3TOLA

Crystal structure of an engineered cytochrome cb562 that forms 1d, zn-mediated coordination polymers
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
106
structure length
106
Chain Sequence
b'ADLEDNMETLNDNLKVIEKADNAAQVEKALEKMLAAAADALKATPPKLEDKSPDSPEMRDFRHGFAILMGQIHDAAHLANEGKVKEAQAAAEQLKTTCNACHQKYR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Soluble cytochrome b562
publication title Metal-directed, chemically tunable assembly of one-, two- and three-dimensional crystalline protein arrays.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal binding protein
total genus 48
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 3tolA00
4D4XA 4JKVA 5AGFA 4L6RA 1QQ3A 1QPUA 3HNIA 5JRAA 4CDYA 2YL1A 5JT4A 1RCPA 2J9BA 4CDVA 2YL3A 3TOLA 2CCYA 4ULVA 1CPQA 1MQVA 2YL0A 3M4BA 4CIPA 2XLWA 4IAQA 4IARA 3HNJA 5JP7A 3QW1A 3ZQYA 3FOOA 3DE9A 1M6TA 1GQAA 256BA 4CX9A 1EKYA 3IQ6A 1LM3B 4CDAA 1S05A 2QLAA 3HNKA 5JSLA 3L1MA 2BC5A 2XM4A 4EIYA 1YYXA 4U9DA 2XLOA 3U8PA 3C63A 1YZCA 5JUAA 3NMIA 2YLGA 2YKZA 3QVZA 3FOPA 3ZTZA 1JAFA 5JLIA 3ZWIA 3NMJA 3NMKA 3QVYA 3VRCA 4CJOA 4WGYA 1APCA 2YLIA 5JVEA 5B3IA 4JE9A 4N6HA 4ER9A 1NBBA 2XLVA 4N4WA 3DE8A 1E84A 2XLMA 3C62A 1E85A 1CGNA 1A7VA 3ZQVA 1CGOA 2XL6A 3ZTMA 3QW0A 1CPRA 2XL8A 1BBHA 2YL7A 2J8WA 3TOMA 4CJGA 4JEBA 4JEAA 3M15A 4U9EA 5JS5A 1YYJA 2YLDA 1E83A 2XLHA 1YZAA 1E86A 2XLDA 4IB4A 3HNLA 3M79A 4NC3A 4WGZA 3IQ5A 4D4NA 3M4CA 2XLEA 2XM0A
chains in the Genus database with same CATH superfamily
3DI5A 4JKVA 4D4XA 2X51A 4N6CA 1JRAA 2UUIA 3FMSA 3SXZA 2EIMC 1I5NA 2KW3C 3W2WA 3ZVRA 1QPUA 3S0XA 3HNIA 2OQMA 1Q0MA 4N06A 5IY5C 3I4UA 1Z3IX 1H6GA 2YL3A 3ZC4A 2NUTB 3F47A 3K1IA 2R7OA 3TOLA 2KGOA 3DD7A 2MYSA 1VMAA 2EPNA 3SXKA 3MLGA 1TWAA 2CW0F 2ICWG 1ZHYA 3M4BA 4CIPA 4EUKB 2R7QA 3ABLC 2D5RB 4JRZA 4P6IC 1V74B 3JT1A 1YARO 3RH3A 3US6A 3FDQA 3LLIA 5L3QA 2IBFA 2PP4A 3HJCA 4P9TA 1ZU5A 4OIPF 1XZQA 3T9OA 3UMHA 4DRIB 3AOUA 3AQBA 2EPKX 2AWCA 4KNWA 4PJLA 3EFOB 3LNMB 1Z63A 2QUPA 4OIQF 1E2XA 4CDAA 4CS7A 2LP4A 3HNKA 2L6HA 4CIHA 4KI2A 2BC5A 1O5HA 3MYIA 1XWJA 1U0BB 3SXYA 3C18A 2PFDA 4JTCB 2Y3GA 3VYWA 2ZXRA 4YT4A 5BQGA 3KL4A 2Q3TA 2L81A 1LVKA 1Y6DA 3MYFA 3U0CA 1I4YA 2I15A 3UMKA 1ORJA 5KYNA 3JYHA 2G62A 2JPUA 3JSZA 1U6HA 2VB6A 5D92A 4BJ1A 5KYYB 5A6JA 4J32B 3LESA 3Q6MA 4MQ9F 2YKZA 4PFOA 2R7XA 3K66A 1T5OA 4PR9A 2A6EF 4F4BA 1NZEA 2H8AA 1VB5A 1HW2A 5JLIA 3B0VC 1OKKD 1Q0DA 1Y4CA 3H65A 1FR0A 5KYXB 4IGGA 3VRCA 2OOCA 4OINF 2L9JA 2R25A 1M2VA 4I1MA 1OCRC 3S90A 3IPMO 2JX0A 3DWWA 2HJ3A 2HKVA 4ONSA 5CI9A 4ANJA 4RD9A 3IQTA 1WWPA 1FTSA 2RD9A 3UMIA 2NSFA 4MVRA 2J46A 2YRFA 4Z9IA 1MMDA 3JTLO 1E84A 3KYJA 1SR2A 3AG1C 1GGQA 1VYKA 2J45A 2XLMA 3G4ZA 1JPNA 2J9VA 4E0IA 1CGNA 1VOMA 4YT2A 4E18A 1CGOA 1YDIA 2CNWA 4XEKA 3L8IA 4WJ0A 3ZTMA 2GWWA 2BL2A 2CGEA 5EK0A 1BBHA 2B0HA 3KH2A 2HZ8A 3TOMA 1LI7A 3U3BA 4JEAA 