3DJUB

Crystal structure of human btg2
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
121
structure length
121
Chain Sequence
TDMLPEIAAAVGFLSSLLRTRGCVSEQRLKVFSGALQEALTEHYKHHWFPEKPSKGSGYRCIRINHKMDPIISRVASQIGLSQPQLHQLLPSELTLWVDPYEVSYRIGEDGSICVLYEEAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Protein BTG2
publication title Crystal structures of human BTG2 and mouse TIS21 involved in suppression of CAF1 deadenylase activity
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2008-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07742 BTG BTG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1120 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3djuB00
2D5RB 3DJNB 3E9VA 5CI8A 5CI9A 3DJUB 2Z15A
chains in the Genus database with same CATH superfamily
1FNTc 3AGTA 4O6YA 3S84A 1M2VB 2NG1A 3LNRA 4LDQA 4YL0A 1OW6A 3DKAA 3HNLA 2NSFA 5HV9A 4BJ1A 2J9UA 3M15A 3NYMA 4J7TA 3X2QC 4BJ5A 2QTVA 1G8XA 2W4BA 3TK0A 2L7AA 2AVKA 3R2PA 4F4BA 1NU9C 2WB7A 3ZQVA 3M4BA 2PNOA 1APCA 4WABA 4YT2A 5KYYA 2IOQA 1YLMA 4RBNA 4CDYA 2W4MA 2YEVA 1MMDA 3L1MA 3L8JA 3DAFA 2VCCA 4I44A 1I5NA 1V4AA 4PJLA 3V5YA 4CS9C 1C02A 4GEHA 2L6FA 4U5GA 3GM2A 4J32B 1XZQA 4JZAA 3TD7A 1XZPA 3VYWA 2YLDA 1RCPA 2L81A 3RH3A 2XS1A 1C03A 3NRHA 1VK5A 3I5QA 2A6HF 4QI2A 2Z15A 4EBKA 2EIKC 3ZQYA 3T6GB 1HE1A 5KYWA 1GGQA 1TWCA 4E7ZA 4EWCA 4XLPF 1O5HA 4CS8A 5T3TA 4E7SA 4PJMA 1OCOC 2X0CA 1HMDA 1OKKD 2PX3A 2R9RB 3EG9A 4MVOA 2Y3DA 5B1BC 3VM6A 4AX2A 2W9YA 1EKYA 3U9MA 2TMVP 5A69A 1UG7A 3S27A 2XL8A 3ZDLA 4KNVA 2JX0A 2LD6A 1CGNA 1TWHA 3M1CB 4CJGA 3RVZA 1Z63A 1D0XA 2XL4A 2YLGA 3JRMO 4N06A 2HMQA 4U9EA 2IXNA 4JCZA 3JZ0A 4EBBA 4O7GA 3UGOA 2C04A 2XM0A 4YL3A 2NUTB 4I1OB 3W8IA 4JRZA 4E17A 2EILC 2J9VA 5BUOA 4CDAA 3VF0A 1HY5A 4XEVA 3ABKC 3AG1C 3QW0A 3U8PA 1NFOA 2DYSC 3CSKA 1OKKA 5DLJA 2J7PD 4JCHA 3AJMA 2PX0A 4ULVA 2HFIA 4X0RA 3AGUA 1EA8A 2J46A 4XQ1A 4DRHB 4JEAA 1QKRA 1RMVA 1JAFA 5DQTA 5DVWA 3U3BA 1WATA 5F28E 1JPNA 1ORJA 2BL2A 2MYSA 3HJCA 2FGYA 1J8MF 3U8VA 5A6JA 1VLTA 5A6KA 1WWPA 5JVEA 2CDQA 2CCYA 2J45A 4LACB 4JTDB 3DJNB 1T5OA 1EQ1A 2VH3A 1YJGA 4EUKB 5CI8A 1G4WR 3T4RA 1ZHXA 4KNWA 1A0BA 1D1AA 2EPNA 3K1IA 3RYLA 2GA0A 3UMHA 1YZAA 3ASOC 2Y3BA 3G4XA 4IAQA 2H7VC 2M64A 4JJGA 1NU7D 3OWTA 1VYIA 2J7PA 2FAPB 1KNYA 4HE8D 1TR2A 4BJ5C 4EBJA 1AEPA 2G62A 3FHDA 2MHRA 3JTLO 1K40A 1I4ZA 3MBGA 4PFOA 4B6IA 4IJJA 4ZLCA 2CNWD 2XSEA 4AE4B 1NZEA 2YZSA 4K7BA 4OD5A 4CDVA 2NUTA 3LEVA 4CSAA 5L0HA 3E70C 3QTHA 1ZYRF 2Q9AA 4PK4A 4R32A 4MVMA 1RXQA 3FOOA 3LAYA 3S28A 1Z3IX 4YJWA 3ZC4A 1TWAA 2H7OA 3LEOA 5CIVA 2PBEA 3W2WA 3EFOB 3ABLC 3AQBA 4E0IA 5D91A 2HKVA 1MNDA 3JYYA 4IB4A 5COMA 4YK5A 1H9GA 5AC4A 1W2WA 2PFDA 3FAPB 4E18A 4C7OB 3ABMC 3CZ6A 4P9TA 1NSGB 1RJ9B 3OA1A 1YA9A 4ER9A 4BJTA 2XLOA 1LE4A 2OEXA 2YLIA 2ZD9A 3EG9B 1D0ZA 2NSGA 3NMKA 3DAGA 1VTMP 3JT1A 2QE9A 4NQFA 3NDBB 5L0DA 3EJNA 1OR3A 2CNWA 1ZU5A 2XLEA 3JRTA 4NCQA 4YT5A 4IRUA 1LI7A 1JMWA 3O6XA 4H4KC 4NTAA 4O79A 3NYJA 1E83A 3EPVA 3AG4C 3ZG1A 4XTKA 1H7IA 1PD0A 2Q9BA 2AU5A 2D4UA 