1S05A

Nmr-validated structural model for oxidized r.palustris cytochrome c556
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
129
structure length
129
Chain Sequence
QQDLVDKTQKLMKDNGRNMMVLGAIAKGEKPYDQAAVDAALKQFDETAKDLPKLFPDSVKGLKPFDSKYSSSPKIWAERAKFDTEIADFAKAVDGAKGKIKDVDTLKAAMQPIGKACGNCHENFRDKEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c-556
publication title NMR-validated structural model for oxidized Rhodopseudomonas palustris cytochrome c(556).
pubmed doi rcsb
source organism Rhodopseudomonas palustris
molecule tags Electron transport
total genus 30
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2003-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 1s05A00
4ULVA 4CDVA 1YZCA 4N4WA 1M6TA 3TOLA 2XLEA 2XLWA 1JAFA 1BBHA 3IQ6A 1APCA 3ZQYA 4IAQA 1NBBA 3VRCA 3NMIA 1CGOA 4D4XA 3C62A 3DE8A 1E86A 4WGYA 4CIPA 1CPRA 3M15A 1YZAA 4CJGA 3QW0A 5JLIA 256BA 3M4CA 1E83A 2YL1A 2BC5A 2J8WA 3M4BA 4L6RA 5AGFA 4D4NA 2XLHA 4NC3A 3IQ5A 2XL6A 3C63A 4WGZA 1YYJA 4CJOA 5JSLA 2CCYA 1MQVA 4CDAA 1RCPA 4EIYA 2YL0A 5JP7A 2YKZA 3HNLA 3ZTZA 5JRAA 4CDYA 3TOMA 2XL8A 3FOPA 2YLIA 3L1MA 1GQAA 3QVZA 1CGNA 3FOOA 4JE9A 4JEAA 3ZTMA 3DE9A 2J9BA 2XLMA 3ZWIA 3HNJA 2YL3A 4U9DA 4IB4A 2YL7A 1YYXA 3QVYA 4U9EA 4JKVA 3HNKA 1E84A 5JUAA 1QQ3A 3QW1A 2YLDA 2XM0A 4CX9A 5JVEA 5B3IA 3NMKA 1LM3B 1CPQA 2YLGA 1S05A 4ER9A 1A7VA 2XLOA 4N6HA 3U8PA 2XLVA 3M79A 2XM4A 3NMJA 1E85A 2QLAA 5JT4A 4JEBA 1QPUA 3HNIA 5JS5A 1EKYA 3ZQVA 4IARA 2XLDA
chains in the Genus database with same CATH superfamily
3DI5A 1HE9A 5E3AA 3WG7C 4DBRA 1AVOB 1YZCA 4N4WA 5KYUA 1M6TA 3TOLA 2XLWA 2Y3HA 2ZXWC 1U0BB 1I4ZA 1ZHZA 3JYYA 3UMIA 2OCCC 1T01A 1U6HA 4J32B 4AX2A 1OKKD 2P61A 2WB7A 3EZIA 5A6KA 3EGDA 4MVUA 4IAQA 3ZC4A 3S0XA 2TMVP 1O5HA 1RJ9B 3ZSUA 1NFOA 2B0JA 4AE4A 2G62A 4NTBA 4E7SA 5L3VA 1TFKB 3MBGA 3NYJA 2AWCA 4JJGA 4NCQA 3K1HA 2H7BA 3ASOC 3C62A 3EH2A 3DE8A 5FCLA 2CYDA 2HKVA 2QNLA 5F5FA 4OD5A 3I5PA 3X2QC 2CNWA 3U3FA 3S84A 4LDQA 3SXKA 2L9JA 1Z3IX 3M4CA 3LEOA 3NKEA 3JTLO 4I1MA 4JIOA 3S29A 3AG2C 1UFBA 2DYRC 2BC5A 2IXPA 2Q00A 2J8WA 1EQ1A 4Q5SF 4JTDB 2DI3A 4DRJB 1RXQA 1D1CA 2WZFA 3FAPB 4B6IA 3DXJF 3JSEO 1D0YA 1Y4CA 3LLIA 4NC3A 2OJED 4LLEA 3RQEA 2AVKA 2VASA 1V4AA 4E7ZA 4IRUA 5DVWA 1M57C 2HJ3A 1M2VB 2IBFA 2P0NA 1YYJA 1MMAA 2C03A 1ZHTA 4Z9HA 4BJ5C 3O55A 5B3SC 2ZD9A 1VB5A 5COGA 3LS1A 3PHF2 1HE1A 1Q0KA 1RCPA 1RKCA 2W45A 3V5XA 3RYLA 2HS5A 1DOWA 2XS1A 1TWAA 2A6HF 2L7AA 2V26A 3HNLA 1LIHA 1ORJA 3V7OA 4BEJA 4BG0A 1H9TA 4QI2A 1I5NA 1V74B 3T4RA 3TOMA 3VYWA 3QMKA 4JJFA 4OIPF 2VH3A 4MS2A 4XPWA 3L1MA 1NU9C 3U9MA 2G3KA 1RMVA 1Z5ZA 3IQCA 4EWCA 2KW3C 3ABLC 2L81A 5DS4A 1FAPB 3GEIA 3EHMA 2HMQA 4OIOF 2P1AA 3GEEA 4JE9A 4MTGA 4F4BA 1ZU4A 4YT2A 4O6YA 2ZXRA 4GQHA 3UMKA 4DBQA 1HMDA 3JCUQ 1WASA 2QY9A 2AP3A 2VCBA 4YL3A 3OWTA 2Q9AA 4JURI 1Z7Qc 4FWVA 2JPUA 1T6IA 3UR3C 4WABA 1NG1A 