 3UGJA 1H8ED 3U4GA 5FPHA 1A4RA 2VCYA 4IHJA 2C03A 3NGXA 1RAIA 3MINB 5E3IA 3TSOA 1ICIA 3I6YA 2V6JA 3U17A 2DUNA 4C3DA 4OYLA 3IJ5A 3HA7A 3QXCA 3IHUA 1CDZA 1GU7A 1QH1B 3ORQA 4KRFA 4OX9Y 4BEJA 3PLAE 4J4BA 4UCFA 4HZUA 1GPNA 2R48A 1DLIA 1KK2A 1U02A 3HDTA 3T9OA 5CYGA 2CMKA 4OHMA 3DE5X 4OHXA 2ZBQA 3NORA 5EJ2A 3E70C 4IUDS 3DAOA 1CJCA 5B36A 3HWX1 4XQ1A 4DIFA 2QZSA 2WDZA 4PZZA 1Y6QA 4Y7CA 3S90A 1GG2A 3U0VA 1IVNA 4HNVA 3EEOA 3SJBA 4NOMA 2X3YA 5KYWA 2ODNA 4JBYA 1DKLA 3DI5A 4D26A 3TO5A 5HVNA 3NM4A 2VJQA 4A27A 4EI8A 1YKSA 5EE1A 3JSEO 3GJQA 2ZE8A 3Q9UA 4E46A 4DSZA 4J7CA 4O0LA 1Y5IA 1G5IA 3ZDEA 2BISA 1XU7A 2BTEA 2YL7A 4D8TA 1WVMA 4YY3B 4UFPA 4QU0A 4A2CA 1XP5A 1T5SA 1L1RA 3KL4A 1L3PA 2ZW9A 1QIDA 5DXJA 3NB0A 3ZJVA 1DQZA 2IM8A 2CCKA 3DA8A 2XIJA 2OPHA 2K2WA 1LBTA 1E0JA 4LI0A 3W0LB 4KI0A 1ULAA 5AJHA 1SVOA 3ENKA 4TS9A 4FCTA 5CVUA 4F8EA 3NYQA 1UBFA 4C43A 2QYHA 3ZK7A 1R3UA 4Z1OA 1PQUA 3MGBA 2RSLA 4EYKA 4QODA 2B7BA 3CLSC 1ZW1A 3UHAA 1D1QA 2PCLA 5FLXA 1K4KA 1LZLA 4RGYA 4WK0B 2NVBA 4PC1A 2QG4A 2JHAA 2UVQA 2VUHB 5D91A 2C20A 4M9SA 1Z5PA 2F1RA 3ZDRA 2PJZA 4CJXA 3HP4A 5DTIA 3QX7A 4LG1A 3A27A 1UC4B 3T61A 4DN6A 1TB4A 1C9DB 3HC7A 1ZINA 1MB3A 3BTVA 3IP7A 1UBOS 5EPUA 3C6MA 3I5QA 1RI5A 4KN9S 1L2TA 1NBHA 1UWKA 4F3RA 4IKOA 1MO4A 5L40A 5DISB 3UJNA 1VG8A 2FX3A 3M6MD 2G08A 3C6ZA 4E7OA 1VJ0A 1KS2A 1NQ5A 4ND7A 1M5RA 1JDSA 1CR2A 5AYVA 1PFKA 1YZVA 1ZNZA 3E0XA 5CIVA 3HKEB 4D4JA 4LZJA 2G07A 3IE1A 4QOFA 5FX2A 2IBSA 2C99A 3CUVA 3RVJA 2R86A 4B32A 3N2IA 4AO6A 2XVXA 1HMDA 1TIBA 4YUXA 1JT2A 1XQYA 4YH1A 3WWOA 3AHIA 1E2IA 4MV4A 1CE8A 3GUVA 4QNRA 1Q3HA 3AIMA 1MFZA 3LO5A 1FX1A 5JW6A 3RU7A 4LNAA 2B4TO 1QQ3A 4BV9A 4EFNA 2ZSJA 5BNIA 4BEMJ 2JI7A 4XWWA 3FCUB 2PLRA 3MMSA 3U3KA 2EFDB 2R7OA 2GXSA 1V8ZA 1WZIA 3GMIA 3TLGA 2IK8A 5H16A 1P62B 4D8XA 4J3NA 4I19A 1A77A 