3DJUB

Crystal structure of human btg2
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
121
structure length
121
Chain Sequence
TDMLPEIAAAVGFLSSLLRTRGCVSEQRLKVFSGALQEALTEHYKHHWFPEKPSKGSGYRCIRINHKMDPIISRVASQIGLSQPQLHQLLPSELTLWVDPYEVSYRIGEDGSICVLYEEAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein BTG2
publication title Crystal structures of human BTG2 and mouse TIS21 involved in suppression of CAF1 deadenylase activity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 35
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2008-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07742 BTG BTG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1120 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3djuB00
3DJNB 3DJUB 5CI8A 2D5RB 5CI9A 2Z15A 3E9VA
chains in the Genus database with same CATH superfamily
2J7PA 4YL1A 2XXAB 2PF4E 2KQ9A 1MMAA 1S05A 3DAFA 3CQZA 4G78A 2OOCA 3NYLA 2IYLD 3EG9A 2X51A 4ANJA 3HTKC 2EPLX 1D0ZA 1OR3A 1JRAA 1YDIA 1HMOA 4L6RA 4XEKA 3T6JA 3DJUB 2IXNA 4JVSA 4Z9IA 1O3UA 2HSBA 2KGOA 2MYSA 2GAQA 4MVUA 2EILC 3AQCA 4MVMA 3RIPA 2XL6A 2G62A 3O39A 3QZCA 4CDYA 4E18A 2A1DD 5JT4A 1APCA 1B68A 1DOWA 3M4CA 1UG7A 2YL7A 3ZVRA 1BR1A 1ZHZA 3SXKA 3AG2C 5FCLA 1K05A 1QQ3A 2JPUA 1G4US 2YLDA 3GORA 3NG1A 5KYXB 3AJMA 3TOMA 4EBBA 3IQ5A 3ABKC 4U5HA 2Q9BA 2LCHA 2CGEA 3U2MA 2YVKA 4I1OB 3ASNC 3V5XA 5BQHA 4ZLCA 3ECSA 1NU7D 2NSGA 2QTVA 2Y3HA 4MW8A 1HMDA 4RD9A 1U6HA 3GANA 3OEOA 3LEVA 2XM4A 5DLJA 2LP4A 1JAFA 4OIRF 2X0CA 5L0DA 1H9TA 2M64A 3SNHA 2C03A 2KYHA 2P6VA 1C17M 1GS9A 3QMKA 1WN0A 2V26A 4JRZA 5GPGB 5T3WA 1M57C 2I8BA 1AUEA 1BBHA 1OQCA 2Y3DA 3LNRA 4FESA 2L81A 4J30B 4PR9A 4YN0B 3S90A 3AG1C 2CNWD 4W8KA 4EWCA 3FXHA 2YRFA 3RQGA 4XEVA 2HUJA 4H4KC 3S29A 4O6MA 3RH3A 3T6GB 4PJLA 1Z5ZA 2GA0A 5KYYB 3FDQA 4IWBA 2PNOA 2R7UA 1WASA 1T6IA 2GFHA 2H7OA 3DXJF 2PFDA 3QW1A 1OCRC 5AC5A 4GEHA 3LS1A 2R7VA 1N1CA 2DB4A 2MWQA 1YA7O 1TQGA 3K33A 2PX3A 2KC3A 3QVYA 5A6JA 2MHRA 1EA8A 3W2VA 2J9VA 1M2OA 3OA1A 2CW0F 4CDAA 5A6KA 2DYSC 1YZCA 2P7VA 2E87A 5JSLA 2WVOA 2B0HA 2CDQA 1TWCA 2A6EF 1ZHWA 3EHNA 4Q4ZF 5JRAA 5JVEA 2Y69C 4JTDB 1L3PA 1RJ9B 3FVYA 1I5NA 2A6HF 2DI3A 5DQZA 4C3DA 4F4BA 5A6BA 1FFHA 1DOVA 1L7CA 2L6HA 2Q00A 1SYQA 3GM3A 4HFKB 5L0HA 3O6XA 3TD7A 1CGME 1VYIA 3GWNA 4XPXA 4O79A 3ZTMA 4DBRA 1XZQA 1D1AA 4QI2A 2AU5A 3CSKA 3S9OA 3H2VA 3T4RA 1LI7A 4MTFA 2HS5A 2TMVP 1MNEA 1K40A 5B1AC 3DKAA 4G7ZF 3HKKA 1A41A 4GQHA 1TFOB 1OW7A 1S7ZA 3HJCA 3TJ5A 4ER9A 2W45A 2YLIA 1Z63A 1LKXA 1IZMA 3A9CA 1NU9C 2QE9A 3IEEA 1Z3IX 2OEVA 4NTAA 4O6YA 5COMA 3S0XA 2CYDA 1LVKA 2J9WA 3KH2A 3QW0A 4IGGA 2BE5F 4CJGA 2OCCC 3B0PA 3LUTB 3V5YA 2O9XA 4BPMA 1ZHXA 3X2QC 2R7XA 5D92A 1NSGB 4C3EA 1NLXA 2R9RB 2NUPB 4DRHB 3U5SA 4JE9A 3DZAA 3EQLF 1GM5A 2LIGA 4NQFA 4U5DE 2HZ8A 4JZAA 1BR4A 1U0BB 3UMIA 4WJ0A 3G50A 4P9FA 3U9JA 1Y6DA 4IAOA 3JTLO 1JPNA 3KKBA 4KNWA 4ULVA 3VYWA 1ZVZA 3NMJA 2WVQA 5L0CA 5FZTA 3JT1A 4MVSA 2EINC 2DGJA 5CIVA 1O87A 1OR2A 1M6TA 1ZZPA 2VC9A 4C7OA 3Q6MA 3ATPA 5L3VA 1M2VB 3IQ6A 3JZ0A 1JR8A 3O55A 2LQGA 1HE1A 4MVRA 3ABLC 4BEMJ 1HW1A 3LAYA 1LM3B 2PBEA 3U3FA 3X1OA 3G4XA 1BR2A 1Y4CA 5E2QA 3LLKA 1OKKD 1YJGA 2HMQA 1GQAA 1Q0MA 2DYRC 4MQ9F 1QLEC 2KK1A 4JJFA 4XWJA 2H8AA 5E3CA 3EZHA 5KYNA 3I5QA 2HFIA 2XLWA 1VOMA 1D0XA 2EIMC 3KYIA 3ZTZA 4E7SA 3IHUA 1LE4A 5KYWA 1EQ1A 5EGYA 5L0FA 2IM8A 2EPKX 2W4MA 2ZXOA 3UGOA 2ZXRA 2Q3TA 1AVOB 1JPJA 2IOQA 3L0IA 1H7IA 3MFNA 1RKCA 1SR2A 3DI5A 5T1DB 3SP1A 2R05A 1LIHA 2D4UA 1HY5A 2VCCA 1Q0DA 3I5PA 3W4YA 3L1MA 3FAJA 2XL4A 3E70C 