2M4EA 4PR9A 1QPUA 1OXBA 3CAXA 4U5CE 3MFNA 3ZVRA 5A6AA 1GS9A 4DRIB 5E33A 2A69F 1DOVA 5E3CA 1YDIA 4YT8A 2EPOA 5EHHA 5HSWA 4I3MA 4IARA 3S29A 2XRHA 4JURI 4JE9A 2DYRC 4EIYA 3RW0A 4KBLA 5DS6A 1T6UA 2R03A 3QVYA 3UNGC 4AE4A 1ZHZA 1EI7A 3ATPA 2VB6A 5T1DB 4DVZA 3IQ5A 1FR0A 2HUJA 3HNIA 4O6NA 2L6HA 3U9JA 3HTKC 1QLEC 1CGME 3UR3C 3RQFA 4Q4ZF 2Y3GA 1OW8A 3TULA 1OCZC 256BA 5T3WA 4QDLA 2OCCC 2R05A 1RKCA 1WASA 3AG3C 4BEMJ 3EFOA 1TFKB 1ZU4A 4OIQF 1ZHWA 3SXZA 4DXWA 4GYTA 2LSEA 4WGYA 2DGJA 3GWNA 3DM5A 3JCUQ 3L0IA 4C7OA 3EGXB 1TKNA 3SYNA 4E0HA 2P61A 1RJ9A 2KSFA 1ZW2A 4IAOA 4MW3A 4CJOA 4FAPB 5L3QA 3EQLF 4EHPA 3PMRA 3TJ5A 1E84A 1Z7Qc 1MMAA 2V3CC 2ICWG 5BQGA 1T9KA 3GODA 3IQCA 4LDKA 4MTGA 2HJMA 4PJJA 3VAYA 2XLVA 1E2XA 5COGA 3B29A 3DM9B 5B3IA 5JRAA 5B1AC 2AWCA 3G4ZA 4MS2A 2QUPA 4XLNF 3U5SA 5CI9A 1VB5A 3C7JA 4C3EA 2I15A 3RQGA 2HZ8A 2R02A 4U5HA 2R7RA 5FCLA 1M57C 4DRJB 1H6GA 3DI5A 1SF8A 3DXJF 3MYIA 4MVSA 3PHF2 2CYDA 1BR1A 1G4US 4BJ6A 2IYLD 3VRCA 3RIPA 2HV6A 2IXOA 3NG1A 3G50A 2KC3A 2EINC 1FAPB 1BR4A 4K1OA 3LS1A 1TFOB 3Q7GA 1HW2A 2EIJC 2QLAA 5D92A 1E85A 2G3VA 4P6IC 4WJ0A 2XLHA 1Q0MA 1VLSA 3JYHA 3K1HA 4AL0A 3WG7C 1N1CA 2R7XA 2MWQA 4OIOF 4U5BE 4U9DA 3A9CA 1FFTC 1ORSC 5FZTA 1K05A 2CW0F 3EGDA 4FWVA 4CX9A 2VASA 4HEAJ 3S9OA 3N0TA 1IZMA 1NBBA 3Q7LA 4XPYA 3H65A 1YA7O 1ZW3A 2KK1A 2VC9A 3FXHA 3ZSUA 4UDVA 2KGOA 1PV3A 2IXPA 1V55C 3EGXA 5L0IA 2Y69C 2YL3A 3KL4A 4G0HA 5KYUB 1KTMA 2OU6A 2IM8A 3RVYA 1M2OA 1U6HA 4Q7CA 2W45A 1M56C 4XEFA 1LS1A 2NUPB 3KH2A 5AC5A 1D0YA 4JJFA 3RF3A 3OEOA 1FMWA 2WZLA 2C03A 3HKKA 3HNJA 3U2MA 2OKUA 5DS5A 3ECSA 2WL8A 4U5FE 3B71A 1Z5ZA 3EH2A 4RDAA 3RKOF 1ORYA 2QNLA 3CEXA 2P6VA 2RD9A 3CQZA 1LKXA 3KYJA 3L34A 4GQHA 4AK9A 4OD4A 1YAUO 3LUTB 4LLCA 4CS7A 4D4XA 5L0FA 4JIOA 4G7ZF 3C8GD 3IQ6A 4JVSA 1MMGA 1JRAA 1MNEA 1V74B 5BQHA 3HNKA 3IHUA 3KPHA 4A4AA 4LERA 5DS4A 1FFHA 4C3BA 3FMSA 2EIMC 3F46A 1AUEA 1FTSA 3C8ZA 3C63A 3DD7A 1C17M 3GM3A 3RFYA 2WVOA 5KYXB 2AWYA 3SNHA 1XWJA 1OQCA 2B0HA 5DQZA 3QZCA 2X51A 1CPRA 3K6BA 2H7BA 4IWBA 3POVA 1HE9A 4NTFA 2YL7A 3U3FA 4Z9JA 3EH1A 4O6MA 4HFKB 5JLIA 3QMKA 4LDRA 4XEKA 3LESA 4ONSA 5COFA 5JT4A 4MTOA 4CS8C 1QQ3A 3KYIA 2UUHA 3RQEA 3SZRA 3C8GA 4LLEA 3MYFA 1BBHA 3PDMP 2J0XA 3B0UX 3W4YA 2UUIA 5KYUA 3WAQA 2AP3A 5GPGB 1T6IA 2HS5A 4HFFB 3R7CA 2NUPA 1OXKA 4DOZA 1Y6DA 2EPMX 2R7QA 3Q6MA 3UGPA 3GEEA 5B3SC 2H8AA 2A1DD 3TOLA 3AQCA 2R7WA 4XWJA 1SR2A 3T6BA 1T01A 4YWQA 1B68A 4NY3A 1A7DA 2LP4A 1PCXA 4EKWA 4BEJA 2Q9CA 3O55A 5L0GA 2OQMA 3DMDA 1Q0DA 2KW3C 2XS8A 4MVUA 2A68F 3IEEA 2YL1A 3ZTZA 1A7VA 5A6BD 3BEHA 4G7HF 1LE2A 1HW1A 1Q0GA 2R7VA 1QSPA 1QVXA 1V54C 1GM5A 1BDJB 3GWLA 4P9FA 1R5ID 1JOGA 2PF4E 3LLIA 2Q4FA 2YL0A 2LK4A 3ZIBA 3SXMA 2GDCA 1RKEB 2IXMA 3LNMB 3EGDB 3Q6NA 4YN0B 5KYXA 1H9TA 5EK0A 1VMAA 3H2VA 3JSEO 3O39A 3WODF 1LS4A 2HMZA 1JPJA 2KNHA 4H54A 1ZHTA 5JS5A 4G7OF 3W8HA 4XPWA 3X1OA 3K33A 2ZXPA 2GFHA 2XXAB 4BPMA 5JP7A 3GM1A 1NG1A 2FFHA 2Y39A 1PD1A 4DJ9A 1TQGA 4W8PA 2ETSA 3DE9A 3K1IC 1MMNA 2J0WA 5E2QA 3J06A 2R7TA 5A6BA 4MTFA 4KI2A 2JPUA 2BC5A 2EPLX 