1TTHA 2H3EA 1OKKA 5DV9A 4B44A 4QUHA 4PLYA 1SEVA 5IKXA 4CUZA 3HKDA 2BFFA 3DTTA 3ZE1B 3EGCA 4LC1A 1K5GA 3QGMA 4RABA 1ZU5A 4ZCQA 2R1TB 1PJ4A 1HLPA 3SXZA 1KXJA 5JQGA 3WK9A 4J90A 5ICFA 2PBLA 4ZI7B 1ZEMA 2UVPA 1NXVA 4QBFA 3NHLA 4B9AA 3TQFA 1WY5A 4BGDA 4PHFA 5DNUA 3CB2A 4HWGA 1C0IA 4M0LA 3T6KA 2VQ3A 2AKEA 4FKZA 4DQUA 1XF9A 1GQOA 3LC0A 1C0EA 4MVXA 4OFXA 2HBYA 2C5SA 2DOKA 2HJ3A 3EXEA 2IXTA 1X2BA 1U7HA 3A05A 1WTCA 4QDJA 1SVSA 4HGZA 5KTKA 2Y0BA 1KEEB 2PD4A 1WXFA 4FVTA 3M5WA 2YLIA 4YP0A 3IAAA 2C8LA 3JQPA 2B25A 2Y1WA 5L7WA 1MD9A 3EZLA 1JAZA 3LEVA 3AUAA 4KNVA 3UMBA 4F9EA 4WAUA 4GX0A 2W5UA 2ZROA 3RQFA 1TTTA 1E9FA 1M8PA 3ZWKA 2Y0EA 3BG5A 3L8HA 2GTPA 4TQ9A 2CHUA 1GZHB 1G8KA 1TK3A 3QXXA 3K0AA 1NBIA 1V7PC 3NNNA 3IERA 3AQBA 4L9RA 4LOLA 1EXVA 3SZ3A 3KUCA 3AUYA 1R0ZA 2P4SA 3EUFA 4HUQA 3AVUA 2L69A 4YQFA 4OGLA 1BKDR 3SYNA 2VSOA 1ORHA 3SSOA 2Q6KA 2QD4A 2C3OA 4Q18A 2Q2NA 3QIAA 1SOUA 5JT4A 1Z0AA 4JXXA 3NBKA 4IFBA 4HEQA 2G9RA 1X3SA 5DTMA 2I2DA 3EGOA 4FDMA 4ZTUB 4RHTA 4HZGA 3NBUA 3IRUA 5L6LB 1AY0A 3RH3A 3EEQA 1QBGA 3CMMA 1CTQA 2P5YA 2Z95A 1HYGA 2UUPA 3RQIA 5A5VA 5GVRA 2IDKA 4X97A 4J75A 4ABYA 3DC2A 4MKFA 3KHKA 2FGJA 1JFTA 2LD4A 3AP2A 3PE3A 1IBCA 3FOBA 3QMWA 3WQHA 4CEHA 5EZYB 3I9LA 2OKUA 2KHZA 1CDOA 4NBLA 2ODQA 2NTEA 3CLVA 4F56A 1FXWF 4HXYA 2YV5A 4WGZA 1EZ4A 5BURA 3WA6A 5L6MB 5DTJA 3Q85A 3BT7A 2QDKA 3IBTA 2IIBA 3IV9A 3L0YA 1Z83A 4TWAA 5EQJB 3M83A 5K3BA 4MVCA 4CL0A 5AOAA 5DHAA 2XA9A 1BJRE 1RLOA 4IOMA 1UOQA 2PG3A 1FSZA 5E4FA 1ADCA 3O2QB 5IZCA 3DOUA 2OO3A 3BHNA 3KMIA 3HVIA 1GIAA 3J7TA 5ITVA 3STWA 5IP5A 3EFOB 3BH6A 2J07A 2LXNA 2JS7A 4C05A 5JCXA 1A9OA 2YWJA 1KI1A 1RNLA 5LXTB 3LDUA 4UBMA 2LRHA 3SIWA 4IJMA 3FDIA 4EW6A 3CX3A 3LT1A 2WU3A 1D3AA 5TVGA 1RJ9A 1LI7A 2KYRA 2EPMX 3A3KA 1VL2A 4XX0A 4TTVA 4EHHA 4EMSA 3JQAB 4FE3A 5K8VA 