3VAYA 5DS4A 1EKYA 4PJJA 4O7GA 4NTBA 2RD9A 3K7DA 3C8GB 3EGXA 2QY9A 4I3MA 4JEBA 1OKKA 3AGUA 4EKWA 1CGNA 4EIYA 1ST6A 2OU6A 4J32B 1BZ4A 2XRHA 3AGTA 3U9MA 3OWTA 3TJ6A 4JCHA 1H9GA 1VLTA 2WVNA 2NUTA 4YT2A 4ZLDA 2R7SA 1VK5A 4OINF 4AE4A 2L6GA 1PD0A 2VASA 2PX0A 2HV6A 1MMGA 3NMKA 1ZYRF 3ZDLA 4EBKA 3Q7GA 2OEXA 2XM0A 4OD4A 5IY5C 1V74B 2NPUA 2VH3A 3FOOA 1HE9A 3W2WA 3DJNB 1OCCC 2FGYA 2ZD9A 1E83A 1ZHTA 1QZXA 2IXPA 2IBFA 2OG2A 2YKZA 2I15A 3NYMA 2YLGA 3GEEA 4OIPF 3O10A 3PCVA 1D1BA 3R2PA 2J46A 1WGWA 3UMKA 3B0UX 2A0BA 4CS7A 5BQIA 4YL3A 3NMIA 2EPOA 3KPHA 2GWWA 4IB4A 2XLMA 3ASOC 3FMSA 3S28A 5L3QA 3J06A 1E2XA 2WZLA 3N24A 1M2VA 3GEHA 2ZXWC 4XLNF 3S84A 3EGDB 3LLIA 3AQBA 4U9DA 1RKEA 2XSEA 3ZSUA 3B29A 4DRJB 1MNDA 3EFOB 1ZW3A 2OJQA 1Z23A 3FAPB 1YYJA 2J9UA 4EUKB 5D91A 2YL1A 1LS1A 4HE8D 2XLDA 1I4ZA 1FTSA 2EIJC 1E86A 4BJ6C 2ETSA 3KL4A 4A2NB 4CS8C 2CNWA 3DM5A 4I1MA 4JKVA 1A0BA 4OD5A 3S27A 4BJTA 2V3CC 3C18A 2A0UA 1LS4A 2OQMA 2XXAA 1NFNA 1ZW2A 4U5EE 4WABA 1R5ID 3L34A 1A7DA 3ZQYA 3RYLA 1SMYF 5L0JA 2XL8A 1J8MF 2ZXPA 1NG1A 3H65A 3SXMA 3HLZA 4YJWA 1D1CA 3B71A 1LPEA 3V7OA 2BC5A 1FAPB 1WOLA 4KNVA 3R7CA 4IAQA 2NSFA 1TWGA 4RBNA 1TR2A 3LEOA 4HFFB 3EG9B 4W8PA 5F5FA 3HNIA 4OIQF 1MMDA 2R7OA 4PFOA 5A69A 5T3TA 3GWLA 4DBQA 4YT4A 3WHNA 5KYXA 4LDRA 4MVQA 4HEAJ 1E84A 1SZIA 1XZPA 3JCUQ 2M4EA 1V54C 2W9YA 3TOLA 3W8HA 4YT8A 4JJGA 4CS9C 5COGA 2Y39A 2QNLA 1YARO 3RFYA 2VB6A 3DM9B 5CI9A 1G4WR 4LDQA 4DOZA 1CPQA 1PD1A 1J8YF 1EI7A 3EH2A 4XPWA 1BDJB 3DAGA 4R32A 3UMHA 2YWAA 1A7EA 4J7YA 5F5HA 1Z6AA 1YVIA 4BEJA 5B1BC 3I4UA 3Q7LA 2Q4FA 2FFHA 2P61A 4NCQA 1V55C 3T9OA 3US6A 3WG7C 2KJGA 1QPUA 3JRTA 2HMZA 1VYKA 2ASRA 2WB7A 1YLMA 2Y3GA 5HV9A 4O6NA 1CPRA 2LFDA 1T01A 4P6IC 2R02A 4AL0A 5A6BD 2G3KA 2D5RB 3IQCA 3M79A 2XLVA 2UUHA 1OXBA 4JTCB 3AG4C 5E3AA 1O5HA 1OCZC 4IRUA 4ONSA 5KYYA 2R7WA 1U89A 1UFBA 2YQYA 3ABMC 3F47A 3Q6NA 2Y3BA 2QLAA 5COFA 3T6BA 3ITFA 4Q7CA 3U3BA 3ZG1A 4BJ6A 4YL0A 4CX9A 3C8ZA 4JTAB 4WGZA 4CS8A 1G8XA 2NG1A 3C63A 1Q0KA 4DRIB 3TK0A 3TQOA 4DVZA 4BJ5C 1QVXA 4CDVA 5JP7A 3IQTA 4CBEA 3LJBA 1YZAA 2L6FA 3L8JA 5EHHA 1YAUO 2OJED 2R7QA 2WL8A 4U9EA 4K7BA 1YYXA 4CIPA 3UGPA 1KTMA 4QI0A 4G7OF 2J9BA 2LD6A 1RJ9A 2JD3A 3MYFA 4JCZA 4MW3A 4D4XA 1R4TA 1VB5A 3GM1A 3E9VA 2BL2A 1W2WA 4X0RA 4XTKA 3H2UA 2FAPB 1FFTC 1JMWA 1YA9A 3NRHA 1K04A 1E85A 4CSAC 3VF0A 4CS9A 5DS5A 3AOUA 3JSZA 1HW2A 3GODA 3W8IA 1TWAA 3RKOF 3VM6A 2F22A 4J7TA 4A4AA 4BG0A 4JIOA 2ICWG 2HJ3A 2EPNA 4XEFA 4Q5SF 2JX0A 2R7RA 2LSEA 4FX5A 3ZIBA 5BQGA 5DVWA 2R25A 3NYJA 4IARA 4N6HA 4WGYA 1NFOA 2OKUA 3K6BA 4LDKA 3ZWIA 3QVZA 5A6AA 3TULA 3LESA 2L9JA 2YL0A 5TJ5E 3B0VC 2KW3C 5DQTA 3DWWA 1OCOC 4PJMA 2EIKC 2NUPA 3GEIA 4K0DA 3EPVA 4P9TA 4YWQA 1F1MA 3NKDA 1Z7Qc 2AP3A 3BRJA 2H7BA 3U8VA 4AX2A 2Q9AA 3RQEA 2VCBA 3ZQVA 1RXQA 3NDBB 3U2LA 2HV7A 4EBJA 4MVOA 4MS2A 1H6GA 2YEVA 1Q0FA 1QKRA 4GYTA 1ZU5A 3UNGC 2J45A 3RVYA 4DXWA 2WZGA 4MTGA 5CI8A 4KBLA 5JUAA 1I4YA 2ZPAA 3AG3C 2AWYA 2UUIA 2A68F 2LK4A 1LI5A 2YHSA 2PP4A 2J8WA 3F46A 1T5OA 2B0JA 2W4BA 4BJ5A 3U0CA 3UR3C 3CZ6A 4JEAA 5KYUB 3GM2A 5K0IA 2XLHA 1FNTc 3V5ZA 3C8GD 4C7OB 5L0IA 2J0XA 3JRMO 3PHF2 3EZIA 4LACB 3HNJA 1ORSC 1TKNA 3EH1A 2KSFA 3JSEO 5F28E 2CCYA 4XPYA 3DD7A 1C02A 1XWJA 2AWCA 1VTMP 5L0GA 2GDCA 4ULWA 4N4WA 4G0HA 3JYYA 3K66A 4LERA 3EJNA 1QSPA 3SZRA 3N0TA 3K1IC 3SXYA 4QDLA 3DE9A 4N6CA 4CSAA 3N2ZB 2G3VA 5HSWA 1SF8A 3RVZA 3QTHA 4D4NA 4NC3A 5B3SC 2Z15A 3M15A 4H54A 2LFFA 2A69F 3G4ZA 3MX3A 4I44A 1A7VA 4NY3A 5KYWB 2IXOA 4NTFA 4LLCA 4U5CE 5DS6A 2R7TA 3SEOA 4PJNA 4DVYP 3SXZA 3MYIA 