3G4XA 4GEHA 2J9UA 1NFNA 2YL3A 1WN0A 4Z9IA 4EUKB 1PD1A 2YL7A 1KU2A 1YYXA 3M1CB 3QVYA 4JKVA 2LCHA 2KQ9A 2R25A 3C8GD 3HNKA 2EILC 4JTCB 4DXWA 5HSWA 1OCCC 2XM0A 3DWWA 1D0ZA 1M2OA 2H7VC 1RJ9A 4IGGA 1CPQA 1DOVA 1LM3B 1V54C 2XSEA 3AJMA 2PX0A 4ER9A 2VB6A 4Q7CA 3GM1A 2JX0A 2XM4A 4BPMA 3HTKC 2EIKC 3RH3A 5L0FA 2HSQA 2IXNA 2LD6A 4MVOA 3WAQA 2R9RB 2ZPAA 1QPUA 3CEXA 3HNIA 2LK4A 5JS5A 1CGME 1TWHA 4YT5A 2Y39A 3GEHA 3KPHA 3KH2A 1VTMP 4JRZA 4E18A 1LVKA 4IARA 2FFHA 1G5ZA 1T6UA 3US6A 4BJ6A 4OD4A 1FFTC 5B1AC 4Q4ZF 2X51A 3JRMO 2V3CC 2M4EA 2KC3A 3I5QA 1YVIA 1WOLA 3RQGA 1OW8A 2EPLX 2KGOA 4J7TA 2L6GA 3Q7LA 3OEOA 1RKEB 1S7ZA 5TJ5E 1ZYRF 2BE5F 3AQBA 3NG1A 1M2VA 5KYXB 3BEHA 4KNWA 2EIMC 3NYLA 3W2VA 3MYFA 2HV7A 3DD7A 1ZW3A 3NMIA 3G50A 3UGPA 3UNGC 4ULWA 3JRTA 4J7YA 4WGYA 2RD9A 4DRIB 4CIPA 1YZAA 3M15A 1I4YA 3VM6A 256BA 1MMDA 4NTAA 4XEFA 3RIPA 3RW0A 1E83A 4M63A 3K66A 2NSGA 1GS9A 2NUTB 3DAFA 4I44A 4P9FA 4DVYP 3T6JA 3KKBA 1EI7A 3TJ5A 3M4BA 4U5FE 3ZG1A 2IYLD 1HMOA 3JYHA 3WHNA 2KJGA 3AG1C 2P6VA 3GM2A 5A6AA 1Q0MA 4D4NA 5DQTA 4G7OF 2R7XA 3AGTA 3POVA 4DOZA 3U9JA 2WZGA 4CIHA 5T1DB 2JD3A 2WVQA 5T3WA 3W8HA 2Q9CA 5JSLA 1TFOB 2J9WA 4HE8D 4EKWA 4U5BE 3KL4A 4GYTA 4ANJA 2O9XA 2IM8A 4OIRF 3K7DA 3QZCA 2CGEA 3GM3A 2G3VA 2YKZA 4PK4A 4R32A 4CDYA 4CSAC 3Q7GA 1ZHXA 2HZ8A 4YL0A 1MNEA 4HFKB 4YT8A 1L3PA 2AWYA 2F22A 2J9VA 2FAPB 3FOPA 3N2ZB 1VMAA 1OKKA 2YLIA 2IXOA 1ZVZA 3C8GB 1A41A 1NZEA 3ECSA 1FR0A 4XQ1A 2EPKX 4PACA 5T3TA 1FMWA 1SZIA 3QVZA 1T9KA 2CDQA 1CGNA 1ZU5A 1OCOC 1WGWA 2NUPB 3FVYA 5D91A 3RKOF 3U0CA 2R7VA 2MHRA 5COFA 3S9OA 3V5YA 1TWCA 2ETSA 2R7QA 1PCXA 3L0IA 1D1BA 2EPMX 3LEVA 4RBNA 4YK5A 2HMZA 5CI8A 1F1MA 3LNRA 2J9BA 3JZ0A 5B1BC 1Z63A 1G4US 5L0DA 2LQGA 4U5GA 3EH1A 1YARO 4OINF 3SXMA 2C04A 2I15A 3KMIA 3VF0A 2PBEA 4MNDA 2QTVA 3FAJA 4ZLDA 2PX3A 3EHNA 3MFNA 1OCZC 4H54A 2E87A 4U5CE 1C02A 4I3MA 1LS4A 1RKEA 1SR2A 3QW1A 2YLDA 4LDRA 3H65A 2EPNA 2IXMA 3AOUA 3R2PA 4YJWA 3T6BA 2R7OA 4CX9A 3NMKA 5KYXA 4N06A 4KI2A 3Q6MA 2EPOA 4BJ6C 3SXYA 3MLGA 3UMHA 1NSGB 3K33A 1ST6A 1WTYA 2DGJA 1K05A 3DJUB 3GANA 3H2UA 1OR2A 4N6HA 4CS7A 4CSAA 1JPNA 3NMJA 1BR2A 3IPMO 2A6EF 3J06A 4U5DE 3B29A 4NY3A 3ABMC 1A7DA 1JOGA 1ZHYA 4JEBA 1EKYA 1QVXA 3MX3A 3DMDA 4O79A 3U3BA 1PV3A 1ORSC 2J46A 1HW1A 4XLNF 2NUTA 4ULVA 3EG9A 3U5SA 3X1OA 4CDVA 2J7PD 4MVZA 1O3UA 1E2XA 1Z23A 2QE9A 3B0UX 2XLEA 3RF3A 4DJ9A 1JAFA 2LIGA 2UUIA 4K1OA 5F5HA 1ZW2A 2YQYA 4JTAB 3TD7A 3GWLA 2YVKA 1BBHA 2Q4FA 1APCA 3IQ6A 2NSFA 4Z9JA 5KYWB 1IZMA 1YA7O 2WZLA 3R7CA 5EHHA 1HY5A 3S27A 4C3EA 3K6BA 2XXAB 1XWJA 3MYIA 3LLKA 3B0PA 3LS0A 4W8KA 3RFYA 2P7VA 3Q6NA 2MWQA 2NPUA 5FZTA 4IAOA 4NTFA 1KTMA 4P9TA 3VRCA 2DB4A 1XZPA 3CAXA 1Z6AA 1CGOA 2UUHA 3F47A 1AEPA 4MVSA 1G4WR 3DM5A 3PCVA 2GFHA 1HW2A 4FAPB 5A6BD 1MNDA 2R7RA 2PFDA 1A0BA 1CPRA 1QLEC 2LFFA 2VCCA 3V5ZA 4CJGA 4XTKA 5A6JA 1J8MF 3T9OA 4CS8C 5CI9A 3C8GA 3PMRA 1N1CA 4BJTA 