2GGSA 4I1MA 4WVLA 3WGZA 1OBOA 3CWZA 4D3SA 3CURA 3LK7A 5JMPA 5G4KA 5A6JA 1SU4A 1GM5A 1NNSA 1OCRC 2G09A 1Z12A 3IQCA 4U6NA 2GM4A 4QA9A 3C39A 4RVNA 1OPXA 3PC8A 4I1OA 3NPAA 3DS8A 3CRZA 4YYEA 3UOAB 1JMWA 4DJFC 2EQBA 2DULA 3W2GA 2PLNA 2C5AA 4JJ6A 3MQ4A 2W42A 4F2DA 4K8OA 2YWBA 4WN9A 4IZ6A 2QXUA 4OJNA 1JN0A 1P9NA 4G89A 4MI6A 4ZCRA 3PXCX 4S2EA 4YRRA 2QY9A 3V2GA 4F8YA 1SEPA 4WINA 4EX7A 1OOEA 3QTBA 2XXBA 4HDAA 3UXMA 3DLHA 3W1VA 4BMZA 4Q34A 3TNFA 5MHTA 1S4MA 1LPBB 4KFSA 2HLNA 1B2RA 3DR5A 4XARA 2CNDA 4QRDA 2L9JA 2VSFA 4AICA 3NBXX 1UBLS 1KJ9A 1ZY2A 4QU5A 1G5ZA 3N5KA 4N8EA 4FHZA 2J6CA 1LVGA 2CWDA 4WKBA 1LRJA 4A6DA 2EJVA 3EMBA 2JLRA 1C1XA 1TAUA 3VR2D 1JA9A 4DEYA 1GLGA 8LDHA 2R1VB 1DAFA 3S81A 1SQ5A 4Q6WA 3MHTA 1WXIA 4FUQA 4UNSA 4Y2YA 4P84A 2OCGA 2C8KA 4NZYA 4C89A 1IBMB 3BRWD 2XKJE 3BSYA 1E4EA 3W90A 4Q39A 2AB0A 3R9KA 2VATA 1MVNA 4CODB 1E0KA 1NULA 3H5NA 4L95C 5ESWA 2Z3WA 5CB4B 1WUYA 3N0TA 4YUYA 4E32A 4KACA 4NZMA 3TW6A 4P7JA 1W48A 2VT2A 1HW1A 1BYUA 2B1RA 3ICWA 3EHEA 4OHZA 3RQEA 1W30A 4TKLA 4RMJA 4JVMA 4BNXA 4GX5A 1D2GA 2OOCA 3H1GA 3W05A 4C0KA 1L5LA 1U8XX 3HDJA 4EKYA 4N5NA 3RUHA 1VFNA 3E1SA 3V55A 1BE0A 2B6HA 3IB3A 3L4SO 4LWOA 4QM6A 1J7JA 1OWNA 4C01A 3P20A 1JHPA 1Z6GA 5LA6A 4JCCA 1B68A 3TZEA 2QP3A 4EMBA 4R1SA 2G04A 5D87A 1GDDA 5KYYA 4BPRA 3DLBA 4YBRA 1E32A 4D25A 2BFNA 1VC2A 3R8CA 5LQNA 3AKEA 1U3DA 2VAVA 4L28A 2XZOA 1PT8A 1N6IA 3S8MA 2V98A 1XZPA 4AWXA 4I55F 1Q1ZA 2WT8A 2PSHA 2BCJQ 4V3CA 3AVWA 1GPJA 4NU0A 1DP4A 4GBJA 3G0CA 4ARIA 4RDAA 1FE8A 5BORA 3NIGB 3KEMA 3NT5A 2X2OA 2AXEA 5IKPA 2JAHA 1D4FA 3L3BA 2JPUA 4MYUA 1AIPA 2QVGA 4RPJA 1CVRA 3QEOA 2QX6A 4PR9A 3U7EB 1RAGA 4IW3B 1W0KD 2ZSKA 3AZOA 5LDGA 2FRXA 1DJMA 4FB4A 5HJEA 1JIIA 4QGHA 3G4XA 3ZQ4A 3BMQA 1NQTA 3D6UA 5AK0A 3VYSB 4NR0A 4CKZA 4D4NA 1BS1A 5HS6A 1PX0A 1VHWA 5KNDA 