3C8GA 1RCPA 2R03A 4OIOF 3MBGA 3PDMP 2HJMA 3C7JA 4Z9JA 1CGOA 3ZC4A 3RF3A 2P0NA 4M63A 1KNYA 4N06A 1FR0A 3KYJA 4PK4A 4DJ9A 2XLOA 3CAXA 3B9QA 4MVZA 1RMVA 1V4AA 3MLGA 1FMWA 1ORYA 4PACA 3EGXB 4YK5A 4Z9HA 3RW0A 5AC4A 4G7HF 2XS8A 1GGQA 1T6UA 2KNHA 3CEXA 4JURI 1TFKB 2HKVA 5JLIA 2C04A 3IPMO 1T9KA 3WAQA 3LS0A 2RSEB 4BJ1A 1JOGA 1OW6A 1VMAA 4RDAA 2NUTB 3SYNA 2XS1A 3DMDA 5AGFA 5EK0A 1T6QA 4AE4B 256BA 4UDVA 4KC9A 4E7ZA 3K1HA 2J0WA 4U5BE 2HSQA 4AK9A 1PV3A 3EHMA 4LLEA 1NBBA 3RQFA 1WTYA 2YZSA 1MMNA 2AVKA 3M1CB 2QUPA 2J7PD 3KMIA 4YT5A 1D0YA 4CIHA 4XQ1A 1ZHYA 4EHPA 4IJJA 4FWVA 1NZEA 4FAPB 4E0IA 1OXKA 4U5FE 1C03A 3PMRA 1AEPA 1ZU4A 3A11A 3FHDA 3JYHA 4B6IA 1VLSA 3K1IA 3EGDA 3POVA 1MQVA 1Q0GA 2H7VC 5KYUA 3HNLA 1TWHA 3DE8A 3L8IA 4E0HA 3EFOA 2XLEA 5E33A 5JS5A 1WWPA 4K1OA 1WATA 3LNMB 2VCAA 3WODF 1LE2A 4MNDA 2YL3A 4XLPF 4PFPA 3BEHA 4JW1A 2Q7RA 3VRCA 1RKEB 4JC7A 4KI2A 4MTOA 5B3IA 1KU2A 2IXMA 1OW8A 3HNKA 1FMVA 4C3BA 4U5GA 3FOPA 4CJOA 1G5ZA 1IW7F 1PCXA 3NKEA 2Q9CA 2WZFA 2L7AA 3U8PA 5BUOA 1M56C 2EPMX 4E17A 3M4BA 4AL1A 2P1AA 1ORJA 3C62A
chains in the Genus database with same CATH topology
2J7PA 2XXAB 2PF4E 2KQ9A 1MMAA 3CQZA 3DAFA 3NYLA 2IYLD 3EG9A 2X51A 4ANJA 3HTKC 1D0ZA 3T6JA 3DJUB 2IXNA 4JVSA 2MYSA 2KGOA 2EILC 3AQCA 3RIPA 3O39A 2G62A 3QZCA 2A1DD 3ZVRA 1BR1A 1ZHZA 3AG2C 5FCLA 5KYXB 3NG1A 4EBBA 3ABKC 4U5HA 2Q9BA 2CGEA 4I1OB 3ASNC 4ZLCA 3ECSA 1NU7D 2QTVA 2Y3HA 4RD9A 3GANA 3OEOA 3LEVA 5DLJA 4OIRF 3SNHA 2C03A 2P6VA 3QMKA 2V26A 5T3WA 1M57C 2I8BA 2Y3DA 4FESA 3LNRA 2L81A 4J30B 4YN0B 3AG1C 2CNWD 4W8KA 4EWCA 4H4KC 3S29A 4O6MA 3RH3A 4PJLA 1Z5ZA 5KYYB 3FDQA 4IWBA 2R7UA 2GFHA 2H7OA 3DXJF 2PFDA 1OCRC 4GEHA 3LS1A 2R7VA 1N1CA 3K33A 2MWQA 2PX3A 3W2VA 2J9VA 1M2OA 3OA1A 2CW0F 2DYSC 2P7VA 2E87A 2WVOA 2CDQA 1TWCA 2A6EF 1ZHWA 3EHNA 4Q4ZF 2Y69C 1RJ9B 3FVYA 2A6HF 4C3DA 5DQZA 4F4BA 1FFHA 4HFKB 3O6XA 3TD7A 1VYIA 4O79A 4DBRA 1D1AA 4QI2A 3CSKA 3T4RA 1MNEA 5B1AC 4G7ZF 3HJCA 1S7ZA 2W45A 1Z63A 1LKXA 1IZMA 3IEEA 1NU9C 1Z3IX 4O6YA 3S0XA 2J9WA 1LVKA 3KH2A 2BE5F 2OCCC 3B0PA 2O9XA 1ZHXA 3X2QC 2R7XA 5D92A 4C3EA 2NUPB 3DZAA 3EQLF 4U5DE 4JZAA 1BR4A 3UMIA 4WJ0A 4KNWA 4IAOA 1JPNA 3KKBA 3VYWA 2WVQA 3JT1A 2EINC 2DGJA 1O87A 4C7OA 3Q6MA 5L3VA 1M2VB 3ABLC 3LAYA 3X1OA 1BR2A 5E2QA 3LLKA 1OKKD 2DYRC 4XWJA 4MQ9F 1QLEC 4JJFA 5E3CA 3EZHA 5KYNA 3I5QA 1VOMA 1D0XA 2EIMC 4E7SA 5KYWA 5EGYA 2ZXOA 2W4MA 3UGOA 2ZXRA 2Q3TA 1JPJA 2IOQA 3L0IA 3SP1A 5T1DB 3I5PA 3FAJA 2XL4A 3E70C 3VAYA 5DS4A 4PJJA 4O7GA 3K7DA 3EGXA 2QY9A 4I3MA 1OKKA 1ST6A 4J32B 2XRHA 3OWTA 4JCHA 2WVNA 2NUTA 4YT2A 4ZLDA 2R7SA 1VK5A 4OINF 4AE4A 2VASA 1PD0A 2PX0A 2HV6A 1MMGA 1ZYRF 3Q7GA 4OD4A 5IY5C 2VH3A 3W2WA 3DJNB 1OCCC 2FGYA 1ZHTA 1QZXA 2IXPA 2OG2A 3NYMA 4OIPF 1D1BA 2J46A 1WGWA 3UMKA 3B0UX 4CS7A 3S28A 3ASOC 5L3QA 2WZLA 3N24A 1M2VA 2ZXWC 4XLNF 3EGDB 3LLIA 3AQBA 2XSEA 3ZSUA 1MNDA 3EFOB 1Z23A 2J9UA 5D91A 1LS1A 4HE8D 1FTSA 2EIJC 4BJ6C 3KL4A 4A2NB 4CS8C 2CNWA 3DM5A 4I1MA 3S27A 4OD5A 4BJTA 2V3CC 2XXAA 4U5EE 3L34A 3RYLA 1SMYF 1J8MF 2ZXPA 1NG1A 3H65A 3HLZA 4YJWA 1D1CA 3V7OA 4KNVA 4RBNA 1TWGA 1TR2A 5F5FA 4HFFB 3EG9B 4OIQF 1MMDA 2R7OA 4PFOA 5T3TA 4DBQA 4YT4A 5KYXA 4HEAJ 1SZIA 3JCUQ 2M4EA 1V54C 2W9YA 4YT8A 3W8HA 4JJGA 4CS9C 2Y39A 3RFYA 2VB6A 3DM9B 5CI9A 4DOZA 1PD1A 1J8YF 3EH2A 3DAGA 3UMHA 5F5HA 1Z6AA 4BEJA 5B1BC 3I4UA 3Q7LA 2FFHA 1V55C 3WG7C 2KJGA 3JRTA 1VYKA 2WB7A 2Y3GA 4O6NA 4P6IC 2G3KA 2D5RB 5KYYA 3AG4C 5E3AA 1O5HA 1OCZC 4IRUA 2R7WA 3Q6NA 3ABMC 3F47A 3T6BA 2Y3BA 3ITFA 4Q7CA 3ZG1A 4BJ6A 4CS8A 1G8XA 2NG1A 4DVZA 