2YHSA 2I8BA 2YL1A 3C8ZA 4C7OA 1OXBA 4BJ1A 4MTOA 4XWJA 3QTHA 5AGFA 4HFFB 1OW6A 1YJGA 2NUPA 3CZ6A 2KK1A 3HKKA 4KBLA 1MMNA 1W2WA 2KNHA 4PFOA 3OA1A 3F46A 4PFPA 2XLHA 4K7BA 2ZXOA 5KYYA 3IQ5A 3ITFA 1R5ID 2Y3GA 5AC5A 3U2MA 4U5EE 4XEVA 4CJOA 3HLZA 4XPXA 2R7UA 3G4ZA 3E9VA 2OU6A 4G7ZF 2LSEA 3RVZA 3FMSA 1MMGA 3ATPA 5JP7A 2Y3DA 2Q3TA 1QSPA 3ABKC 2A0BA 3TK0A 5GPGB 3LUTB 3SEOA 3TJ6A 3DM9B 1JRAA 1YLMA 1FNTc 2FGYA 4IJJA 1H7IA 1OXKA 5F28E 3ASNC 3EG9B 4MVMA 4ZLCA 1NU7D 3B9QA 3LAYA 4RDAA 2YZSA 4MVRA 1O87A 3TULA 3E70C 5BQGA 3W4YA 4YL1A 1Q0DA 2D5RB 3H2VA 5E3CA 4QDLA 4CS9A 3FOOA 2HFIA 3JT1A 3SXZA 4G78A 1YAUO 5DQZA 4CS8A 4LERA 2OJQA 2HV6A 3ZTMA 1TR2A 1J8YF 3AG4C 3L8JA 1JMWA 5DS6A 3U2LA 2EIJC 1PD0A 2Y3BA 3KYIA 2EINC 2XLMA 3VAYA 3W2WA 3ZWIA 2W4MA 5L0JA 1VOMA 2R7SA 5IY5C 3HNJA 4U9DA 1TQGA 3K1IC 2CNWD 4MVQA 3FDQA 2R7WA 5BQHA 1V55C 4H4KC 4G0HA 5D92A 1ORYA 5KYWA 3RQFA 1SF8A 3SNHA 1E84A 1YDIA 1LI7A 2Y69C 5JUAA 2XXAA 2R05A 2OOCA 1VYIA 3L8IA 1ZZPA 4EHPA 1T6QA 5B3IA 5JVEA 5E33A 4C7OB 4O6NA 2YLGA 2YEVA 3SZRA 2XLOA 2XL4A 4JZAA 3KYJA 3NYMA 1LS1A 2OEXA 1GGQA 4MQ9F 1LKXA 1LPEA 2QLAA 2VC9A 1SMYF 1NLXA 2W9YA 2ZXPA 3EZHA 2GA0A 3EPVA 5KYYB 2L6HA 3AG3C 1FMVA 3LNMB 2ICWG 1LE4A 4KC9A 4KNVA 2LP4A 2L6FA 3EJNA 3O10A 4DVZA 3ZQVA 3BRJA 3EGXA 5CIVA 5HV9A 5JT4A 2D4UA 3IQTA 4XPYA 3GORA 4J30B 4JVSA 1BZ4A 1H6GA 1BDJB 2OEVA 2Q9BA 3A9CA 2WVNA 3EQLF 4MTFA 1R4TA 1B68A 3IHUA 2IOQA 2BL2A 2CW0F 5KYNA 1FFHA 4PJLA 3ZVRA 3ZQYA 5L0GA 1IW7F 4X0RA 4DRHB 1XZQA 3A11A 1NBBA 3EFOB 3FXHA 3K1IA 5L0HA 4OIQF 4YN0B 1OCRC 1OW7A 1TWGA 4FESA 3U8VA 2M64A 4O7GA 3CSKA 2RSEB 3CQZA 4ONSA 1D0XA 2YRFA 3SP1A 3B71A 4D4XA 1WWPA 2B0HA 3O39A 4E0HA 3AGUA 4QI0A 2XS8A 3DAGA 1E86A 2WL8A 4PJNA 2GDCA 3TQOA 3HJCA 3QW0A 5JLIA 5EK0A 4PJJA 1VLTA 3JSZA 3FHDA 3N24A 5K0IA 3PDMP 2OG2A 4FX5A 4I1OB 2NG1A 2A0UA 3UGOA 1FTSA 4N6CA 3LESA 4WJ0A 2OQMA 5KYUB 2A68F 4LLCA 1Q0FA 4L6RA 1TKNA 5L0IA 5A6BA 4LACB 2AU5A 3EGDB 2KYHA 1VLSA 2XL6A 4C3BA 5AC4A 2R7TA 4K0DA 4NQFA 2Q7RA 2WVOA 4YT4A 3C63A 3RVYA 1K40A 3NKDA 2ASRA 4WGZA 1VYKA 2J0XA 3O6XA 1D1AA 3DJNB 4AE4B 4A4AA 2H8AA 1U89A 4O6MA 4CBEA 3I4UA 2YWAA 3WODF 2CCYA 1MQVA 3GODA 2R03A 4RD9A 4W8PA 2YL0A 3S28A 4CDAA 2J7PA 4EIYA 4CS9C 1A7EA 1SYQA 4PR9A 2HJMA 3ZTZA 5JRAA 1L7CA 3NRHA 3ZDLA 3C18A 3SYNA 3EGXB 3S90A 2XL8A 2X0CA 4AL0A 1LI5A 4EBKA 1JR8A 2XRHA 4JCZA 4BJ5A 5BQIA 1QKRA 1GQAA 2HSBA 2PF4E 4MW8A 3T6GB 1Q0GA 1G8XA 3L34A 1ZHWA 4JW1A 3AQCA 5DLJA 4C3DA 1WATA 4PJMA 4AK9A 1KNYA 1OQCA 4U5HA 4BEMJ 3C7JA 2HUJA 5COMA 4JEAA 3LJBA 2J45A 1YA9A 4E0IA 4G7HF 3B0VC 5L0CA 3NDBB 1C03A 2H7OA 3DE9A 1H9GA 5DS5A 5EGYA 4JC7A 4LDKA 4XLPF 3IEEA 1Y6DA 2QUPA 1QZXA 2DYSC 4XEKA 1VK5A 1EA8A 2J0WA 5E2QA 4IB4A 3GWNA 2GWWA 4U9EA 2W4BA 3DZAA 4P6IC 4E17A 1M56C 1UG7A 1QQ3A 3W8IA 2PNOA 2PP4A 2MYSA 1K04A 3EFOA 5BUOA 1LE2A 2LFDA 1S05A 1A7VA 4JCHA 4YWQA 2VCAA 3U8PA 2A69F 1BR1A 2XLVA 3DKAA 2OKUA 3M79A 2Z15A 5A69A 2KSFA 4HEAJ 4IWBA 1E85A 1GM5A 2R02A 4A2NB 1T5OA 4AL1A 1OR3A 1JPJA 1BR4A 4UDVA 3ZIBA 2GAQA 4EBJA 2A1DD 4MW3A 5L3QA 1C17M 3N0TA 4EBBA 1AUEA 2XLDA
