3TOLA

Crystal structure of an engineered cytochrome cb562 that forms 1d, zn-mediated coordination polymers
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
106
structure length
106
Chain Sequence
ADLEDNMETLNDNLKVIEKADNAAQVEKALEKMLAAAADALKATPPKLEDKSPDSPEMRDFRHGFAILMGQIHDAAHLANEGKVKEAQAAAEQLKTTCNACHQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Soluble cytochrome b562
publication title Metal-directed, chemically tunable assembly of one-, two- and three-dimensional crystalline protein arrays.
pubmed doi rcsb
source organism Escherichia coli
total genus 48
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 3tolA00
3NMJA 3C63A 1QQ3A 1YZAA 2YLDA 1E86A 1YYJA 3HNLA 3HNIA 5AGFA 1E84A 5JUAA 3U8PA 2CCYA 3ZTMA 2XLEA 3QVYA 4CDVA 3QW1A 3IQ5A 4CIPA 3TOMA 1RCPA 3QW0A 5JSLA 4WGYA 2YL1A 1E83A 4D4XA 2XLDA 4NC3A 3QVZA 4L6RA 2YKZA 2YL0A 2XL8A 4U9DA 2YLGA 3IQ6A 2YL3A 5JS5A 3NMKA 1CGNA 1LM3B 3DE8A 3L1MA 1M6TA 1E85A 4CJOA 3ZWIA 3HNJA 4EIYA 4U9EA 4IB4A 2YL7A 4CX9A 1APCA 3DE9A 4CDAA 1JAFA 4JEAA 2J9BA 2XLMA 2YLIA 3C62A 1CPQA 1GQAA 4ER9A 2XLWA 4CJGA 2QLAA 256BA 5B3IA 3M15A 2XL6A 1NBBA 1YYXA 3HNKA 1QPUA 1A7VA 3NMIA 3ZTZA 4ULVA 2XLOA 4IAQA 1CGOA 1EKYA 4IARA 4N4WA 2BC5A 3M4BA 4D4NA 5JT4A 4N6HA 1CPRA 4CDYA 2XLHA 3TOLA 5JRAA 3VRCA 5JVEA 1S05A 1MQVA 2XM4A 4JE9A 3FOPA 3M79A 4JKVA 2J8WA 3FOOA 3M4CA 3ZQVA 4JEBA 5JP7A 2XLVA 2XM0A 1YZCA 4WGZA 3ZQYA 5JLIA 1BBHA
chains in the Genus database with same CATH superfamily
4LLCA 2QY9A 4DVZA 1WWPA 3NMJA 3LJBA 2P6VA 1TFKB 4EUKB 1VYIA 4MS2A 5E3AA 3WODF 2KQ9A 3I5QA 3U3FA 4BEJA 1ZYRF 3KMIA 1E86A 1YYJA 2J0XA 2C04A 2KC3A 2Y3DA 3HNLA 4HFFB 3US6A 2GAQA 5AGFA 3ZIBA 4NCQA 1E84A 2H7OA 3UGPA 3ZTMA 2EPKX 1VB5A 4RBNA 4XPYA 3EZHA 5D91A 2A68F 1M57C 4CIPA 5L0CA 3W8IA 3L0IA 4JTAB 3MBGA 1JOGA 1WATA 3LNRA 3MFNA 4XLNF 3QW0A 4YK5A 1YARO 2YL1A 1M2VA 5AC4A 2EILC 5KYXB 3RF3A 3U9MA 1S7ZA 1RKEB 1Z5ZA 3ZG1A 3AG4C 4IRUA 1D0XA 3MYFA 2XLDA 4J32B 5BQGA 3DZAA 4JTCB 4N6CA 4HE8D 1HE9A 3F47A 5B1BC 1E2XA 1FFHA 2M4EA 2R7OA 2WVQA 5GPGB 3FVYA 1K04A 2NUPB 2YLGA 3AJMA 2YWAA 4FWVA 3NMKA 4DRHB 3DE8A 4E18A 3U9JA 3L34A 1MNEA 2J9WA 3K66A 4FX5A 2YHSA 1A41A 4MW3A 5IY5C 3RQGA 2J7PD 4C3BA 4EIYA 1V4AA 2P1AA 5KYXA 3TJ5A 1ZU4A 2VB6A 4MVUA 4MVMA 1RKEA 4CX9A 1AUEA 1TWCA 3KYIA 4JJGA 4H54A 3CQZA 4BJ6A 3JT1A 4CDAA 3B0PA 4QDLA 4ZLDA 2A6EF 1JAFA 4DVYP 2B0HA 3DI5A 2H7BA 1SYQA 2NUPA 2UUIA 1D0YA 4G78A 2OCCC 1Z63A 3N2ZB 3NG1A 1MNDA 3RW0A 3CZ6A 3S27A 3ZVRA 1Z6AA 1ZW2A 2EIKC 2R05A 2ZXRA 3DMDA 3O55A 4NY3A 4RD9A 4P9FA 1BZ4A 3W8HA 1OCCC 3I4UA 4XQ1A 3S29A 2HMZA 1YYXA 1TR2A 1NZEA 2I15A 3HNKA 4HEAJ 4W8PA 5COMA 2J45A 4MNDA 3IHUA 4YL0A 3LEOA 4U5GA 1U6HA 5B1AC 2J0WA 2VC9A 1A7VA 2IXPA 4ULVA 3TQOA 4PJJA 4Z9HA 3VF0A 1D1AA 2KJGA 4YL1A 1CGOA 2ZXOA 1NLXA 2JD3A 4CS7A 4JJFA 2LQGA 2H7VC 3E70C 3CSKA 2ZXPA 4YWQA 4JW1A 3POVA 4G0HA 4KC9A 