1T6IA 2HJMA 3L0IA 4O6YA 3IHUA 1FMWA 4U9EA 3LS0A 2AU5A 4LDKA 1TKNA 2LFDA 2YLDA 2KJGA 4FX5A 4PJJA 3TJ6A 4MNDA 2LK4A 4YWQA 2IOQA 2PX0A 4Z9HA 3AG2C 2A68F 3ATPA 3RYLA 1ORSC 4O6MA 2W45A 4EWCA 2DI3A 4LLEA 3B0UX 1JOGA 4IB4A 4AX2A 5A6AA 2J7PA 4DVYP 1ZZPA 5AC4A 4JTAB 3BEHA 4JJGA 5HV9A 1MMNA 4CS9A 1H7IA 3S29A 3V5XA 2C04A 3TULA 2XM0A 4LERA 4DRHB 1OKKA 3ITFA 1QLEC 2AVKA 3EHMA 3ABKC 3AGUA 4K0DA 3S27A 1CGME 1G4US 3U9JA 4GYTA 4U5BE 1F1MA 2J0WA 2OJQA 2YL1A 1U89A 3GANA 1NFNA 3G50A 4MTOA 1RKEB 3RQGA 1XZPA 1ZYRF 3NKEA 3PDMP 4CSAA 1K04A 1Q0FA 1YJGA 2B0JA 4ULVA 1NG1A 2GDCA 4E0HA 3QTHA 3J06A 1MQVA 2KNHA 2XS8A 1H9GA 3DAGA 3EGXB 3T6BA 5BQHA 3NDBB 2KYHA 3UGPA 2KQ9A 1TR2A 3U5SA 4QI0A 3HNJA 2A69F 5JP7A 1D1BA 3QW1A 5DQZA 1YA9A 4PACA 3DE9A 2Q4FA 4NTFA 3I5QA 2XXAA 1WASA 256BA 4YL3A 3EHNA 2XRHA 5B1BC 1EKYA 1I4ZA 3RVYA 4EBKA 2LIGA 1OCOC 5L3VA 1AEPA 1IW7F 1S05A 2QLAA 2VC9A 4U5GA 3C8GB 5KYUB 2TMVP 5JSLA 3L1MA 1LKXA 4I3MA 1A0BA 2W9YA 5L0CA 4MVZA 1W2WA 3NKDA 3M1CB 2XM4A 3S84A 1S7ZA 1EI7A 3G4XA 3FVYA 4CSAC 1N1CA 4OIOF 2P0NA 1MNDA 1T6UA 3U8PA 1ZHXA 3UNGC 4C7OB 1QZXA 1BR1A 2L6GA 2YEVA 4G7OF 2HV6A 5E3AA 4M63A 4AE4B 3EGDA 1R5ID 3ZTZA 2NUPA 2PNOA 3JSEO 2QNLA 1ZVZA 3O55A 1JAFA 1MMGA 3DM9B 3IEEA 3NYLA 4NTAA 2LQGA 4FWVA 1JR8A 3NG1A 5DQTA 2Y3BA 3NMKA 3QVYA 1HY5A 4JCZA 3TD7A 5L0GA 4BEJA 5TJ5E 2WZGA 4JIOA 1QSPA 3MFNA 3SXMA 4HFFB 1EA8A 3LUTB 1TFKB 1LS4A 4JE9A 4ER9A 1OXKA 3N2ZB 3O6XA 4MTFA 1ZU4A 4PK4A 2NG1A 2XLVA 1D0XA 4P9FA 4A4AA 2DGJA 3SYNA 1JMWA 1GS9A 3ZDLA 3ASOC 3B71A 2Y3DA 4G7ZF 3C62A 1WGWA 2KK1A 4KNVA 5A6BD 2H7VC 1LIHA 3AGTA 3T6GB 2WZLA 5L0HA 1WATA 1NU7D 2XL8A 1PV3A 1BDJB 2EILC 4PJMA 4WABA 4DOZA 1EQ1A 2YL7A 1M57C 1OW6A 4U5EE 3RFYA 2P1AA 1WOLA 2ETSA 2HUJA 1LE2A 3TJ5A 5JS5A 2OEVA 4C3EA 1YYJA 1RXQA 3U8VA 3VM6A 2OJED 2Q7RA 5L0DA 3C7JA 2C03A 3N24A 2H7OA 2WVNA 3LS1A 2EPMX 4Z9JA 1E86A 1FNTc 1OR3A 2OKUA 2P7VA 4MTGA 4G7HF 1M2OA 1NFOA 1OCCC 4JVSA 1LS1A 5CI8A 2MWQA 3CAXA 2OCCC 2XLDA 3T6JA 4NC3A 3LEOA 3AQCA 3N0TA 1SF8A 2HSQA 5E3CA 3TQOA 3RQEA 2CYDA 5DS6A 2EIKC 2O9XA 2QE9A 3HLZA 3I5PA 3L34A 3OWTA 5COGA 3AJMA 5E33A 4FAPB 3GEEA 1Z6AA 2L6FA 5AGFA 2J0XA 1TWHA 2R02A 4EHPA 4L6RA 4J30B 1D1CA 3DJNB 4K7BA 3RIPA 5KYWA 1FFTC 4J7TA 4ZLDA 4CDYA 4BEMJ 5JT4A 4FESA 1JPJA 1OW8A 4O79A 5T3WA 2J9BA 4JCHA 4O6NA 4E7SA 4E7ZA 3GODA 2P61A 3ZIBA 2EIJC 2CCYA 5AC5A 1CPQA 1VYIA 3NYMA 5F5HA 2VH3A 4AL0A 2XLWA 4IAQA 2W4BA 2QTVA 2A6HF 2F22A 3EPVA 2ZPAA 4NY3A 4XWJA 2L7AA 3OEOA 2P6VA 3X2QC 2VCBA 3ZQYA 3CEXA 3EZIA 4HFKB 1C02A 1BZ4A 3QZCA 1GQAA 2R7VA 1L3PA 1DOVA 2PX3A 3GM3A 1RJ9A 2J9UA 3EH2A 1T9KA 3U3FA 2A0UA 4Q5SF 3Q6NA 4ULWA 4YT5A 4OIRF 3RQFA 1YA7O 3VAYA 3TK0A 1G4WR 2HFIA 3ABMC 4EIYA 4LDQA 1LI5A 4W8KA 5B3SC 1RMVA 2YHSA 4LDRA 2R7UA 2XLOA 1TWCA 3EG9A 5K0IA 2H7BA 4XLPF 1O87A 1LE4A 1VK5A 5JUAA 2DB4A 2M64A 3NMIA 4MS2A 2OU6A 2YLGA 2ASRA 3KPHA 4JTDB 2WVOA 1C17M 2RSEB 2YQYA 