1S05A

Nmr-validated structural model for oxidized r.palustris cytochrome c556
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
129
structure length
129
Chain Sequence
b'QQDLVDKTQKLMKDNGRNMMVLGAIAKGEKPYDQAAVDAALKQFDETAKDLPKLFPDSVKGLKPFDSKYSSSPKIWAERAKFDTEIADFAKAVDGAKGKIKDVDTLKAAMQPIGKACGNCHENFRDKEG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c-556
publication title NMR-validated structural model for oxidized Rhodopseudomonas palustris cytochrome c(556).
pubmed doi rcsb
source organism Rhodopseudomonas palustris
molecule tags Electron transport
total genus 30
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2003-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 1s05A00
2XLVA 2YLGA 3C62A 4JKVA 4CJGA 4IB4A 5JP7A 4CDVA 1BBHA 3NMKA 2QLAA 4CIPA 1GQAA 3ZQYA 2J8WA 3TOLA 3C63A 3DE8A 3M15A 4CDAA 4WGYA 4ER9A 3ZTZA 2XLEA 4U9EA 2XLDA 2YKZA 2XM4A 2XLMA 3QW1A 3M79A 3ZWIA 3NMJA 2YL1A 4EIYA 5JLIA 2BC5A 2XL6A 4WGZA 1CPRA 4D4NA 2XM0A 4IARA 1LM3B 3QVZA 1S05A 2YL3A 1CGOA 3VRCA 2YL0A 3TOMA 4JEBA 1CPQA 1MQVA 2CCYA 5JVEA 4N4WA 1A7VA 256BA 3M4CA 3QW0A 4N6HA 5JS5A 1JAFA 1E84A 1E85A 5JSLA 5JUAA 3IQ5A 3QVYA 4NC3A 3U8PA 3ZTMA 4CX9A 3FOOA 3NMIA 2XL8A 5JRAA 5B3IA 3M4BA 4ULVA 1YYXA 5AGFA 4CJOA 1YYJA 1EKYA 1E86A 3HNKA 4JEAA 1YZCA 5JT4A 1E83A 1RCPA 3HNIA 2YL7A 2J9BA 1CGNA 1YZAA 2XLHA 4IAQA 3HNJA 4D4XA 2XLOA 2XLWA 3L1MA 1APCA 3IQ6A 4CDYA 4U9DA 4L6RA 3HNLA 4JE9A 3FOPA 3DE9A 1QQ3A 1M6TA 2YLDA 3ZQVA 2YLIA 1QPUA 1NBBA
chains in the Genus database with same CATH superfamily
3KKBA 4H54A 2XLVA 5KYXA 4HFFB 1IW7F 4CJGA 4OIQF 4CSAA 3A11A 2FFHA 5FCLA 1L7CA 3G4XA 4IJJA 1G5ZA 3US6A 5A6JA 1FAPB 3I5QA 3FHDA 5TJ5E 2OEXA 3T6JA 5AC5A 4GQHA 3S29A 5L0IA 3AQCA 3WAQA 5DQZA 2R7UA 2QLAA 3C8GA 3MYIA 3NYLA 2HSQA 1EI7A 2H8AA 1N1CA 2EILC 2HUJA 2CNWA 3IPMO 3VAYA 1MMDA 3GM2A 2L6FA 2LP4A 3DE8A 4WGYA 1Z23A 1NLXA 3RYLA 4D4XA 2P61A 4JIOA 2XLDA 4R32A 1T6UA 4U5GA 2WB7A 4G7HF 3EGXA 1TFKB 2ETSA 3AQBA 3DJNB 2YHSA 3M79A 4JCHA 4CS9A 3LJBA 1T9KA 1L3PA 2Q9BA 2Q7RA 3W8HA 3JYHA 1ORJA 2YL1A 2C03A 3RW0A 1Q0GA 1AUEA 1Z3IX 1R5ID 3AGTA 4D4NA 3GEHA 4Q7CA 4EWCA 4XTKA 4DXWA 2R7WA 3G4ZA 2ZD9A 3L8JA 3ASNC 1ZW2A 1TR2A 3EGDA 4C3EA 5KYWB 1H7IA 1S7ZA 2J0XA 2PFDA 2Y3DA 3PHF2 4HFKB 4JEBA 1CPQA 1MQVA 1I4YA 2A6HF 2CCYA 3EHNA 4U5CE 2PX3A 4N4WA 5DVWA 256BA 3K1IC 1IZMA 1RKCA 2GA0A 1VYIA 2Y69C 3M4CA 1SZIA 3QW0A 4GYTA 3W2VA 1YARO 5L3VA 2UUHA 2VC9A 4H4KC 1E84A 2KSFA 1E85A 4LDKA 3RIPA 2TMVP 1TWHA 3IQ5A 3GANA 1EQ1A 1VMAA 3ZTMA 1ZHYA 4OIOF 1RMVA 2EIMC 3R2PA 4KNWA 3S0XA 1Q0KA 3AG1C 2OQMA 1RKEA 3NMIA 2X51A 5JRAA 3HLZA 2B0JA 5B3IA 1UG7A 3M4BA 4AE4B 2CDQA 5L0CA 2R7TA 1PD0A 1QVXA 3E70C 1NU7D 2LFFA 2OOCA 4XQ1A 5BQGA 5KYUA 1D1CA 3IQTA 1VTMP 4CDYA 5A6AA 3FXHA 4CIHA 4KI2A 3O39A 4Q4ZF 3FDQA 4MVZA 3SP1A 1ORYA 1WWPA 2EPKX 4JTDB 5L3QA 2D4UA 1YZCA 3KL4A 4A2NB 3ABKC 4YWQA 2L81A 