1S05A

Nmr-validated structural model for oxidized r.palustris cytochrome c556
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
129
structure length
129
Chain Sequence
QQDLVDKTQKLMKDNGRNMMVLGAIAKGEKPYDQAAVDAALKQFDETAKDLPKLFPDSVKGLKPFDSKYSSSPKIWAERAKFDTEIADFAKAVDGAKGKIKDVDTLKAAMQPIGKACGNCHENFRDKEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Cytochrome c-556
publication title NMR-validated structural model for oxidized Rhodopseudomonas palustris cytochrome c(556).
pubmed doi rcsb
source organism Rhodopseudomonas palustris
total genus 30
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2003-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 1s05A00
3QVYA 2BC5A 4WGZA 3TOMA 3FOPA 5JP7A 1YYXA 1CPRA 3NMKA 4ULVA 4EIYA 2YL0A 2QLAA 1GQAA 2YL7A 4N6HA 2XLVA 4JKVA 2XL6A 4WGYA 1QQ3A 3HNJA 4IAQA 3U8PA 3C63A 5JS5A 3IQ5A 4JE9A 3VRCA 2YLDA 2XLHA 5JVEA 4U9DA 2J9BA 1E86A 1CGNA 2XLDA 3M79A 4IARA 2YL1A 4N4WA 3FOOA 4L6RA 3QVZA 1M6TA 1RCPA 3NMJA 3QW0A 1E84A 3DE8A 4JEAA 1YZAA 4CDYA 2CCYA 3ZTZA 4CDVA 3C62A 1NBBA 5JLIA 1E83A 3QW1A 1APCA 1BBHA 2XL8A 4CJGA 3M4CA 2XLWA 2XM0A 1A7VA 1EKYA 4IB4A 4D4NA 3ZQVA 256BA 1JAFA 4JEBA 1LM3B 5B3IA 2XLMA 5JRAA 3ZTMA 2XLEA 1YZCA 2J8WA 3HNKA 3HNLA 2YLIA 3DE9A 1QPUA 4D4XA 3IQ6A 2XM4A 1CGOA 1S05A 4CX9A 4ER9A 2YKZA 2XLOA 1YYJA 3L1MA 4U9EA 3ZWIA 5JUAA 3TOLA 5AGFA 4NC3A 1MQVA 1CPQA 3M15A 4CIPA 3HNIA 3M4BA 5JSLA 5JT4A 1E85A 4CJOA 3NMIA 2YL3A 2YLGA 4CDAA 3ZQYA
chains in the Genus database with same CATH superfamily
1L3PA 2A69F 2BC5A 2W4BA 3A9CA 3IEEA 3N2ZB 1K05A 1U6HA 3K6BA 5B3SC 2EIMC 2EPKX 3FOPA 4I44A 3I4UA 1SF8A 4MVZA 2RD9A 1CPRA 1Q0FA 3AG2C 2C03A 3DJUB 5F28E 4A4AA 4EIYA 3T6GB 3DAGA 2Z15A 4MNDA 4BJ6C 4AK9A 1T6IA 4ULWA 3X1OA 2P61A 2P6VA 4P9TA 1VMAA 2XLVA 2XL6A 2J46A 1SZIA 1I4YA 4WGYA 4YN0B 1FR0A 4YT4A 3U9MA 2R03A 3HNJA 4IAQA 1D1CA 1JPJA 3U3FA 1TWHA 1RXQA 4XQ1A 3L8JA 2MYSA 2OG2A 4XLPF 2AP3A 1WATA 3E9VA 4XTKA 1E2XA 2J9BA 4J30B 4U9DA 1E86A 3MBGA 5CI8A 2M4EA 4MVQA 2XLDA 4K1OA 3M79A 3CEXA 4E7ZA 4C3BA 5EHHA 3T6BA 4L6RA 1Y6DA 1QVXA 4YL3A 2KW3C 3F46A 3SZRA 3HTKC 4OIRF 4W8PA 3B0VC 3NMJA 1TWAA 2AWCA 3ITFA 3QW0A 1WGWA 4IAOA 4I3MA 4O6MA 5DS6A 4JEAA 1V55C 2YQYA 4G7HF 3OEOA 2GWWA 4EKWA 2DYSC 4U5FE 1N1CA 2CCYA 3U8VA 3FDQA 4Z9JA 3GEHA 4MTGA 5DQZA 2R25A 3ABLC 3T4RA 1A41A 2JPUA 5JLIA 1E83A 4MVRA 1FNTc 4UDVA 1C02A 3EHNA 2F22A 3K1IC 4XLNF 3NYMA 4CS9C 3UGOA 4R32A 2WL8A 3EH1A 3OA1A 4DBQA 1TWCA 4QI2A 1YLMA 4Z9IA 1FFTC 5L0IA 1M2VB 1AUEA 3SXKA 5BQHA 3V5XA 3GWNA 3ZQVA 5KYWB 2OJQA 4MVUA 3ASOC 5A6JA 1YARO 1EI7A 3F47A 2A0UA 2P0NA 3IQTA 4YT2A 5B3IA 5BQIA 2X0CA 3QMKA 4XEKA 1JRAA 3R7CA 4EHPA 2LD6A 3AG4C 3ASNC 3GM1A 1YZCA 3PCVA 4MW3A 3EG9B 1H9TA 2HZ8A 2NUPA 1Q0DA 1BR4A 3HNLA 3LNRA 2YLIA 1RJ9B 2I8BA 1AVOB 4MQ9F 5DS4A 1ZU4A 4JC7A 1TWGA 4EWCA 5T1DB 4YJWA 1CGOA 3K33A 4CX9A 4DVZA 4KI2A 1L7CA 