3GM2A 4EBBA 1BR4A 2IXMA 4MVOA 4DVZA 1DOWA 3BRJA 2Q9BA 4BJ5C 1ZHWA 2VCCA 3DXJF 2NSGA 4YK5A 3EQLF 4HE8D 3ZWIA 4AL1A 4DJ9A 1Q0GA 2D4UA 1G8XA 5E2QA 2IXOA 4CJOA 1V4AA 1BR2A 3FXHA 4H54A 2HMQA 3U9MA 5EHHA 3EH1A 5JVEA 2HV7A 2ZXWC 4N6HA 3S28A 3WG7C 3K6BA 4I44A 4N4WA 3SEOA 2LFFA 4LACB 4RBNA 4IRUA 2OEXA 1QKRA 4G0HA 1M56C 2DYRC 2IXPA 4JJFA 4QDLA 2CDQA 2R7RA 2GFHA 5L0IA 2YVKA 4DBRA 2XXAB 1E85A 1SZIA 2R9RB 1V55C 4IWBA 1Z7Qc 2NUTA 2Q9CA 4JZAA 2Q9AA 1NU9C 2FFHA 3CQZA 1CPRA 1UFBA 3H2UA 1H9TA 3ZSUA 2ZXPA 2Y69C 2XL4A 2NPUA 4XQ1A 1PCXA 1HMOA 2J8WA 3ZG1A 2W4MA 5B1AC 1G5ZA 2KC3A 3JRTA 3LNRA 1A7EA 2R05A 3JRMO 3M15A 4GQHA 4JEBA 4NQFA 4Q7CA 3W8IA 2R7WA 5F5FA 3SZRA 2LD6A 4JURI 4RDAA 1WTYA 3U2LA 3JCUQ 1HW1A 3EFOA 3GWLA 3LJBA 5BQIA 2AP3A 1VLSA 3FAJA 3O10A 3EGDB 3U2MA 4C3BA 4BG0A 4CS8C 2XSEA 2G3VA 4XEFA 2XLHA 2NUPB 1YZAA 3R2PA 4A2NB 4BJ6A 4CBEA 5A69A 1VTMP 3LAYA 3VF0A 2R7SA 4LLCA 2CNWD 4YT8A 5BUOA 1VLTA 4OD4A 2PF4E 3HNLA 3M79A 4HEAJ 3K1HA 4IJJA 4WGZA 3DKAA 3M4CA 3W2VA 1ORYA 2Y39A 3NYJA 1B68A 3AG3C 1OXBA 3RW0A 4XTKA 1ZW2A 1YLMA 5T3TA 5KYYA 1YVIA 3DAFA 3MBGA 3V7OA 1Q0KA 1QVXA 5COMA 2A0BA 1K05A 4MVSA 4PJNA 4K1OA 4XPXA 5CIVA 1QQ3A 4DXWA 4NCQA 4XLNF 2OG2A 5JRAA 4U5DE 2X0CA 2LSEA 3F46A 1NLXA 2J9WA 3K1IC 5KYXA 2YWAA 3RF3A 1OCZC 1RCPA 1A7DA 3WHNA 4BJ6C 1Z5ZA 1ZW3A 4CDVA 2HS5A 1J8MF 1FFHA 1LPEA 2J7PD 3PCVA 5DS5A 4MVUA 1V54C 4YN0B 1AVOB 3AG4C 3S9OA 2YL0A 4XEVA 3B9QA 4I1OB 4MW8A 4BJTA 3RVZA 3C8ZA 4R32A 4G78A 5EGYA 4IARA 4X0RA 2IXNA 1J8YF 1M2VB 4KC9A 3PHF2 1ZHTA 1ST6A 3E9VA 3FOOA 1M6TA 4IAOA 1AUEA 5DVWA 4CX9A 5FZTA 4Q4ZF 3IQ6A 3O39A 1LM3B 3EJNA 3V5YA 2I8BA 2WB7A 3A9CA 4AK9A 1A41A 4NTBA 3DMDA 4XPYA 5FCLA 4UDVA 3C8GD 2E87A 4QI2A 3HTKC 2Y3HA 1YYXA 4J7YA 2FGYA 4U9DA 3QMKA 3C63A 4YL0A 1YZCA 1WN0A 4ZLCA 5L0FA 5COFA 4EKWA 3OA1A 1D0YA 1FAPB 2R7TA 1D1AA 2A1DD 3DJUB 1L7CA 3DZAA 3UGOA 3B0PA 3QVZA 3FOPA 3H2VA 2PBEA 1O3UA 1HMDA 3KKBA 5KYWB 4OD5A 4U5HA 1GM5A 3WAQA 4DRJB 2VASA 4BJ5A 3NMJA 5A6BA 1SMYF 3DM5A 3MX3A 3W4YA 3T4RA 1OW7A 4WGYA 1APCA 3KYIA 1UG7A 2YLIA 3B29A 4W8PA 4B6IA 1ZHZA 2WL8A 4GEHA 3WODF 4C3DA 3GM1A 3SNHA 2V26A 5B3IA 1HE9A 1MMAA 4JC7A 3GORA 1Z23A 3EZHA 1OR2A 3CZ6A 3FAPB 4MW3A 4U5CE 3K7DA 1D0ZA 5DLJA 1C03A 1NBBA 2YZSA 1YAUO 2ZXOA 1T01A 3GEIA 3GWNA 5T1DB 3DE8A 3L8JA 3PMRA 1SYQA 2V3CC 4PFPA 3POVA 2ZD9A 2BE5F 2UUHA 1TQGA 3R7CA 1RKEA 1A7VA 3RKOF 3SP1A 4BPMA 4YL1A 3ZQVA 3FHDA 1R4TA 1RJ9B 2XL6A 1T6QA 2HSBA 3CSKA 5F28E 2IYLD 3QW0A 4EBJA 4H4KC 4E17A 1K40A 3EGXA 1NSGB 2EPOA 2EPLX 2Q00A 1IZMA 1OQCA 3HKKA 3JZ0A 4JW1A 4MVQA 4CJGA 3UR3C 3A11A 1HE1A 2HMZA 3E70C 3EG9B 2LCHA 2EINC 3NRHA 3V5ZA 4DBQA 4MVMA 5L0JA 3LEVA 1PD1A 2IM8A 2DYSC 2FAPB 2GA0A 4YJWA 2VCAA 1KU2A 3JYYA 1E83A 2WVQA 5DS4A 5KYUA 1TFOB 3LLKA 2G3KA 3C8GA 3Q7LA 3W8HA 3X1OA 2JD3A 2AWYA 5A6KA 2Z15A 2R03A 4CS8A 5HSWA 1KTMA 2MHRA 3IQCA 2KSFA 4U5FE 1MNEA 4CS9C 3ASNC 1TWGA 4O7GA 3ECSA 3IQ5A 4D4NA 4KBLA 4C7OA 1RKCA 2XS1A 1PD0A 3K33A 3KMIA 1FMVA 2QY9A 2M4EA 2XLEA 3Q7GA 1KNYA 5D91A 2WZFA 3GEHA 4XPWA 4AE4A 2GAQA 5GPGB