4IRUA 4NTFA 2BE5F 2EPLX 2R9RB 2RSEB 1M2OA 2L6GA 4LLCA 3JCUQ 2YEVA 1UFBA 3WHNA 2EPMX 3F47A 3N0TA 2IXPA 2NUPB 1TWAA 2J9WA 2L7AA 1H6GA 1Z7Qc 3O10A 5KYWA 5CI8A 1A0BA 3N24A 2ZXWC 2NUTB 5F5HA 2G3VA 1QKRA 1EA8A 1V55C 3B71A 2XLWA 3EJNA 3IQ6A 3NDBB 3AOUA 2ZXRA 3L0IA 2DYSC 2IBFA 3DXJF 3QMKA 3R7CA 2HMQA 2W4BA 5T1DB 3RKOF 3NYJA 4MVMA 2WVNA 3SXMA 1ZVZA 5A6BD 3HNLA 3W8IA 1M57C 3PDMP 1MMGA 1ST6A 2R7SA 5F28E 1ZHZA 2A68F 3BEHA 2PF4E 1QPUA 2H7VC 2OJED 2XXAB 2Y39A 2ICWG 4K0DA 2PX0A 2XRHA 3RF3A 4J7TA 4O6NA 4N6CA 1OW7A 5CI9A 5DS5A 3B29A 2YRFA 1ZHTA 3JRTA 1SMYF 2XL4A 3QZCA 4J30B 1M56C 4C3DA 4MS2A 2EPNA 5T3TA 3TK0A 4QDLA 2OJQA 4EKWA 5EHHA 2J9VA 1JMWA 3I5PA 2NSGA 1M2VA 3LUTB 4C7OB 1HW2A 2J7PA 2QUPA 4P9TA 1LE2A 1LI7A 1HMDA 2GDCA 5L0FA 1K04A 1ZU5A 4G0HA 2YQYA 3NKEA 4G78A 2XLEA 3DM9B 3H2UA 3AGUA 4ZLCA 4U9EA 3S90A 4EBKA 1YLMA 3GWLA 3KPHA 5F5FA 3K66A 1Z5ZA 2HKVA 2XLMA 2HSBA 2WVOA 1KU2A 3FVYA 2P0NA 3A9CA 3C8GB 3TULA 3VYWA 2G3KA 2UUIA 2ZPAA 3DJUB 2IXNA 1Z6AA 2AWCA 3CZ6A 4IAOA 1V74B 2XS8A 3B9QA 2R7OA 3DMDA 4LLEA 4N06A 4RD9A 3U2LA 4U5FE 1YDIA 1MMAA 2Q00A 4HE8D 5BQHA 4ULWA 1Y4CA 2ASRA 3EGXB 2PBEA 2M64A 3B0UX 3IQCA 2Y3GA 3SZRA 4YK5A 3TD7A 2J9UA 3EZHA 1I4ZA 4AL0A 4XPYA 1S05A 2A69F 3C8GD 2YL3A 3TJ5A 5K0IA 3M1CB 1TKNA 2CNWD 2KC3A 1Q0MA 4LDRA 2YZSA 4NCQA 4U5DE 1Q0FA 3MLGA 3JT1A 3ZSUA 2NSFA 3EZIA 2GAQA 2KYHA 2RD9A 4N6HA 3U3FA 5JS5A 3WODF 1NU9C 1JAFA 5HV9A 3B0VC 1VB5A 1HY5A 1Q0DA 3CAXA 1O5HA 2WVQA 3E9VA 2F22A 3LESA 2Y3BA 1QZXA 2HJ3A 3QVYA 4W8KA 4I1OB 1ZW3A 2DB4A 3Q6NA 1NSGB 1KNYA 3DI5A 4J32B 1G4WR 4PJLA 3HTKC 1G4US 3MBGA 3T4RA 4ULVA 1TWCA 3T6GB 1ZHWA 3UMIA 3RH3A 1HE9A 4MVSA 2IXOA 2W4MA 2IYLD 3ECSA 3G50A 2M4EA 3LLIA 4JEAA 1YA9A 1U0BB 2HFIA 1Y6DA 3ABMC 3RVZA 1WGWA 1WN0A 1RKEB 2LQGA 3AJMA 4YL0A 1GM5A 3GEEA 3ZDLA 1OKKA 3T9OA 4BJ6C 2R7RA 5L0DA 5JT4A 3W2WA 4QI2A 3H65A 4U5HA 5EGYA 4I3MA 3LEVA 3IHUA 2MYSA 3N2ZB 1OXKA 1ZHXA 4P9FA 1LKXA 3MX3A 2JPUA 4E18A 4NTBA 1YZAA 1T01A 3GODA 2Q9AA 2HJMA 1LI5A 1A7EA 4MQ9F 1OW8A 3DD7A 4BJ1A 2IM8A 1K05A 3DAFA 4E7ZA 1AEPA 1BR4A 2FAPB 4I44A 4MVUA 2EPOA 3S9OA 1G8XA 1D1BA 1O87A 4U9DA 3MYFA 3UR3C 2WZLA 3C8ZA 5KYYB 2LD6A 3CQZA 4JE9A 3FOPA 3DE9A 1QQ3A 1LS4A 2B0HA 1M6TA 1LE4A 1U89A 1ZYRF 2AP3A 4IWBA 4K1OA 3U9MA 2YLIA 4CS8C 4XEKA 3X2QC 2Y3HA 3EH2A 3IEEA 4PFOA 3OA1A 3ZVRA 3NYMA 4BJTA 3S28A 4IB4A 5EK0A 2QTVA 3FAPB 2OEVA 2MHRA 3K1IA 1J8YF 1FFTC 2VASA 4JC7A 3C7JA 3NMKA 4UDVA 1KTMA 4XEVA 1NFNA 2VB6A 2KQ9A 2EIJC 2HS5A 4NY3A 3JYYA 1GS9A 4AL1A 1JOGA 3V5ZA 2V3CC 4BG0A 3C63A 3M15A 4ER9A 3ZTZA 3EFOB 4DRHB 2KW3C 1LIHA 4JZAA 2JD3A 4AE4A 2YKZA 3Q6MA 3O6XA 2A1DD 3JSEO 3DKAA 5E3CA 2VCCA 3DAGA 2OKUA 1LPEA 1HE1A 4Q5SF 1VOMA 1YVIA 3ZWIA 1T6QA 2H7BA 3KYIA 4FESA 4KBLA 3V7OA 5B1AC 4E0HA 5B1BC 5JLIA 2XL6A 3UGOA 3UGPA 1JPNA 4KC9A 1D0XA 1CPRA 2J46A 2XM0A 3EG9A 4XPWA 4IARA 3K7DA 4ZLDA 4K7BA 4MW8A 1LM3B 2LIGA 2ZXOA 3UMKA 3BRJA 