4BJ5C 4CBEA 3LJBA 5EHHA 2R7QA 2WL8A 4K7BA 3UGPA 4QI0A 4G7OF 1RJ9A 2JD3A 3E9VA 4X0RA 1W2WA 1FFTC 3NRHA 4CSAC 4CS9A 5DS5A 3JSZA 3GODA 3W8IA 1TWAA 3RKOF 4BG0A 4Q5SF 2R7RA 2LSEA 4FX5A 3ZIBA 5DVWA 3NYJA 3K6BA 3LESA 2L9JA 3B0VC 2KW3C 5DQTA 1OCOC 4PJMA 2EIKC 2NUPA 4K0DA 3EPVA 4YWQA 3NKDA 2H7BA 4AX2A 2Q9AA 3NDBB 2HV7A 2YEVA 4GYTA 3UNGC 1ZU5A 2J45A 2WZGA 5CI8A 4KBLA 2ZPAA 3AG3C 2A68F 3F46A 2YHSA 2PP4A 2B0JA 2W4BA 4BJ5A 3UR3C 3CZ6A 5KYUB 4C7OB 2J0XA 3PHF2 3EZIA 4LACB 1TKNA 3EH1A 3DD7A 4ULWA 4G0HA 3K66A 4LERA 3EJNA 3SZRA 3N0TA 3K1IC 4QDLA 4CSAA 3N2ZB 2G3VA 5HSWA 1SF8A 5B3SC 2Z15A 2A69F 3MX3A 4I44A 4NY3A 5KYWB 2IXOA 4LLCA 4U5CE 5DS6A 2R7TA 3SEOA 4PJNA 4DVYP 4OIOF 3ZC4A 4M63A 4N06A 4PK4A 3B9QA 3MLGA 1FMWA 3EGXB 4G7HF 2KNHA 4JURI 2C04A 3LS0A 4BJ1A 1VMAA 4RDAA 2NUTB 3SYNA 3DMDA 4AE4B 4KC9A 4E7ZA 3K1HA 2J0WA 4U5BE 4AK9A 3EHMA 4LLEA 2YZSA 1MMNA 3M1CB 3KMIA 2J7PD 4YT5A 1D0YA 4CIHA 1ZHYA 4IJJA 4FWVA 1NZEA 4U5FE 4B6IA 3PMRA 1ZU4A 3FHDA 3JYHA 3EGDA 3POVA 2H7VC 5KYUA 1TWHA 3EFOA 5E33A 3WODF 4MNDA 4XLPF 4PFPA 4JW1A 4KI2A 1KU2A 2IXMA 1FMVA 4C3BA 4U5GA 1IW7F 1PCXA 3NKEA 2Q9CA 2WZFA 5BUOA 1M56C 4XTKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DJN B;  3DJU B;  5CI8 A;  2D5R B;  5CI9 A;  2Z15 A;  3E9V A; 
#chains in the Genus database with same CATH topology
 2J7P A;  4YL1 A;  2XXA B;  2PF4 E;  2KQ9 A;  1MMA A;  1S05 A;  3DAF A;  3CQZ A;  4G78 A;  2OOC A;  3NYL A;  2IYL D;  3EG9 A;  2X51 A;  4ANJ A;  3HTK C;  2EPL X;  1D0Z A;  1OR3 A;  1JRA A;  1YDI A;  1HMO A;  4L6R A;  4XEK A;  3T6J A;  3DJU B;  2IXN A;  4JVS A;  4Z9I A;  1O3U A;  2HSB A;  2KGO A;  2MYS A;  2GAQ A;  4MVU A;  2EIL C;  3AQC A;  4MVM A;  3RIP A;  2XL6 A;  2G62 A;  3O39 A;  3QZC A;  4CDY A;  4E18 A;  2A1D D;  5JT4 A;  1APC A;  1B68 A;  1DOW A;  3M4C A;  1UG7 A;  2YL7 A;  3ZVR A;  1BR1 A;  1ZHZ A;  3SXK A;  3AG2 C;  5FCL A;  1K05 A;  1QQ3 A;  2JPU A;  1G4U S;  2YLD A;  3GOR A;  3NG1 A;  5KYX B;  3AJM A;  3TOM A;  4EBB A;  3IQ5 A;  3ABK C;  4U5H A;  2Q9B A;  2LCH A;  2CGE A;  3U2M A;  2YVK A;  4I1O B;  3ASN C;  3V5X A;  5BQH A;  4ZLC A;  3ECS A;  1NU7 D;  2NSG A;  2QTV A;  2Y3H A;  4MW8 A;  1HMD A;  4RD9 A;  1U6H A;  3GAN A;  3OEO A;  3LEV A;  2XM4 A;  5DLJ A;  2LP4 A;  1JAF A;  4OIR F;  2X0C A;  5L0D A;  1H9T A;  2M64 A;  3SNH A;  2C03 A;  2KYH A;  2P6V A;  1C17 M;  1GS9 A;  3QMK A;  1WN0 A;  2V26 A;  4JRZ A;  5GPG B;  5T3W A;  1M57 C;  2I8B A;  1AUE A;  1BBH A;  1OQC A;  2Y3D A;  3LNR A;  4FES A;  2L81 A;  4J30 B;  4PR9 A;  4YN0 B;  3S90 A;  3AG1 C;  2CNW D;  4W8K A;  4EWC A;  3FXH A;  2YRF A;  3RQG A;  4XEV A;  2HUJ A;  4H4K C;  3S29 A;  4O6M A;  3RH3 A;  3T6G B;  4PJL A;  1Z5Z A;  2GA0 A;  5KYY B;  3FDQ A;  4IWB A;  2PNO A;  2R7U A;  1WAS A;  1T6I A;  2GFH A;  2H7O A;  3DXJ F;  2PFD A;  3QW1 A;  1OCR C;  5AC5 A;  4GEH A;  3LS1 A;  2R7V A;  1N1C A;  2DB4 A;  2MWQ A;  1YA7 O;  1TQG A;  3K33 A;  2PX3 A;  2KC3 A;  3QVY A;  5A6J A;  2MHR A;  1EA8 A;  3W2V A;  2J9V A;  1M2O A;  3OA1 A;  2CW0 F;  4CDA A;  5A6K A;  2DYS C;  1YZC A;  2P7V A;  2E87 A;  5JSL A;  2WVO A;  2B0H A;  2CDQ A;  1TWC A;  2A6E F;  1ZHW A;  3EHN A;  4Q4Z F;  5JRA A;  5JVE A;  2Y69 C;  4JTD B;  1L3P A;  1RJ9 B;  3FVY A;  1I5N A;  2A6H F;  2DI3 A;  5DQZ A;  4C3D A;  4F4B A;  5A6B A;  1FFH A;  1DOV A;  1L7C A;  2L6H A;  2Q00 A;  1SYQ A;  3GM3 A;  4HFK B;  5L0H A;  3O6X A;  3TD7 A;  1CGM E;  1VYI A;  3GWN A;  4XPX A;  4O79 A;  3ZTM A;  4DBR A;  1XZQ A;  1D1A A;  4QI2 A;  