1F1MA 1OXKA 4W8KA 1OCCC 2Q00A 1LKXA 2KC3A 3V5YA 5FCLA 3RF3A 3EGXA 2XLOA 2HJ3A 4EBKA 3EHMA 2Q7RA 4KNWA 2D4UA 1QKRA 3K66A 4X0RA 1GM5A 2TMVP 3GANA 4MVSA 2Y3DA 2IXNA 2YRFA 1Q0GA 5AGFA 3TJ6A 1WOLA 2ZXPA 2P7VA 2Y3GA 1MQVA 1YA9A 1ZHWA 1U89A 2L7AA 3DZAA 3MYFA 4O6NA 2PBEA 3M4BA 1KU2A 3L8IA 3NRHA 2R7XA 3GEEA 5TJ5E 1WASA 1YA7O 1Z63A 2JX0A 1WN0A 5GPGB 3DJNB 4KC9A 3LEVA 3B9QA 3SNHA 4ONSA 1D0ZA 1JR8A 2XL4A 1C03A 5BUOA 3RQFA 2YL3A 4PR9A 2XS1A 3DXJF 2YLGA 1IZMA 4HEAJ 4YK5A 3UMKA 3ZVRA 1DOWA 3EFOA 1XZQA 4XPYA 3Q6NA 4JURI 3C8ZA 3G50A 4XWJA 4MVMA 3WAQA 1ZHTA 5JP7A 4BPMA 3FMSA 2A68F 5L0FA 1YYXA 3JRMO 4JIOA 3PMRA 4N06A 2EILC 5EK0A 1B68A 1M2VA 4A2NB 1D0XA 2YL7A 2LP4A 4N6HA 1VLTA 3S9OA 3B29A 4U5DE 1V54C 2IOQA 2WZGA 5KYWA 2V3CC 3DWWA 4GQHA 4E7SA 3IPMO 3BRJA 5L0CA 4PJJA 2LSEA 1BDJB 1LE4A 2Y69C 2AU5A 2EPLX 3EG9A 4JE9A 4LDKA 2FFHA 3CAXA 4Q7CA 2HSQA 2MWQA 3LEOA 1RJ9A 2FAPB 2YLDA 1I4ZA 4JW1A 3VRCA 5D92A 2H7VC 3JRTA 3S29A 5JVEA 1FTSA 2IYLD 2WZLA 3LUTB 4WJ0A 4FAPB 3LLKA 4CS8C 3FOOA 4YL1A 3V5ZA 2XXAB 5E33A 1VOMA 1H7IA 2IM8A 2HMZA 1M6TA 1VLSA 2GA0A 3C8GB 4AX2A 2UUHA 3OWTA 3ZDLA 4JJFA 3RVYA 1A7DA 1QZXA 5E3CA 1ZHXA 2IXOA 3MYIA 3MLGA 3DM9B 3NDBB 5B1AC 1Z6AA 2KQ9A 2BL2A 3C62A 3EGXB 2EPNA 4BJTA 2R7OA 2QTVA 1BBHA 2YVKA 2DYRC 3EZHA 2C04A 3B0UX 3M4CA 4B6IA 2GDCA 3RIPA 2J9VA 3SXYA 3ZIBA 4BJ6A 2XLWA 3S28A 4C3EA 1LE2A 2LCHA 3J06A 2G3VA 1A7VA 2L6GA 5COFA 1I5NA 1BR1A 2DB4A 3H2UA 3QZCA 5A6AA 1T6UA 5DQTA 3CQZA 3T9OA 5F5FA 1T5OA 2EIKC 3U5SA 1G4WR 4NTAA 3I5PA 4J7YA 4MTOA 2J0XA 3GM2A 4RDAA 1HE1A 1AEPA 2OU6A 2VC9A 4KNVA 2XLEA 2ZD9A 3HNKA 1V4AA 2Y3HA 3HKKA 3WODF 3EZIA 5L0JA 4RBNA 4G0HA 3RH3A 2XM4A 1R5ID 1TKNA 3RQEA 2ETSA 4CSAC 2OQMA 2R9RB 3LLIA 2B0HA 3Q6MA 1MMDA 2Y39A 3EFOB 4YWQA 1MMNA 4BG0A 3HJCA 2VH3A 4ER9A 2ZXWC 1GGQA 1FMWA 3G4ZA 3CZ6A 3R2PA 2X51A 1TFOB 4IGGA 3SXZA 4LDRA 3ZQYA 4EUKB 5T3WA 1NU9C 5KYXB 2J7PA 5HSWA 3AGTA 4BJ5C 4WABA 1NFOA 3EJNA 2DI3A 1T9KA 1NZEA 1S7ZA 2KK1A 3DKAA 3K1IA 3LNMB 5JUAA 4DRHB 3B71A 3C18A 1YVIA 4NC3A 4CS9A 4OIOF 2EPMX 3M15A 2EPOA 3W4YA 4XEVA 3AGUA 3M1CB 2W9YA 1GS9A 3VF0A 3TULA 3EH2A 2VCBA 3FHDA 1H6GA 1Q0MA 4JCHA 2KSFA 2R02A 1SYQA 4LACB 2HJMA 2XXAA 3NYJA 1ZW3A 2LIGA 3H65A 3C8GA 1T6QA 4NCQA 2OOCA 2L6FA 1M57C 2D5RB 3DMDA 4CJOA 2ICWG 4DOZA 3E70C 3NMIA 5F5HA 4DXWA 1A0BA 2HS5A 2J9WA 3AQBA 1D1AA 2G62A 2HUJA 4O7GA 4OINF 2KGOA 1HY5A 3UMIA 2YHSA 3QVYA 3AQCA 4WGZA 3C7JA 2VCAA 5KYUA 3RVZA 1Z3IX 4O6YA 5B1BC 4FESA 3S27A 1ZZPA 1ST6A 1ZVZA 2NUTB 1Z7Qc 2ZPAA 2R05A 2QLAA 1GQAA 2YZSA 1U0BB 3SXMA 3W2WA 3FVYA 3ATPA 3B0PA 2A0BA 3GORA 3K1HA 2R7VA 4JKVA 4CIHA 4LLEA 3LESA 1NLXA 1QQ3A 2A6HF 2EIJC 2Q9CA 4AL0A 1G4US 1TR2A 4P6IC 3DI5A 3U8PA 5DS5A 1OQCA 3C63A 1VTMP 5L0HA 4JTDB 1G5ZA 3IQ5A 4BEMJ 2L9JA 4I1MA 1ORYA 2XLHA 4ZLDA 1OCOC 4OIQF 1CGNA 1OW8A 4N6CA 4E18A 5L3VA 4O79A 2ASRA 4RD9A 3AJMA 1LIHA 3WHNA 2WVOA 2W45A 5L0DA 2GAQA 1IW7F 