chains in the Genus database with same CATH topology
4ULVA 4CDVA 1YZCA 4N4WA 1M6TA 3TOLA 2XLEA 2XLWA 1JAFA 1BBHA 3IQ6A 1APCA 3ZQYA 4IAQA 1NBBA 3VRCA 3NMIA 1CGOA 4D4XA 3C62A 3DE8A 1E86A 4WGYA 4CIPA 1CPRA 3M15A 1YZAA 4CJGA 3QW0A 5JLIA 256BA 3M4CA 1E83A 2YL1A 2BC5A 2J8WA 3M4BA 4L6RA 5AGFA 4D4NA 2XLHA 4NC3A 3IQ5A 2XL6A 3C63A 4WGZA 1YYJA 4CJOA 5JSLA 2CCYA 1MQVA 4CDAA 1RCPA 4EIYA 2YL0A 5JP7A 2YKZA 3HNLA 3ZTZA 5JRAA 4CDYA 3TOMA 2XL8A 3FOPA 2YLIA 3L1MA 1GQAA 3QVZA 1CGNA 3FOOA 4JE9A 4JEAA 3ZTMA 3DE9A 2J9BA 2XLMA 3ZWIA 3HNJA 2YL3A 4U9DA 4IB4A 2YL7A 1YYXA 3QVYA 4U9EA 4JKVA 3HNKA 1E84A 5JUAA 1QQ3A 3QW1A 2YLDA 2XM0A 4CX9A 5JVEA 5B3IA 3NMKA 1LM3B 1CPQA 2YLGA 1S05A 4ER9A 1A7VA 2XLOA 4N6HA 3U8PA 2XLVA 3M79A 2XM4A 3NMJA 1E85A 2QLAA 5JT4A 4JEBA 1QPUA 3HNIA 5JS5A 1EKYA 3ZQVA 4IARA 2XLDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ULV A;  4CDV A;  1YZC A;  4N4W A;  1M6T A;  3TOL A;  2XLE A;  2XLW A;  1JAF A;  1BBH A;  3IQ6 A;  1APC A;  3ZQY A;  4IAQ A;  1NBB A;  3VRC A;  3NMI A;  1CGO A;  4D4X A;  3C62 A;  3DE8 A;  1E86 A;  4WGY A;  4CIP A;  1CPR A;  3M15 A;  1YZA A;  4CJG A;  3QW0 A;  5JLI A;  256B A;  3M4C A;  1E83 A;  2YL1 A;  2BC5 A;  2J8W A;  3M4B A;  4L6R A;  5AGF A;  4D4N A;  2XLH A;  4NC3 A;  3IQ5 A;  2XL6 A;  3C63 A;  4WGZ A;  1YYJ A;  4CJO A;  5JSL A;  2CCY A;  1MQV A;  4CDA A;  1RCP A;  4EIY A;  2YL0 A;  5JP7 A;  2YKZ A;  3HNL A;  3ZTZ A;  5JRA A;  4CDY A;  3TOM A;  2XL8 A;  3FOP A;  2YLI A;  3L1M A;  1GQA A;  3QVZ A;  1CGN A;  3FOO A;  4JE9 A;  4JEA A;  3ZTM A;  3DE9 A;  2J9B A;  2XLM A;  3ZWI A;  3HNJ A;  2YL3 A;  4U9D A;  4IB4 A;  2YL7 A;  1YYX A;  3QVY A;  4U9E A;  4JKV A;  3HNK A;  1E84 A;  5JUA A;  1QQ3 A;  3QW1 A;  2YLD A;  2XM0 A;  4CX9 A;  5JVE A;  5B3I A;  3NMK A;  1LM3 B;  1CPQ A;  2YLG A;  1S05 A;  4ER9 A;  1A7V A;  2XLO A;  4N6H A;  3U8P A;  2XLV A;  3M79 A;  2XM4 A;  3NMJ A;  1E85 A;  2QLA A;  5JT4 A;  4JEB A;  1QPU A;  3HNI A;  5JS5 A;  1EKY A;  3ZQV A;  4IAR A;  2XLD A; 
#chains in the Genus database with same CATH topology
 3DI5 A;  1HE9 A;  5E3A A;  3WG7 C;  4DBR A;  1AVO B;  1YZC A;  4N4W A;  5KYU A;  1M6T A;  3TOL A;  2XLW A;  2Y3H A;  2ZXW C;  1U0B B;  1I4Z A;  1ZHZ A;  3JYY A;  3UMI A;  2OCC C;  1T01 A;  1U6H A;  4J32 B;  4AX2 A;  1OKK D;  2P61 A;  2WB7 A;  3EZI A;  5A6K A;  3EGD A;  4MVU A;  4IAQ A;  3ZC4 A;  3S0X A;  2TMV P;  1O5H A;  1RJ9 B;  3ZSU A;  1NFO A;  2B0J A;  4AE4 A;  2G62 A;  4NTB A;  4E7S A;  5L3V A;  1TFK B;  3MBG A;  3NYJ A;  2AWC A;  4JJG A;  4NCQ A;  3K1H A;  2H7B A;  3ASO C;  3C62 A;  3EH2 A;  3DE8 A;  5FCL A;  2CYD A;  2HKV A;  2QNL A;  5F5F A;  4OD5 A;  3I5P A;  3X2Q C;  2CNW