1JKXA 3GUYA 5JNUA 2QUHA 1DKUA 3FMGA 4Z7JA 2GYUA 3AIKA 3IV6A 4P4NA 2MYNA 5AKEA 3H9GA 5AVRA 2P0YA 3DDWA 1YI8A 4BY9E 3ZGLA 3L6DA 5FL7A 2PKWA 4KRYA 4D92A 3REFA 3FPAA 4LNUA 3DG9A 4KQJA 1V47A 1D0XA 1SMKA 1CW2B 4D9HA 2GWRA 2DCUA 1CXZA 4DLNA 3I5XA 3LYLA 4BKMA 3RU9A 2C2GA 3SHQA 3K16A 2BGRA 1W52X 1PFYA 3DP9A 1QIHA 2X1LA 4B33A 3HM2A 5IWCA 1KOFA 4OGGA 3PIRA 4MS4B 4MV9A 2AZ4A 5DNEA 5AI4A 2NU9B 1XKLA 2D59A 3HRIA 1V6AA 5A5DA 1KZ4A 4PRLA 5F2KA 5B4TA 4EGAA 1IPFA 1KKLA 1TD9A 5A5GA 3IFSA 1J9ZA 4MMXB 2AL7A 3ENNA 3ND6A 1N6LA 3WKAA 3QBJA 2DPYA 4E5PA 1M0SA 4FEEA 4WLUA 2V7XA 1W85A 4MI3A 2I4MA 4ZPJA 1QNFA 2R85A 3N7TA 4U5QA 3NHMA 3U7IA 3DXJF 4LYEA 2PAFA 2IGTA 2R5NA 4DNQA 4JIMA 3KKEA 3ANLA 1J0EA 3MA0A 4I8DA 3ZCXA 2FPGB 3S7ZA 2LD6A 1KETA 2ZJ4A 2XGJA 4UUNA 3KZCA 4P98A 2GWHA 3NBYC 2QY6A 1H2FA 3WS7A 5BNTA 4A4DA 4X41A 5CCBA 3QVJA 4QQFA 4JYMA 1N9GB 1V1RB 5HSWA 4Q9IA 1LW7A 2ZR7A 2V7PA 3SBOA 2PBEA 1XZEA 4W5NA 5E4YA 4ZKEA 4ZT4A 4WK2B 1P7WA 3OEWA 2XOKA 1H5QA 4PCUA 4YUAA 1YAUO 2NU6B 1EUDA 3S0JA 4LLEA 1PLLA 3MJ4A 4ZMBA 2R03A 4WA8A 3BL8A 3H8WA 3BRCA 2EBFX 1VPTA 4D4MA 3WRXA 2AFIA 1SQGA 3FYSA 3K73O 1UJNA 1COZA 4G65A 3VMFA 2YWXA 3ORFA 4MVJH 4Z0HO 5I5EA 2ZTHA 4AL1A 2ZJFA 3NFRA 1DDIA 2DBQA 1MABA 4RGBA 5CT5A 3OY7A 1UBKS 4UDYX 4DLXA 3D0RA 3UTCA 1A96A 3NCTA 1WSWA 5GPGB 3D2LA 3TTXA 3A6PC 4HDKA 5KWVA 4RTLA 2MDTA 2B8JA 5CW1A 3H05A 3UJ8A 2IS6A 1IY0A 1R66A 3ZIAA 1G4WR 1YTUA 2GM9A 2VSYA 1UOPA 4AYTA 4NMWA 2XUFA 5BN3B 3VPDA 5CAEB 3HNJA 4QU9A 1B00A 3DKVA 3AB7A 1RCTE 2AZXA 2BSAA 1X19A 2W6OA 3W2VA 1V7CA 1GR0A 1MRSA 1UMKA 3SEAA 4WWHA 3IAS1 8ADHA 2XE8A 2H2AA 4H9GA 4QRHA 2QM7A 2VZ8A 4NBNA 4YECA 2E2WA 3AK4A 3HWWA 2IITA 5C80A 2N1BA 3THOA 2UYYA 3ZHZA 2GDZA 5K6RA 3J06A 4PZUA 3T5GA 1NKSA 4W4TA 5JD3A 1RWWA 2YTZA 4LPKA 2LWIA 1DO0A 1HQDA 1ZI6A 1Z8NA 4KRGA 3T5MA 