2AWYA 2NSGA 2HFIA 3EQLF 4NY3A 5KYXA 2J0WA 3DE8A 1E84A 2XRHA 1LPEA 4C7OB 2O9XA 1UG7A 1ZHZA 2HSBA 4PJLA 2IBFA 2A1DD 1T01A 5KYYA 1NBBA 4AL1A 3Q7GA 4P9FA 3NKDA 3NYLA 2PP4A 1JMWA 2CNWA 4BEJA 3U3BA 2W4MA 1A7EA 2JD3A 1RKEB 2I15A 4DRJB 1EQ1A 3I5QA 1LI7A 4U5GA 1EKYA 1JOGA 1TQGA 1YDIA 3IQCA 4IB4A 4J32B 5D91A 3GEIA 5T3TA 3U9JA 4D4NA 3KMIA 1VYKA 2CNWD 5A6BA 5HV9A 1ZW2A 1Q0KA 1LS4A 256BA 2QE9A 4JRZA 4MVOA 1LM3B 3ZG1A 3ABMC 2XLMA 4HE8D 2Q9BA 5DLJA 1WTYA 3GODA 1OKKA 4U5CE 1MNEA 2Q3TA 1QSPA 1VYIA 2NG1A 3A11A 1HE9A 1OW7A 1LI5A 3DE9A 1JPNA 2A6EF 4OD4A 1OW6A 3KL4A 5AC4A 2R7TA 4CS8A 4BJ1A 2L6HA 3JYYA 4CS7A 3PHF2 2R7WA 1QLEC 4LERA 2NUTA 4FWVA 3ABKC 4E17A 1J8MF 4E0IA 4XPXA 1O3UA 2H7BA 2Q9AA 4GEHA 2DGJA 5L3QA 2M64A 1MMGA 3TD7A 1O87A 3VAYA 5KYUB 2KYHA 4QDLA 3POVA 3KYIA 4H54A 3CSKA 4Z9HA 3KPHA 1YYJA 2IXPA 2QY9A 2LQGA 4U9EA 3U2LA 2LK4A 3VYWA 4YT8A 5IY5C 1OR2A 4E0HA 3LAYA 2XSEA 3SEOA 1CPQA 2Y3BA 5CI9A 2XS8A 4CIPA 1BZ4A 1BR2A 3JCUQ 3T6JA 1K40A 3HNIA 4C3DA 3DAFA 2GFHA 1PCXA 1R4TA 3QTHA 3DM5A 5EGYA 3AG3C 4MTFA 3S84A 4JVSA 1FMVA 1YJGA 5JSLA 5JT4A 1WWPA 4HFKB 1EA8A 1HMOA 1PD0A 1TFKB 2LFFA 2OEVA 3TK0A 1RMVA 3LJBA 2ZXOA 3RKOF 4C7OA 2R7SA 3ZSUA 4CDAA 1KTMA 2R7QA 3K7DA 1NSGB 1V74B 2OCCC 2VB6A 2PX0A 4Q5SF 3L0IA 3PDMP 4CSAA 2ZXRA 2VASA 2HV7A 1YAUO 1ZYRF 3LS1A 3V7OA 3TOMA 2PX3A 4MW8A 3WG7C 5KYYB 1RKEA 2E87A 2CW0F 2J9UA 3EGDA 3NMKA 2YL0A 3IHUA 4IWBA 2PF4E 4ULVA 5DVWA 1HW2A 2LFDA 4NTFA 3US6A 2J7PD 1CGME 4XPWA 4ANJA 3W8HA 1NFNA 4BJ5A 1KNYA 2WVNA 1Z5ZA 3TJ5A 1C17M 3MFNA 3JZ0A 1HMDA 2QUPA 4GYTA 2PFDA 1Z23A 1M2OA 1PV3A 3S0XA 3JSEO 3GWLA 4MS2A 3O6XA 5JS5A 1XZPA 4OIPF 4XEFA 3ECSA 2V26A 4PJNA 3O39A 2NPUA 5KYNA 5E2QA 3JYHA 4J7TA 4JJGA 1UFBA 4IARA 2YL1A 3C8GD 3JT1A 4N4WA 3S90A 3QVZA 4DJ9A 2HMQA 2KNHA 2WZFA 4PK4A 4H4KC 3RYLA 4AE4B 1RCPA 1OR3A 1FAPB 1YZAA 3RW0A 3O55A 4CDYA 2YEVA 3AOUA 2WVQA 4K7BA 2KJGA 1H9GA 3ZTZA 1XWJA 1W2WA 4CDVA 1M56C 5FZTA 4G7OF 5K0IA 3QW1A 4HFFB 1APCA 4PACA 4U5HA 2B0JA 2CGEA 1J8YF 2J45A 2XL8A 4CJGA 2HV6A 5COGA 1K04A 2XM0A 2PNOA 2AVKA 3MX3A 5E3AA 2R7RA 1G8XA 1RKCA 4DBRA 3NG1A 1D0YA 3FAPB 1NU7D 2MHRA 4CBEA 4DRIB 1OCZC 3SP1A 2NSFA 1JAFA 1ORJA 3O10A 3DD7A 4JEBA 5BQGA 3UNGC 2P1AA 4PFOA 4U5EE 5JRAA 4F4BA 2L81A 4JTAB 3ZTMA 5A69A 4KBLA 1OXBA 2HKVA 2J8WA 3KYJA 4NQFA 2G3KA 1MMAA 3VM6A 3AG1C 2EINC 2WB7A 3H2VA 1QPUA 3W2VA 4D4XA 3UGPA 3IQ6A 4G78A 3BEHA 1MNDA 1S05A 3N0TA 4YT5A 3L34A 4JZAA 2OKUA 3UR3C 1LVKA 4NTBA 3U0CA 1ZU5A 1SMYF 1VB5A 2YKZA 4LLCA 2CDQA 2VCCA 4U5BE 3Q7LA 4EBJA 1HW1A 4PFPA 2OJED 3RFYA 3EGDB 4M63A 4LDQA 3L1MA 1LS1A 2QNLA 2FGYA 3ZWIA 3UMHA 3TOLA 4G7ZF 5A6KA 5L0GA 3FAJA 1PD1A 4JCZA 1DOVA 3W8IA 4IRUA 3JSZA 4EBBA 4YL0A 4FX5A 3TQOA 4ZLCA 5CIVA 3LS0A 3KKBA 3RQGA 1OCRC 3EPVA 3SYNA 2H7OA 1ZHYA 2YWAA 2H8AA 3X2QC 2RSEB 1FFHA 3FXHA 3GM3A 4JTCB 4Q4ZF 1D1BA 5A6BD 3G4XA 2UUIA 5AC5A 1E85A 4I1OB 4QI0A 4OD5A 3U2MA 3HLZA 2IXMA 4AE4A 2R7UA 1SR2A 2Q4FA 1O5HA 2BE5F 1VK5A 1OKKD 1Y4CA 3KH2A 3NKEA 5COMA 3ZC4A 1NG1A 4PJMA 4IJJA 4DVYP 4K0DA 2OEXA 3JTLO 1ORSC 3N24A 2NUPB 2CYDA