chains in the Genus database with same CATH topology
4D4XA 4JKVA 5AGFA 4L6RA 1QQ3A 1QPUA 3HNIA 5JRAA 4CDYA 2YL1A 5JT4A 1RCPA 2J9BA 4CDVA 2YL3A 3TOLA 2CCYA 4ULVA 1CPQA 1MQVA 2YL0A 3M4BA 4CIPA 2XLWA 4IAQA 4IARA 3HNJA 5JP7A 3QW1A 3ZQYA 3FOOA 3DE9A 1M6TA 1GQAA 256BA 4CX9A 1EKYA 3IQ6A 1LM3B 4CDAA 1S05A 2QLAA 3HNKA 5JSLA 3L1MA 2BC5A 2XM4A 4EIYA 1YYXA 4U9DA 2XLOA 3U8PA 3C63A 1YZCA 5JUAA 3NMIA 2YLGA 2YKZA 3QVZA 3FOPA 3ZTZA 1JAFA 5JLIA 3ZWIA 3NMJA 3NMKA 3QVYA 3VRCA 4CJOA 4WGYA 1APCA 2YLIA 5JVEA 5B3IA 4JE9A 4N6HA 4ER9A 1NBBA 2XLVA 4N4WA 3DE8A 1E84A 2XLMA 3C62A 1E85A 1CGNA 1A7VA 3ZQVA 1CGOA 2XL6A 3ZTMA 3QW0A 1CPRA 2XL8A 1BBHA 2YL7A 2J8WA 3TOMA 4CJGA 4JEBA 4JEAA 3M15A 4U9EA 5JS5A 1YYJA 2YLDA 1E83A 2XLHA 1YZAA 1E86A 2XLDA 4IB4A 3HNLA 3M79A 4NC3A 4WGZA 3IQ5A 4D4NA 3M4CA 2XLEA 2XM0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4D4X A;  4JKV A;  5AGF A;  4L6R A;  1QQ3 A;  1QPU A;  3HNI A;  5JRA A;  4CDY A;  2YL1 A;  5JT4 A;  1RCP A;  2J9B A;  4CDV A;  2YL3 A;  3TOL A;  2CCY A;  4ULV A;  1CPQ A;  1MQV A;  2YL0 A;  3M4B A;  4CIP A;  2XLW A;  4IAQ A;  4IAR A;  3HNJ A;  5JP7 A;  3QW1 A;  3ZQY A;  3FOO A;  3DE9 A;  1M6T A;  1GQA A;  256B A;  4CX9 A;  1EKY A;  3IQ6 A;  1LM3 B;  4CDA A;  1S05 A;  2QLA A;  3HNK A;  5JSL A;  3L1M A;  2BC5 A;  2XM4 A;  4EIY A;  1YYX A;  4U9D A;  2XLO A;  3U8P A;  3C63 A;  1YZC A;  5JUA A;  3NMI A;  2YLG A;  2YKZ A;  3QVZ A;  3FOP A;  3ZTZ A;  1JAF A;  5JLI A;  3ZWI A;  3NMJ A;  3NMK A;  3QVY A;  3VRC A;  4CJO A;  4WGY A;  1APC A;  2YLI A;  5JVE A;  5B3I A;  4JE9 A;  4N6H A;  4ER9 A;  1NBB A;  2XLV A;  4N4W A;  3DE8 A;  1E84 A;  2XLM A;  3C62 A;  1E85 A;  1CGN A;  1A7V A;  3ZQV A;  1CGO A;  2XL6 A;  3ZTM A;  3QW0 A;  1CPR A;  2XL8 A;  1BBH A;  2YL7 A;  2J8W A;  3TOM A;  4CJG A;  4JEB A;  4JEA A;  3M15 A;  4U9E A;  5JS5 A;  1YYJ A;  2YLD A;  1E83 A;  2XLH A;  1YZA A;  1E86 A;  2XLD A;  4IB4 A;  3HNL A;  3M79 A;  4NC3 A;  4WGZ A;  3IQ5 A;  4D4N A;  3M4C A;  2XLE A;  2XM0 A; 
#chains in the Genus database with same CATH topology
 3DI5 A;  4JKV A;  4D4X A;  2X51 A;  4N6C A;  1JRA A;  2UUI A;  3FMS A;  3SXZ A;  2EIM C;  1I5N A;  2KW3 C;  3W2W A;  3ZVR A;  1QPU A;  3S0X A;  3HNI A;  2OQM A;  1Q0M A;  4N06 A;  5IY5 C;  3I4U A;  1Z3I X;  1H6G A;  2YL3 A;  3ZC4 A;  2NUT B;  3F47 A;  3K1I A;  2R7O A;  3TOL A;  2KGO A;  3DD7 A;  2MYS A;  1VMA A;  2EPN A;  3SXK A;  3MLG A;  1TWA A;  2CW0 F;  2ICW G;  1ZHY A;  3M4B A;  4CIP A;  4EUK B;  2R7Q A;  3ABL C;  2D5R B;  4JRZ A;  4P6I C;  1V74 B;  3JT1 A;  1YAR O;  3RH3 A;  3US6 A;  3FDQ A;  3LLI A;  5L3Q A;  2IBF A;  2PP4 A;  3HJC A;  4P9T A;  1ZU5 A;  4OIP F;  1XZQ A;  3T9O A;  3UMH A;  