4BPMA 4DVYP 3ZIBA 4W8PA 1RJ9B 2HV6A 2I8BA 4PR9A 5KYXB 1CGME 2NUPA 4OINF 3SXKA 3U9JA 3SXZA 2CGEA 1DOWA 2J7PD 3TOMA 4CS7A 4YT2A 1SYQA 2WZGA 5JVEA 4HEAJ 2CW0F 2Q4FA 4MVRA 4CSAC 2AVKA 4YN0B 2NUTA 1A7VA 2LFDA 3KYJA 5A6KA 1C02A 3AG2C 1TQGA 1WATA 1VLTA 3LNMB 4JJFA 1OCRC 2L9JA 4WABA 2W9YA 3RQFA 4FWVA 2CYDA 2NPUA 4PJJA 3ATPA 4NC3A 4CX9A 2XSEA 1U6HA 3AG3C 3FOOA 3GORA 3WG7C 1T5OA 2XL8A 3KMIA 4YT4A 4F4BA 2ZXPA 4OIPF 4PJMA 1ZZPA 1YYXA 3J06A 2R05A 2P7VA 2YVKA 5AGFA 3SXYA 4CJOA 4CS9C 5DLJA 2IOQA 5BQIA 3LEOA 4Z9IA 1E86A 3MFNA 2O9XA 1JR8A 2QE9A 1TFOB 1W2WA 1F1MA 2XS1A 3L8IA 1HW1A 1VK5A 1WOLA 1ZU4A 3HJCA 3PMRA 3U8VA 4E0IA 1BR1A 4DBRA 4CBEA 2A0UA 3LNRA 4PJNA 4Z9HA 4YL3A 4C7OA 4LACB 3LAYA 3EGDB 2FGYA 4FX5A 3Q7GA 4ANJA 1OQCA 4EUKB 5CIVA 2W45A 1C17M 1D1AA 1MNDA 1DOVA 1QSPA 1RXQA 2H7OA 2VCAA 3U2MA 3U0CA 1SF8A 1XZQA 1PD1A 2AU5A 2D5RB 3QTHA 2XLHA 4JRZA 1MNEA 2V26A 4PFPA 2OU6A 3HNJA 4IAQA 4DRJB 4GEHA 2DI3A 3LS0A 1QLEC 2LSEA 2PP4A 1T6IA 2XLOA 4JTCB 5COGA 4C3BA 3L1MA 4EBJA 4EHPA 4ONSA 5D91A 4MVQA 4OD5A 1YA7O 1VYKA 1OCOC 2LK4A 4OD4A 2DGJA 2R02A 3FAJA 4NQFA 3X1OA 5DQTA 4L6RA 1YJGA 2Q9CA 2OCCC 1OR3A 2YWAA 3CEXA 4P6IC 5COMA 4G7ZF 5E33A 3K33A 5KYNA 1WTYA 2J0WA 2BL2A 1JRAA 2J45A 1OKKD 1FTSA 2QY9A 4JJGA 1FMVA 4BEMJ 2YLGA 3C62A 3DZAA 1XZPA 1JPJA 4JKVA 5KYUB 1FNTc 3RVYA 1LVKA 3V5XA 5COFA 2L6HA 3OEOA 5GPGB 5JP7A 1VLSA 1K40A 4KNVA 2R25A 3DWWA 4CDVA 5HSWA 4QI0A 1FR0A 1BBHA 4DVZA 2P6VA 4JW1A 4DJ9A 2HMZA 2R7XA 4FAPB 4CIPA 1GQAA 2P1AA 3ITFA 3ZQYA 2J8WA 3TOLA 3W4YA 4U5BE 4RDAA 4CDAA 1NFOA 2X0CA 1BR2A 4JCZA 3VM6A 2I15A 1A7DA 3O55A 2MWQA 2XM4A 2A6EF 3KH2A 3ZG1A 2LCHA 1B68A 1PV3A 2AWYA 1MMNA 3JTLO 3QW1A 3UMHA 4A4AA 1LS1A 3S84A 4J7YA 4E7SA 2GWWA 4AK9A 3NMJA 4MVOA 1V54C 3ABLC 1OW6A 3LS1A 4JURI 3T6BA 4PACA 5DS6A 5A69A 3GEIA 1YAUO 5E3AA 3EHMA 1OR2A 2BC5A 3H2VA 4WGZA 4EIYA 3OWTA 4B6IA 2KK1A 1NZEA 1HMOA 1NG1A 1OCCC 3Q7LA 3F46A 4BJ6A 4E17A 1AVOB 2A0BA 3LLKA 3U5SA 2JX0A 3QVZA 1OCZC 1Z63A 1FFHA 3EPVA 3GWNA 2VH3A 1FMWA 1CGOA 4DRIB 5B3SC 3CSKA 3EQLF 3VRCA 2E87A 2YL0A 4RBNA 2DYRC 4XEFA 4I1MA 4XWJA 3HKKA 1XWJA 2EINC 2NG1A 3EG9B 5L0HA 4O6MA 1C03A 2EIKC 3B0PA 2WL8A 1TWGA 1OXBA 3NKDA 3ASOC 5JSLA 4DOZA 5JUAA 4JTAB 1BZ4A 4MW3A 1M2VB 4LERA 3JZ0A 3RFYA 3SYNA 3U8PA 5KYYA 2QNLA 4XLPF 3U3BA 4CS8A 4MTOA 3SNHA 5T3WA 3JRMO 3V5YA 3VF0A 1WASA 3JSZA 3EH1A 3K1HA 4BJ5C 4U5EE 1R4TA 5L0GA 2KGOA 1YYJA 4AX2A 1H9GA 5E2QA 3NRHA 3TJ6A 5A6BA 1V4AA 3HNKA 3SEOA 1EKYA 3FMSA 4DBQA 4MNDA 4O6YA 4EBBA 3AG4C 4O7GA 3S27A 4BJ5A 1E2XA 2C04A 1O3UA 2OG2A 5IY5C 4G7OF 4YJWA 2HV7A 2Q3TA 5DS4A 2GFHA 1E83A 2R7QA 4NTAA 3DM5A 1RCPA 5FZTA 2R7VA 2YL7A 1J8MF 3HNIA 4LDQA 4OIRF 1I5NA 3I4UA 3UNGC 1BDJB 4JVSA 3EFOA 3ZC4A 2J9BA 1CGNA 4MTGA 3POVA 2IXMA 2R03A 4M63A 4MTFA 1SR2A 3PCVA 2HZ8A 5AC4A 3RQEA 4IGGA 4O79A 4WJ0A 1PCXA 2WZFA 1D0ZA 1D0YA 1GGQA 3GM3A 2XXAA 1APCA 2VCBA 4BEJA 2PNOA 4XPXA 1A41A 2G62A 4X0RA 4YT8A 2KJGA 3RQGA 5D92A 5L0JA 1ORSC 3NG1A 2KNHA 2YLDA 4YL1A 3ZQVA 2Z15A 4PK4A 1NBBA 1H9TA 3K6BA 4YT5A 4Z9JA 3C18A 5BUOA 3GM1A 4XLNF 3TQOA 3L34A 1RJ9A