chains in the Genus database with same CATH topology
3QVYA 2BC5A 4WGZA 3TOMA 3FOPA 5JP7A 1YYXA 1CPRA 3NMKA 4ULVA 4EIYA 2YL0A 2QLAA 1GQAA 2YL7A 4N6HA 2XLVA 4JKVA 2XL6A 4WGYA 1QQ3A 3HNJA 4IAQA 3U8PA 3C63A 5JS5A 3IQ5A 4JE9A 3VRCA 2YLDA 2XLHA 5JVEA 4U9DA 2J9BA 1E86A 1CGNA 2XLDA 3M79A 4IARA 2YL1A 4N4WA 3FOOA 4L6RA 3QVZA 1M6TA 1RCPA 3NMJA 3QW0A 1E84A 3DE8A 4JEAA 1YZAA 4CDYA 2CCYA 3ZTZA 4CDVA 3C62A 1NBBA 5JLIA 1E83A 3QW1A 1APCA 1BBHA 2XL8A 4CJGA 3M4CA 2XLWA 2XM0A 1A7VA 1EKYA 4IB4A 4D4NA 3ZQVA 256BA 1JAFA 4JEBA 1LM3B 5B3IA 2XLMA 5JRAA 3ZTMA 2XLEA 1YZCA 2J8WA 3HNKA 3HNLA 2YLIA 3DE9A 1QPUA 4D4XA 3IQ6A 2XM4A 1CGOA 1S05A 4CX9A 4ER9A 2YKZA 2XLOA 1YYJA 3L1MA 4U9EA 3ZWIA 5JUAA 3TOLA 5AGFA 4NC3A 1MQVA 1CPQA 3M15A 4CIPA 3HNIA 3M4BA 5JSLA 5JT4A 1E85A 4CJOA 3NMIA 2YL3A 2YLGA 4CDAA 3ZQYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QVY A;  2BC5 A;  4WGZ A;  3TOM A;  3FOP A;  5JP7 A;  1YYX A;  1CPR A;  3NMK A;  4ULV A;  4EIY A;  2YL0 A;  2QLA A;  1GQA A;  2YL7 A;  4N6H A;  2XLV A;  4JKV A;  2XL6 A;  4WGY A;  1QQ3 A;  3HNJ A;  4IAQ A;  3U8P A;  3C63 A;  5JS5 A;  3IQ5 A;  4JE9 A;  3VRC A;  2YLD A;  2XLH A;  5JVE A;  4U9D A;  2J9B A;  1E86 A;  1CGN A;  2XLD A;  3M79 A;  4IAR A;  2YL1 A;  4N4W A;  3FOO A;  4L6R A;  3QVZ A;  1M6T A;  1RCP A;  3NMJ A;  3QW0 A;  1E84 A;  3DE8 A;  4JEA A;  1YZA A;  4CDY A;  2CCY A;  3ZTZ A;  4CDV A;  3C62 A;  1NBB A;  5JLI A;  1E83 A;  3QW1 A;  1APC A;  1BBH A;  2XL8 A;  4CJG A;  3M4C A;  2XLW A;  2XM0 A;  1A7V A;  1EKY A;  4IB4 A;  4D4N A;  3ZQV A;  256B A;  1JAF A;  4JEB A;  1LM3 B;  5B3I A;  2XLM A;  5JRA A;  3ZTM A;  2XLE A;  1YZC A;  2J8W A;  3HNK A;  3HNL A;  2YLI A;  3DE9 A;  1QPU A;  4D4X A;  3IQ6 A;  2XM4 A;  1CGO A;  1S05 A;  4CX9 A;  4ER9 A;  2YKZ A;  2XLO A;  1YYJ A;  3L1M A;  4U9E A;  3ZWI A;  5JUA A;  3TOL A;  5AGF A;  4NC3 A;  1MQV A;  1CPQ A;  3M15 A;  4CIP A;  3HNI A;  3M4B A;  5JSL A;  5JT4 A;  1E85 A;  4CJO A;  3NMI A;  2YL3 A;  2YLG A;  4CDA A;  3ZQY A; 
#chains in the Genus database with same CATH topology
 1L3P A;  2A69 F;  2BC5 A;  2W4B A;  3A9C A;  3IEE A;  3N2Z B;  1K05 A;  1U6H A;  3K6B A;  5B3S C;  2EIM C;  2EPK X;  3FOP A;  4I44 A;  3I4U A;  1SF8 A;  4MVZ A;  2RD9 A;  1CPR A;  1Q0F A;  3AG2 C;  2C03 A;  3DJU B;  5F28 E;  4A4A A;  4EIY A;  3T6G B;  3DAG A;  2Z15 A;  4MND A;  4BJ6 C;  4AK9 A;  1T6I A;  4ULW A;  3X1O A;  2P61 A;  2P6V A;  4P9T A;  1VMA A;  2XLV A;  2XL6 A;  2J46 A;  1SZI A;  1I4Y A;  4WGY A;  4YN0 B;  1FR0 A;  4YT4 A;  3U9M A;  2R03 A;  3HNJ A;  4IAQ A;  1D1C A;  1JPJ A;  3U3F A;  1TWH A;  1RXQ A;  4XQ1 A;  3L8J A;  2MYS A;  2OG2 A;  4XLP F;  2AP3 A;  1WAT A;  3E9V A;  4XTK