A;  3U3F A;  3S84 A;  4LDQ A;  3SXK A;  2L9J A;  1Z3I X;  3M4C A;  3LEO A;  3NKE A;  3JTL O;  4I1M A;  4JIO A;  3S29 A;  3AG2 C;  1UFB A;  2DYR C;  2BC5 A;  2IXP A;  2Q00 A;  2J8W A;  1EQ1 A;  4Q5S F;  4JTD B;  2DI3 A;  4DRJ B;  1RXQ A;  1D1C A;  2WZF A;  3FAP B;  4B6I A;  3DXJ F;  3JSE O;  1D0Y A;  1Y4C A;  3LLI A;  4NC3 A;  2OJE D;  4LLE A;  3RQE A;  2AVK A;  2VAS A;  1V4A A;  4E7Z A;  4IRU A;  5DVW A;  1M57 C;  2HJ3 A;  1M2V B;  2IBF A;  2P0N A;  1YYJ A;  1MMA A;  2C03 A;  1ZHT A;  4Z9H A;  4BJ5 C;  3O55 A;  5B3S C;  2ZD9 A;  1VB5 A;  5COG A;  3LS1 A;  3PHF 2;  1HE1 A;  1Q0K A;  1RCP A;  1RKC A;  2W45 A;  3V5X A;  3RYL A;  2HS5 A;  1DOW A;  2XS1 A;  1TWA A;  2A6H F;  2L7A A;  2V26 A;  3HNL A;  1LIH A;  1ORJ A;  3V7O A;  4BEJ A;  4BG0 A;  1H9T A;  4QI2 A;  1I5N A;  1V74 B;  3T4R A;  3TOM A;  3VYW A;  3QMK A;  4JJF A;  4OIP F;  2VH3 A;  4MS2 A;  4XPW A;  3L1M A;  1NU9 C;  3U9M A;  2G3K A;  1RMV A;  1Z5Z A;  3IQC A;  4EWC A;  2KW3 C;  3ABL C;  2L81 A;  5DS4 A;  1FAP B;  3GEI A;  3EHM A;  2HMQ A;  4OIO F;  2P1A A;  3GEE A;  4JE9 A;  4MTG A;  4F4B A;  1ZU4 A;  4YT2 A;  4O6Y A;  2ZXR A;  4GQH A;  3UMK A;  4DBQ A;  1HMD A;  3JCU Q;  1WAS A;  2QY9 A;  2AP3 A;  2VCB A;  4YL3 A;  3OWT A;  2Q9A A;  4JUR I;  1Z7Q c;  4FWV A;  2JPU A;  1T6I A;  3UR3 C;  4WAB A;  1NG1 A;  3G4X A;  4GEH A;  2J9U A;  1NFN A;  2YL3 A;  1WN0 A;  4Z9I A;  4EUK B;  1PD1 A;  2YL7 A;  1KU2 A;  1YYX A;  3M1C B;  3QVY A;  4JKV A;  2LCH A;  2KQ9 A;  2R25 A;  3C8G D;  3HNK A;  2EIL C;  4JTC B;  4DXW A;  5HSW A;  1OCC C;  2XM0 A;  3DWW A;  1D0Z A;  1M2O A;  2H7V C;  1RJ9 A;  4IGG A;  1CPQ A;  1DOV A;  1LM3 B;  1V54 C;  2XSE A;  3AJM A;  2PX0 A;  4ER9 A;  2VB6 A;  4Q7C A;  3GM1 A;  2JX0 A;  2XM4 A;  4BPM A;  3HTK C;  2EIK C;  3RH3 A;  5L0F A;  2HSQ A;  2IXN A;  2LD6 A;  4MVO A;  3WAQ A;  2R9R B;  2ZPA A;  1QPU A;  3CEX A;  3HNI A;  2LK4 A;  5JS5 A;  1CGM E;  1TWH A;  4YT5 A;  2Y39 A;  3GEH A;  3KPH A;  3KH2 A;  1VTM P;  4JRZ A;  4E18 A;  1LVK A;  4IAR A;  2FFH A;  1G5Z A;  1T6U A;  3US6 A;  4BJ6 A;  4OD4 A;  1FFT C;  5B1A C;  4Q4Z F;  2X51 A;  3JRM O;  2V3C C;  2M4E A;  2KC3 A;  3I5Q A;  1YVI A;  1WOL A;  3RQG A;  1OW8 A;  2EPL X;  2KGO A;  4J7T A;  2L6G A;  3Q7L A;  3OEO A;  1RKE B;  1S7Z A;  5TJ5 E;  1ZYR F;  2BE5 F;  3AQB A;  3NG1 A;  1M2V A;  5KYX B;  3BEH A;  4KNW A;  2EIM C;  3NYL A;  3W2V A;  3MYF A;  2HV7 A;  3DD7 A;  1ZW3 A;  3NMI A;  3G50 A;  3UGP A;  3UNG C;  4ULW A;  3JRT A;  4J7Y A;  4WGY A;  2RD9 A;  4DRI B;  4CIP A;  1YZA A;  3M15 A;  1I4Y A;  3VM6 A;  256B A;  1MMD A;  4NTA A;  4XEF A;  3RIP A;  3RW0 A;  1E83 A;  4M63 A;  3K66 A;  2NSG A;  1GS9 A;  2NUT B;  3DAF A;  4I44 A;  4P9F A;  4DVY P;  3T6J A;  3KKB A;  1EI7 A;  3TJ5 A;  3M4B A;  4U5F E;  3ZG1 A;  2IYL D;  1HMO A;  3JYH A;  3WHN A;  2KJG A;  