chains in the Genus database with same CATH topology
2XLVA 2YLGA 3C62A 4JKVA 4CJGA 4IB4A 5JP7A 4CDVA 1BBHA 3NMKA 2QLAA 4CIPA 1GQAA 3ZQYA 2J8WA 3TOLA 3C63A 3DE8A 3M15A 4CDAA 4WGYA 4ER9A 3ZTZA 2XLEA 4U9EA 2XLDA 2YKZA 2XM4A 2XLMA 3QW1A 3M79A 3ZWIA 3NMJA 2YL1A 4EIYA 5JLIA 2BC5A 2XL6A 4WGZA 1CPRA 4D4NA 2XM0A 4IARA 1LM3B 3QVZA 1S05A 2YL3A 1CGOA 3VRCA 2YL0A 3TOMA 4JEBA 1CPQA 1MQVA 2CCYA 5JVEA 4N4WA 1A7VA 256BA 3M4CA 3QW0A 4N6HA 5JS5A 1JAFA 1E84A 1E85A 5JSLA 5JUAA 3IQ5A 3QVYA 4NC3A 3U8PA 3ZTMA 4CX9A 3FOOA 3NMIA 2XL8A 5JRAA 5B3IA 3M4BA 4ULVA 1YYXA 5AGFA 4CJOA 1YYJA 1EKYA 1E86A 3HNKA 4JEAA 1YZCA 5JT4A 1E83A 1RCPA 3HNIA 2YL7A 2J9BA 1CGNA 1YZAA 2XLHA 4IAQA 3HNJA 4D4XA 2XLOA 2XLWA 3L1MA 1APCA 3IQ6A 4CDYA 4U9DA 4L6RA 3HNLA 4JE9A 3FOPA 3DE9A 1QQ3A 1M6TA 2YLDA 3ZQVA 2YLIA 1QPUA 1NBBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XLV A;  2YLG A;  3C62 A;  4JKV A;  4CJG A;  4IB4 A;  5JP7 A;  4CDV A;  1BBH A;  3NMK A;  2QLA A;  4CIP A;  1GQA A;  3ZQY A;  2J8W A;  3TOL A;  3C63 A;  3DE8 A;  3M15 A;  4CDA A;  4WGY A;  4ER9 A;  3ZTZ A;  2XLE A;  4U9E A;  2XLD A;  2YKZ A;  2XM4 A;  2XLM A;  3QW1 A;  3M79 A;  3ZWI A;  3NMJ A;  2YL1 A;  4EIY A;  5JLI A;  2BC5 A;  2XL6 A;  4WGZ A;  1CPR A;  4D4N A;  2XM0 A;  4IAR A;  1LM3 B;  3QVZ A;  1S05 A;  2YL3 A;  1CGO A;  3VRC A;  2YL0 A;  3TOM A;  4JEB A;  1CPQ A;  1MQV A;  2CCY A;  5JVE A;  4N4W A;  1A7V A;  256B A;  3M4C A;  3QW0 A;  4N6H A;  5JS5 A;  1JAF A;  1E84 A;  1E85 A;  5JSL A;  5JUA A;  3IQ5 A;  3QVY A;  4NC3 A;  3U8P A;  3ZTM A;  4CX9 A;  3FOO A;  3NMI A;  2XL8 A;  5JRA A;  5B3I A;  3M4B A;  4ULV A;  1YYX A;  5AGF A;  4CJO A;  1YYJ A;  1EKY A;  1E86 A;  3HNK A;  4JEA A;  1YZC A;  5JT4 A;  1E83 A;  1RCP A;  3HNI A;  2YL7 A;  2J9B A;  1CGN A;  1YZA A;  2XLH A;  4IAQ A;  3HNJ A;  4D4X A;  2XLO A;  2XLW A;  3L1M A;  1APC A;  3IQ6 A;  4CDY A;  4U9D A;  4L6R A;  3HNL A;  4JE9 A;  3FOP A;  3DE9 A;  1QQ3 A;  1M6T A;  2YLD A;  3ZQV A;  2YLI A;  1QPU A;  1NBB A; 
#chains in the Genus database with same CATH topology
 3KKB A;  4H54 A;  2XLV A;  5KYX A;  4HFF B;  1IW7 F;  4CJG A;  4OIQ F;  4CSA A;  3A11 A;  2FFH A;  5FCL A;  1L7C A;  3G4X A;  4IJJ A;  1G5Z A;  3US6 A;  5A6J A;  1FAP B;  3I5Q A;  3FHD A;  5TJ5 E;  2OEX A;  3T6J A;  5AC5 A;  4GQH A;  3S29 A;  5L0I A;  3AQC A;  3WAQ A;  5DQZ A;  2R7U A;  2QLA A;  3C8G A;  3MYI A;  3NYL A;  2HSQ A;  1EI7 A;  2H8A A;  1N1C A;  2EIL C;  2HUJ A;  2CNW A;  3IPM O;  3VAY A;  1MMD A;  3GM2 A;  2L6F A;  2LP4 A;  3DE8 A;  4WGY A;  1Z23 A;  1NLX A;  3RYL A;  4D4X A;  2P61 A;  4JIO A;  2XLD A;  4R32 A;  1T6U A;  4U5G A;  2WB7 A;  4G7H F;  3EGX A;  1TFK B;  