A;  1E2X A;  2J9B A;  4J30 B;  4U9D A;  1E86 A;  3MBG A;  5CI8 A;  2M4E A;  4MVQ A;  2XLD A;  4K1O A;  3M79 A;  3CEX A;  4E7Z A;  4C3B A;  5EHH A;  3T6B A;  4L6R A;  1Y6D A;  1QVX A;  4YL3 A;  2KW3 C;  3F46 A;  3SZR A;  3HTK C;  4OIR F;  4W8P A;  3B0V C;  3NMJ A;  1TWA A;  2AWC A;  3ITF A;  3QW0 A;  1WGW A;  4IAO A;  4I3M A;  4O6M A;  5DS6 A;  4JEA A;  1V55 C;  2YQY A;  4G7H F;  3OEO A;  2GWW A;  4EKW A;  2DYS C;  4U5F E;  1N1C A;  2CCY A;  3U8V A;  3FDQ A;  4Z9J A;  3GEH A;  4MTG A;  5DQZ A;  2R25 A;  3ABL C;  3T4R A;  1A41 A;  2JPU A;  5JLI A;  1E83 A;  4MVR A;  1FNT c;  4UDV A;  1C02 A;  3EHN A;  2F22 A;  3K1I C;  4XLN F;  3NYM A;  4CS9 C;  3UGO A;  4R32 A;  2WL8 A;  3EH1 A;  3OA1 A;  4DBQ A;  1TWC A;  4QI2 A;  1YLM A;  4Z9I A;  1FFT C;  5L0I A;  1M2V B;  1AUE A;  3SXK A;  5BQH A;  3V5X A;  3GWN A;  3ZQV A;  5KYW B;  2OJQ A;  4MVU A;  3ASO C;  5A6J A;  1YAR O;  1EI7 A;  3F47 A;  2A0U A;  2P0N A;  3IQT A;  4YT2 A;  5B3I A;  5BQI A;  2X0C A;  3QMK A;  4XEK A;  1JRA A;  3R7C A;  4EHP A;  2LD6 A;  3AG4 C;  3ASN C;  3GM1 A;  1YZC A;  3PCV A;  4MW3 A;  3EG9 B;  1H9T A;  2HZ8 A;  2NUP A;  1Q0D A;  1BR4 A;  3HNL A;  3LNR A;  2YLI A;  1RJ9 B;  2I8B A;  1AVO B;  4MQ9 F;  5DS4 A;  1ZU4 A;  4JC7 A;  1TWG A;  4EWC A;  5T1D B;  4YJW A;  1CGO A;  3K33 A;  4CX9 A;  4DVZ A;  4KI2 A;  1L7C A;  1F1M A;  1OXK A;  4W8K A;  1OCC C;  2Q00 A;  1LKX A;  2KC3 A;  3V5Y A;  5FCL A;  3RF3 A;  3EGX A;  2XLO A;  2HJ3 A;  4EBK A;  3EHM A;  2Q7R A;  4KNW A;  2D4U A;  1QKR A;  3K66 A;  4X0R A;  1GM5 A;  2TMV P;  3GAN A;  4MVS A;  2Y3D A;  2IXN A;  2YRF A;  1Q0G A;  5AGF A;  3TJ6 A;  1WOL A;  2ZXP A;  2P7V A;  2Y3G A;  1MQV A;  1YA9 A;  1ZHW A;  1U89 A;  2L7A A;  3DZA A;  3MYF A;  4O6N A;  2PBE A;  3M4B A;  1KU2 A;  3L8I A;  3NRH A;  2R7X A;  3GEE A;  5TJ5 E;  1WAS A;  1YA7 O;  1Z63 A;  2JX0 A;  1WN0 A;  5GPG B;  3DJN B;  4KC9 A;  3LEV A;  3B9Q A;  3SNH A;  4ONS A;  1D0Z A;  1JR8 A;  2XL4 A;  1C03 A;  5BUO A;  3RQF A;  2YL3 A;  4PR9 A;  2XS1 A;  3DXJ F;  2YLG A;  1IZM A;  4HEA J;  4YK5 A;  3UMK A;  3ZVR A;  1DOW A;  3EFO A;  1XZQ A;  4XPY A;  3Q6N A;  4JUR I;  3C8Z A;  3G50 A;  4XWJ A;  4MVM A;  3WAQ A;  1ZHT A;  5JP7 A;  4BPM A;  3FMS A;  2A68 F;  5L0F A;  1YYX A;  3JRM O;  4JIO A;  3PMR A;  4N06 A;  2EIL C;  5EK0 A;  1B68 A;  1M2V A;  4A2N B;  1D0X A;  2YL7 A;  2LP4 A;  4N6H A;  1VLT A;  3S9O A;  3B29 A;  4U5D E;  1V54 C;  2IOQ A;  2WZG A;  5KYW A;  2V3C C;  3DWW A;  4GQH A;  4E7S A;  3IPM O;  3BRJ A;  5L0C A;  4PJJ A;  2LSE A;  1BDJ B;  1LE4 A;  2Y69 C;  2AU5 A;  2EPL X;  3EG9 A;  4JE9 A;  4LDK A;  2FFH A;  3CAX A;  4Q7C A;  2HSQ A;  2MWQ A;  3LEO A;  1RJ9 A;  2FAP B;  2YLD A;  1I4Z A;  4JW1 A;  3VRC A;  5D92 A;  2H7V C;  3JRT A;  3S29 A;  5JVE A;  1FTS A;  2IYL D;  2WZL A;  3LUT B;  4WJ0 A;  4FAP B;  