3PCVA 4C3DA 3MX3A 4OINF 1ZVZA 1U0BB 1YYXA 1MQVA 2GWWA 4N4WA 2WVNA 3ZTMA 3FAJA 3O10A 2R7OA 3I5PA 3NMJA 1LI5A 4MQ9F 1F1MA 2ZPAA 2KQ9A 3C18A 3KKBA 4IGGA 3W2VA 2OEVA 2CGEA 2VCBA 4ZLDA 1FMVA 3LLKA 2V26A 2LFFA 3B0VC 4CIHA 3TOMA 2YKZA 3GANA 4J30B 4JTAB 5JUAA 4CSAC 4Q5SF 4U5DE 3C62A 5JSLA 4RD9A 1E86A 3T9OA 1NLXA 4NC3A 1OW7A 2R7SA 1LPEA 1GQAA 1ZHYA 1O87A 2J9WA 2R25A 1M2VA 2LQGA 3DWWA 3V5XA 4I1MA 2XL6A 4FESA 2ZXRA 4U5EE 1D1CA 3MLGA 3M4CA 4FX5A 5BQIA 1SMYF 2QY9A 1RKEA 1YZCA 1OCRC 1R4TA 3K7DA 1BZ4A 3L8IA 4G78A 5TJ5E 4JKVA 4MVRA 2I8BA 2J8WA 5F5HA 1CGOA 1IW7F 3M79A 1JR8A 3IPMO 4PJNA 3FDQA 2HV7A 3AG2C 2Q3TA 3C8GB 3EZIA 3QVZA 3JSZA 4MNDA 2P0NA 3T6JA 1OR2A 4DVYP 1WN0A 3UMKA 3NKDA 3ITFA 2XXAA 4N6CA 2VCAA 1LVKA 1LIHA 1SZIA 1S05A 1KU2A 1L7CA 3HLZA 3KMIA 4OIRF 4CS9A 2DI3A 2R7UA 4CBEA 2WZFA 2PP4A 2G3KA 4MVQA 3S90A 1CPQA 1VYKA 1Y4CA 2NPUA 1VOMA 2A0BA 2E87A 1TWGA 2P7VA 2ZXOA 4XPXA 2L9JA 4Z9IA 5EGYA 4ANJA 3SEOA 5L0CA 2LCHA 1K04A 2L6GA 2YWAA 2RSEB 1ST6A 3ASNC 1O3UA 2OG2A 3IQTA 4ULWA 3SXKA 3US6A 1YVIA 1Q0KA 3EHNA 3DZAA 2F22A 4KC9A 3EZHA 5E3AA 4MW8A 2A0UA 4W8KA 3NMIA 3SXYA 1T6QA 3GEHA 5K0IA 1M6TA 1WOLA 3DJUB 3H2UA 3GEIA 1L3PA 3B9QA 5L0JA 3LS0A 2YQYA 2HSBA 4AL1A 2KYHA 1WGWA 5AGFA 4YL1A 3TJ6A 3WHNA 2B0JA 4JC7A 2ZXWC 4N6HA 4BG0A 5KYNA 3V7OA 4JEBA 2YHSA 3U0CA 2OJED 4J7YA 1BR2A 1ZZPA 3A11A 1Z6AA 2Q00A 2Q7RA 2GAQA 2XLDA 2ASRA 2HJ3A 1Q0FA 2WVQA 4YT4A 2XLWA 3ZWIA 3I4UA 5KYYB 4CIPA 5F5FA 2OJQA 5IY5C 3NYLA 3UMIA 3B0PA 3F47A 1WTYA 1U89A 1NFNA 2YRFA 4PACA 4D4NA 3FVYA 1LM3B 1G5ZA 1YARO 3NKEA 1DOWA 3LJBA 4NTBA 3V5ZA 2LIGA 1J8YF 1A7EA 2OOCA 4L6RA 3K66A 3U2LA 1HMOA 2EPKX 2A6EF 2WZGA 2P1AA 4M63A 2D5RB 2DB4A 4DBRA 1D1BA 1QZXA 2JD3A 1I4YA 1OCCC 1Z23A 2KJGA 2LFDA 3DE8A 4WGZA 2BE5F 4K0DA 4A2NB 4DBQA 4Z9HA 3GORA 5KYWB 2O9XA 3TQOA 3E9VA 3QW1A 4PFPA 3FOPA 3S0XA 3AOUA 1UFBA 2HSQA 2IBFA 3N2ZB 4OIPF 3BRJA 4JTCB 3EHMA 4BJ6C 1YYJA 4JW1A 4MVZA 5L3VA 1S7ZA 2XM4A 2Y3HA 3SP1A 4QI0A 1A41A 2J9BA 2XLMA 2YVKA 1SYQA 3N24A 1AVOB
chains in the Genus database with same CATH topology
4O6YA 1M2VB 2NG1A 3LNRA 4BJ1A 2J9UA 3NYMA 3X2QC 4BJ5A 2QTVA 1G8XA 2W4BA 4F4BA 1NU9C 2WB7A 4YT2A 5KYYA 2IOQA 4RBNA 2W4MA 2YEVA 1MMDA 3DAFA 4I44A 4CS9C 4PJLA 4GEHA 4U5GA 4J32B 3TD7A 4JZAA 3VYWA 2L81A 3RH3A 3NRHA 1VK5A 3I5QA 2A6HF 4QI2A 2Z15A 2EIKC 5KYWA 1TWCA 4E7ZA 4EWCA 4XLPF 1O5HA 4CS8A 5T3TA 4E7SA 4PJMA 1OCOC 1OKKD 2PX3A 3EG9A 2Y3DA 5B1BC 4AX2A 2W9YA 3S27A 4KNVA 3M1CB 1TWHA 1Z63A 1D0XA 2XL4A 4N06A 2IXNA 4EBBA 4O7GA 3UGOA 2C04A 2NUTB 4I1OB 3W8IA 2EILC 2J9VA 5BUOA 3ABKC 3AG1C 2DYSC 3CSKA 1OKKA 5DLJA 2J7PD 4JCHA 2PX0A 4X0RA 2J46A 5DQTA 5DVWA 1JPNA 2MYSA 3HJCA 2FGYA 1J8MF 2CDQA 4LACB 2J45A 3DJNB 2VH3A 5CI8A 3T4RA 1ZHXA 4KNWA 1D1AA 3RYLA 3UMHA 3ASOC 2Y3BA 2H7VC 4JJGA 1NU7D 3OWTA 1VYIA 2J7PA 4HE8D 1TR2A 4BJ5C 2G62A 3FHDA 4B6IA 4PFOA 4ZLCA 4IJJA 2CNWD 2XSEA 4AE4B 1NZEA 2YZSA 4K7BA 4OD5A 2NUTA 3LEVA 4CSAA 3E70C 1ZYRF 2Q9AA 4PK4A 3S28A 3LAYA 1Z3IX 4YJWA 3ZC4A 1TWAA 2H7OA 3W2WA 3EFOB 3ABLC 3AQBA 5D91A 1MNDA 1W2WA 2PFDA 4C7OB 