2ETS A;  3AQB A;  3DJN B;  2YHS A;  3M79 A;  4JCH A;  4CS9 A;  3LJB A;  1T9K A;  1L3P A;  2Q9B A;  2Q7R A;  3W8H A;  3JYH A;  1ORJ A;  2YL1 A;  2C03 A;  3RW0 A;  1Q0G A;  1AUE A;  1Z3I X;  1R5I D;  3AGT A;  4D4N A;  3GEH A;  4Q7C A;  4EWC A;  4XTK A;  4DXW A;  2R7W A;  3G4Z A;  2ZD9 A;  3L8J A;  3ASN C;  1ZW2 A;  1TR2 A;  3EGD A;  4C3E A;  5KYW B;  1H7I A;  1S7Z A;  2J0X A;  2PFD A;  2Y3D A;  3PHF 2;  4HFK B;  4JEB A;  1CPQ A;  1MQV A;  1I4Y A;  2A6H F;  2CCY A;  3EHN A;  4U5C E;  2PX3 A;  4N4W A;  5DVW A;  256B A;  3K1I C;  1IZM A;  1RKC A;  2GA0 A;  1VYI A;  2Y69 C;  3M4C A;  1SZI A;  3QW0 A;  4GYT A;  3W2V A;  1YAR O;  5L3V A;  2UUH A;  2VC9 A;  4H4K C;  1E84 A;  2KSF A;  1E85 A;  4LDK A;  3RIP A;  2TMV P;  1TWH A;  3IQ5 A;  3GAN A;  1EQ1 A;  1VMA A;  3ZTM A;  1ZHY A;  4OIO F;  1RMV A;  2EIM C;  3R2P A;  4KNW A;  3S0X A;  1Q0K A;  3AG1 C;  2OQM A;  1RKE A;  3NMI A;  2X51 A;  5JRA A;  3HLZ A;  2B0J A;  5B3I A;  1UG7 A;  3M4B A;  4AE4 B;  2CDQ A;  5L0C A;  2R7T A;  1PD0 A;  1QVX A;  3E70 C;  1NU7 D;  2LFF A;  2OOC A;  4XQ1 A;  5BQG A;  5KYU A;  1D1C A;  3IQT A;  1VTM P;  4CDY A;  5A6A A;  3FXH A;  4CIH A;  4KI2 A;  3O39 A;  4Q4Z F;  3FDQ A;  4MVZ A;  3SP1 A;  1ORY A;  1WWP A;  2EPK X;  4JTD B;  5L3Q A;  2D4U A;  1YZC A;  3KL4 A;  4A2N B;  3ABK C;  4YWQ A;  2L81 A;  4IRU A;  4NTF A;  2BE5 F;  2EPL X;  2R9R B;  2RSE B;  1M2O A;  2L6G A;  4LLC A;  3JCU Q;  2YEV A;  1UFB A;  3WHN A;  2EPM X;  3F47 A;  3N0T A;  2IXP A;  2NUP B;  1TWA A;  2J9W A;  2L7A A;  1H6G A;  1Z7Q c;  3O10 A;  5KYW A;  5CI8 A;  1A0B A;  3N24 A;  2ZXW C;  2NUT B;  5F5H A;  2G3V A;  1QKR A;  1EA8 A;  1V55 C;  3B71 A;  2XLW A;  3EJN A;  3IQ6 A;  3NDB B;  3AOU A;  2ZXR A;  3L0I A;  2DYS C;  2IBF A;  3DXJ F;  3QMK A;  3R7C A;  2HMQ A;  2W4B A;  5T1D B;  3RKO F;  3NYJ A;  4MVM A;  2WVN A;  3SXM A;  1ZVZ A;  5A6B D;  3HNL A;  3W8I A;  1M57 C;  3PDM P;  1MMG A;  1ST6 A;  2R7S A;  5F28 E;  1ZHZ A;  2A68 F;  3BEH A;  2PF4 E;  1QPU A;  2H7V C;  2OJE D;  2XXA B;  2Y39 A;  2ICW G;  4K0D A;  2PX0 A;  2XRH A;  3RF3 A;  4J7T A;  4O6N A;  4N6C A;  1OW7 A;  5CI9 A;  5DS5 A;  3B29 A;  2YRF A;  1ZHT A;  3JRT A;  1SMY F;  2XL4 A;  3QZC A;  4J30 B;  1M56 C;  4C3D A;  4MS2 A;  2EPN A;  5T3T A;  3TK0 A;  4QDL A;  2OJQ A;  4EKW A;  5EHH A;  2J9V A;  1JMW A;  3I5P A;  2NSG A;  1M2V A;  3LUT B;  4C7O B;  1HW2 A;  2J7P A;  2QUP A;  4P9T A;  1LE2 A;  1LI7 A;  1HMD A;  2GDC A;  5L0F A;  1K04 A;  1ZU5 A;  4G0H A;  2YQY A;  3NKE A;  4G78 A;  2XLE A;  3DM9 B;  3H2U A;  3AGU A;  4ZLC A;  4U9E A;  3S90 A;  4EBK A;  1YLM A;  3GWL A;  3KPH A;  5F5F A;  3K66 A;  1Z5Z A;  2HKV A;  2XLM A;  2HSB A;  2WVO A;  1KU2 A;  3FVY A;  2P0N A;  3A9C A;  3C8G B;  3TUL A;  3VYW A;  2G3K A;  2UUI A;  2ZPA A;  3DJU B;  2IXN A;  1Z6A A;  2AWC A;  3CZ6 A;  4IAO A;  