4DRI B;  3AOU A;  3AQB A;  2EPK X;  2AWC A;  4KNW A;  4PJL A;  3EFO B;  3LNM B;  1Z63 A;  2QUP A;  4OIQ F;  1E2X A;  4CDA A;  4CS7 A;  2LP4 A;  3HNK A;  2L6H A;  4CIH A;  4KI2 A;  2BC5 A;  1O5H A;  3MYI A;  1XWJ A;  1U0B B;  3SXY A;  3C18 A;  2PFD A;  4JTC B;  2Y3G A;  3VYW A;  2ZXR A;  4YT4 A;  5BQG A;  3KL4 A;  2Q3T A;  2L81 A;  1LVK A;  1Y6D A;  3MYF A;  3U0C A;  1I4Y A;  2I15 A;  3UMK A;  1ORJ A;  5KYN A;  3JYH A;  2G62 A;  2JPU A;  3JSZ A;  1U6H A;  2VB6 A;  5D92 A;  4BJ1 A;  5KYY B;  5A6J A;  4J32 B;  3LES A;  3Q6M A;  4MQ9 F;  2YKZ A;  4PFO A;  2R7X A;  3K66 A;  1T5O A;  4PR9 A;  2A6E F;  4F4B A;  1NZE A;  2H8A A;  1VB5 A;  1HW2 A;  5JLI A;  3B0V C;  1OKK D;  1Q0D A;  1Y4C A;  3H65 A;  1FR0 A;  5KYX B;  4IGG A;  3VRC A;  2OOC A;  4OIN F;  2L9J A;  2R25 A;  1M2V A;  4I1M A;  1OCR C;  3S90 A;  3IPM O;  2JX0 A;  3DWW A;  2HJ3 A;  2HKV A;  4ONS A;  5CI9 A;  4ANJ A;  4RD9 A;  3IQT A;  1WWP A;  1FTS A;  2RD9 A;  3UMI A;  2NSF A;  4MVR A;  2J46 A;  2YRF A;  4Z9I A;  1MMD A;  3JTL O;  1E84 A;  3KYJ A;  1SR2 A;  3AG1 C;  1GGQ A;  1VYK A;  2J45 A;  2XLM A;  3G4Z A;  1JPN A;  2J9V A;  4E0I A;  1CGN A;  1VOM A;  4YT2 A;  4E18 A;  1CGO A;  1YDI A;  2CNW A;  4XEK A;  3L8I A;  4WJ0 A;  3ZTM A;  2GWW A;  2BL2 A;  2CGE A;  5EK0 A;  1BBH A;  2B0H A;  3KH2 A;  2HZ8 A;  3TOM A;  1LI7 A;  3U3B A;  4JEA A;  1T6I A;  2HJM A;  3L0I A;  4O6Y A;  3IHU A;  1FMW A;  4U9E A;  3LS0 A;  2AU5 A;  4LDK A;  1TKN A;  2LFD A;  2YLD A;  2KJG A;  4FX5 A;  4PJJ A;  3TJ6 A;  4MND A;  2LK4 A;  4YWQ A;  2IOQ A;  2PX0 A;  4Z9H A;  3AG2 C;  2A68 F;  3ATP A;  3RYL A;  1ORS C;  4O6M A;  2W45 A;  4EWC A;  2DI3 A;  4LLE A;  3B0U X;  1JOG A;  4IB4 A;  4AX2 A;  5A6A A;  2J7P A;  4DVY P;  1ZZP A;  5AC4 A;  4JTA B;  3BEH A;  4JJG A;  5HV9 A;  1MMN A;  4CS9 A;  1H7I A;  3S29 A;  3V5X A;  2C04 A;  3TUL A;  2XM0 A;  4LER A;  4DRH B;  1OKK A;  3ITF A;  1QLE C;  2AVK A;  3EHM A;  3ABK C;  3AGU A;  4K0D A;  3S27 A;  1CGM E;  1G4U S;  3U9J A;  4GYT A;  4U5B E;  1F1M A;  2J0W A;  2OJQ A;  2YL1 A;  1U89 A;  3GAN A;  1NFN A;  3G50 A;  4MTO A;  1RKE B;  3RQG A;  1XZP A;  1ZYR F;  3NKE A;  3PDM P;  4CSA A;  1K04 A;  1Q0F A;  1YJG A;  2B0J A;  4ULV A;  1NG1 A;  2GDC A;  4E0H A;  3QTH A;  3J06 A;  1MQV A;  2KNH A;  2XS8 A;  1H9G A;  3DAG A;  3EGX B;  3T6B A;  5BQH A;  3NDB B;  2KYH A;  3UGP A;  2KQ9 A;  1TR2 A;  3U5S A;  4QI0 A;  3HNJ A;  2A69 F;  5JP7 A;  1D1B A;  3QW1 A;  5DQZ A;  1YA9 A;  4PAC A;  3DE9 A;  2Q4F A;  4NTF A;  3I5Q A;  2XXA A;  1WAS A;  256B A;  4YL3 A;  3EHN A;  2XRH A;  5B1B C;  1EKY A;  1I4Z A;  3RVY A;  4EBK A;  2LIG A;  1OCO C;  5L3V A;  1AEP A;  1IW7 F;  1S05 A;  2QLA A;  2VC9 A;  4U5G A;  3C8G B;  5KYU B;  2TMV P;  5JSL A;  3L1M A;  1LKX A;  4I3M A;  1A0B A;  2W9Y A;  5L0C A;  4MVZ A;  1W2W A;  3NKD A;  3M1C