3C8ZA 2NPUA 4N6HA 5DQZA 2J9UA 5E33A 4E7ZA 1ZHTA 3TOLA 4MW8A 3K1HA 3X1OA 2X51A 3GWNA 2ZXWC 5COGA 2HMQA 1Q0DA 4LACB 2AVKA 3VRCA 3X2QC 4E17A 5JRAA 5JVEA 5T3TA 1U0BB 2XM4A 2CDQA 2DI3A 1O87A 4JE9A 4LDQA 3LESA 4PJNA 3W4YA 4ANJA 4LDKA 3RVYA 4EHPA 1Q0FA 1OKKA 2OG2A 3JRMO 3DKAA 2LIGA 3FOOA 5L3VA 4JC7A 2CGEA 2A6HF 2RSEB 5JP7A 5L0JA 3V7OA 3IQCA 3LUTB 3OA1A 1LKXA 1BBHA 3CAXA 4YT4A 3Q6NA 5JLIA 1AVOB 1ZHYA 3DAGA 4XEVA 1HW2A 2IYLD 3EGDB 2CNWA 4IAOA 4MTFA 4C7OB 3BRJA 3UGOA 2XXAA 2NUTB 1OCOC 1ORYA 3QTHA 4XPXA 2HV6A 2KSFA 2I8BA 3GM3A 1R4TA 3ABMC 1C03A 4J7YA 4HFKB 4EBJA 1TWHA 3G4ZA 5K0IA 2R7SA 3HLZA 1ORSC 1V55C 1YVIA 3EHNA 2OQMA 3ECSA 4GQHA 3ZC4A 4AE4B 1HY5A 1Z3IX 3U8VA 1KU2A 4OIPF 3NKEA 4DOZA 4IWBA 5EK0A 5L0FA 1FNTc 1R5ID 3MYIA 3O39A 1O3UA 2HKVA 2ZPAA 2R7WA 4LDRA 2JPUA 2NSFA 3AG3C 2HJ3A 4CS8A 1HW1A 1BR4A 4XPWA 2A0UA 4O6MA 2PNOA 2KYHA 2L7AA 1HMOA 1MMAA 4WGYA 3T4RA 3RYLA 5KYNA 2PP4A 3RKOF 1SF8A 1ZHWA 2Q4FA 5JUAA 5KYWB 4QI2A 4NC3A 3QVZA 1PD1A 3DM9B 1AEPA 5CI9A 2D4UA 4IGGA 2LK4A 3EJNA 3EZIA 1FFTC 2LFDA 3V5ZA 3EGXB 4EBKA 3FDQA 2YL0A 3GODA 1C17M 2R9RB 3S9OA 2XL8A 4JCZA 4U9DA 4MVZA 5A6BA 5B3SC 2QE9A 3IQ6A 1W2WA 2VCAA 2YL3A 2RD9A 3NYJA 3GM2A 5JS5A 3EQLF 1QKRA 3L1MA 2TMVP 1M6TA 2Y39A 4ONSA 1K05A 5E2QA 4KI2A 3AGTA 3RIPA 3TULA 3MX3A 1WASA 3JTLO 2YRFA 3NRHA 2PX3A 4PFOA 2G3VA 2JX0A 4AE4A 2EPOA 2YQYA 1BDJB 2EPLX 4QI0A 3SXYA 3G4XA 4MVOA 1TWAA 3AG1C 4XEKA 3DE9A 3K1IA 5BUOA 4KBLA 2HSQA 2PX0A 4O6NA 3EGXA 1WOLA 2BE5F 2IXNA 1SMYF 1J8YF 1V74B 2OEVA 1BR2A 4KNWA 3A9CA 1MMDA 4O6YA 3RH3A 3KPHA 5DQTA 1OW8A 3KL4A 2XLWA 2PFDA 2F22A 3PHF2 1F1MA 3C8GD 5B3IA 3O6XA 1G5ZA 1JPNA 3V5YA 4CS9A 4CIHA 4GEHA 4B6IA 2A69F 2J7PA 2XL6A 2R7VA 3LLKA 4KNVA 3WAQA 3MLGA 4C3DA 1OW7A 3DAFA 1T6UA 4NQFA 3B9QA 4BJ6C 1I5NA 2WZFA 1KNYA 1XZQA 2DGJA 2MWQA 3ZTZA 3DWWA 2QNLA 3GEIA 2FFHA 1Q0GA 2EINC 3SYNA 4DBQA 4PR9A 2R7RA 1Z7Qc 1NU9C 2WVOA 3L8JA 5A6AA 4DRIB 4I1OB 3VM6A 4CBEA 1QVXA 1H7IA 2AP3A 2A1DD 1TQGA 3GEEA 5EGYA 1QSPA 3LS0A 1OR2A 4NTAA 4NTBA 2XLHA 4CDYA 5DS4A 2ASRA 5KYUB 1VLTA 3UMHA 3ITFA 3IQTA 2E87A 4U5BE 3R7CA 3E9VA 3QMKA 1KTMA 3FOPA 4AK9A 1D0ZA 1GM5A 2XRHA 3AQBA 3VYWA 4PACA 1YA7O 2AWCA 3DD7A 4O79A 4JEBA 3AGUA 1BR1A 4X0RA 3ZQVA 3JZ0A 4AX2A 5T1DB 2VH3A 1V54C 2XLVA 2ICWG 3WHNA 1YZCA 1HMDA 3C18A 4JIOA 3ZQYA 1TFOB 2Y3GA 3LAYA 2XS1A 3KKBA 3B0VC 1L3PA 3W2VA 3O10A 3UMKA 3U5SA 2EIJC 3C63A 1T01A 3FMSA 1QQ3A 3H2UA 1VTMP 1YZAA 1NFNA 2YLDA 1B68A 4U5FE 3SZRA 3PDMP 3AG2C 4LLEA 5A69A 1D1CA 3KYJA 1K40A 5KYUA 3AQCA 1FR0A 3DM5A 1PV3A 4E7SA 1NSGB 2CCYA 2H8AA 2EIMC 3LNMB 5COFA 3ZSUA 1FMWA 1OW6A 3QVYA 4LERA 3ATPA 4CS9C 1YDIA 2R7TA 1VYKA 1RXQA 2HJMA 3B71A 3CEXA 3HJCA 3RFYA 2L6HA 1E83A 2NG1A 2P0NA 2EPNA 2QUPA 5FZTA 4D4XA 5DS6A 3U0CA 1LE2A 5D92A 4L6RA 1MMGA 2GDCA 4OIQF 3NDBB 3SXKA 1VLSA 2YKZA 2GFHA 2Y69C 1CGME 1M2OA 4IJJA 1IZMA 1OR3A 3GORA 3OEOA 3A11A 5DVWA 1A7DA 