2AU5 A;  3CSK A;  3S9O A;  3H2V A;  3T4R A;  1LI7 A;  4MTF A;  2HS5 A;  2TMV P;  1MNE A;  1K40 A;  5B1A C;  3DKA A;  4G7Z F;  3HKK A;  1A41 A;  4GQH A;  1TFO B;  1OW7 A;  1S7Z A;  3HJC A;  3TJ5 A;  4ER9 A;  2W45 A;  2YLI A;  1Z63 A;  1LKX A;  1IZM A;  3A9C A;  1NU9 C;  2QE9 A;  3IEE A;  1Z3I X;  2OEV A;  4NTA A;  4O6Y A;  5COM A;  3S0X A;  2CYD A;  1LVK A;  2J9W A;  3KH2 A;  3QW0 A;  4IGG A;  2BE5 F;  4CJG A;  2OCC C;  3B0P A;  3LUT B;  3V5Y A;  2O9X A;  4BPM A;  1ZHX A;  3X2Q C;  2R7X A;  5D92 A;  1NSG B;  4C3E A;  1NLX A;  2R9R B;  2NUP B;  4DRH B;  3U5S A;  4JE9 A;  3DZA A;  3EQL F;  1GM5 A;  2LIG A;  4NQF A;  4U5D E;  2HZ8 A;  4JZA A;  1BR4 A;  1U0B B;  3UMI A;  4WJ0 A;  3G50 A;  4P9F A;  3U9J A;  1Y6D A;  4IAO A;  3JTL O;  1JPN A;  3KKB A;  4KNW A;  4ULV A;  3VYW A;  1ZVZ A;  3NMJ A;  2WVQ A;  5L0C A;  5FZT A;  3JT1 A;  4MVS A;  2EIN C;  2DGJ A;  5CIV A;  1O87 A;  1OR2 A;  1M6T A;  1ZZP A;  2VC9 A;  4C7O A;  3Q6M A;  3ATP A;  5L3V A;  1M2V B;  3IQ6 A;  3JZ0 A;  1JR8 A;  3O55 A;  2LQG A;  1HE1 A;  4MVR A;  3ABL C;  4BEM J;  1HW1 A;  3LAY A;  1LM3 B;  2PBE A;  3U3F A;  3X1O A;  3G4X A;  1BR2 A;  1Y4C A;  5E2Q A;  3LLK A;  1OKK D;  1YJG A;  2HMQ A;  1GQA A;  1Q0M A;  2DYR C;  4MQ9 F;  1QLE C;  2KK1 A;  4JJF A;  4XWJ A;  2H8A A;  5E3C A;  3EZH A;  5KYN A;  3I5Q A;  2HFI A;  2XLW A;  1VOM A;  1D0X A;  2EIM C;  3KYI A;  3ZTZ A;  4E7S A;  3IHU A;  1LE4 A;  5KYW A;  1EQ1 A;  5EGY A;  5L0F A;  2IM8 A;  2EPK X;  2W4M A;  2ZXO A;  3UGO A;  2ZXR A;  2Q3T A;  1AVO B;  1JPJ A;  2IOQ A;  3L0I A;  1H7I A;  3MFN A;  1RKC A;  1SR2 A;  3DI5 A;  5T1D B;  3SP1 A;  2R05 A;  1LIH A;  2D4U A;  1HY5 A;  2VCC A;  1Q0D A;  3I5P A;  3W4Y A;  3L1M A;  3FAJ A;  2XL4 A;  3E70 C;  3VAY A;  5DS4 A;  1EKY A;  4PJJ A;  4O7G A;  4NTB A;  2RD9 A;  3K7D A;  3C8G B;  3EGX A;  2QY9 A;  4I3M A;  4JEB A;  1OKK A;  3AGU A;  4EKW A;  1CGN A;  4EIY A;  1ST6 A;  2OU6 A;  4J32 B;  1BZ4 A;  2XRH A;  3AGT A;  3U9M A;  3OWT A;  3TJ6 A;  4JCH A;  1H9G A;  1VLT A;  2WVN A;  2NUT A;  4YT2 A;  4ZLD A;  2R7S A;  1VK5 A;  4OIN F;  4AE4 A;  2L6G A;  1PD0 A;  2VAS A;  2PX0 A;  2HV6 A;  1MMG A;  3NMK A;  1ZYR F;  3ZDL A;  4EBK A;  3Q7G A;  2OEX A;  2XM0 A;  4OD4 A;  5IY5 C;  1V74 B;  2NPU A;  2VH3 A;  3FOO A;  1HE9 A;  3W2W A;  3DJN B;  1OCC C;  2FGY A;  2ZD9 A;  1E83 A;  1ZHT A;  1QZX A;  2IXP A;  2IBF A;  2OG2 A;  2YKZ A;  2I15 A;  3NYM A;  2YLG A;  3GEE A;  4OIP F;  3O10 A;  3PCV A;  1D1B A;  3R2P A;  2J46 A;  1WGW A;  3UMK A;  3B0U X;  2A0B A;  4CS7 A;  5BQI A;  4YL3 A;  3NMI A;  2EPO A;  3KPH A;  2GWW A;  4IB4 A;  2XLM A;  3ASO C;  3FMS A;  3S28 A;  5L3Q A;  3J06 A;  1E2X A;  2WZL A;  3N24 A;  1M2V A;  3GEH A;  2ZXW C;  4XLN F;  3S84 A;  3EGD B;  3LLI A;  3AQB A;  4U9D A;  1RKE A;  2XSE A;  3ZSU A;  3B29 A;  4DRJ B;  1MND A;  3EFO B;  1ZW3 A;  2OJQ A;  1Z23 A;  3FAP B;  1YYJ A;  2J9U A;  4EUK B;  5D91 A;  2YL1 A;  1LS1 A;  4HE8 D;  2XLD A;  1I4Z A;  1FTS A;  2EIJ C;  1E86 A;  4BJ6 C;  2ETS A;  3KL4 A;  4A2N B;  4CS8 C;  2CNW A;  3DM5 A;  4I1M A;  4JKV A;  1A0B A;  4OD5 A;  3S27 A;  4BJT A;  2V3C C;  3C18 A;  2A0U A;  1LS4 A;  2OQM A;  2XXA A;  1NFN A;  1ZW2 A;  4U5E E;  4WAB A;  1R5I D;  3L34 A;  1A7D A;  3ZQY A;  3RYL A;  1SMY F;  5L0J A;  2XL8 A;  1J8M F;  2ZXP A;  1NG1 A;  3H65 A;  3SXM A;  3HLZ A;  4YJW A;  1D1C A;  3B71 A;  1LPE A;  3V7O A;  2BC5 A;  1FAP B;  1WOL A;  4KNV A;  3R7C A;  4IAQ A;  2NSF A;  1TWG A;  4RBN A;  