1V74 B;  2XS8 A;  3B9Q A;  2R7O A;  3DMD A;  4LLE A;  4N06 A;  4RD9 A;  3U2L A;  4U5F E;  1YDI A;  1MMA A;  2Q00 A;  4HE8 D;  5BQH A;  4ULW A;  1Y4C A;  2ASR A;  3EGX B;  2PBE A;  2M64 A;  3B0U X;  3IQC A;  2Y3G A;  3SZR A;  4YK5 A;  3TD7 A;  2J9U A;  3EZH A;  1I4Z A;  4AL0 A;  4XPY A;  1S05 A;  2A69 F;  3C8G D;  2YL3 A;  3TJ5 A;  5K0I A;  3M1C B;  1TKN A;  2CNW D;  2KC3 A;  1Q0M A;  4LDR A;  2YZS A;  4NCQ A;  4U5D E;  1Q0F A;  3MLG A;  3JT1 A;  3ZSU A;  2NSF A;  3EZI A;  2GAQ A;  2KYH A;  2RD9 A;  4N6H A;  3U3F A;  5JS5 A;  3WOD F;  1NU9 C;  1JAF A;  5HV9 A;  3B0V C;  1VB5 A;  1HY5 A;  1Q0D A;  3CAX A;  1O5H A;  2WVQ A;  3E9V A;  2F22 A;  3LES A;  2Y3B A;  1QZX A;  2HJ3 A;  3QVY A;  4W8K A;  4I1O B;  1ZW3 A;  2DB4 A;  3Q6N A;  1NSG B;  1KNY A;  3DI5 A;  4J32 B;  1G4W R;  4PJL A;  3HTK C;  1G4U S;  3MBG A;  3T4R A;  4ULV A;  1TWC A;  3T6G B;  1ZHW A;  3UMI A;  3RH3 A;  1HE9 A;  4MVS A;  2IXO A;  2W4M A;  2IYL D;  3ECS A;  3G50 A;  2M4E A;  3LLI A;  4JEA A;  1YA9 A;  1U0B B;  2HFI A;  1Y6D A;  3ABM C;  3RVZ A;  1WGW A;  1WN0 A;  1RKE B;  2LQG A;  3AJM A;  4YL0 A;  1GM5 A;  3GEE A;  3ZDL A;  1OKK A;  3T9O A;  4BJ6 C;  2R7R A;  5L0D A;  5JT4 A;  3W2W A;  4QI2 A;  3H65 A;  4U5H A;  5EGY A;  4I3M A;  3LEV A;  3IHU A;  2MYS A;  3N2Z B;  1OXK A;  1ZHX A;  4P9F A;  1LKX A;  3MX3 A;  2JPU A;  4E18 A;  4NTB A;  1YZA A;  1T01 A;  3GOD A;  2Q9A A;  2HJM A;  1LI5 A;  1A7E A;  4MQ9 F;  1OW8 A;  3DD7 A;  4BJ1 A;  2IM8 A;  1K05 A;  3DAF A;  4E7Z A;  1AEP A;  1BR4 A;  2FAP B;  4I44 A;  4MVU A;  2EPO A;  3S9O A;  1G8X A;  1D1B A;  1O87 A;  4U9D A;  3MYF A;  3UR3 C;  2WZL A;  3C8Z A;  5KYY B;  2LD6 A;  3CQZ A;  4JE9 A;  3FOP A;  3DE9 A;  1QQ3 A;  1LS4 A;  2B0H A;  1M6T A;  1LE4 A;  1U89 A;  1ZYR F;  2AP3 A;  4IWB A;  4K1O A;  3U9M A;  2YLI A;  4CS8 C;  4XEK A;  3X2Q C;  2Y3H A;  3EH2 A;  3IEE A;  4PFO A;  3OA1 A;  3ZVR A;  3NYM A;  4BJT A;  3S28 A;  4IB4 A;  5EK0 A;  2QTV A;  3FAP B;  2OEV A;  2MHR A;  3K1I A;  1J8Y F;  1FFT C;  2VAS A;  4JC7 A;  3C7J A;  3NMK A;  4UDV A;  1KTM A;  4XEV A;  1NFN A;  2VB6 A;  2KQ9 A;  2EIJ C;  2HS5 A;  4NY3 A;  3JYY A;  1GS9 A;  4AL1 A;  1JOG A;  3V5Z A;  2V3C C;  4BG0 A;  3C63 A;  3M15 A;  4ER9 A;  3ZTZ A;  3EFO B;  4DRH B;  2KW3 C;  1LIH A;  4JZA A;  2JD3 A;  4AE4 A;  2YKZ A;  3Q6M A;  3O6X A;  2A1D D;  3JSE O;  3DKA A;  5E3C A;  2VCC A;  3DAG A;  2OKU A;  1LPE A;  1HE1 A;  4Q5S F;  1VOM A;  1YVI A;  3ZWI A;  1T6Q A;  2H7B A;  3KYI A;  4FES A;  4KBL A;  3V7O A;  5B1A C;  4E0H A;  5B1B C;  5JLI A;  2XL6 A;  3UGO A;  3UGP A;  1JPN A;  4KC9 A;  1D0X A;  1CPR A;  2J46 A;  2XM0 A;  3EG9 A;  4XPW A;  4IAR A;  3K7D A;  4ZLD A;  4K7B A;  4MW8 A;  1LM3 B;  2LIG A;  2ZXO A;  3UMK A;  3BRJ A;  4BPM A;  4DVY P;  3ZIB A;  4W8P A;  1RJ9 B;  2HV6 A;  2I8B A;  4PR9 A;  5KYX B;  