3ABMC 3CZ6A 3OA1A 1RJ9B 4BJTA 3EG9B 1D0ZA 3DAGA 3JT1A 3NDBB 3EJNA 2CNWA 1ZU5A 3JRTA 4YT5A 4IRUA 3O6XA 4H4KC 4O79A 3NYJA 3EPVA 3AG4C 3ZG1A 4XTKA 1PD0A 2Q9BA 2M4EA 3ZVRA 4U5CE 5E33A 2A69F 5E3CA 4YT8A 5EHHA 5HSWA 4I3MA 3S29A 2XRHA 4JURI 2DYRC 4KBLA 5DS6A 3UNGC 4AE4A 1ZHZA 4DVZA 5T1DB 2VB6A 4O6NA 3HTKC 1QLEC 3UR3C 4Q4ZF 2Y3GA 1OCZC 5T3WA 4QDLA 2OCCC 3AG3C 3EFOA 1ZU4A 4OIQF 1ZHWA 4GYTA 2LSEA 2DGJA 3DM5A 3JCUQ 3L0IA 4C7OA 3EGXB 1TKNA 3SYNA 1RJ9A 4IAOA 5L3QA 3EQLF 3PMRA 1MMAA 2V3CC 3GODA 4PJJA 3VAYA 3DM9B 5B1AC 4XLNF 5CI9A 4C3EA 4U5HA 2R7RA 5FCLA 1M57C 1SF8A 3DXJF 3PHF2 1BR1A 4BJ6A 2IYLD 3RIPA 2HV6A 2IXOA 3NG1A 2EINC 1BR4A 3LS1A 3Q7GA 2EIJC 5D92A 2G3VA 4P6IC 4WJ0A 3JYHA 3K1HA 3WG7C 1N1CA 2R7XA 2MWQA 4OIOF 4U5BE 1FFTC 3EGDA 2CW0F 4FWVA 2VASA 4HEAJ 3N0TA 1IZMA 3Q7LA 3H65A 3ZSUA 2KGOA 2IXPA 1V55C 3EGXA 2Y69C 3KL4A 4G0HA 5KYUB 1M2OA 4Q7CA 2W45A 1M56C 1LS1A 2NUPB 3KH2A 1D0YA 4JJFA 3OEOA 1FMWA 2WZLA 2C03A 5DS5A 3ECSA 2WL8A 4U5FE 1Z5ZA 3EH2A 4RDAA 3RKOF 3L34A 3CQZA 2P6VA 1LKXA 4AK9A 4CS7A 4OD4A 4G7ZF 4LLCA 4JVSA 1MMGA 1MNEA 4LERA 5DS4A 1FFHA 4C3BA 2EIMC 3F46A 1FTSA 3DD7A 3RFYA 2WVOA 5KYXB 3SNHA 5DQZA 3QZCA 2X51A 3K6BA 2H7BA 4IWBA 3POVA 3EH1A 4O6MA 4HFKB 3QMKA 3LESA 4CS8C 3SZRA 4LLEA 2J0XA 3B0UX 5KYUA 4HFFB 2NUPA 4DOZA 2R7QA 3Q6MA 3UGPA 5B3SC 2A1DD 3AQCA 2R7WA 4XWJA 3T6BA 4YWQA 4NY3A 1PCXA 4BEJA 2Q9CA 3DMDA 2KW3C 2A68F 3IEEA 4G7HF 2R7VA 1V54C 2PF4E 3LLIA 3ZIBA 2IXMA 3Q6NA 3EGDB 4YN0B 5KYXA 1VMAA 3O39A 3WODF 1JPJA 2KNHA 1ZHTA 4G7OF 3W8HA 3X1OA 3K33A 2ZXPA 2GFHA 2XXAB 1NG1A 2FFHA 2Y39A 1PD1A 3K1IC 1MMNA 2J0WA 5E2QA 2R7TA 4KI2A 4C3DA 3MX3A 4OINF 2WVNA 3FAJA 2R7OA 3I5PA 4MQ9F 2ZPAA 2KQ9A 3KKBA 3W2VA 2CGEA 4ZLDA 1FMVA 3LLKA 2V26A 3B0VC 4CIHA 3GANA 4J30B 4Q5SF 4CSAC 4U5DE 4RD9A 2R7SA 1ZHYA 2J9WA 1O87A 1M2VA 4I1MA 4FESA 4U5EE 2ZXRA 1D1CA 3MLGA 4FX5A 1SMYF 2QY9A 3K7DA 1OCRC 2I8BA 5F5HA 1IW7F 3FDQA 4PJNA 2HV7A 3AG2C 2Q3TA 3EZIA 3T6JA 3JSZA 4MNDA 4DVYP 3UMKA 3NKDA 3ITFA 2XXAA 1LVKA 1SZIA 1KU2A 3HLZA 4OIRF 3KMIA 4CS9A 2R7UA 4CBEA 2WZFA 2PP4A 2G3KA 1VYKA 1VOMA 2E87A 2P7VA 1TWGA 5EGYA 2ZXOA 2L9JA 4ANJA 3SEOA 3ASNC 1ST6A 4ULWA 2OG2A 3EHNA 3DZAA 4KC9A 3EZHA 5E3AA 4W8KA 3DJUB 3B9QA 3LS0A 1WGWA 5KYNA 2B0JA 2ZXWC 4BG0A 3V7OA 2YHSA 1BR2A 1Z6AA 2WVQA 4YT4A 5KYYB 3I4UA 5F5FA 5IY5C 3NYLA 3UMIA 3B0PA 3F47A 3FVYA 3NKEA 3LJBA 1J8YF 3K66A 2A6EF 2WZGA 4M63A 2D5RB 4DBRA 1D1BA 1QZXA 2JD3A 1OCCC 1Z23A 2KJGA 2BE5F 4K0DA 4A2NB 4DBQA 5KYWB 2O9XA 3E9VA 4PFPA 3S0XA 3N2ZB 4OIPF 3EHMA 4BJ6C 4JW1A 5L3VA 1S7ZA 2Y3HA 3SP1A 4QI0A 3N24A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D5R B;  3DJN B;  3E9V A;  5CI8 A;  5CI9 A;  3DJU B;  2Z15 A; 
#chains in the Genus database with same CATH topology