3AG1 C;  2P6V A;  3GM2 A;  5A6A A;  1Q0M A;  4D4N A;  5DQT A;  4G7O F;  2R7X A;  3AGT A;  3POV A;  4DOZ A;  3U9J A;  2WZG A;  4CIH A;  5T1D B;  2JD3 A;  2WVQ A;  5T3W A;  3W8H A;  2Q9C A;  5JSL A;  1TFO B;  2J9W A;  4HE8 D;  4EKW A;  4U5B E;  3KL4 A;  4GYT A;  4ANJ A;  2O9X A;  2IM8 A;  4OIR F;  3K7D A;  3QZC A;  2CGE A;  3GM3 A;  2G3V A;  2YKZ A;  4PK4 A;  4R32 A;  4CDY A;  4CSA C;  3Q7G A;  1ZHX A;  2HZ8 A;  4YL0 A;  1MNE A;  4HFK B;  4YT8 A;  1L3P A;  2AWY A;  2F22 A;  2J9V A;  2FAP B;  3FOP A;  3N2Z B;  1VMA A;  1OKK A;  2YLI A;  2IXO A;  1ZVZ A;  3C8G B;  1A41 A;  1NZE A;  3ECS A;  1FR0 A;  4XQ1 A;  2EPK X;  4PAC A;  5T3T A;  1FMW A;  1SZI A;  3QVZ A;  1T9K A;  2CDQ A;  1CGN A;  1ZU5 A;  1OCO C;  1WGW A;  2NUP B;  3FVY A;  5D91 A;  3RKO F;  3U0C A;  2R7V A;  2MHR A;  5COF A;  3S9O A;  3V5Y A;  1TWC A;  2ETS A;  2R7Q A;  1PCX A;  3L0I A;  1D1B A;  2EPM X;  3LEV A;  4RBN A;  4YK5 A;  2HMZ A;  5CI8 A;  1F1M A;  3LNR A;  2J9B A;  3JZ0 A;  5B1B C;  1Z63 A;  1G4U S;  5L0D A;  2LQG A;  4U5G A;  3EH1 A;  1YAR O;  4OIN F;  3SXM A;  2C04 A;  2I15 A;  3KMI A;  3VF0 A;  2PBE A;  4MND A;  2QTV A;  3FAJ A;  4ZLD A;  2PX3 A;  3EHN A;  3MFN A;  1OCZ C;  4H54 A;  2E87 A;  4U5C E;  1C02 A;  4I3M A;  1LS4 A;  1RKE A;  1SR2 A;  3QW1 A;  2YLD A;  4LDR A;  3H65 A;  2EPN A;  2IXM A;  3AOU A;  3R2P A;  4YJW A;  3T6B A;  2R7O A;  4CX9 A;  3NMK A;  5KYX A;  4N06 A;  4KI2 A;  3Q6M A;  2EPO A;  4BJ6 C;  3SXY A;  3MLG A;  3UMH A;  1NSG B;  3K33 A;  1ST6 A;  1WTY A;  2DGJ A;  1K05 A;  3DJU B;  3GAN A;  3H2U A;  1OR2 A;  4N6H A;  4CS7 A;  4CSA A;  1JPN A;  3NMJ A;  1BR2 A;  3IPM O;  2A6E F;  3J06 A;  4U5D E;  3B29 A;  4NY3 A;  3ABM C;  1A7D A;  1JOG A;  1ZHY A;  4JEB A;  1EKY A;  1QVX A;  3MX3 A;  3DMD A;  4O79 A;  3U3B A;  1PV3 A;  1ORS C;  2J46 A;  1HW1 A;  4XLN F;  2NUT A;  4ULV A;  3EG9 A;  3U5S A;  3X1O A;  4CDV A;  2J7P D;  4MVZ A;  1O3U A;  1E2X A;  1Z23 A;  2QE9 A;  3B0U X;  2XLE A;  3RF3 A;  4DJ9 A;  1JAF A;  2LIG A;  2UUI A;  4K1O A;  5F5H A;  1ZW2 A;  2YQY A;  4JTA B;  3TD7 A;  3GWL A;  2YVK A;  1BBH A;  2Q4F A;  1APC A;  3IQ6 A;  2NSF A;  4Z9J A;  5KYW B;  1IZM A;  1YA7 O;  2WZL A;  3R7C A;  5EHH A;  1HY5 A;  3S27 A;  4C3E A;  3K6B A;  2XXA B;  1XWJ A;  3MYI A;  3LLK A;  3B0P A;  3LS0 A;  4W8K A;  3RFY A;  2P7V A;  3Q6N A;  2MWQ A;  2NPU A;  5FZT A;  4IAO A;  4NTF A;  1KTM A;  4P9T A;  3VRC A;  2DB4 A;  1XZP A;  3CAX A;  1Z6A A;  1CGO A;  2UUH A;  3F47 A;  1AEP A;  4MVS A;  1G4W R;  3DM5 A;  3PCV A;  2GFH A;  1HW2 A;  4FAP B;  5A6B D;  1MND A;  2R7R A;  2PFD A;  1A0B A;  1CPR A;  1QLE C;  2LFF A;  2VCC A;  3V5Z A;  4CJG A;  4XTK A;  5A6J A;  1J8M F;  3T9O A;  4CS8 C;  5CI9 A;  3C8G A;  3PMR A;  1N1C A;  4BJT A;  2YHS A;  2I8B A;  2YL1 A;  3C8Z A;  4C7O A;  1OXB A;  4BJ1 A;  4MTO A;  4XWJ A;  