1TR2 A;  3LEO A;  4HFF B;  3EG9 B;  4W8P A;  5F5F A;  3HNI A;  4OIQ F;  1MMD A;  2R7O A;  4PFO A;  5A69 A;  5T3T A;  3GWL A;  4DBQ A;  4YT4 A;  3WHN A;  5KYX A;  4LDR A;  4MVQ A;  4HEA J;  1E84 A;  1SZI A;  1XZP A;  3JCU Q;  2M4E A;  1V54 C;  2W9Y A;  3TOL A;  3W8H A;  4YT8 A;  4JJG A;  4CS9 C;  5COG A;  2Y39 A;  2QNL A;  1YAR O;  3RFY A;  2VB6 A;  3DM9 B;  5CI9 A;  1G4W R;  4LDQ A;  4DOZ A;  1CPQ A;  1PD1 A;  1J8Y F;  1EI7 A;  3EH2 A;  4XPW A;  1BDJ B;  3DAG A;  4R32 A;  3UMH A;  2YWA A;  1A7E A;  4J7Y A;  5F5H A;  1Z6A A;  1YVI A;  4BEJ A;  5B1B C;  3I4U A;  3Q7L A;  2Q4F A;  2FFH A;  2P61 A;  4NCQ A;  1V55 C;  3T9O A;  3US6 A;  3WG7 C;  2KJG A;  1QPU A;  3JRT A;  2HMZ A;  1VYK A;  2ASR A;  2WB7 A;  1YLM A;  2Y3G A;  5HV9 A;  4O6N A;  1CPR A;  2LFD A;  1T01 A;  4P6I C;  2R02 A;  4AL0 A;  5A6B D;  2G3K A;  2D5R B;  3IQC A;  3M79 A;  2XLV A;  2UUH A;  1OXB A;  4JTC B;  3AG4 C;  5E3A A;  1O5H A;  1OCZ C;  4IRU A;  4ONS A;  5KYY A;  2R7W A;  1U89 A;  1UFB A;  2YQY A;  3ABM C;  3F47 A;  3Q6N A;  2Y3B A;  2QLA A;  5COF A;  3T6B A;  3ITF A;  4Q7C A;  3U3B A;  3ZG1 A;  4BJ6 A;  4YL0 A;  4CX9 A;  3C8Z A;  4JTA B;  4WGZ A;  4CS8 A;  1G8X A;  2NG1 A;  3C63 A;  1Q0K A;  4DRI B;  3TK0 A;  3TQO A;  4DVZ A;  4BJ5 C;  1QVX A;  4CDV A;  5JP7 A;  3IQT A;  4CBE A;  3LJB A;  1YZA A;  2L6F A;  3L8J A;  5EHH A;  1YAU O;  2OJE D;  2R7Q A;  2WL8 A;  4U9E A;  4K7B A;  1YYX A;  4CIP A;  3UGP A;  1KTM A;  4QI0 A;  4G7O F;  2J9B A;  2LD6 A;  1RJ9 A;  2JD3 A;  3MYF A;  4JCZ A;  4MW3 A;  4D4X A;  1R4T A;  1VB5 A;  3GM1 A;  3E9V A;  2BL2 A;  1W2W A;  4X0R A;  4XTK A;  3H2U A;  2FAP B;  1FFT C;  1JMW A;  1YA9 A;  3NRH A;  1K04 A;  1E85 A;  4CSA C;  3VF0 A;  4CS9 A;  5DS5 A;  3AOU A;  3JSZ A;  1HW2 A;  3GOD A;  3W8I A;  1TWA A;  3RKO F;  3VM6 A;  2F22 A;  4J7T A;  4A4A A;  4BG0 A;  4JIO A;  2ICW G;  2HJ3 A;  2EPN A;  4XEF A;  4Q5S F;  2JX0 A;  2R7R A;  2LSE A;  4FX5 A;  3ZIB A;  5BQG A;  5DVW A;  2R25 A;  3NYJ A;  4IAR A;  4N6H A;  4WGY A;  1NFO A;  2OKU A;  3K6B A;  4LDK A;  3ZWI A;  3QVZ A;  5A6A A;  3TUL A;  3LES A;  2L9J A;  2YL0 A;  5TJ5 E;  3B0V C;  2KW3 C;  5DQT A;  3DWW A;  1OCO C;  4PJM A;  2EIK C;  2NUP A;  3GEI A;  4K0D A;  3EPV A;  4P9T A;  4YWQ A;  1F1M A;  3NKD A;  1Z7Q c;  2AP3 A;  3BRJ A;  2H7B A;  3U8V A;  4AX2 A;  2Q9A A;  3RQE A;  2VCB A;  3ZQV A;  1RXQ A;  3NDB B;  3U2L A;  2HV7 A;  4EBJ A;  4MVO A;  4MS2 A;  1H6G A;  2YEV A;  1Q0F A;  1QKR A;  4GYT A;  1ZU5 A;  3UNG C;  2J45 A;  3RVY A;  4DXW A;  2WZG A;  4MTG A;  5CI8 A;  4KBL A;  5JUA A;  1I4Y A;  2ZPA A;  3AG3 C;  2AWY A;  2UUI A;  2A68 F;  2LK4 A;  1LI5 A;  2YHS A;  2PP4 A;  2J8W A;  3F46 A;  1T5O A;  2B0J A;  2W4B A;  4BJ5 A;  3U0C A;  3UR3 C;  3CZ6 A;  4JEA A;  5KYU B;  3GM2 A;  5K0I A;  2XLH A;  1FNT c;  3V5Z A;  3C8G D;  4C7O B;  5L0I A;  2J0X A;  3JRM O;  3PHF 2;  3EZI A;  4LAC B;  3HNJ A;  1ORS C;  1TKN A;  3EH1 A;  2KSF A;  3JSE O;  5F28 E;  2CCY A;  4XPY A;  3DD7 A;  1C02 A;  1XWJ A;  2AWC A;  1VTM P;  5L0G A;  2GDC A;  4ULW A;  4N4W A;  4G0H A;  3JYY A;  3K66 A;  4LER A;  3EJN A;  1QSP A;  3SZR A;  3N0T A;  3K1I C;  3SXY A;  4QDL A;  3DE9 A;  4N6C A;  4CSA A;  3N2Z B;  2G3V A;  5HSW A;  1SF8 A;  3RVZ A;  3QTH A;  4D4N A;  4NC3 A;  5B3S C;  2Z15 A;  3M15 A;  4H54 A;  2LFF A;  2A69 F;  3G4Z A;  3MX3 A;  4I44 A;  1A7V A;  4NY3 A;  5KYW B;  2IXO A;  4NTF A;  4LLC A;  4U5C E;  5DS6 A;  2R7T A;  3SEO A;  4PJN A;  4DVY P;  3SXZ A;  