3LLK A;  4CS8 C;  3FOO A;  4YL1 A;  3V5Z A;  2XXA B;  5E33 A;  1VOM A;  1H7I A;  2IM8 A;  2HMZ A;  1M6T A;  1VLS A;  2GA0 A;  3C8G B;  4AX2 A;  2UUH A;  3OWT A;  3ZDL A;  4JJF A;  3RVY A;  1A7D A;  1QZX A;  5E3C A;  1ZHX A;  2IXO A;  3MYI A;  3MLG A;  3DM9 B;  3NDB B;  5B1A C;  1Z6A A;  2KQ9 A;  2BL2 A;  3C62 A;  3EGX B;  2EPN A;  4BJT A;  2R7O A;  2QTV A;  1BBH A;  2YVK A;  2DYR C;  3EZH A;  2C04 A;  3B0U X;  3M4C A;  4B6I A;  2GDC A;  3RIP A;  2J9V A;  3SXY A;  3ZIB A;  4BJ6 A;  2XLW A;  3S28 A;  4C3E A;  1LE2 A;  2LCH A;  3J06 A;  2G3V A;  1A7V A;  2L6G A;  5COF A;  1I5N A;  1BR1 A;  2DB4 A;  3H2U A;  3QZC A;  5A6A A;  1T6U A;  5DQT A;  3CQZ A;  3T9O A;  5F5F A;  1T5O A;  2EIK C;  3U5S A;  1G4W R;  4NTA A;  3I5P A;  4J7Y A;  4MTO A;  2J0X A;  3GM2 A;  4RDA A;  1HE1 A;  1AEP A;  2OU6 A;  2VC9 A;  4KNV A;  2XLE A;  2ZD9 A;  3HNK A;  1V4A A;  2Y3H A;  3HKK A;  3WOD F;  3EZI A;  5L0J A;  4RBN A;  4G0H A;  3RH3 A;  2XM4 A;  1R5I D;  1TKN A;  3RQE A;  2ETS A;  4CSA C;  2OQM A;  2R9R B;  3LLI A;  2B0H A;  3Q6M A;  1MMD A;  2Y39 A;  3EFO B;  4YWQ A;  1MMN A;  4BG0 A;  3HJC A;  2VH3 A;  4ER9 A;  2ZXW C;  1GGQ A;  1FMW A;  3G4Z A;  3CZ6 A;  3R2P A;  2X51 A;  1TFO B;  4IGG A;  3SXZ A;  4LDR A;  3ZQY A;  4EUK B;  5T3W A;  1NU9 C;  5KYX B;  2J7P A;  5HSW A;  3AGT A;  4BJ5 C;  4WAB A;  1NFO A;  3EJN A;  2DI3 A;  1T9K A;  1NZE A;  1S7Z A;  2KK1 A;  3DKA A;  3K1I A;  3LNM B;  5JUA A;  4DRH B;  3B71 A;  3C18 A;  1YVI A;  4NC3 A;  4CS9 A;  4OIO F;  2EPM X;  3M15 A;  2EPO A;  3W4Y A;  4XEV A;  3AGU A;  3M1C B;  2W9Y A;  1GS9 A;  3VF0 A;  3TUL A;  3EH2 A;  2VCB A;  3FHD A;  1H6G A;  1Q0M A;  4JCH A;  2KSF A;  2R02 A;  1SYQ A;  4LAC B;  2HJM A;  2XXA A;  3NYJ A;  1ZW3 A;  2LIG A;  3H65 A;  3C8G A;  1T6Q A;  4NCQ A;  2OOC A;  2L6F A;  1M57 C;  2D5R B;  3DMD A;  4CJO A;  2ICW G;  4DOZ A;  3E70 C;  3NMI A;  5F5H A;  4DXW A;  1A0B A;  2HS5 A;  2J9W A;  3AQB A;  1D1A A;  2G62 A;  2HUJ A;  4O7G A;  4OIN F;  2KGO A;  1HY5 A;  3UMI A;  2YHS A;  3QVY A;  3AQC A;  4WGZ A;  3C7J A;  2VCA A;  5KYU A;  3RVZ A;  1Z3I X;  4O6Y A;  5B1B C;  4FES A;  3S27 A;  1ZZP A;  1ST6 A;  1ZVZ A;  2NUT B;  1Z7Q c;  2ZPA A;  2R05 A;  2QLA A;  1GQA A;  2YZS A;  1U0B B;  3SXM A;  3W2W A;  3FVY A;  3ATP A;  3B0P A;  2A0B A;  3GOR A;  3K1H A;  2R7V A;  4JKV A;  4CIH A;  4LLE A;  3LES A;  1NLX A;  1QQ3 A;  2A6H F;  2EIJ C;  2Q9C A;  4AL0 A;  1G4U S;  1TR2 A;  4P6I C;  3DI5 A;  3U8P A;  5DS5 A;  1OQC A;  3C63 A;  1VTM P;  5L0H A;  4JTD B;  1G5Z A;  3IQ5 A;  4BEM J;  2L9J A;  4I1M A;  1ORY A;  2XLH A;  4ZLD A;  1OCO C;  4OIQ F;  1CGN A;  1OW8 A;  4N6C A;  4E18 A;  5L3V A;  4O79 A;  2ASR A;  4RD9 A;  3AJM A;  1LIH A;  3WHN A;  2WVO A;  2W45 A;  5L0D A;  2GAQ A;  1IW7 F;  2AWY A;  2NSG A;  2HFI A;  3EQL F;  4NY3 A;  5KYX A;  2J0W