 1FNT c;  3AGT A;  4O6Y A;  3S84 A;  1M2V B;  2NG1 A;  3LNR A;  4LDQ A;  4YL0 A;  1OW6 A;  3DKA A;  3HNL A;  2NSF A;  5HV9 A;  4BJ1 A;  2J9U A;  3M15 A;  3NYM A;  4J7T A;  3X2Q C;  4BJ5 A;  2QTV A;  1G8X A;  2W4B A;  3TK0 A;  2L7A A;  2AVK A;  3R2P A;  4F4B A;  1NU9 C;  2WB7 A;  3ZQV A;  3M4B A;  2PNO A;  1APC A;  4WAB A;  4YT2 A;  5KYY A;  2IOQ A;  1YLM A;  4RBN A;  4CDY A;  2W4M A;  2YEV A;  1MMD A;  3L1M A;  3L8J A;  3DAF A;  2VCC A;  4I44 A;  1I5N A;  1V4A A;  4PJL A;  3V5Y A;  4CS9 C;  1C02 A;  4GEH A;  2L6F A;  4U5G A;  3GM2 A;  4J32 B;  1XZQ A;  4JZA A;  3TD7 A;  1XZP A;  3VYW A;  2YLD A;  1RCP A;  2L81 A;  3RH3 A;  2XS1 A;  1C03 A;  3NRH A;  1VK5 A;  3I5Q A;  2A6H F;  4QI2 A;  2Z15 A;  4EBK A;  2EIK C;  3ZQY A;  3T6G B;  1HE1 A;  5KYW A;  1GGQ A;  1TWC A;  4E7Z A;  4EWC A;  4XLP F;  1O5H A;  4CS8 A;  5T3T A;  4E7S A;  4PJM A;  1OCO C;  2X0C A;  1HMD A;  1OKK D;  2PX3 A;  2R9R B;  3EG9 A;  4MVO A;  2Y3D A;  5B1B C;  3VM6 A;  4AX2 A;  2W9Y A;  1EKY A;  3U9M A;  2TMV P;  5A69 A;  1UG7 A;  3S27 A;  2XL8 A;  3ZDL A;  4KNV A;  2JX0 A;  2LD6 A;  1CGN A;  1TWH A;  3M1C B;  4CJG A;  3RVZ A;  1Z63 A;  1D0X A;  2XL4 A;  2YLG A;  3JRM O;  4N06 A;  2HMQ A;  4U9E A;  2IXN A;  4JCZ A;  3JZ0 A;  4EBB A;  4O7G A;  3UGO A;  2C04 A;  2XM0 A;  4YL3 A;  2NUT B;  4I1O B;  3W8I A;  4JRZ A;  4E17 A;  2EIL C;  2J9V A;  5BUO A;  4CDA A;  3VF0 A;  1HY5 A;  4XEV A;  3ABK C;  3AG1 C;  3QW0 A;  3U8P A;  1NFO A;  2DYS C;  3CSK A;  1OKK A;  5DLJ A;  2J7P D;  4JCH A;  3AJM A;  2PX0 A;  4ULV A;  2HFI A;  4X0R A;  3AGU A;  1EA8 A;  2J46 A;  4XQ1 A;  4DRH B;  4JEA A;  1QKR A;  1RMV A;  1JAF A;  5DQT A;  5DVW A;  3U3B A;  1WAT A;  5F28 E;  1JPN A;  1ORJ A;  2BL2 A;  2MYS A;  3HJC A;  2FGY A;  1J8M F;  3U8V A;  5A6J A;  1VLT A;  5A6K A;  1WWP A;  5JVE A;  2CDQ A;  2CCY A;  2J45 A;  4LAC B;  4JTD B;  3DJN B;  1T5O A;  1EQ1 A;  2VH3 A;  1YJG A;  4EUK B;  5CI8 A;  1G4W R;  3T4R A;  1ZHX A;  4KNW A;  1A0B A;  1D1A A;  2EPN A;  3K1I A;  3RYL A;  2GA0 A;  3UMH A;  1YZA A;  3ASO C;  2Y3B A;  3G4X A;  4IAQ A;  2H7V C;  2M64 A;  4JJG A;  1NU7 D;  3OWT A;  1VYI A;  2J7P A;  2FAP B;  1KNY A;  4HE8 D;  1TR2 A;  4BJ5 C;  4EBJ A;  1AEP A;  2G62 A;  3FHD A;  2MHR A;  3JTL O;  1K40 A;  1I4Z A;  3MBG A;  4PFO A;  4B6I A;  4IJJ A;  4ZLC A;  2CNW D;  2XSE A;  4AE4 B;  1NZE A;  2YZS A;  4K7B A;  4OD5 A;  4CDV A;  2NUT A;  3LEV A;  4CSA A;  5L0H A;  3E70 C;  3QTH A;  1ZYR F;  2Q9A A;  4PK4 A;  4R32 A;  4MVM A;  1RXQ A;  3FOO A;  3LAY A;  3S28 A;  1Z3I X;  4YJW A;  3ZC4 A;  1TWA A;  2H7O A;  3LEO A;  5CIV A;  2PBE A;  3W2W A;  3EFO B;  3ABL C;  3AQB A;  4E0I A;  5D91 A;  2HKV A;  1MND A;  3JYY A;  4IB4 A;  5COM A;  4YK5 A;  1H9G A;  5AC4 A;  1W2W A;  2PFD A;  3FAP B;  4E18 A;  4C7O B;  3ABM C;  3CZ6 A;  4P9T A;  1NSG B;  1RJ9 B;  3OA1 A;  1YA9 A;  4ER9 A;  4BJT A;  2XLO A;  1LE4 A;  2OEX A;  2YLI A;  2ZD9 A;  3EG9 B;  1D0Z A;  2NSG A;  3NMK A;  3DAG A;  1VTM P;  3JT1 A;  2QE9 A;  4NQF A;  3NDB B;  5L0D A;  3EJN A;  1OR3 A;  2CNW A;  1ZU5 A;  2XLE A;  3JRT A;  4NCQ A;  4YT5 A;  4IRU A;  1LI7 A;  1JMW A;  3O6X A;  4H4K C;  4NTA A;  4O79 A;  3NYJ A;  1E83 A;  3EPV A;  3AG4 C;  3ZG1 A;  4XTK A;  1H7I A;  1PD0 A;  2Q9B A;  2AU5 A;  2D4U A;  2M4E A;  4PR9 