3MYI A;  3C8G A;  1RCP A;  2R03 A;  4OIO F;  3MBG A;  3PDM P;  2HJM A;  3C7J A;  4Z9J A;  1CGO A;  3ZC4 A;  3RF3 A;  2P0N A;  4M63 A;  1KNY A;  4N06 A;  1FR0 A;  3KYJ A;  4PK4 A;  4DJ9 A;  2XLO A;  3CAX A;  3B9Q A;  4MVZ A;  1RMV A;  1V4A A;  3MLG A;  1FMW A;  1ORY A;  4PAC A;  3EGX B;  4YK5 A;  4Z9H A;  3RW0 A;  5AC4 A;  4G7H F;  2XS8 A;  1GGQ A;  1T6U A;  2KNH A;  3CEX A;  4JUR I;  1TFK B;  2HKV A;  5JLI A;  2C04 A;  3IPM O;  1T9K A;  3WAQ A;  3LS0 A;  2RSE B;  4BJ1 A;  1JOG A;  1OW6 A;  1VMA A;  4RDA A;  2NUT B;  3SYN A;  2XS1 A;  3DMD A;  5AGF A;  5EK0 A;  1T6Q A;  4AE4 B;  256B A;  4UDV A;  4KC9 A;  4E7Z A;  3K1H A;  2J0W A;  4U5B E;  2HSQ A;  4AK9 A;  1PV3 A;  3EHM A;  4LLE A;  1NBB A;  3RQF A;  1WTY A;  2YZS A;  1MMN A;  2AVK A;  3M1C B;  2QUP A;  2J7P D;  3KMI A;  4YT5 A;  1D0Y A;  4CIH A;  4XQ1 A;  1ZHY A;  4EHP A;  4IJJ A;  4FWV A;  1NZE A;  4FAP B;  4E0I A;  1OXK A;  4U5F E;  1C03 A;  3PMR A;  1AEP A;  1ZU4 A;  3A11 A;  3FHD A;  3JYH A;  4B6I A;  1VLS A;  3K1I A;  3EGD A;  3POV A;  1MQV A;  1Q0G A;  2H7V C;  5KYU A;  3HNL A;  1TWH A;  3DE8 A;  3L8I A;  4E0H A;  3EFO A;  2XLE A;  5E33 A;  5JS5 A;  1WWP A;  4K1O A;  1WAT A;  3LNM B;  2VCA A;  3WOD F;  1LE2 A;  4MND A;  2YL3 A;  4XLP F;  4PFP A;  3BEH A;  4JW1 A;  2Q7R A;  3VRC A;  1RKE B;  4JC7 A;  4KI2 A;  4MTO A;  5B3I A;  1KU2 A;  2IXM A;  1OW8 A;  3HNK A;  1FMV A;  4C3B A;  4U5G A;  3FOP A;  4CJO A;  1G5Z A;  1IW7 F;  1PCX A;  3NKE A;  2Q9C A;  2WZF A;  2L7A A;  3U8P A;  5BUO A;  1M56 C;  2EPM X;  4E17 A;  3M4B A;  4AL1 A;  2P1A A;  1ORJ A;  3C62 A; 
#chains in the Genus database with same CATH homology
 2J7P A;  2XXA B;  2PF4 E;  2KQ9 A;  1MMA A;  3CQZ A;  3DAF A;  3NYL A;  2IYL D;  3EG9 A;  2X51 A;  4ANJ A;  3HTK C;  1D0Z A;  3T6J A;  3DJU B;  2IXN A;  4JVS A;  2MYS A;  2KGO A;  2EIL C;  3AQC A;  3RIP A;  3O39 A;  2G62 A;  3QZC A;  2A1D D;  3ZVR A;  1BR1 A;  1ZHZ A;  3AG2 C;  5FCL A;  5KYX B;  3NG1 A;  4EBB A;  3ABK C;  4U5H A;  2Q9B A;  2CGE A;  4I1O B;  3ASN C;  4ZLC A;  3ECS A;  1NU7 D;  2QTV A;  2Y3H A;  4RD9 A;  3GAN A;  3OEO A;  3LEV A;  5DLJ A;  4OIR F;  3SNH A;  2C03 A;  2P6V A;  3QMK A;  2V26 A;  5T3W A;  1M57 C;  2I8B A;  2Y3D A;  4FES A;  3LNR A;  2L81 A;  4J30 B;  4YN0 B;  3AG1 C;  2CNW D;  4W8K A;  4EWC A;  4H4K C;  3S29 A;  4O6M A;  3RH3 A;  4PJL A;  1Z5Z A;  5KYY B;  3FDQ A;  4IWB A;  2R7U A;  2GFH A;  2H7O A;  3DXJ F;  2PFD A;  1OCR C;  4GEH A;  3LS1 A;  2R7V A;  1N1C A;  3K33 A;  2MWQ A;  2PX3 A;  3W2V A;  2J9V A;  1M2O A;  3OA1 A;  2CW0 F;  2DYS C;  2P7V A;  2E87 A;  2WVO A;  2CDQ A;  1TWC A;  2A6E F;  1ZHW A;  3EHN A;  4Q4Z F;  2Y69 C;  1RJ9 B;  3FVY A;  2A6H F;  4C3D A;  5DQZ A;  4F4B A;  1FFH A;  4HFK B;  3O6X A;  3TD7 A;  1VYI A;  4O79 A;  4DBR A;  1D1A A;  4QI2 A;  3CSK A;  3T4R A;  1MNE A;  5B1A C;  4G7Z F;  3HJC A;  1S7Z A;  2W45 A;  1Z63 A;  1LKX A;  1IZM A;  3IEE A;  1NU9 C;  1Z3I X;  4O6Y A;  3S0X A;  2J9W A;  1LVK A;  3KH2 A;  2BE5 F;  2OCC C;  3B0P A;  2O9X A;  1ZHX A;  3X2Q C;  2R7X A;  5D92 A;  4C3E A;  2NUP B;  3DZA A;  3EQL F;  4U5D E;  4JZA A;  1BR4 A;  3UMI A;  4WJ0 A;  4KNW A;  4IAO A;  1JPN A;  3KKB A;  3VYW A;  2WVQ A;  3JT1 A;  2EIN C;  2DGJ A;  1O87 A;  4C7O A;  3Q6M A;  5L3V A;  1M2V B;  3ABL C;  3LAY A;  3X1O A;  1BR2 A;  5E2Q A;  3LLK A;  1OKK D;  2DYR C;  4XWJ A;  4MQ9 F;  1QLE C;  4JJF A;  5E3C A;  3EZH A;  5KYN A;  3I5Q A;  1VOM A;  1D0X A;  2EIM C;  4E7S A;  5KYW