3QTH A;  5AGF A;  4HFF B;  1OW6 A;  1YJG A;  2NUP A;  3CZ6 A;  2KK1 A;  3HKK A;  4KBL A;  1MMN A;  1W2W A;  2KNH A;  4PFO A;  3OA1 A;  3F46 A;  4PFP A;  2XLH A;  4K7B A;  2ZXO A;  5KYY A;  3IQ5 A;  3ITF A;  1R5I D;  2Y3G A;  5AC5 A;  3U2M A;  4U5E E;  4XEV A;  4CJO A;  3HLZ A;  4XPX A;  2R7U A;  3G4Z A;  3E9V A;  2OU6 A;  4G7Z F;  2LSE A;  3RVZ A;  3FMS A;  1MMG A;  3ATP A;  5JP7 A;  2Y3D A;  2Q3T A;  1QSP A;  3ABK C;  2A0B A;  3TK0 A;  5GPG B;  3LUT B;  3SEO A;  3TJ6 A;  3DM9 B;  1JRA A;  1YLM A;  1FNT c;  2FGY A;  4IJJ A;  1H7I A;  1OXK A;  5F28 E;  3ASN C;  3EG9 B;  4MVM A;  4ZLC A;  1NU7 D;  3B9Q A;  3LAY A;  4RDA A;  2YZS A;  4MVR A;  1O87 A;  3TUL A;  3E70 C;  5BQG A;  3W4Y A;  4YL1 A;  1Q0D A;  2D5R B;  3H2V A;  5E3C A;  4QDL A;  4CS9 A;  3FOO A;  2HFI A;  3JT1 A;  3SXZ A;  4G78 A;  1YAU O;  5DQZ A;  4CS8 A;  4LER A;  2OJQ A;  2HV6 A;  3ZTM A;  1TR2 A;  1J8Y F;  3AG4 C;  3L8J A;  1JMW A;  5DS6 A;  3U2L A;  2EIJ C;  1PD0 A;  2Y3B A;  3KYI A;  2EIN C;  2XLM A;  3VAY A;  3W2W A;  3ZWI A;  2W4M A;  5L0J A;  1VOM A;  2R7S A;  5IY5 C;  3HNJ A;  4U9D A;  1TQG A;  3K1I C;  2CNW D;  4MVQ A;  3FDQ A;  2R7W A;  5BQH A;  1V55 C;  4H4K C;  4G0H A;  5D92 A;  1ORY A;  5KYW A;  3RQF A;  1SF8 A;  3SNH A;  1E84 A;  1YDI A;  1LI7 A;  2Y69 C;  5JUA A;  2XXA A;  2R05 A;  2OOC A;  1VYI A;  3L8I A;  1ZZP A;  4EHP A;  1T6Q A;  5B3I A;  5JVE A;  5E33 A;  4C7O B;  4O6N A;  2YLG A;  2YEV A;  3SZR A;  2XLO A;  2XL4 A;  4JZA A;  3KYJ A;  3NYM A;  1LS1 A;  2OEX A;  1GGQ A;  4MQ9 F;  1LKX A;  1LPE A;  2QLA A;  2VC9 A;  1SMY F;  1NLX A;  2W9Y A;  2ZXP A;  3EZH A;  2GA0 A;  3EPV A;  5KYY B;  2L6H A;  3AG3 C;  1FMV A;  3LNM B;  2ICW G;  1LE4 A;  4KC9 A;  4KNV A;  2LP4 A;  2L6F A;  3EJN A;  3O10 A;  4DVZ A;  3ZQV A;  3BRJ A;  3EGX A;  5CIV A;  5HV9 A;  5JT4 A;  2D4U A;  3IQT A;  4XPY A;  3GOR A;  4J30 B;  4JVS A;  1BZ4 A;  1H6G A;  1BDJ B;  2OEV A;  2Q9B A;  3A9C A;  2WVN A;  3EQL F;  4MTF A;  1R4T A;  1B68 A;  3IHU A;  2IOQ A;  2BL2 A;  2CW0 F;  5KYN A;  1FFH A;  4PJL A;  3ZVR A;  3ZQY A;  5L0G A;  1IW7 F;  4X0R A;  4DRH B;  1XZQ A;  3A11 A;  1NBB A;  3EFO B;  3FXH A;  3K1I A;  5L0H A;  4OIQ F;  4YN0 B;  1OCR C;  1OW7 A;  1TWG A;  4FES A;  3U8V A;  2M64 A;  4O7G A;  3CSK A;  2RSE B;  3CQZ A;  4ONS A;  1D0X A;  2YRF A;  3SP1 A;  3B71 A;  4D4X A;  1WWP A;  2B0H A;  3O39 A;  4E0H A;  3AGU A;  4QI0 A;  2XS8 A;  3DAG A;  1E86 A;  2WL8 A;  4PJN A;  2GDC A;  3TQO A;  3HJC A;  3QW0 A;  5JLI A;  5EK0 A;  4PJJ A;  1VLT A;  3JSZ A;  3FHD A;  3N24 A;  5K0I A;  3PDM P;  2OG2 A;  4FX5 A;  4I1O B;  2NG1 A;  2A0U A;  3UGO A;  1FTS A;  4N6C A;  3LES A;  4WJ0 A;  2OQM A;  5KYU B;  2A68 F;  4LLC A;  1Q0F A;  4L6R A;  1TKN A;  5L0I A;  5A6B A;  4LAC B;  2AU5 A;  3EGD B;  2KYH A;  1VLS A;  2XL6 A;  4C3B A;  5AC4 A;  2R7T A;  