A;  1QPU A;  1OXB A;  3CAX A;  4U5C E;  3MFN A;  3ZVR A;  5A6A A;  1GS9 A;  4DRI B;  5E33 A;  2A69 F;  1DOV A;  5E3C A;  1YDI A;  4YT8 A;  2EPO A;  5EHH A;  5HSW A;  4I3M A;  4IAR A;  3S29 A;  2XRH A;  4JUR I;  4JE9 A;  2DYR C;  4EIY A;  3RW0 A;  4KBL A;  5DS6 A;  1T6U A;  2R03 A;  3QVY A;  3UNG C;  4AE4 A;  1ZHZ A;  1EI7 A;  3ATP A;  2VB6 A;  5T1D B;  4DVZ A;  3IQ5 A;  1FR0 A;  2HUJ A;  3HNI A;  4O6N A;  2L6H A;  3U9J A;  3HTK C;  1QLE C;  1CGM E;  3UR3 C;  3RQF A;  4Q4Z F;  2Y3G A;  1OW8 A;  3TUL A;  1OCZ C;  256B A;  5T3W A;  4QDL A;  2OCC C;  2R05 A;  1RKC A;  1WAS A;  3AG3 C;  4BEM J;  3EFO A;  1TFK B;  1ZU4 A;  4OIQ F;  1ZHW A;  3SXZ A;  4DXW A;  4GYT A;  2LSE A;  4WGY A;  2DGJ A;  3GWN A;  3DM5 A;  3JCU Q;  3L0I A;  4C7O A;  3EGX B;  1TKN A;  3SYN A;  4E0H A;  2P61 A;  1RJ9 A;  2KSF A;  1ZW2 A;  4IAO A;  4MW3 A;  4CJO A;  4FAP B;  5L3Q A;  3EQL F;  4EHP A;  3PMR A;  3TJ5 A;  1E84 A;  1Z7Q c;  1MMA A;  2V3C C;  2ICW G;  5BQG A;  1T9K A;  3GOD A;  3IQC A;  4LDK A;  4MTG A;  2HJM A;  4PJJ A;  3VAY A;  2XLV A;  1E2X A;  5COG A;  3B29 A;  3DM9 B;  5B3I A;  5JRA A;  5B1A C;  2AWC A;  3G4Z A;  4MS2 A;  2QUP A;  4XLN F;  3U5S A;  5CI9 A;  1VB5 A;  3C7J A;  4C3E A;  2I15 A;  3RQG A;  2HZ8 A;  2R02 A;  4U5H A;  2R7R A;  5FCL A;  1M57 C;  4DRJ B;  1H6G A;  3DI5 A;  1SF8 A;  3DXJ F;  3MYI A;  4MVS A;  3PHF 2;  2CYD A;  1BR1 A;  1G4U S;  4BJ6 A;  2IYL D;  3VRC A;  3RIP A;  2HV6 A;  2IXO A;  3NG1 A;  3G50 A;  2KC3 A;  2EIN C;  1FAP B;  1BR4 A;  4K1O A;  3LS1 A;  1TFO B;  3Q7G A;  1HW2 A;  2EIJ C;  2QLA A;  5D92 A;  1E85 A;  2G3V A;  4P6I C;  4WJ0 A;  2XLH A;  1Q0M A;  1VLS A;  3JYH A;  3K1H A;  4AL0 A;  3WG7 C;  1N1C A;  2R7X A;  2MWQ A;  4OIO F;  4U5B E;  4U9D A;  3A9C A;  1FFT C;  1ORS C;  5FZT A;  1K05 A;  2CW0 F;  3EGD A;  4FWV A;  4CX9 A;  2VAS A;  4HEA J;  3S9O A;  3N0T A;  1IZM A;  1NBB A;  3Q7L A;  4XPY A;  3H65 A;  1YA7 O;  1ZW3 A;  2KK1 A;  2VC9 A;  3FXH A;  3ZSU A;  4UDV A;  2KGO A;  1PV3 A;  2IXP A;  1V55 C;  3EGX A;  5L0I A;  2Y69 C;  2YL3 A;  3KL4 A;  4G0H A;  5KYU B;  1KTM A;  2OU6 A;  2IM8 A;  3RVY A;  1M2O A;  1U6H A;  4Q7C A;  2W45 A;  1M56 C;  4XEF A;  1LS1 A;  2NUP B;  3KH2 A;  5AC5 A;  1D0Y A;  4JJF A;  3RF3 A;  3OEO A;  1FMW A;  2WZL A;  2C03 A;  3HKK A;  3HNJ A;  3U2M A;  2OKU A;  5DS5 A;  3ECS A;  2WL8 A;  4U5F E;  3B71 A;  1Z5Z A;  3EH2 A;  4RDA A;  3RKO F;  1ORY A;  2QNL A;  3CEX A;  2P6V A;  2RD9 A;  3CQZ A;  1LKX A;  3KYJ A;  3L34 A;  4GQH A;  4AK9 A;  4OD4 A;  1YAU O;  3LUT B;  4LLC A;  4CS7 A;  4D4X A;  5L0F A;  4JIO A;  4G7Z F;  3C8G D;  3IQ6 A;  4JVS A;  1MMG A;  1JRA A;  1MNE A;  1V74 B;  5BQH A;  3HNK A;  3IHU A;  3KPH A;  4A4A A;  4LER A;  5DS4 A;  1FFH A;  4C3B A;  3FMS A;  2EIM C;  3F46 A;  1AUE A;  1FTS A;  3C8Z A;  3C63 A;  3DD7 A;  1C17 M;  3GM3 A;  3RFY A;  2WVO A;  5KYX B;  2AWY A;  3SNH A;  1XWJ A;  1OQC A;  2B0H A;  5DQZ A;  3QZC A;  2X51 A;  1CPR A;  3K6B A;  2H7B A;  4IWB A;  3POV A;  