1EI7A 1Y6DA 2W4BA 2J46A 3U2LA 2KNHA 3SNHA 2Q3TA 2L6GA 4PFPA 2WL8A 2X0CA 4YT8A 1E85A 1FMVA 1JR8A 4F4BA 4C3EA 2HUJA 5KYYB 2M64A 4XLPF 4E0HA 4MVRA 4OINF 2B0JA 3S84A 2YZSA 2UUHA 5EHHA 1T6IA 4U9EA 1OQCA 1PD0A 3G50A 4J30B 5L3QA 4JCHA 4MVSA 3UR3C 1QZXA 1LIHA 1I4YA 2YL7A 3RQFA 3S28A 3JCUQ 1APCA 4H4KC 2W9YA 3U2MA 3EGDA 3K6BA 1ZU5A 4MTOA 5T3WA 3T6BA 4C7OA 2LSEA 2Q7RA 1NG1A 2DYSC 3LS1A 4JEAA 2NUTA 4DXWA 3L8IA 2J9BA 3J06A 1N1CA 2XLMA 1WN0A 1OCZC 1ZHXA 2CNWD 1UFBA 1G4WR 1CPQA 1GQAA 2Y3HA 3C8GB 3DJNB 2C03A 1ZVZA 1ZZPA 2AWYA 4YL3A 2VCBA 1D1BA 2IXOA 4CJGA 4Q5SF 1JPJA 4MVQA 3M15A 1HE1A 3DXJF 3JYYA 4GYTA 2Q9CA 3ASOC 1NBBA 5CI8A 3JYHA 3V5XA 2ETSA 2BL2A 1QPUA 2L9JA 4P6IC 5DLJA 4BEMJ 4A4AA 1NFOA 4WABA 2YVKA 4YN0B 2Q00A 4JVSA 4EKWA 3ZDLA 2HSBA 3NMIA 2WZGA 1TWGA 2Y3BA 1H9TA 1M2VB 5KYWA 2XLOA 4R32A 3ABKC 3Q7GA 3N24A 4BPMA 1A0BA 1LE4A 1M56C 2DB4A 2G3KA 2Q9BA 4IAQA 2OOCA 4JZAA 5BQIA 4N4WA 5CIVA 4DBRA 3JRTA 4RDAA 5AC5A 3C8GA 4OIRF 3T9OA 1CPRA 2O9XA 1GGQA 4ULWA 4I1MA 1OXKA 1U89A 2FGYA 4XEFA 4G7HF 4U5HA 4JURI 4Z9IA 5A6BD 1UG7A 1WTYA 4JTDB 3N0TA 1O5HA 3UNGC 3NYMA 1FTSA 5L0IA 1J8MF 1YJGA 2CYDA 1MMNA 3GWLA 4W8KA 3U3BA 4WJ0A 4JKVA 2J8WA 3M4CA 4U5EE 2A0BA 4ER9A 5HSWA 2WB7A 1SR2A 3EH1A 3IPMO 4BJ5A 2GWWA 1XWJA 2AU5A 4MQ9F 4WGZA 3SXMA 4CS8C 4CSAA 3DJUB 4PK4A 3T6GB 3ABLC 5A6KA 1LPEA 3GM1A 2IOQA 5A6JA 4ZLCA 3SP1A 1ZHZA 1RKCA 3B29A 2XS8A 2P7VA 4XWJA 2W4MA 2HZ8A 1QLEC 1RJ9B 4K0DA 1H6GA 2WZLA 3TJ6A 4A2NB 3HNIA 2HV7A 1LI5A 1YA9A 3EH2A 3Q6MA 1IW7F 3FAJA 1JRAA 4M63A 3U8PA 1XZPA 3C7JA 2XLEA 3LLIA 1Y4CA 3EPVA 3KH2A 1ORJA 1OXBA 4CDVA 3QW1A 3H2VA 4AL0A 3TK0A 2DYRC 3IQ5A 4YT2A 2VASA 2QTVA 1ST6A 2LD6A 3TOMA 4BG0A 2R7UA 1RCPA 5JSLA 2R7QA 2LCHA 1PCXA 4PJLA 3EG9B 1LS1A 2IM8A 1TKNA 3OWTA 4I3MA 4P9TA 4Q4ZF 2XSEA 4E0IA 2PBEA 4U5CE 1JMWA 5DS5A 3ASNC 4XTKA 3VAYA 5BQHA 1RJ9A 3SXZA 3K33A 3K1IC 3IEEA 3NYLA 2CW0F 2R03A 1Q0MA 1I4ZA 1LVKA 2VCCA 3HTKC 3QZCA 2KGOA 3HKKA 1CGNA 1LM3B 2OEXA 4N06A 1Q0KA 2LP4A 2IXMA 3H65A 2OJQA 4G7ZF 1YAUO 1C02A 4CJOA 3ZWIA 3GEHA 2W45A 3HNJA 1LS4A 4Q7CA 5L0HA 4UDVA 2GA0A 4PJMA 1T6QA 2Z15A 4EBBA 2LFFA 2NSGA 4FESA 2D5RB 3EG9A 2R7XA 1H9GA 1VK5A 4IB4A 2OKUA 4J7TA 3K7DA 5HV9A 3GANA 5F5HA 3T6JA 2L81A 5F5FA 2EPMX 4BJ5C 2P61A 2ZD9A 3S0XA 4CSAC 5L0DA 3TD7A 3RVZA 3EFOB 4DJ9A 3PMRA 1RMVA 1VMAA 2FAPB 4G7OF 2XXAB 2YLIA 5F28E 3C62A 4U5DE 5E3CA 2OJED 1L7CA 4YJWA 2R02A 3EHMA 2QLAA 256BA 3M1CB 3R2PA 1T9KA 3Q7LA 5TJ5E 3JSZA 1T5OA 4FAPB 2R25A 1VOMA 1Z23A 2G62A 3W2WA 3RQEA 4BJ1A 1G8XA 1SZIA 2HFIA 4I44A 3BEHA 1OKKD 3FXHA 3PCVA 2OU6A 1GS9A 3F46A 3I5PA 4YT5A 4OD4A 2V26A 2IBFA 2HS5A 1EKYA 3EFOA 4O7GA 4DRJB 4IARA 4K7BA 5L0GA 2BC5A 3M4BA 2KK1A 1LI7A 3AOUA 3S90A 4OIOF 4D4NA 1DOVA 4Z9JA 5JT4A 1WGWA 1OCRC 2XL4A 2J9VA 2L6FA 3FAPB 4NTFA 3WG7C 4MTGA 2KW3C 2PF4E 2V3CC 1S05A 2MYSA 5KYYA 1MQVA 4BJTA 3JSEO 4AL1A 3SEOA 3M79A 1EA8A 1EQ1A 3B0UX 4EWCA 2MHRA 3LEVA 1ZW3A 1FAPB 5FCLA 1YLMA 2YEVA 1NU7D 2Q9AA 3NKDA 2XM0A 4JRZA 4OD5A 3FHDA 4K1OA 1G4US 2WVNA 1DOWA 1A7EA 3UMIA