1SOWA 5DYWA 5IYZF 3QYJA 2EERA 3V00A 4ILEA 4MW0A 4UHFA 2D7DA 5BWLA 4C03A 4RVUA 5B5SA 4MQFA 1CCWA 4RADA 3ZV3A 5B2ZA 2PGLA 1NPYA 4RZQA 1M7GA 4UMDA 1J1IA 3ZJ4A 5B2EA 1NX6A 3UMVA 4E31A 2D3TA 2JFQA 1OZ0A 4JP1A 4UULA 1AQJA 1DUIA 1HG0A 2NO0A 4RK5A 3SYMA 256BA 1N5IA 5ILOA 4NV0A 2F3SA 3OIDA 2A1TR 5KAMA 4RKRA 5B1YA 4EAAA 4MKHA 4FINA 1NSGB 4CQLA 2JLUA 1DC3A 3HV2A 2P1ZA 2X5OA 3JQ9C 3E8SA 5JS7A 1EDOA 2AFHB 4UBOA 4LYFA 2HXGA 4Z0NA 4TZ0A 4RTMA 5JUWA 3HL4A 3FSGD 4EWLA 1NA5A 4L4XA 2XF8A 3DJYA 4CEIB 2BGTA 1S8AA 4UEJA 4KKXB 1T8TA 3O73A 2XRZA 4LGYA 2J7PD 4NJMB 3C70A 4JA2A 2H5JA 3BGIA 1LSSA 2YS7A 4BQRA 4BRUA 3GJ6A 2QUKA 4INAA 1OT3A 4RDIA 5AW7A 2JD2A 2I2FA 4LJ8A 4ZTZB 5JZBA 4Y2HA 2JIRA 3W3AA 4NCJA 2W0SA 3TD9A 1UMCB 3HEMA 1RLTA 4JKIA 1HFWA 3O94A 1YU9A 3PFKA 3G68A 2KPOA 4O2AF 2OQ2A 3CLSD 2XHZA 3SZGA 2YV2A 4AN0A 1Y9AA 3DTVD 2PO7A 1NDHA 4X45A 2PWZA 2EX4A 2WUWE 4NBSA 1XTIA 1DJNA 2IQIA 1SULA 1QFMA 2DHCA 4LV6A 7MHTA 4CMKA 2KC3A 1B0PA 4BAUA 2GZHA 2CYDA 3KWLA 1XNHA 3K1IA 2P78A 3E9RA 5DWVA 3LT2A 1RAFA 2BTQB 4QYSA 2ORED 1WOMA 4QOEA 1L7CA 2ZRHA 2DTXA 3LPLA 1T5BA 5D6NA 2D5BA 2XA1A 4URFA 4GRIA 3LU1A 1FUEA 3V1NA 2JH9A 4KE6A 3PA8A 2IWHA 4JVOA 1L5RA 1RACA 2XKBA 1T8SA 5TGTA 4FN4A 2B34A 3ROGA 1YBHA 1KEZA 4Q4HA 1DX9A 4AF7A 1ENPA 4IX1A 4Z9XA 1SVUA 4HLQB 3ZGZA 1WV1A 2YRWA 3KYDB 4QGBA 5A3RA 3MIIA 2PLWA 2P0NA 1MO3A 1E3SA 3A1TA 4PTZA 4DADA 1SXJC 4R2HA 2YINC 1PAUA 3GV0A 2H2DA 2QI9C 1U9CA 5C8YA 4M63A 2RJ3A 2F7SA 1Z16A 1K7CA 3ZGNA 3KDSE 1GT91 1TVEA 1XMJA 3OEHA 4LJ7A 4XASA 3V4SA 2JCSA 5ALTA 2QJTA 2FUEA 3JQEA 4OJMX 2AOVA 5HUQA 1RCUA 2ZSHA 3HJFA 1TO6A 3IGFA 3EF1A 3I2HA 1X70A 4BNMA 4IB4A 4EDFA 3QK7A 2V7GA 3PTZA 4LF4B 2XJ4A 3K1TA 4FD3A 4HWOA 2EKBA 5AHKA 3EVDA 4YN0B 3H9EO 1OFUX 1NMXA 3UGPA 2JA1A 3EA5A 4ZT3A 1L5FA 2YL0A 3MTQA 2XMGA 3HFRA 3EVNA 2M6RA 