1HE9 A;  4NTF A;  2YL7 A;  3U3F A;  4Z9J A;  3EH1 A;  4O6M A;  4HFK B;  5JLI A;  3QMK A;  4LDR A;  4XEK A;  3LES A;  4ONS A;  5COF A;  5JT4 A;  4MTO A;  4CS8 C;  1QQ3 A;  3KYI A;  2UUH A;  3RQE A;  3SZR A;  3C8G A;  4LLE A;  3MYF A;  1BBH A;  3PDM P;  2J0X A;  3B0U X;  3W4Y A;  2UUI A;  5KYU A;  3WAQ A;  2AP3 A;  5GPG B;  1T6I A;  2HS5 A;  4HFF B;  3R7C A;  2NUP A;  1OXK A;  4DOZ A;  1Y6D A;  2EPM X;  2R7Q A;  3Q6M A;  3UGP A;  3GEE A;  5B3S C;  2H8A A;  2A1D D;  3TOL A;  3AQC A;  2R7W A;  4XWJ A;  1SR2 A;  3T6B A;  1T01 A;  4YWQ A;  1B68 A;  4NY3 A;  1A7D A;  2LP4 A;  1PCX A;  4EKW A;  4BEJ A;  2Q9C A;  3O55 A;  5L0G A;  2OQM A;  3DMD A;  1Q0D A;  2KW3 C;  2XS8 A;  4MVU A;  2A68 F;  3IEE A;  2YL1 A;  3ZTZ A;  1A7V A;  5A6B D;  3BEH A;  4G7H F;  1LE2 A;  1HW1 A;  1Q0G A;  2R7V A;  1QSP A;  1QVX A;  1V54 C;  1GM5 A;  1BDJ B;  3GWL A;  4P9F A;  1R5I D;  1JOG A;  2PF4 E;  3LLI A;  2Q4F A;  2YL0 A;  2LK4 A;  3ZIB A;  3SXM A;  2GDC A;  1RKE B;  2IXM A;  3LNM B;  3EGD B;  3Q6N A;  4YN0 B;  5KYX A;  1H9T A;  5EK0 A;  1VMA A;  3H2V A;  3JSE O;  3O39 A;  3WOD F;  1LS4 A;  2HMZ A;  1JPJ A;  2KNH A;  4H54 A;  1ZHT A;  5JS5 A;  4G7O F;  3W8H A;  4XPW A;  3X1O A;  3K33 A;  2ZXP A;  2GFH A;  2XXA B;  4BPM A;  5JP7 A;  3GM1 A;  1NG1 A;  2FFH A;  2Y39 A;  1PD1 A;  4DJ9 A;  1TQG A;  4W8P A;  2ETS A;  3DE9 A;  3K1I C;  1MMN A;  2J0W A;  5E2Q A;  3J06 A;  2R7T A;  5A6B A;  4MTF A;  4KI2 A;  2JPU A;  2BC5 A;  2EPL X;  3PCV A;  4C3D A;  3MX3 A;  4OIN F;  1ZVZ A;  1U0B B;  1YYX A;  1MQV A;  2GWW A;  4N4W A;  2WVN A;  3ZTM A;  3FAJ A;  3O10 A;  2R7O A;  3I5P A;  3NMJ A;  1LI5 A;  4MQ9 F;  1F1M A;  2ZPA A;  2KQ9 A;  3C18 A;  3KKB A;  4IGG A;  3W2V A;  2OEV A;  2CGE A;  2VCB A;  4ZLD A;  1FMV A;  3LLK A;  2V26 A;  2LFF A;  3B0V C;  4CIH A;  3TOM A;  2YKZ A;  3GAN A;  4J30 B;  4JTA B;  5JUA A;  4CSA C;  4Q5S F;  4U5D E;  3C62 A;  5JSL A;  4RD9 A;  1E86 A;  3T9O A;  1NLX A;  4NC3 A;  1OW7 A;  2R7S A;  1LPE A;  1GQA A;  1ZHY A;  1O87 A;  2J9W A;  2R25 A;  1M2V A;  2LQG A;  3DWW A;  3V5X A;  4I1M A;  2XL6 A;  4FES A;  2ZXR A;  4U5E E;  1D1C A;  3MLG A;  3M4C A;  4FX5 A;  5BQI A;  1SMY F;  2QY9 A;  1RKE A;  1YZC A;  1OCR C;  1R4T A;  3K7D A;  1BZ4 A;  3L8I A;  4G78 A;  5TJ5 E;  4JKV A;  4MVR A;  2I8B A;  2J8W A;  5F5H A;  1CGO A;  1IW7 F;  3M79 A;  1JR8 A;  3IPM O;  4PJN A;  3FDQ A;  2HV7 A;  3AG2 C;  2Q3T A;  3C8G B;  3EZI A;  3QVZ A;  3JSZ A;  4MND A;  2P0N A;  3T6J A;  1OR2 A;  4DVY P;  1WN0 A;  3UMK A;  3NKD A;  3ITF A;  2XXA A;  4N6C A;  2VCA A;  1LVK A;  1LIH A;  1SZI A;  1S05 A;  1KU2 A;  1L7C A;  3HLZ A;  3KMI A;  4OIR F;  4CS9 A;  2DI3 A;  2R7U A;  4CBE A;  2WZF A;  2PP4 A;  2G3K A;  4MVQ A;  3S90 A;  1CPQ A;  1VYK A;  1Y4C A;  2NPU A;  1VOM A;  2A0B A;  2E87 A;  1TWG A;  2P7V A;  2ZXO A;  4XPX A;  2L9J A;  4Z9I A;  5EGY A;  4ANJ A;  3SEO A;  5L0C A;  2LCH A;  1K04 A;  2L6G A;  2YWA A;  2RSE B;  1ST6 A;  3ASN C;  1O3U A;  2OG2 A;  3IQT A;  4ULW