chains in the Genus database with same CATH topology
3NMJA 3C63A 1QQ3A 1YZAA 2YLDA 1E86A 1YYJA 3HNLA 3HNIA 5AGFA 1E84A 5JUAA 3U8PA 2CCYA 3ZTMA 2XLEA 3QVYA 4CDVA 3QW1A 3IQ5A 4CIPA 3TOMA 1RCPA 3QW0A 5JSLA 4WGYA 2YL1A 1E83A 4D4XA 2XLDA 4NC3A 3QVZA 4L6RA 2YKZA 2YL0A 2XL8A 4U9DA 2YLGA 3IQ6A 2YL3A 5JS5A 3NMKA 1CGNA 1LM3B 3DE8A 3L1MA 1M6TA 1E85A 4CJOA 3ZWIA 3HNJA 4EIYA 4U9EA 4IB4A 2YL7A 4CX9A 1APCA 3DE9A 4CDAA 1JAFA 4JEAA 2J9BA 2XLMA 2YLIA 3C62A 1CPQA 1GQAA 4ER9A 2XLWA 4CJGA 2QLAA 256BA 5B3IA 3M15A 2XL6A 1NBBA 1YYXA 3HNKA 1QPUA 1A7VA 3NMIA 3ZTZA 4ULVA 2XLOA 4IAQA 1CGOA 1EKYA 4IARA 4N4WA 2BC5A 3M4BA 4D4NA 5JT4A 4N6HA 1CPRA 4CDYA 2XLHA 3TOLA 5JRAA 3VRCA 5JVEA 1S05A 1MQVA 2XM4A 4JE9A 3FOPA 3M79A 4JKVA 2J8WA 3FOOA 3M4CA 3ZQVA 4JEBA 5JP7A 2XLVA 2XM0A 1YZCA 4WGZA 3ZQYA 5JLIA 1BBHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NMJ A;  3C63 A;  1QQ3 A;  1YZA A;  2YLD A;  1E86 A;  1YYJ A;  3HNL A;  3HNI A;  5AGF A;  1E84 A;  5JUA A;  3U8P A;  2CCY A;  3ZTM A;  2XLE A;  3QVY A;  4CDV A;  3QW1 A;  3IQ5 A;  4CIP A;  3TOM A;  1RCP A;  3QW0 A;  5JSL A;  4WGY A;  2YL1 A;  1E83 A;  4D4X A;  2XLD A;  4NC3 A;  3QVZ A;  4L6R A;  2YKZ A;  2YL0 A;  2XL8 A;  4U9D A;  2YLG A;  3IQ6 A;  2YL3 A;  5JS5 A;  3NMK A;  1CGN A;  1LM3 B;  3DE8 A;  3L1M A;  1M6T A;  1E85 A;  4CJO A;  3ZWI A;  3HNJ A;  4EIY A;  4U9E A;  4IB4 A;  2YL7 A;  4CX9 A;  1APC A;  3DE9 A;  4CDA A;  1JAF A;  4JEA A;  2J9B A;  2XLM A;  2YLI A;  3C62 A;  1CPQ A;  1GQA A;  4ER9 A;  2XLW A;  4CJG A;  2QLA A;  256B A;  5B3I A;  3M15 A;  2XL6 A;  1NBB A;  1YYX A;  3HNK A;  1QPU A;  1A7V A;  3NMI A;  3ZTZ A;  4ULV A;  2XLO A;  4IAQ A;  1CGO A;  1EKY A;  4IAR A;  4N4W A;  2BC5 A;  3M4B A;  4D4N A;  5JT4 A;  4N6H A;  1CPR A;  4CDY A;  2XLH A;  3TOL A;  5JRA A;  3VRC A;  5JVE A;  1S05 A;  1MQV A;  2XM4 A;  4JE9 A;  3FOP A;  3M79 A;  4JKV A;  2J8W A;  3FOO A;  3M4C A;  3ZQV A;  4JEB A;  5JP7 A;  2XLV A;  2XM0 A;  1YZC A;  4WGZ A;  3ZQY A;  5JLI A;  1BBH A; 
#chains in the Genus database with same CATH topology
 4LLC A;  2QY9 A;  4DVZ A;  1WWP A;  3NMJ A;  3LJB A;  2P6V A;  1TFK B;  4EUK B;  1VYI A;  4MS2 A;  5E3A A;  3WOD F;  2KQ9 A;  3I5Q A;  3U3F A;  4BEJ A;  1ZYR F;  3KMI A;  1E86 A;  1YYJ A;  2J0X A;  2C04 A;  2KC3 A;  2Y3D A;  3HNL A;  4HFF B;  3US6 A;  2GAQ A;  5AGF A;  3ZIB A;  4NCQ A;  1E84 A;  2H7O A;  3UGP A;  3ZTM A;  2EPK X;  1VB5 A;  4RBN A;  4XPY A;  3EZH A;  5D91 A;  2A68 F;  1M57 C;  4CIP A;  5L0C A;  3W8I A;  3L0I A;  4JTA B;  3MBG A;  1JOG A;  1WAT A;  3LNR A;  3MFN A;  4XLN F;  3QW0 A;  4YK5 A;  1YAR O;  2YL1 A;  1M2V A;  5AC4 A;  2EIL C;  5KYX B;  3RF3 A;  3U9M A;  1S7Z A;  1RKE B;  1Z5Z A;  3ZG1 