A;  3DE8 A;  1E84 A;  2XRH A;  1LPE A;  4C7O B;  2O9X A;  1UG7 A;  1ZHZ A;  2HSB A;  4PJL A;  2IBF A;  2A1D D;  1T01 A;  5KYY A;  1NBB A;  4AL1 A;  3Q7G A;  4P9F A;  3NKD A;  3NYL A;  2PP4 A;  1JMW A;  2CNW A;  4BEJ A;  3U3B A;  2W4M A;  1A7E A;  2JD3 A;  1RKE B;  2I15 A;  4DRJ B;  1EQ1 A;  3I5Q A;  1LI7 A;  4U5G A;  1EKY A;  1JOG A;  1TQG A;  1YDI A;  3IQC A;  4IB4 A;  4J32 B;  5D91 A;  3GEI A;  5T3T A;  3U9J A;  4D4N A;  3KMI A;  1VYK A;  2CNW D;  5A6B A;  5HV9 A;  1ZW2 A;  1Q0K A;  1LS4 A;  256B A;  2QE9 A;  4JRZ A;  4MVO A;  1LM3 B;  3ZG1 A;  3ABM C;  2XLM A;  4HE8 D;  2Q9B A;  5DLJ A;  1WTY A;  3GOD A;  1OKK A;  4U5C E;  1MNE A;  2Q3T A;  1QSP A;  1VYI A;  2NG1 A;  3A11 A;  1HE9 A;  1OW7 A;  1LI5 A;  3DE9 A;  1JPN A;  2A6E F;  4OD4 A;  1OW6 A;  3KL4 A;  5AC4 A;  2R7T A;  4CS8 A;  4BJ1 A;  2L6H A;  3JYY A;  4CS7 A;  3PHF 2;  2R7W A;  1QLE C;  4LER A;  2NUT A;  4FWV A;  3ABK C;  4E17 A;  1J8M F;  4E0I A;  4XPX A;  1O3U A;  2H7B A;  2Q9A A;  4GEH A;  2DGJ A;  5L3Q A;  2M64 A;  1MMG A;  3TD7 A;  1O87 A;  3VAY A;  5KYU B;  2KYH A;  4QDL A;  3POV A;  3KYI A;  4H54 A;  3CSK A;  4Z9H A;  3KPH A;  1YYJ A;  2IXP A;  2QY9 A;  2LQG A;  4U9E A;  3U2L A;  2LK4 A;  3VYW A;  4YT8 A;  5IY5 C;  1OR2 A;  4E0H A;  3LAY A;  2XSE A;  3SEO A;  1CPQ A;  2Y3B A;  5CI9 A;  2XS8 A;  4CIP A;  1BZ4 A;  1BR2 A;  3JCU Q;  3T6J A;  1K40 A;  3HNI A;  4C3D A;  3DAF A;  2GFH A;  1PCX A;  1R4T A;  3QTH A;  3DM5 A;  5EGY A;  3AG3 C;  4MTF A;  3S84 A;  4JVS A;  1FMV A;  1YJG A;  5JSL A;  5JT4 A;  1WWP A;  4HFK B;  1EA8 A;  1HMO A;  1PD0 A;  1TFK B;  2LFF A;  2OEV A;  3TK0 A;  1RMV A;  3LJB A;  2ZXO A;  3RKO F;  4C7O A;  2R7S A;  3ZSU A;  4CDA A;  1KTM A;  2R7Q A;  3K7D A;  1NSG B;  1V74 B;  2OCC C;  2VB6 A;  2PX0 A;  4Q5S F;  3L0I A;  3PDM P;  4CSA A;  2ZXR A;  2VAS A;  2HV7 A;  1YAU O;  1ZYR F;  3LS1 A;  3V7O A;  3TOM A;  2PX3 A;  4MW8 A;  3WG7 C;  5KYY B;  1RKE A;  2E87 A;  2CW0 F;  2J9U A;  3EGD A;  3NMK A;  2YL0 A;  3IHU A;  4IWB A;  2PF4 E;  4ULV A;  5DVW A;  1HW2 A;  2LFD A;  4NTF A;  3US6 A;  2J7P D;  1CGM E;  4XPW A;  4ANJ A;  3W8H A;  1NFN A;  4BJ5 A;  1KNY A;  2WVN A;  1Z5Z A;  3TJ5 A;  1C17 M;  3MFN A;  3JZ0 A;  1HMD A;  2QUP A;  4GYT A;  2PFD A;  1Z23 A;  1M2O A;  1PV3 A;  3S0X A;  3JSE O;  3GWL A;  4MS2 A;  3O6X A;  5JS5 A;  1XZP A;  4OIP F;  4XEF A;  3ECS A;  2V26 A;  4PJN A;  3O39 A;  2NPU A;  5KYN A;  5E2Q A;  3JYH A;  4J7T A;  4JJG A;  1UFB A;  4IAR A;  2YL1 A;  3C8G D;  3JT1 A;  4N4W A;  3S90 A;  3QVZ A;  4DJ9 A;  2HMQ A;  2KNH A;  2WZF A;  4PK4 A;  4H4K C;  3RYL A;  4AE4 B;  1RCP A;  1OR3 A;  1FAP B;  1YZA A;  3RW0 A;  3O55 A;  4CDY A;  2YEV A;  3AOU A;  2WVQ A;  4K7B A;  2KJG A;  1H9G A;  3ZTZ A;  1XWJ A;  1W2W A;  4CDV A;  1M56 C;  5FZT A;  4G7O F;  5K0I A;  3QW1 A;  4HFF B;  1APC A;  