B;  2XM4 A;  3S84 A;  1S7Z A;  1EI7 A;  3G4X A;  3FVY A;  4CSA C;  1N1C A;  4OIO F;  2P0N A;  1MND A;  1T6U A;  3U8P A;  1ZHX A;  3UNG C;  4C7O B;  1QZX A;  1BR1 A;  2L6G A;  2YEV A;  4G7O F;  2HV6 A;  5E3A A;  4M63 A;  4AE4 B;  3EGD A;  1R5I D;  3ZTZ A;  2NUP A;  2PNO A;  3JSE O;  2QNL A;  1ZVZ A;  3O55 A;  1JAF A;  1MMG A;  3DM9 B;  3IEE A;  3NYL A;  4NTA A;  2LQG A;  4FWV A;  1JR8 A;  3NG1 A;  5DQT A;  2Y3B A;  3NMK A;  3QVY A;  1HY5 A;  4JCZ A;  3TD7 A;  5L0G A;  4BEJ A;  5TJ5 E;  2WZG A;  4JIO A;  1QSP A;  3MFN A;  3SXM A;  4HFF B;  1EA8 A;  3LUT B;  1TFK B;  1LS4 A;  4JE9 A;  4ER9 A;  1OXK A;  3N2Z B;  3O6X A;  4MTF A;  1ZU4 A;  4PK4 A;  2NG1 A;  2XLV A;  1D0X A;  4P9F A;  4A4A A;  2DGJ A;  3SYN A;  1JMW A;  1GS9 A;  3ZDL A;  3ASO C;  3B71 A;  2Y3D A;  4G7Z F;  3C62 A;  1WGW A;  2KK1 A;  4KNV A;  5A6B D;  2H7V C;  1LIH A;  3AGT A;  3T6G B;  2WZL A;  5L0H A;  1WAT A;  1NU7 D;  2XL8 A;  1PV3 A;  1BDJ B;  2EIL C;  4PJM A;  4WAB A;  4DOZ A;  1EQ1 A;  2YL7 A;  1M57 C;  1OW6 A;  4U5E E;  3RFY A;  2P1A A;  1WOL A;  2ETS A;  2HUJ A;  1LE2 A;  3TJ5 A;  5JS5 A;  2OEV A;  4C3E A;  1YYJ A;  1RXQ A;  3U8V A;  3VM6 A;  2OJE D;  2Q7R A;  5L0D A;  3C7J A;  2C03 A;  3N24 A;  2H7O A;  2WVN A;  3LS1 A;  2EPM X;  4Z9J A;  1E86 A;  1FNT c;  1OR3 A;  2OKU A;  2P7V A;  4MTG A;  4G7H F;  1M2O A;  1NFO A;  1OCC C;  4JVS A;  1LS1 A;  5CI8 A;  2MWQ A;  3CAX A;  2OCC C;  2XLD A;  3T6J A;  4NC3 A;  3LEO A;  3AQC A;  3N0T A;  1SF8 A;  2HSQ A;  5E3C A;  3TQO A;  3RQE A;  2CYD A;  5DS6 A;  2EIK C;  2O9X A;  2QE9 A;  3HLZ A;  3I5P A;  3L34 A;  3OWT A;  5COG A;  3AJM A;  5E33 A;  4FAP B;  3GEE A;  1Z6A A;  2L6F A;  5AGF A;  2J0X A;  1TWH A;  2R02 A;  4EHP A;  4L6R A;  4J30 B;  1D1C A;  3DJN B;  4K7B A;  3RIP A;  5KYW A;  1FFT C;  4J7T A;  4ZLD A;  4CDY A;  4BEM J;  5JT4 A;  4FES A;  1JPJ A;  1OW8 A;  4O79 A;  5T3W A;  2J9B A;  4JCH A;  4O6N A;  4E7S A;  4E7Z A;  3GOD A;  2P61 A;  3ZIB A;  2EIJ C;  2CCY A;  5AC5 A;  1CPQ A;  1VYI A;  3NYM A;  5F5H A;  2VH3 A;  4AL0 A;  2XLW A;  4IAQ A;  2W4B A;  2QTV A;  2A6H F;  2F22 A;  3EPV A;  2ZPA A;  4NY3 A;  4XWJ A;  2L7A A;  3OEO A;  2P6V A;  3X2Q C;  2VCB A;  3ZQY A;  3CEX A;  3EZI A;  4HFK B;  1C02 A;  1BZ4 A;  3QZC A;  1GQA A;  2R7V A;  1L3P A;  1DOV A;  2PX3 A;  3GM3 A;  1RJ9 A;  2J9U A;  3EH2 A;  1T9K A;  3U3F A;  2A0U A;  4Q5S F;  3Q6N A;  4ULW A;  4YT5 A;  4OIR F;  3RQF A;  1YA7 O;  3VAY A;  3TK0 A;  1G4W R;  2HFI A;  3ABM C;  4EIY A;  4LDQ A;  1LI5 A;  4W8K A;  5B3S C;  1RMV A;  2YHS A;  4LDR A;  2R7U A;  2XLO A;  1TWC A;  3EG9 A;  5K0I A;  2H7B A;  4XLP F;  1O87 A;  1LE4 A;  1VK5 A;  5JUA A;  2DB4 A;  2M64 A;  3NMI A;  4MS2 A;  2OU6 A;  2YLG A;  2ASR A;  3KPH A;  4JTD B;  2WVO A;  1C17 M;  2RSE B;  2YQY A;  3GM2 A;  4EBB A;  1BR4 A;  2IXM A;  4MVO A;  