A;  3AG4 C;  4IRU A;  1D0X A;  3MYF A;  2XLD A;  4J32 B;  5BQG A;  3DZA A;  4JTC B;  4N6C A;  4HE8 D;  1HE9 A;  3F47 A;  5B1B C;  1E2X A;  1FFH A;  2M4E A;  2R7O A;  2WVQ A;  5GPG B;  3FVY A;  1K04 A;  2NUP B;  2YLG A;  3AJM A;  2YWA A;  4FWV A;  3NMK A;  4DRH B;  3DE8 A;  4E18 A;  3U9J A;  3L34 A;  1MNE A;  2J9W A;  3K66 A;  4FX5 A;  2YHS A;  1A41 A;  4MW3 A;  5IY5 C;  3RQG A;  2J7P D;  4C3B A;  4EIY A;  1V4A A;  2P1A A;  5KYX A;  3TJ5 A;  1ZU4 A;  2VB6 A;  4MVU A;  4MVM A;  1RKE A;  4CX9 A;  1AUE A;  1TWC A;  3KYI A;  4JJG A;  4H54 A;  3CQZ A;  4BJ6 A;  3JT1 A;  4CDA A;  3B0P A;  4QDL A;  4ZLD A;  2A6E F;  1JAF A;  4DVY P;  2B0H A;  3DI5 A;  2H7B A;  1SYQ A;  2NUP A;  2UUI A;  1D0Y A;  4G78 A;  2OCC C;  1Z63 A;  3N2Z B;  3NG1 A;  1MND A;  3RW0 A;  3CZ6 A;  3S27 A;  3ZVR A;  1Z6A A;  1ZW2 A;  2EIK C;  2R05 A;  2ZXR A;  3DMD A;  3O55 A;  4NY3 A;  4RD9 A;  4P9F A;  1BZ4 A;  3W8H A;  1OCC C;  3I4U A;  4XQ1 A;  3S29 A;  2HMZ A;  1YYX A;  1TR2 A;  1NZE A;  2I15 A;  3HNK A;  4HEA J;  4W8P A;  5COM A;  2J45 A;  4MND A;  3IHU A;  4YL0 A;  3LEO A;  4U5G A;  1U6H A;  5B1A C;  2J0W A;  2VC9 A;  1A7V A;  2IXP A;  4ULV A;  3TQO A;  4PJJ A;  4Z9H A;  3VF0 A;  1D1A A;  2KJG A;  4YL1 A;  1CGO A;  2ZXO A;  1NLX A;  2JD3 A;  4CS7 A;  4JJF A;  2LQG A;  2H7V C;  3E70 C;  3CSK A;  2ZXP A;  4YWQ A;  4JW1 A;  3POV A;  4G0H A;  4KC9 A;  3C8Z A;  2NPU A;  4N6H A;  5DQZ A;  2J9U A;  5E33 A;  4E7Z A;  1ZHT A;  3TOL A;  4MW8 A;  3K1H A;  3X1O A;  2X51 A;  3GWN A;  2ZXW C;  5COG A;  2HMQ A;  1Q0D A;  4LAC B;  2AVK A;  3VRC A;  3X2Q C;  4E17 A;  5JRA A;  5JVE A;  5T3T A;  1U0B B;  2XM4 A;  2CDQ A;  2DI3 A;  1O87 A;  4JE9 A;  4LDQ A;  3LES A;  4PJN A;  3W4Y A;  4ANJ A;  4LDK A;  3RVY A;  4EHP A;  1Q0F A;  1OKK A;  2OG2 A;  3JRM O;  3DKA A;  2LIG A;  3FOO A;  5L3V A;  4JC7 A;  2CGE A;  2A6H F;  2RSE B;  5JP7 A;  5L0J A;  3V7O A;  3IQC A;  3LUT B;  3OA1 A;  1LKX A;  1BBH A;  3CAX A;  4YT4 A;  3Q6N A;  5JLI A;  1AVO B;  1ZHY A;  3DAG A;  4XEV A;  1HW2 A;  2IYL D;  3EGD B;  2CNW A;  4IAO A;  4MTF A;  4C7O B;  3BRJ A;  3UGO A;  2XXA A;  2NUT B;  1OCO C;  1ORY A;  3QTH A;  4XPX A;  2HV6 A;  2KSF A;  2I8B A;  3GM3 A;  1R4T A;  3ABM C;  1C03 A;  4J7Y A;  4HFK B;  4EBJ A;  1TWH A;  3G4Z A;  5K0I A;  2R7S A;  3HLZ A;  1ORS C;  1V55 C;  1YVI A;  3EHN A;  2OQM A;  3ECS A;  4GQH A;  3ZC4 A;  4AE4 B;  1HY5 A;  1Z3I X;  3U8V A;  1KU2 A;  4OIP F;  3NKE A;  4DOZ A;  4IWB A;  5EK0 A;  5L0F A;  1FNT c;  1R5I D;  3MYI A;  3O39 A;  1O3U A;  2HKV A;  2ZPA A;  2R7W A;  4LDR A;  2JPU A;  2NSF A;  3AG3 C;  2HJ3 A;  4CS8 A;  1HW1 A;  1BR4 A;  4XPW A;  2A0U A;  4O6M A;  2PNO A;  2KYH A;  2L7A A;  1HMO A;  1MMA A;  4WGY A;  3T4R A;  3RYL A;  5KYN A;  2PP4 A;  3RKO F;  1SF8 A;  1ZHW A;  2Q4F A;  5JUA A;  5KYW B;  4QI2 A;  4NC3 A;  3QVZ A;  1PD1 A;  3DM9 B;  1AEP A;  5CI9 A;  2D4U A;  4IGG A;  2LK4 A;  3EJN A;  3EZI A;  1FFT C;  2LFD A;  3V5Z A;  3EGX B;  4EBK A;  3FDQ A;  2YL0 A;  3GOD A;  1C17 M;  2R9R B;  3S9O A;  2XL8 A;  4JCZ A;  4U9D A;  4MVZ A;  5A6B A;  5B3S C;  2QE9 A;  3IQ6 A;  1W2W A;  2VCA A;  2YL3 A;  2RD9 A;  3NYJ A;  3GM2 A;  5JS5 A;  3EQL F;  1QKR A;  3L1M A;  2TMV P;  1M6T A;  2Y39 A;  4ONS A;  1K05 A;  5E2Q A;  4KI2 A;  3AGT A;  3RIP A;  3TUL A;  3MX3 A;  1WAS A;  3JTL O;  2YRF A;  3NRH A;  2PX3 A;  4PFO A;  2G3V A;  2JX0 A;  4AE4 A;  2EPO A;  2YQY A;  1BDJ B;  2EPL X;  4QI0 A;  3SXY A;  3G4X A;  4MVO A;  1TWA A;  3AG1 C;  4XEK A;  3DE9 A;  3K1I A;  5BUO A;  4KBL A;  2HSQ A;  2PX0 A;  4O6N A;  3EGX A;  1WOL A;  2BE5 F;  2IXN A;  1SMY F;  1J8Y F;  1V74 B;  2OEV A;  1BR2 A;  4KNW A;  3A9C A;  1MMD A;  4O6Y A;  3RH3 A;  3KPH A;  5DQT A;  1OW8 A;  3KL4 A;  2XLW A;  2PFD A;  2F22 A;  3PHF 2;  1F1M A;  3C8G D;  5B3I A;  3O6X A;  1G5Z A;  1JPN A;  3V5Y A;  4CS9 A;  4CIH A;  4GEH A;  4B6I A;  2A69 F;  2J7P A;  2XL6 A;  2R7V A;  3LLK A;  4KNV A;  3WAQ A;  3MLG A;  4C3D A;  1OW7 A;  3DAF A;  1T6U A;  4NQF A;  3B9Q A;  4BJ6 C;  1I5N A;  2WZF A;  1KNY A;  1XZQ A;  2DGJ A;  2MWQ A;  3ZTZ A;  3DWW A;  2QNL A;  3GEI A;  2FFH A;  1Q0G A;  2EIN C;  3SYN A;  4DBQ A;  4PR9 A;  2R7R A;  1Z7Q c;  1NU9 C;  2WVO A;  3L8J A;  5A6A A;  4DRI B;  4I1O B;  3VM6 A;  4CBE A;  1QVX A;  1H7I A;  2AP3 A;  2A1D D;  1TQG A;  3GEE A;  5EGY A;  1QSP A;  3LS0 A;  1OR2 A;  4NTA A;  4NTB A;  2XLH A;  4CDY A;  5DS4 A;  2ASR A;  5KYU B;  1VLT A;  3UMH A;  3ITF A;  3IQT A;  2E87 A;  4U5B E;  3R7C A;  3E9V A;  3QMK A;  1KTM A;  3FOP A;  4AK9 A;  1D0Z A;  1GM5 A;  2XRH A;  3AQB A;  3VYW A;  4PAC A;  1YA7 O;  2AWC A;  3DD7 A;  4O79 A;  4JEB A;  3AGU A;  1BR1 A;  4X0R A;  3ZQV A;  3JZ0 A;  4AX2 A;  5T1D B;  2VH3 A;  1V54 C;  2XLV A;  2ICW G;  3WHN A;  1YZC A;  1HMD A;  3C18 A;  4JIO A;  3ZQY A;  1TFO B;  2Y3G A;  3LAY A;  2XS1 A;  3KKB A;  3B0V C;  1L3P A;  3W2V A;  3O10 A;  3UMK A;  3U5S A;  2EIJ C;  3C63 A;  1T01 A;  3FMS A;  1QQ3 A;  3H2U A;  1VTM P;  1YZA A;  1NFN A;  2YLD A;  1B68 A;  4U5F E;  3SZR A;  3PDM P;  3AG2 C;  4LLE A;  5A69 A;  1D1C A;  3KYJ A;  1K40 A;  5KYU A;  3AQC A;  1FR0 A;  3DM5 A;  1PV3 A;  4E7S A;  1NSG B;  2CCY A;  2H8A A;  2EIM C;  3LNM B;  5COF A;  3ZSU A;  1FMW A;  1OW6 A;  3QVY A;  4LER A;  3ATP A;  4CS9 C;  1YDI A;  2R7T A;  1VYK A;  1RXQ A;  2HJM A;  3B71 A;  3CEX A;  3HJC A;  3RFY A;  2L6H A;  1E83 A;  2NG1 A;  2P0N A;  2EPN A;  2QUP A;  5FZT A;  4D4X A;  5DS6 A;  3U0C A;  1LE2 A;  5D92 A;  4L6R A;  1MMG A;  2GDC A;  4OIQ F;  3NDB B;  3SXK A;  1VLS A;  2YKZ A;  2GFH A;  2Y69 C;  1CGM E;  1M2O A;  4IJJ A;  1IZM A;  1OR3 A;  3GOR A;  3OEO A;  3A11 A;  5DVW A;  1A7D A;  1EI7 A;  1Y6D A;  2W4B