A;  5EGY A;  2ZXO A;  2W4M A;  3UGO A;  2ZXR A;  2Q3T A;  1JPJ A;  2IOQ A;  3L0I A;  3SP1 A;  5T1D B;  3I5P A;  3FAJ A;  2XL4 A;  3E70 C;  3VAY A;  5DS4 A;  4PJJ A;  4O7G A;  3K7D A;  3EGX A;  2QY9 A;  4I3M A;  1OKK A;  1ST6 A;  4J32 B;  2XRH A;  3OWT A;  4JCH A;  2WVN A;  2NUT A;  4YT2 A;  4ZLD A;  2R7S A;  1VK5 A;  4OIN F;  4AE4 A;  2VAS A;  1PD0 A;  2PX0 A;  2HV6 A;  1MMG A;  1ZYR F;  3Q7G A;  4OD4 A;  5IY5 C;  2VH3 A;  3W2W A;  3DJN B;  1OCC C;  2FGY A;  1ZHT A;  1QZX A;  2IXP A;  2OG2 A;  3NYM A;  4OIP F;  1D1B A;  2J46 A;  1WGW A;  3UMK A;  3B0U X;  4CS7 A;  3S28 A;  3ASO C;  5L3Q A;  2WZL A;  3N24 A;  1M2V A;  2ZXW C;  4XLN F;  3EGD B;  3LLI A;  3AQB A;  2XSE A;  3ZSU A;  1MND A;  3EFO B;  1Z23 A;  2J9U A;  5D91 A;  1LS1 A;  4HE8 D;  1FTS A;  2EIJ C;  4BJ6 C;  3KL4 A;  4A2N B;  4CS8 C;  2CNW A;  3DM5 A;  4I1M A;  3S27 A;  4OD5 A;  4BJT A;  2V3C C;  2XXA A;  4U5E E;  3L34 A;  3RYL A;  1SMY F;  1J8M F;  2ZXP A;  1NG1 A;  3H65 A;  3HLZ A;  4YJW A;  1D1C A;  3V7O A;  4KNV A;  4RBN A;  1TWG A;  1TR2 A;  5F5F A;  4HFF B;  3EG9 B;  4OIQ F;  1MMD A;  2R7O A;  4PFO A;  5T3T A;  4DBQ A;  4YT4 A;  5KYX A;  4HEA J;  1SZI A;  3JCU Q;  2M4E A;  1V54 C;  2W9Y A;  4YT8 A;  3W8H A;  4JJG A;  4CS9 C;  2Y39 A;  3RFY A;  2VB6 A;  3DM9 B;  5CI9 A;  4DOZ A;  1PD1 A;  1J8Y F;  3EH2 A;  3DAG A;  3UMH A;  5F5H A;  1Z6A A;  4BEJ A;  5B1B C;  3I4U A;  3Q7L A;  2FFH A;  1V55 C;  3WG7 C;  2KJG A;  3JRT A;  1VYK A;  2WB7 A;  2Y3G A;  4O6N A;  4P6I C;  2G3K A;  2D5R B;  5KYY A;  3AG4 C;  5E3A A;  1O5H A;  1OCZ C;  4IRU A;  2R7W A;  3Q6N A;  3ABM C;  3F47 A;  3T6B A;  2Y3B A;  3ITF A;  4Q7C A;  3ZG1 A;  4BJ6 A;  4CS8 A;  1G8X A;  2NG1 A;  4DVZ A;  4BJ5 C;  4CBE A;  3LJB A;  5EHH A;  2R7Q A;  2WL8 A;  4K7B A;  3UGP A;  4QI0 A;  4G7O F;  1RJ9 A;  2JD3 A;  3E9V A;  4X0R A;  1W2W A;  1FFT C;  3NRH A;  4CSA C;  4CS9 A;  5DS5 A;  3JSZ A;  3GOD A;  3W8I A;  1TWA A;  3RKO F;  4BG0 A;  4Q5S F;  2R7R A;  2LSE A;  4FX5 A;  3ZIB A;  5DVW A;  3NYJ A;  3K6B A;  3LES A;  2L9J A;  3B0V C;  2KW3 C;  5DQT A;  1OCO C;  4PJM A;  2EIK C;  2NUP A;  4K0D A;  3EPV A;  4YWQ A;  3NKD A;  2H7B A;  4AX2 A;  2Q9A A;  3NDB B;  2HV7 A;  2YEV A;  4GYT A;  3UNG C;  1ZU5 A;  2J45 A;  2WZG A;  5CI8 A;  4KBL A;  2ZPA A;  3AG3 C;  2A68 F;  3F46 A;  2YHS A;  2PP4 A;  2B0J A;  2W4B A;  4BJ5 A;  3UR3 C;  3CZ6 A;  5KYU B;  4C7O B;  2J0X A;  3PHF 2;  3EZI A;  4LAC B;  1TKN A;  3EH1 A;  3DD7 A;  4ULW A;  4G0H A;  3K66 A;  4LER A;  3EJN A;  3SZR A;  3N0T A;  3K1I C;  4QDL A;  4CSA A;  3N2Z B;  2G3V A;  5HSW A;  1SF8 A;  5B3S C;  2Z15 A;  2A69 F;  3MX3 A;  4I44 A;  4NY3 A;  5KYW B;  2IXO A;  4LLC A;  4U5C E;  5DS6 A;  2R7T A;  3SEO A;  4PJN A;  4DVY P;  4OIO F;  3ZC4 A;  4M63 A;  4N06 A;  4PK4 A;  3B9Q A;  3MLG A;  1FMW A;  3EGX B;  4G7H F;  2KNH A;  4JUR I;  2C04 A;  3LS0 A;  4BJ1 A;  1VMA A;  4RDA A;  2NUT B;  3SYN A;  3DMD A;  4AE4 B;  4KC9 A;  4E7Z A;  3K1H A;  2J0W A;  4U5B E;  4AK9 A;  3EHM A;  4LLE A;  2YZS A;  1MMN A;  3M1C B;  3KMI A;  2J7P D;  4YT5 A;  1D0Y A;  4CIH A;  1ZHY A;  4IJJ A;  4FWV A;  1NZE A;  4U5F E;  4B6I A;  3PMR A;  1ZU4 A;  3FHD A;  3JYH A;  3EGD A;  3POV A;  2H7V C;  5KYU A;  1TWH A;  3EFO A;  5E33 A;  3WOD F;  4MND A;  4XLP F;  4PFP A;  4JW1 A;  4KI2 A;  1KU2 A;  2IXM A;  1FMV A;  4C3B A;  4U5G A;  1IW7 F;  1PCX A;  3NKE A;  2Q9C A;  2WZF A;  5BUO A;  1M56 C;  4XTK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...