2DVMA 2L81A 2QD2A 4MWBA 1FP1D 4TYYA 1E18A 1I2CA 1EP1B 2F1KA 3GUHA 4Q9KA 5FBHA 4M0EA 2Z15A 1E3WB 2CEKA 4Q05A 1JDZA 5IG2A 4UM5A 5TGZA 1P0CA 1YH3A 5EG5A 2LK4A 4KDEA 3HA3A 1Q44A 2CXUA 2EQ5A 2WMOB 3QLVC 5J47A 1L4UA 4N3CA 1MAVA 4KGDA 3RYLA 3T6JA 2H7VC 4KIWA 4LERA 2ZE5A 4HFRA 4CIVA 3AEQA 4FDUA 1NQAO 4EA9A 3ED5A 4LXHA 2NPOA 2DTEA 3UQYS 1W94A 2BJHA 1MLDA 2C2HA 1S2OA 3P5BA 4CN8A 1F8YA 4JX9A 2H4XA 3WAJA 2BEWA 4M83A 4YRNA 2CD7A 5KNDH 3OEYA 1JHQA 1SBTA 5U4XA 2CB0A 2IYPA 4AUNA 4MUXA 1ZZEA 3KAKA 5DLQC 3RGGA 2H54A 3DXXA 2ZIXA 4YP1A 4G9EA 3L8YA 2GILA 4OXNA 4IMPA 2IU4A 3IT3A 4JVSB 4PR0A 3R2PA 3M3HA 3L93A 3W7VA 4LE0A 4GYTA 4BUZA 1FL9A 1BXRA 4IUYA 5CVEA 4KREA 1LRLA 5IU6A 2Q5CA 2FZVA 3ER6A 2ABWA 3WA7A 4YLEA 3ZUGA 1CZNA 1SUCA 2PX4A 2D5CA 2OWEA 1OGYA 2EBHX 5CA0B 3PFCA 2I62A 3FPLA 1XNRB 1R0BA 2Q5FA 2Z6VA 1CDEA 4PZ0A 4M89A 4Z3OA 2W48A 3C1AA 2AC2A 3VR4A 5FBZA 2Y69C 2PUCA 3QVVA 5E1DA 3BERA 3QSGA 3D1LA 1EUZA 5CBKA 4EWCA 3IR7A 1C8KA 1PNQA 3WGIA 1G5PA 1QKIA 2FPSA 4AUMA 2VTBB 3AETA 2PJRA 3IEMA 1N1CA 1SUDA 3E61A 3CEXA 2QTAA 3AEUB 1P1RA 2Z3ZA 1CJKC 3MBIA 1DFHA 2H7CA 5L7YA 4GWLA 5TJHA 1FVOA 3A4IA 3GDOA 2YV4A 2A1IA 1NUQA 2NAFA 1FXUA 621PA 3COJA 2E4AA 2HJGA 3VO9A 2DPMA 4LISA 4OM7A 3SVZA 4HQ6A 2O0HA 1ZNXA 3F96A 4H7EA 1PWEA 4DMRA 3ZTZA 1KYVA 5ED0A 4B3SB 1I4EB 3EZ7A 1EP2B 2RGXA 2Q5JA 4FHFA 3UBMA 2ZJ7A 5HKKA 3N87A 1ZUNA 3RQGA 1V3QE 3JXEA 3NYMA 3U9TA 1E2JA 3GCWA 2GJ9A 3LS2A 3OZXA 3AQIA 2Y05A 3AJRA 2ZFUA 4IZHA 3QLJA 5LQKA 3E9EA 4LJ4A 3TQHA 4N4WA 4ZV7A 1SUPA 3NWJA 1AF4A 3NLLA 2PZ8A 3ZGYA 3FOZA 4ZEMA 3SIPA 3TRIA 5LYJB 3S2GA 4XB2A 3GQBA 1V5WA 4MLCA 4MUIA 1YUMA 4ATNA 1DTWB 1ZOIA 3ZDFA 2YYSA 4ZVQA 3GJRA 4XLTA 2V3VA 1XJWA 3AFIA 4KQWA 4O4LF 3NJ4A 1YZUA 2WG2A 2WJIA 3F67A 3PNSA 5DGHA 3WP0A 2X0KA 3DMDA 4MDYA 1N6HA 1B8VA 3R8FA 4S1PA 3VDQA 4KPGA 