A;  2J46 A;  3U2L A;  2KNH A;  3SNH A;  2Q3T A;  2L6G A;  4PFP A;  2WL8 A;  2X0C A;  4YT8 A;  1E85 A;  1FMV A;  1JR8 A;  4F4B A;  4C3E A;  2HUJ A;  5KYY B;  2M64 A;  4XLP F;  4E0H A;  4MVR A;  4OIN F;  2B0J A;  3S84 A;  2YZS A;  2UUH A;  5EHH A;  1T6I A;  4U9E A;  1OQC A;  1PD0 A;  3G50 A;  4J30 B;  5L3Q A;  4JCH A;  4MVS A;  3UR3 C;  1QZX A;  1LIH A;  1I4Y A;  2YL7 A;  3RQF A;  3S28 A;  3JCU Q;  1APC A;  4H4K C;  2W9Y A;  3U2M A;  3EGD A;  3K6B A;  1ZU5 A;  4MTO A;  5T3W A;  3T6B A;  4C7O A;  2LSE A;  2Q7R A;  1NG1 A;  2DYS C;  3LS1 A;  4JEA A;  2NUT A;  4DXW A;  3L8I A;  2J9B A;  3J06 A;  1N1C A;  2XLM A;  1WN0 A;  1OCZ C;  1ZHX A;  2CNW D;  1UFB A;  1G4W R;  1CPQ A;  1GQA A;  2Y3H A;  3C8G B;  3DJN B;  2C03 A;  1ZVZ A;  1ZZP A;  2AWY A;  4YL3 A;  2VCB A;  1D1B A;  2IXO A;  4CJG A;  4Q5S F;  1JPJ A;  4MVQ A;  3M15 A;  1HE1 A;  3DXJ F;  3JYY A;  4GYT A;  2Q9C A;  3ASO C;  1NBB A;  5CI8 A;  3JYH A;  3V5X A;  2ETS A;  2BL2 A;  1QPU A;  2L9J A;  4P6I C;  5DLJ A;  4BEM J;  4A4A A;  1NFO A;  4WAB A;  2YVK A;  4YN0 B;  2Q00 A;  4JVS A;  4EKW A;  3ZDL A;  2HSB A;  3NMI A;  2WZG A;  1TWG A;  2Y3B A;  1H9T A;  1M2V B;  5KYW A;  2XLO A;  4R32 A;  3ABK C;  3Q7G A;  3N24 A;  4BPM A;  1A0B A;  1LE4 A;  1M56 C;  2DB4 A;  2G3K A;  2Q9B A;  4IAQ A;  2OOC A;  4JZA A;  5BQI A;  4N4W A;  5CIV A;  4DBR A;  3JRT A;  4RDA A;  5AC5 A;  3C8G A;  4OIR F;  3T9O A;  1CPR A;  2O9X A;  1GGQ A;  4ULW A;  4I1M A;  1OXK A;  1U89 A;  2FGY A;  4XEF A;  4G7H F;  4U5H A;  4JUR I;  4Z9I A;  5A6B D;  1UG7 A;  1WTY A;  4JTD B;  3N0T A;  1O5H A;  3UNG C;  3NYM A;  1FTS A;  5L0I A;  1J8M F;  1YJG A;  2CYD A;  1MMN A;  3GWL A;  4W8K A;  3U3B A;  4WJ0 A;  4JKV A;  2J8W A;  3M4C A;  4U5E E;  2A0B A;  4ER9 A;  5HSW A;  2WB7 A;  1SR2 A;  3EH1 A;  3IPM O;  4BJ5 A;  2GWW A;  1XWJ A;  2AU5 A;  4MQ9 F;  4WGZ A;  3SXM A;  4CS8 C;  4CSA A;  3DJU B;  4PK4 A;  3T6G B;  3ABL C;  5A6K A;  1LPE A;  3GM1 A;  2IOQ A;  5A6J A;  4ZLC A;  3SP1 A;  1ZHZ A;  1RKC A;  3B29 A;  2XS8 A;  2P7V A;  4XWJ A;  2W4M A;  2HZ8 A;  1QLE C;  1RJ9 B;  4K0D A;  1H6G A;  2WZL A;  3TJ6 A;  4A2N B;  3HNI A;  2HV7 A;  1LI5 A;  1YA9 A;  3EH2 A;  3Q6M A;  1IW7 F;  3FAJ A;  1JRA A;  4M63 A;  3U8P A;  1XZP A;  3C7J A;  2XLE A;  3LLI A;  1Y4C A;  3EPV A;  3KH2 A;  1ORJ A;  1OXB A;  4CDV A;  3QW1 A;  3H2V A;  4AL0 A;  3TK0 A;  2DYR C;  3IQ5 A;  4YT2 A;  2VAS A;  2QTV A;  1ST6 A;  2LD6 A;  3TOM A;  4BG0 A;  2R7U A;  1RCP A;  5JSL A;  2R7Q A;  2LCH A;  1PCX A;  4PJL A;  3EG9 B;  1LS1 A;  2IM8 A;  1TKN A;  3OWT A;  4I3M A;  4P9T A;  4Q4Z F;  2XSE A;  4E0I A;  2PBE A;  4U5C E;  1JMW A;  5DS5 A;  3ASN C;  4XTK A;  3VAY A;  5BQH A;  1RJ9 A;  3SXZ A;  3K33 A;  3K1I C;  3IEE A;  3NYL A;  2CW0 F;  2R03 A;  1Q0M A;  1I4Z A;  1LVK A;  2VCC A;  3HTK C;  3QZC A;  2KGO