4K0D A;  4NQF A;  2Q7R A;  2WVO A;  4YT4 A;  3C63 A;  3RVY A;  1K40 A;  3NKD A;  2ASR A;  4WGZ A;  1VYK A;  2J0X A;  3O6X A;  1D1A A;  3DJN B;  4AE4 B;  4A4A A;  2H8A A;  1U89 A;  4O6M A;  4CBE A;  3I4U A;  2YWA A;  3WOD F;  2CCY A;  1MQV A;  3GOD A;  2R03 A;  4RD9 A;  4W8P A;  2YL0 A;  3S28 A;  4CDA A;  2J7P A;  4EIY A;  4CS9 C;  1A7E A;  1SYQ A;  4PR9 A;  2HJM A;  3ZTZ A;  5JRA A;  1L7C A;  3NRH A;  3ZDL A;  3C18 A;  3SYN A;  3EGX B;  3S90 A;  2XL8 A;  2X0C A;  4AL0 A;  1LI5 A;  4EBK A;  1JR8 A;  2XRH A;  4JCZ A;  4BJ5 A;  5BQI A;  1QKR A;  1GQA A;  2HSB A;  2PF4 E;  4MW8 A;  3T6G B;  1Q0G A;  1G8X A;  3L34 A;  1ZHW A;  4JW1 A;  3AQC A;  5DLJ A;  4C3D A;  1WAT A;  4PJM A;  4AK9 A;  1KNY A;  1OQC A;  4U5H A;  4BEM J;  3C7J A;  2HUJ A;  5COM A;  4JEA A;  3LJB A;  2J45 A;  1YA9 A;  4E0I A;  4G7H F;  3B0V C;  5L0C A;  3NDB B;  1C03 A;  2H7O A;  3DE9 A;  1H9G A;  5DS5 A;  5EGY A;  4JC7 A;  4LDK A;  4XLP F;  3IEE A;  1Y6D A;  2QUP A;  1QZX A;  2DYS C;  4XEK A;  1VK5 A;  1EA8 A;  2J0W A;  5E2Q A;  4IB4 A;  3GWN A;  2GWW A;  4U9E A;  2W4B A;  3DZA A;  4P6I C;  4E17 A;  1M56 C;  1UG7 A;  1QQ3 A;  3W8I A;  2PNO A;  2PP4 A;  2MYS A;  1K04 A;  3EFO A;  5BUO A;  1LE2 A;  2LFD A;  1S05 A;  1A7V A;  4JCH A;  4YWQ A;  2VCA A;  3U8P A;  2A69 F;  1BR1 A;  2XLV A;  3DKA A;  2OKU A;  3M79 A;  2Z15 A;  5A69 A;  2KSF A;  4HEA J;  4IWB A;  1E85 A;  1GM5 A;  2R02 A;  4A2N B;  1T5O A;  4AL1 A;  1OR3 A;  1JPJ A;  1BR4 A;  4UDV A;  3ZIB A;  2GAQ A;  4EBJ A;  2A1D D;  4MW3 A;  5L3Q A;  1C17 M;  3N0T A;  4EBB A;  1AUE A;  2XLD A; 
#chains in the Genus database with same CATH homology
 4ULV A;  4CDV A;  1YZC A;  4N4W A;  1M6T A;  3TOL A;  2XLE A;  2XLW A;  1JAF A;  1BBH A;  3IQ6 A;  1APC A;  3ZQY A;  4IAQ A;  1NBB A;  3VRC A;  3NMI A;  1CGO A;  4D4X A;  3C62 A;  3DE8 A;  1E86 A;  4WGY A;  4CIP A;  1CPR A;  3M15 A;  1YZA A;  4CJG A;  3QW0 A;  5JLI A;  256B A;  3M4C A;  1E83 A;  2YL1 A;  2BC5 A;  2J8W A;  3M4B A;  4L6R A;  5AGF A;  4D4N A;  2XLH A;  4NC3 A;  3IQ5 A;  2XL6 A;  3C63 A;  4WGZ A;  1YYJ A;  4CJO A;  5JSL A;  2CCY A;  1MQV A;  4CDA A;  1RCP A;  4EIY A;  2YL0 A;  5JP7 A;  2YKZ A;  3HNL A;  3ZTZ A;  5JRA A;  4CDY A;  3TOM A;  2XL8 A;  3FOP A;  2YLI A;  3L1M A;  1GQA A;  3QVZ A;  1CGN A;  3FOO A;  4JE9 A;  4JEA A;  3ZTM A;  3DE9 A;  2J9B A;  2XLM A;  3ZWI A;  3HNJ A;  2YL3 A;  4U9D A;  4IB4 A;  2YL7 A;  1YYX A;  3QVY A;  4U9E A;  4JKV A;  3HNK A;  1E84 A;  5JUA A;  1QQ3 A;  3QW1 A;  2YLD A;  2XM0 A;  4CX9 A;  5JVE A;  5B3I A;  3NMK A;  1LM3 B;  1CPQ A;  2YLG A;  1S05 A;  4ER9 A;  1A7V A;  2XLO A;  4N6H A;  3U8P A;  2XLV A;  3M79 A;  2XM4 A;  3NMJ A;  1E85 A;  2QLA A;  5JT4 A;  4JEB A;  1QPU A;  3HNI A;  5JS5 A;  1EKY A;  3ZQV A;  4IAR A;  2XLD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...