1CGM E;  2NUP A;  4OIN F;  3SXK A;  3U9J A;  3SXZ A;  2CGE A;  1DOW A;  2J7P D;  3TOM A;  4CS7 A;  4YT2 A;  1SYQ A;  2WZG A;  5JVE A;  4HEA J;  2CW0 F;  2Q4F A;  4MVR A;  4CSA C;  2AVK A;  4YN0 B;  2NUT A;  1A7V A;  2LFD A;  3KYJ A;  5A6K A;  1C02 A;  3AG2 C;  1TQG A;  1WAT A;  1VLT A;  3LNM B;  4JJF A;  1OCR C;  2L9J A;  4WAB A;  2W9Y A;  3RQF A;  4FWV A;  2CYD A;  2NPU A;  4PJJ A;  3ATP A;  4NC3 A;  4CX9 A;  2XSE A;  1U6H A;  3AG3 C;  3FOO A;  3GOR A;  3WG7 C;  1T5O A;  2XL8 A;  3KMI A;  4YT4 A;  4F4B A;  2ZXP A;  4OIP F;  4PJM A;  1ZZP A;  1YYX A;  3J06 A;  2R05 A;  2P7V A;  2YVK A;  5AGF A;  3SXY A;  4CJO A;  4CS9 C;  5DLJ A;  2IOQ A;  5BQI A;  3LEO A;  4Z9I A;  1E86 A;  3MFN A;  2O9X A;  1JR8 A;  2QE9 A;  1TFO B;  1W2W A;  1F1M A;  2XS1 A;  3L8I A;  1HW1 A;  1VK5 A;  1WOL A;  1ZU4 A;  3HJC A;  3PMR A;  3U8V A;  4E0I A;  1BR1 A;  4DBR A;  4CBE A;  2A0U A;  3LNR A;  4PJN A;  4Z9H A;  4YL3 A;  4C7O A;  4LAC B;  3LAY A;  3EGD B;  2FGY A;  4FX5 A;  3Q7G A;  4ANJ A;  1OQC A;  4EUK B;  5CIV A;  2W45 A;  1C17 M;  1D1A A;  1MND A;  1DOV A;  1QSP A;  1RXQ A;  2H7O A;  2VCA A;  3U2M A;  3U0C A;  1SF8 A;  1XZQ A;  1PD1 A;  2AU5 A;  2D5R B;  3QTH A;  2XLH A;  4JRZ A;  1MNE A;  2V26 A;  4PFP A;  2OU6 A;  3HNJ A;  4IAQ A;  4DRJ B;  4GEH A;  2DI3 A;  3LS0 A;  1QLE C;  2LSE A;  2PP4 A;  1T6I A;  2XLO A;  4JTC B;  5COG A;  4C3B A;  3L1M A;  4EBJ A;  4EHP A;  4ONS A;  5D91 A;  4MVQ A;  4OD5 A;  1YA7 O;  1VYK A;  1OCO C;  2LK4 A;  4OD4 A;  2DGJ A;  2R02 A;  3FAJ A;  4NQF A;  3X1O A;  5DQT A;  4L6R A;  1YJG A;  2Q9C A;  2OCC C;  1OR3 A;  2YWA A;  3CEX A;  4P6I C;  5COM A;  4G7Z F;  5E33 A;  3K33 A;  5KYN A;  1WTY A;  2J0W A;  2BL2 A;  1JRA A;  2J45 A;  1OKK D;  1FTS A;  2QY9 A;  4JJG A;  1FMV A;  4BEM J;  2YLG A;  3C62 A;  3DZA A;  1XZP A;  1JPJ A;  4JKV A;  5KYU B;  1FNT c;  3RVY A;  1LVK A;  3V5X A;  5COF A;  2L6H A;  3OEO A;  5GPG B;  5JP7 A;  1VLS A;  1K40 A;  4KNV A;  2R25 A;  3DWW A;  4CDV A;  5HSW A;  4QI0 A;  1FR0 A;  1BBH A;  4DVZ A;  2P6V A;  4JW1 A;  4DJ9 A;  2HMZ A;  2R7X A;  4FAP B;  4CIP A;  1GQA A;  2P1A A;  3ITF A;  3ZQY A;  2J8W A;  3TOL A;  3W4Y A;  4U5B E;  4RDA A;  4CDA A;  1NFO A;  2X0C A;  1BR2 A;  4JCZ A;  3VM6 A;  2I15 A;  1A7D A;  3O55 A;  2MWQ A;  2XM4 A;  2A6E F;  3KH2 A;  3ZG1 A;  2LCH A;  1B68 A;  1PV3 A;  2AWY A;  1MMN A;  3JTL O;  3QW1 A;  3UMH A;  4A4A A;  1LS1 A;  3S84 A;  4J7Y A;  4E7S A;  2GWW A;  4AK9 A;  3NMJ A;  4MVO A;  1V54 C;  3ABL C;  1OW6 A;  3LS1 A;  4JUR I;  3T6B A;  4PAC A;  5DS6 A;  5A69 A;  3GEI A;  1YAU O;  5E3A A;  3EHM A;  1OR2 A;  2BC5 A;  3H2V A;  4WGZ A;  4EIY A;  3OWT A;  4B6I A;  2KK1 A;  1NZE A;  1HMO A;  1NG1 A;  1OCC C;  3Q7L A;  3F46 A;  4BJ6 A;  4E17 A;  1AVO B;  2A0B A;  3LLK A;  3U5S A;  2JX0 A;  3QVZ A;  1OCZ C;  1Z63 A;  1FFH A;  