A;  3HKK A;  1CGN A;  1LM3 B;  2OEX A;  4N06 A;  1Q0K A;  2LP4 A;  2IXM A;  3H65 A;  2OJQ A;  4G7Z F;  1YAU O;  1C02 A;  4CJO A;  3ZWI A;  3GEH A;  2W45 A;  3HNJ A;  1LS4 A;  4Q7C A;  5L0H A;  4UDV A;  2GA0 A;  4PJM A;  1T6Q A;  2Z15 A;  4EBB A;  2LFF A;  2NSG A;  4FES A;  2D5R B;  3EG9 A;  2R7X A;  1H9G A;  1VK5 A;  4IB4 A;  2OKU A;  4J7T A;  3K7D A;  5HV9 A;  3GAN A;  5F5H A;  3T6J A;  2L81 A;  5F5F A;  2EPM X;  4BJ5 C;  2P61 A;  2ZD9 A;  3S0X A;  4CSA C;  5L0D A;  3TD7 A;  3RVZ A;  3EFO B;  4DJ9 A;  3PMR A;  1RMV A;  1VMA A;  2FAP B;  4G7O F;  2XXA B;  2YLI A;  5F28 E;  3C62 A;  4U5D E;  5E3C A;  2OJE D;  1L7C A;  4YJW A;  2R02 A;  3EHM A;  2QLA A;  256B A;  3M1C B;  3R2P A;  1T9K A;  3Q7L A;  5TJ5 E;  3JSZ A;  1T5O A;  4FAP B;  2R25 A;  1VOM A;  1Z23 A;  2G62 A;  3W2W A;  3RQE A;  4BJ1 A;  1G8X A;  1SZI A;  2HFI A;  4I44 A;  3BEH A;  1OKK D;  3FXH A;  3PCV A;  2OU6 A;  1GS9 A;  3F46 A;  3I5P A;  4YT5 A;  4OD4 A;  2V26 A;  2IBF A;  2HS5 A;  1EKY A;  3EFO A;  4O7G A;  4DRJ B;  4IAR A;  4K7B A;  5L0G A;  2BC5 A;  3M4B A;  2KK1 A;  1LI7 A;  3AOU A;  3S90 A;  4OIO F;  4D4N A;  1DOV A;  4Z9J A;  5JT4 A;  1WGW A;  1OCR C;  2XL4 A;  2J9V A;  2L6F A;  3FAP B;  4NTF A;  3WG7 C;  4MTG A;  2KW3 C;  2PF4 E;  2V3C C;  1S05 A;  2MYS A;  5KYY A;  1MQV A;  4BJT A;  3JSE O;  4AL1 A;  3SEO A;  3M79 A;  1EA8 A;  1EQ1 A;  3B0U X;  4EWC A;  2MHR A;  3LEV A;  1ZW3 A;  1FAP B;  5FCL A;  1YLM A;  2YEV A;  1NU7 D;  2Q9A A;  3NKD A;  2XM0 A;  4JRZ A;  4OD5 A;  3FHD A;  4K1O A;  1G4U S;  2WVN A;  1DOW A;  1A7E A;  3UMI A; 
#chains in the Genus database with same CATH homology
 3NMJ A;  3C63 A;  1QQ3 A;  1YZA A;  2YLD A;  1E86 A;  1YYJ A;  3HNL A;  3HNI A;  5AGF A;  1E84 A;  5JUA A;  3U8P A;  2CCY A;  3ZTM A;  2XLE A;  3QVY A;  4CDV A;  3QW1 A;  3IQ5 A;  4CIP A;  3TOM A;  1RCP A;  3QW0 A;  5JSL A;  4WGY A;  2YL1 A;  1E83 A;  4D4X A;  2XLD A;  4NC3 A;  3QVZ A;  4L6R A;  2YKZ A;  2YL0 A;  2XL8 A;  4U9D A;  2YLG A;  3IQ6 A;  2YL3 A;  5JS5 A;  3NMK A;  1CGN A;  1LM3 B;  3DE8 A;  3L1M A;  1M6T A;  1E85 A;  4CJO A;  3ZWI A;  3HNJ A;  4EIY A;  4U9E A;  4IB4 A;  2YL7 A;  4CX9 A;  1APC A;  3DE9 A;  4CDA A;  1JAF A;  4JEA A;  2J9B A;  2XLM A;  2YLI A;  3C62 A;  1CPQ A;  1GQA A;  4ER9 A;  2XLW A;  4CJG A;  2QLA A;  256B A;  5B3I A;  3M15 A;  2XL6 A;  1NBB A;  1YYX A;  3HNK A;  1QPU A;  1A7V A;  3NMI A;  3ZTZ A;  4ULV A;  2XLO A;  4IAQ A;  1CGO A;  1EKY A;  4IAR A;  4N4W A;  2BC5 A;  3M4B A;  4D4N A;  5JT4 A;  4N6H A;  1CPR A;  4CDY A;  2XLH A;  3TOL A;  5JRA A;  3VRC A;  5JVE A;  1S05 A;  1MQV A;  2XM4 A;  4JE9 A;  3FOP A;  3M79 A;  4JKV A;  2J8W A;  3FOO A;  3M4C A;  3ZQV A;  4JEB A;  5JP7 A;  2XLV A;  2XM0 A;  1YZC A;  4WGZ A;  3ZQY A;  5JLI A;  1BBH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...