1ZCFA 3CY6A 4OXYA 1M6HA 5IFLA 4IVPA 2WVAA 1OLXB 3KKOA 3ZEAA 5IH7A 4G7ZF 4TLCA 2HJMA 1BR1A 4H2DA 2GEDA 1ZD9A 4R1MA 3DBHB 4IV5A 1TNDA 1M1YE 4FGWA 2H57A 1U3UA 1H69A 2OO5A 1D0IA 1QV9A 4KGVA 4MAFA 4O8ZA 4XEFA 2XNDD 1LNSA 3VNSA 1V0JA 2G4CA 3U5SA 3KXIA 1A2KC 5DLYA 4A3SA 1Y3FE 4O2BA 3C5EA 4LCJA 2ZBGA 1D07A 3SG0A 4XGRA 2AN4A 4J2OA 3NNDA 4G67A 2Q3EA 3WKCA 2VF5X 3SCZA 1VDMA 3DULA 3W9YA 3EZ6A 3PJGA 3UIEA 2FPRA 4Q3LA 1XJCA 1H8EA 1LZKA 3CRMA 4OHPA 2HS5A 1JF8A 5HV9A 4INJA 2YS6A 4QPJC 3QVYA 1NLUA 2PZLA 2EZ4A 1LUAA 4C22A 2IXOA 3ZLBA 4OUDA 4IS2A 1QB7A 3EVGA 3JQ8A 3WMWA 2W6CX 1J2JA 1RZVA 4E09A 1XMVA 4HEHA 2WZDA 1RJWA 2W58A 4MB6A 4CF3A 2FQ1A 2FMHA 3R6GA 2UUCB 3I2FA 4PYOA 3LI2A 4R2IA 4QYMA 2IYTA 3LWZA 4P54A 4E0IA 1QYVA 3NC0C 3N2KA 2GPJA 3MCUA 4IFEA 4LSGA 4X71A 5DP2A 3ROXA 2DH6A 4EW1A 2GD1O 3N05A 3L79A 1Q6YA 3A6GA 1R74A 4YRCA 2HV7A 1PYOA 2NUTA 1RJFA 4YCAA 4GLLA 2FA9A 1DAPA 1F5NA 2XQKA 2CE7A 3EY4A 2Y76A 3OWTA 3NUGA 4R83A 1XEXA 3HE3A 1FSFA 1UZNA 4Y6OA 1GYQA 4RXUA 5JCZA 4AG3A 2EZ9A 1CJBA 2CV1A 2QS9A 2I65A 3RHTA 1EBBA 3GHHA 1I2MA 3OD5A 4YUWA 4JLPA 1E5DA 2Z9DA 1NFOA 3PI6A 1CF9A 2GESA 4MDFA 2I2AA 4CDGA 5BV7A 1DX6A 2EKQA 1T0UA 4KN5A 1ZRNA 3VDRA 1LNZA 1KORA 1FTYA 3WMRA 3F8TA 5KNCD 2XBMA 2WW8A 2EP8A 1XLTC 3VU1A 1I2DA 2YRFA 2OSBA 2FXVA 3ZE0B 5EJFA 5TGDA 1W4ZA 3AGPA 1ZK2A 1YQQA 3UC5A 4C2UA 3FSJX 5K6AC 3WGVA 2R7MA 4OKSA 4XD7A 2PUFA 3E7WA 2QVXX 4MR9B 4FYVA 3OTIA 4C7BA 2HO5A 1PO7A 2PD3A 3TLXA 4QWMA 3DDUA 2JARA 2WHYA 4BKPA 5LP6C 4B5LA 4HNAA 3FYCA 3II6X 2IPOA 4R54A 1G9XA 2V5AA 1O0CA 3FAKA 4IGAA 1R4TA 3L4KA 2IYRA 3OT5A 5AI0A 1H9AA 4CF5A 2VDPB 4BS9A 1GYPA 4YJ2F 1CVIA 3WGJA 3DTYA 1OW6A 2YOHA 4F60A 2ECQA 5IF3A 4NMMA 2XI4A 2A1UA 4Q1EA 1KSJA 3LUFA 3C4JA 4N18A 1E9EA 4DUYB 2AG0A 3UXHA 4EH1A 4IV8A 1QRAA 5JDCA 4ENQA 4GGPA 3E5NA 3RS9A 1AKU