4PAC A;  4U5H A;  2B0J A;  2CGE A;  1J8Y F;  2J45 A;  2XL8 A;  4CJG A;  2HV6 A;  5COG A;  1K04 A;  2XM0 A;  2PNO A;  2AVK A;  3MX3 A;  5E3A A;  2R7R A;  1G8X A;  1RKC A;  4DBR A;  3NG1 A;  1D0Y A;  3FAP B;  1NU7 D;  2MHR A;  4CBE A;  4DRI B;  1OCZ C;  3SP1 A;  2NSF A;  1JAF A;  1ORJ A;  3O10 A;  3DD7 A;  4JEB A;  5BQG A;  3UNG C;  2P1A A;  4PFO A;  4U5E E;  5JRA A;  4F4B A;  2L81 A;  4JTA B;  3ZTM A;  5A69 A;  4KBL A;  1OXB A;  2HKV A;  2J8W A;  3KYJ A;  4NQF A;  2G3K A;  1MMA A;  3VM6 A;  3AG1 C;  2EIN C;  2WB7 A;  3H2V A;  1QPU A;  3W2V A;  4D4X A;  3UGP A;  3IQ6 A;  4G78 A;  3BEH A;  1MND A;  1S05 A;  3N0T A;  4YT5 A;  3L34 A;  4JZA A;  2OKU A;  3UR3 C;  1LVK A;  4NTB A;  3U0C A;  1ZU5 A;  1SMY F;  1VB5 A;  2YKZ A;  4LLC A;  2CDQ A;  2VCC A;  4U5B E;  3Q7L A;  4EBJ A;  1HW1 A;  4PFP A;  2OJE D;  3RFY A;  3EGD B;  4M63 A;  4LDQ A;  3L1M A;  1LS1 A;  2QNL A;  2FGY A;  3ZWI A;  3UMH A;  3TOL A;  4G7Z F;  5A6K A;  5L0G A;  3FAJ A;  1PD1 A;  4JCZ A;  1DOV A;  3W8I A;  4IRU A;  3JSZ A;  4EBB A;  4YL0 A;  4FX5 A;  3TQO A;  4ZLC A;  5CIV A;  3LS0 A;  3KKB A;  3RQG A;  1OCR C;  3EPV A;  3SYN A;  2H7O A;  1ZHY A;  2YWA A;  2H8A A;  3X2Q C;  2RSE B;  1FFH A;  3FXH A;  3GM3 A;  4JTC B;  4Q4Z F;  1D1B A;  5A6B D;  3G4X A;  2UUI A;  5AC5 A;  1E85 A;  4I1O B;  4QI0 A;  4OD5 A;  3U2M A;  3HLZ A;  2IXM A;  4AE4 A;  2R7U A;  1SR2 A;  2Q4F A;  1O5H A;  2BE5 F;  1VK5 A;  1OKK D;  1Y4C A;  3KH2 A;  3NKE A;  5COM A;  3ZC4 A;  1NG1 A;  4PJM A;  4IJJ A;  4DVY P;  4K0D A;  2OEX A;  3JTL O;  1ORS C;  3N24 A;  2NUP B;  2CYD A; 
#chains in the Genus database with same CATH homology
 3QVY A;  2BC5 A;  4WGZ A;  3TOM A;  3FOP A;  5JP7 A;  1YYX A;  1CPR A;  3NMK A;  4ULV A;  4EIY A;  2YL0 A;  2QLA A;  1GQA A;  2YL7 A;  4N6H A;  2XLV A;  4JKV A;  2XL6 A;  4WGY A;  1QQ3 A;  3HNJ A;  4IAQ A;  3U8P A;  3C63 A;  5JS5 A;  3IQ5 A;  4JE9 A;  3VRC A;  2YLD A;  2XLH A;  5JVE A;  4U9D A;  2J9B A;  1E86 A;  1CGN A;  2XLD A;  3M79 A;  4IAR A;  2YL1 A;  4N4W A;  3FOO A;  4L6R A;  3QVZ A;  1M6T A;  1RCP A;  3NMJ A;  3QW0 A;  1E84 A;  3DE8 A;  4JEA A;  1YZA A;  4CDY A;  2CCY A;  3ZTZ A;  4CDV A;  3C62 A;  1NBB A;  5JLI A;  1E83 A;  3QW1 A;  1APC A;  1BBH A;  2XL8 A;  4CJG A;  3M4C A;  2XLW A;  2XM0 A;  1A7V A;  1EKY A;  4IB4 A;  4D4N A;  3ZQV A;  256B A;  1JAF A;  4JEB A;  1LM3 B;  5B3I A;  2XLM A;  5JRA A;  3ZTM A;  2XLE A;  1YZC A;  2J8W A;  3HNK A;  3HNL A;  2YLI A;  3DE9 A;  1QPU A;  4D4X A;  3IQ6 A;  2XM4 A;  1CGO A;  1S05 A;  4CX9 A;  4ER9 A;  2YKZ A;  2XLO A;  1YYJ A;  3L1M A;  4U9E A;  3ZWI A;  5JUA A;  3TOL A;  5AGF A;  4NC3 A;  1MQV A;  1CPQ A;  3M15 A;  4CIP A;  3HNI A;  3M4B A;  5JSL A;  5JT4 A;  1E85 A;  4CJO A;  3NMI A;  2YL3 A;  2YLG A;  4CDA A;  3ZQY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...