4DVZ A;  1DOW A;  3BRJ A;  2Q9B A;  4BJ5 C;  1ZHW A;  2VCC A;  3DXJ F;  2NSG A;  4YK5 A;  3EQL F;  4HE8 D;  3ZWI A;  4AL1 A;  4DJ9 A;  1Q0G A;  2D4U A;  1G8X A;  5E2Q A;  2IXO A;  4CJO A;  1V4A A;  1BR2 A;  3FXH A;  4H54 A;  2HMQ A;  3U9M A;  5EHH A;  3EH1 A;  5JVE A;  2HV7 A;  2ZXW C;  4N6H A;  3S28 A;  3WG7 C;  3K6B A;  4I44 A;  4N4W A;  3SEO A;  2LFF A;  4LAC B;  4RBN A;  4IRU A;  2OEX A;  1QKR A;  4G0H A;  1M56 C;  2DYR C;  2IXP A;  4JJF A;  4QDL A;  2CDQ A;  2R7R A;  2GFH A;  5L0I A;  2YVK A;  4DBR A;  2XXA B;  1E85 A;  1SZI A;  2R9R B;  1V55 C;  4IWB A;  1Z7Q c;  2NUT A;  2Q9C A;  4JZA A;  2Q9A A;  1NU9 C;  2FFH A;  3CQZ A;  1CPR A;  1UFB A;  3H2U A;  1H9T A;  3ZSU A;  2ZXP A;  2Y69 C;  2XL4 A;  2NPU A;  4XQ1 A;  1PCX A;  1HMO A;  2J8W A;  3ZG1 A;  2W4M A;  5B1A C;  1G5Z A;  2KC3 A;  3JRT A;  3LNR A;  1A7E A;  2R05 A;  3JRM O;  3M15 A;  4GQH A;  4JEB A;  4NQF A;  4Q7C A;  3W8I A;  2R7W A;  5F5F A;  3SZR A;  2LD6 A;  4JUR I;  4RDA A;  1WTY A;  3U2L A;  3JCU Q;  1HW1 A;  3EFO A;  3GWL A;  3LJB A;  5BQI A;  2AP3 A;  1VLS A;  3FAJ A;  3O10 A;  3EGD B;  3U2M A;  4C3B A;  4BG0 A;  4CS8 C;  2XSE A;  2G3V A;  4XEF A;  2XLH A;  2NUP B;  1YZA A;  3R2P A;  4A2N B;  4BJ6 A;  4CBE A;  5A69 A;  1VTM P;  3LAY A;  3VF0 A;  2R7S A;  4LLC A;  2CNW D;  4YT8 A;  5BUO A;  1VLT A;  4OD4 A;  2PF4 E;  3HNL A;  3M79 A;  4HEA J;  3K1H A;  4IJJ A;  4WGZ A;  3DKA A;  3M4C A;  3W2V A;  1ORY A;  2Y39 A;  3NYJ A;  1B68 A;  3AG3 C;  1OXB A;  3RW0 A;  4XTK A;  1ZW2 A;  1YLM A;  5T3T A;  5KYY A;  1YVI A;  3DAF A;  3MBG A;  3V7O A;  1Q0K A;  1QVX A;  5COM A;  2A0B A;  1K05 A;  4MVS A;  4PJN A;  4K1O A;  4XPX A;  5CIV A;  1QQ3 A;  4DXW A;  4NCQ A;  4XLN F;  2OG2 A;  5JRA A;  4U5D E;  2X0C A;  2LSE A;  3F46 A;  1NLX A;  2J9W A;  3K1I C;  5KYX A;  2YWA A;  3RF3 A;  1OCZ C;  1RCP A;  1A7D A;  3WHN A;  4BJ6 C;  1Z5Z A;  1ZW3 A;  4CDV A;  2HS5 A;  1J8M F;  1FFH A;  1LPE A;  2J7P D;  3PCV A;  5DS5 A;  4MVU A;  1V54 C;  4YN0 B;  1AVO B;  3AG4 C;  3S9O A;  2YL0 A;  4XEV A;  3B9Q A;  4I1O B;  4MW8 A;  4BJT A;  3RVZ A;  3C8Z A;  4R32 A;  4G78 A;  5EGY A;  4IAR A;  4X0R A;  2IXN A;  1J8Y F;  1M2V B;  4KC9 A;  3PHF 2;  1ZHT A;  1ST6 A;  3E9V A;  3FOO A;  1M6T A;  4IAO A;  1AUE A;  5DVW A;  4CX9 A;  5FZT A;  4Q4Z F;  3IQ6 A;  3O39 A;  1LM3 B;  3EJN A;  3V5Y A;  2I8B A;  2WB7 A;  3A9C A;  4AK9 A;  1A41 A;  4NTB A;  3DMD A;  4XPY A;  5FCL A;  4UDV A;  3C8G D;  2E87 A;  4QI2 A;  3HTK C;  2Y3H A;  1YYX A;  4J7Y A;  2FGY A;  4U9D A;  3QMK A;  3C63 A;  4YL0 A;  1YZC A;  1WN0 A;  4ZLC A;  5L0F A;  5COF A;  4EKW A;  3OA1 A;  1D0Y A;  1FAP B;  2R7T A;  1D1A A;  2A1D D;  3DJU B;  1L7C A;  3DZA A;  3UGO A;  3B0P A;  3QVZ A;  3FOP A;  3H2V A;  2PBE A;  1O3U A;  1HMD A;  3KKB A;  5KYW B;  4OD5 A;  4U5H A;  1GM5 A;  3WAQ A;  4DRJ B;  2VAS A;  4BJ5 A;  3NMJ A;  5A6B A;  1SMY F;  3DM5 A;  3MX3 A;  3W4Y A;  3T4R A;  1OW7 A;  4WGY A;  1APC A;  3KYI A;  1UG7 A;  2YLI A;  3B29 A;  4W8P A;  4B6I A;  1ZHZ A;  2WL8 A;  4GEH A;  3WOD F;  4C3D A;  3GM1 A;  3SNH A;  2V26 A;  5B3I A;  1HE9 A;  1MMA A;  4JC7 A;  3GOR A;  1Z23 A;  3EZH A;  1OR2 A;  3CZ6 A;  3FAP B;  4MW3 A;  4U5C E;  3K7D A;  1D0Z A;  5DLJ A;  1C03 A;  1NBB A;  2YZS A;  1YAU O;  2ZXO A;  1T01 A;  3GEI A;  3GWN A;  5T1D B;  3DE8 A;  3L8J A;  3PMR A;  1SYQ A;  2V3C C;  4PFP A;  3POV A;  2ZD9 A;  2BE5 F;  2UUH A;  1TQG A;  3R7C A;  1RKE A;  1A7V A;  3RKO F;  3SP1 A;  4BPM A;  4YL1 A;  3ZQV A;  3FHD A;  1R4T A;  1RJ9 B;  2XL6 A;  1T6Q A;  2HSB A;  3CSK A;  5F28 E;  2IYL D;  3QW0 A;  4EBJ A;  4H4K C;  4E17 A;  1K40 A;  3EGX A;  1NSG B;  2EPO A;  2EPL X;  2Q00 A;  1IZM A;  1OQC A;  3HKK A;  3JZ0 A;  4JW1 A;  4MVQ A;  4CJG A;  3UR3 C;  3A11 A;  1HE1 A;  2HMZ A;  3E70 C;  3EG9 B;  2LCH A;  2EIN C;  3NRH A;  3V5Z A;  4DBQ A;  4MVM A;  5L0J A;  3LEV A;  1PD1 A;  2IM8 A;  2DYS C;  2FAP B;  2GA0 A;  4YJW A;  2VCA A;  1KU2 A;  3JYY A;  1E83 A;  2WVQ A;  5DS4 A;  5KYU A;  1TFO B;  3LLK A;  2G3K A;  3C8G A;  3Q7L A;  3W8H A;  3X1O A;  2JD3 A;  2AWY A;  5A6K A;  2Z15 A;  2R03 A;  4CS8 A;  5HSW A;  1KTM A;  2MHR A;  3IQC A;  2KSF A;  4U5F E;  1MNE A;  4CS9 C;  3ASN C;  1TWG A;  4O7G A;  3ECS A;  3IQ5 A;  4D4N A;  4KBL A;  4C7O A;  1RKC A;  2XS1 A;  1PD0 A;  3K33 A;  3KMI A;  1FMV A;  2QY9 A;  2M4E A;  2XLE A;  3Q7G A;  1KNY A;  5D91 A;  2WZF A;  3GEH A;  4XPW A;  4AE4 A;  2GAQ A;  5GPG B; 
#chains in the Genus database with same CATH homology
 4D4X A;  4JKV A;  5AGF A;  4L6R A;  1QQ3 A;  1QPU A;  3HNI A;  5JRA A;  4CDY A;  2YL1 A;  5JT4 A;  1RCP A;  2J9B A;  4CDV A;  2YL3 A;  3TOL A;  2CCY A;  4ULV A;  1CPQ A;  1MQV A;  2YL0 A;  3M4B A;  4CIP A;  2XLW A;  4IAQ A;  4IAR A;  3HNJ A;  5JP7 A;  3QW1 A;  3ZQY A;  3FOO A;  3DE9 A;  1M6T A;  1GQA A;  256B A;  4CX9 A;  1EKY A;  3IQ6 A;  1LM3 B;  4CDA A;  1S05 A;  2QLA A;  3HNK A;  5JSL A;  3L1M A;  2BC5 A;  2XM4 A;  4EIY A;  1YYX A;  4U9D A;  2XLO A;  3U8P A;  3C63 A;  1YZC A;  5JUA A;  3NMI A;  2YLG A;  2YKZ A;  3QVZ A;  3FOP A;  3ZTZ A;  1JAF A;  5JLI A;  3ZWI A;  3NMJ A;  3NMK A;  3QVY A;  3VRC A;  4CJO A;  4WGY A;  1APC A;  2YLI A;  5JVE A;  5B3I A;  4JE9 A;  4N6H A;  4ER9 A;  1NBB A;  2XLV A;  4N4W A;  3DE8 A;  1E84 A;  2XLM A;  3C62 A;  1E85 A;  1CGN A;  1A7V A;  3ZQV A;  1CGO A;  2XL6 A;  3ZTM A;  3QW0 A;  1CPR A;  2XL8 A;  1BBH A;  2YL7 A;  2J8W A;  3TOM A;  4CJG A;  4JEB A;  4JEA A;  3M15 A;  4U9E A;  5JS5 A;  1YYJ A;  2YLD A;  1E83 A;  2XLH A;  1YZA A;  1E86 A;  2XLD A;  4IB4 A;  3HNL A;  3M79 A;  4NC3 A;  4WGZ A;  3IQ5 A;  4D4N A;  3M4C A;  2XLE A;  2XM0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...