3EPV A;  3GWN A;  2VH3 A;  1FMW A;  1CGO A;  4DRI B;  5B3S C;  3CSK A;  3EQL F;  3VRC A;  2E87 A;  2YL0 A;  4RBN A;  2DYR C;  4XEF A;  4I1M A;  4XWJ A;  3HKK A;  1XWJ A;  2EIN C;  2NG1 A;  3EG9 B;  5L0H A;  4O6M A;  1C03 A;  2EIK C;  3B0P A;  2WL8 A;  1TWG A;  1OXB A;  3NKD A;  3ASO C;  5JSL A;  4DOZ A;  5JUA A;  4JTA B;  1BZ4 A;  4MW3 A;  1M2V B;  4LER A;  3JZ0 A;  3RFY A;  3SYN A;  3U8P A;  5KYY A;  2QNL A;  4XLP F;  3U3B A;  4CS8 A;  4MTO A;  3SNH A;  5T3W A;  3JRM O;  3V5Y A;  3VF0 A;  1WAS A;  3JSZ A;  3EH1 A;  3K1H A;  4BJ5 C;  4U5E E;  1R4T A;  5L0G A;  2KGO A;  1YYJ A;  4AX2 A;  1H9G A;  5E2Q A;  3NRH A;  3TJ6 A;  5A6B A;  1V4A A;  3HNK A;  3SEO A;  1EKY A;  3FMS A;  4DBQ A;  4MND A;  4O6Y A;  4EBB A;  3AG4 C;  4O7G A;  3S27 A;  4BJ5 A;  1E2X A;  2C04 A;  1O3U A;  2OG2 A;  5IY5 C;  4G7O F;  4YJW A;  2HV7 A;  2Q3T A;  5DS4 A;  2GFH A;  1E83 A;  2R7Q A;  4NTA A;  3DM5 A;  1RCP A;  5FZT A;  2R7V A;  2YL7 A;  1J8M F;  3HNI A;  4LDQ A;  4OIR F;  1I5N A;  3I4U A;  3UNG C;  1BDJ B;  4JVS A;  3EFO A;  3ZC4 A;  2J9B A;  1CGN A;  4MTG A;  3POV A;  2IXM A;  2R03 A;  4M63 A;  4MTF A;  1SR2 A;  3PCV A;  2HZ8 A;  5AC4 A;  3RQE A;  4IGG A;  4O79 A;  4WJ0 A;  1PCX A;  2WZF A;  1D0Z A;  1D0Y A;  1GGQ A;  3GM3 A;  2XXA A;  1APC A;  2VCB A;  4BEJ A;  2PNO A;  4XPX A;  1A41 A;  2G62 A;  4X0R A;  4YT8 A;  2KJG A;  3RQG A;  5D92 A;  5L0J A;  1ORS C;  3NG1 A;  2KNH A;  2YLD A;  4YL1 A;  3ZQV A;  2Z15 A;  4PK4 A;  1NBB A;  1H9T A;  3K6B A;  4YT5 A;  4Z9J A;  3C18 A;  5BUO A;  3GM1 A;  4XLN F;  3TQO A;  3L34 A;  1RJ9 A; 
#chains in the Genus database with same CATH homology
 2XLV A;  2YLG A;  3C62 A;  4JKV A;  4CJG A;  4IB4 A;  5JP7 A;  4CDV A;  1BBH A;  3NMK A;  2QLA A;  4CIP A;  1GQA A;  3ZQY A;  2J8W A;  3TOL A;  3C63 A;  3DE8 A;  3M15 A;  4CDA A;  4WGY A;  4ER9 A;  3ZTZ A;  2XLE A;  4U9E A;  2XLD A;  2YKZ A;  2XM4 A;  2XLM A;  3QW1 A;  3M79 A;  3ZWI A;  3NMJ A;  2YL1 A;  4EIY A;  5JLI A;  2BC5 A;  2XL6 A;  4WGZ A;  1CPR A;  4D4N A;  2XM0 A;  4IAR A;  1LM3 B;  3QVZ A;  1S05 A;  2YL3 A;  1CGO A;  3VRC A;  2YL0 A;  3TOM A;  4JEB A;  1CPQ A;  1MQV A;  2CCY A;  5JVE A;  4N4W A;  1A7V A;  256B A;  3M4C A;  3QW0 A;  4N6H A;  5JS5 A;  1JAF A;  1E84 A;  1E85 A;  5JSL A;  5JUA A;  3IQ5 A;  3QVY A;  4NC3 A;  3U8P A;  3ZTM A;  4CX9 A;  3FOO A;  3NMI A;  2XL8 A;  5JRA A;  5B3I A;  3M4B A;  4ULV A;  1YYX A;  5AGF A;  4CJO A;  1YYJ A;  1EKY A;  1E86 A;  3HNK A;  4JEA A;  1YZC A;  5JT4 A;  1E83 A;  1RCP A;  3HNI A;  2YL7 A;  2J9B A;  1CGN A;  1YZA A;  2XLH A;  4IAQ A;  3HNJ A;  4D4X A;  2XLO A;  2XLW A;  3L1M A;  1APC A;  3IQ6 A;  4CDY A;  4U9D A;  4L6R A;  3HNL A;  4JE9 A;  3FOP A;  3DE9 A;  1QQ3 A;  1M6T A;  2YLD A;  3ZQV A;  2YLI A;  1QPU A;  1NBB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...