A;  3SXK A;  3US6 A;  1YVI A;  1Q0K A;  3EHN A;  3DZA A;  2F22 A;  4KC9 A;  3EZH A;  5E3A A;  4MW8 A;  2A0U A;  4W8K A;  3NMI A;  3SXY A;  1T6Q A;  3GEH A;  5K0I A;  1M6T A;  1WOL A;  3DJU B;  3H2U A;  3GEI A;  1L3P A;  3B9Q A;  5L0J A;  3LS0 A;  2YQY A;  2HSB A;  4AL1 A;  2KYH A;  1WGW A;  5AGF A;  4YL1 A;  3TJ6 A;  3WHN A;  2B0J A;  4JC7 A;  2ZXW C;  4N6H A;  4BG0 A;  5KYN A;  3V7O A;  4JEB A;  2YHS A;  3U0C A;  2OJE D;  4J7Y A;  1BR2 A;  1ZZP A;  3A11 A;  1Z6A A;  2Q00 A;  2Q7R A;  2GAQ A;  2XLD A;  2ASR A;  2HJ3 A;  1Q0F A;  2WVQ A;  4YT4 A;  2XLW A;  3ZWI A;  3I4U A;  5KYY B;  4CIP A;  5F5F A;  2OJQ A;  5IY5 C;  3NYL A;  3UMI A;  3B0P A;  3F47 A;  1WTY A;  1U89 A;  1NFN A;  2YRF A;  4PAC A;  4D4N A;  3FVY A;  1LM3 B;  1G5Z A;  1YAR O;  3NKE A;  1DOW A;  3LJB A;  4NTB A;  3V5Z A;  2LIG A;  1J8Y F;  1A7E A;  2OOC A;  4L6R A;  3K66 A;  3U2L A;  1HMO A;  2EPK X;  2A6E F;  2WZG A;  2P1A A;  4M63 A;  2D5R B;  2DB4 A;  4DBR A;  1D1B A;  1QZX A;  2JD3 A;  1I4Y A;  1OCC C;  1Z23 A;  2KJG A;  2LFD A;  3DE8 A;  4WGZ A;  2BE5 F;  4K0D A;  4A2N B;  4DBQ A;  4Z9H A;  3GOR A;  5KYW B;  2O9X A;  3TQO A;  3E9V A;  3QW1 A;  4PFP A;  3FOP A;  3S0X A;  3AOU A;  1UFB A;  2HSQ A;  2IBF A;  3N2Z B;  4OIP F;  3BRJ A;  4JTC B;  3EHM A;  4BJ6 C;  1YYJ A;  4JW1 A;  4MVZ A;  5L3V A;  1S7Z A;  2XM4 A;  2Y3H A;  3SP1 A;  4QI0 A;  1A41 A;  2J9B A;  2XLM A;  2YVK A;  1SYQ A;  3N24 A;  1AVO B; 
#chains in the Genus database with same CATH homology
 4O6Y A;  1M2V B;  2NG1 A;  3LNR A;  4BJ1 A;  2J9U A;  3NYM A;  3X2Q C;  4BJ5 A;  2QTV A;  1G8X A;  2W4B A;  4F4B A;  1NU9 C;  2WB7 A;  4YT2 A;  5KYY A;  2IOQ A;  4RBN A;  2W4M A;  2YEV A;  1MMD A;  3DAF A;  4I44 A;  4CS9 C;  4PJL A;  4GEH A;  4U5G A;  4J32 B;  3TD7 A;  4JZA A;  3VYW A;  2L81 A;  3RH3 A;  3NRH A;  1VK5 A;  3I5Q A;  2A6H F;  4QI2 A;  2Z15 A;  2EIK C;  5KYW A;  1TWC A;  4E7Z A;  4EWC A;  4XLP F;  1O5H A;  4CS8 A;  5T3T A;  4E7S A;  4PJM A;  1OCO C;  1OKK D;  2PX3 A;  3EG9 A;  2Y3D A;  5B1B C;  4AX2 A;  2W9Y A;  3S27 A;  4KNV A;  3M1C B;  1TWH A;  1Z63 A;  1D0X A;  2XL4 A;  4N06 A;  2IXN A;  4EBB A;  4O7G A;  3UGO A;  2C04 A;  2NUT B;  4I1O B;  3W8I A;  2EIL C;  2J9V A;  5BUO A;  3ABK C;  3AG1 C;  2DYS C;  3CSK A;  1OKK A;  5DLJ A;  2J7P D;  4JCH A;  2PX0 A;  4X0R A;  2J46 A;  5DQT A;  5DVW A;  1JPN A;  2MYS A;  3HJC A;  2FGY A;  1J8M F;  2CDQ A;  4LAC B;  2J45 A;  3DJN B;  2VH3 A;  5CI8 A;  3T4R A;  1ZHX A;  4KNW A;  1D1A A;  3RYL A;  3UMH A;  3ASO C;  2Y3B A;  2H7V C;  4JJG A;  1NU7 D;  3OWT A;  1VYI A;  2J7P A;  4HE8 D;  1TR2 A;  4BJ5 C;  2G62 A;  3FHD A;  4B6I A;  4PFO A;  4ZLC A;  4IJJ A;  2CNW D;  2XSE A;  4AE4 B;  1NZE A;  2YZS A;  4K7B A;  4OD5 A;  2NUT A;  3LEV A;  4CSA A;  3E70 C;  1ZYR F;  2Q9A A;  4PK4 A;  3S28 A;  3LAY A;  1Z3I X;  4YJW A;  3ZC4 A;  1TWA A;  2H7O A;  3W2W A;  3EFO B;  3ABL C;  3AQB A;  5D91 A;  1MND A;  1W2W A;  2PFD A;  4C7O B;  3ABM C;  3CZ6 A;  3OA1 A;  1RJ9 B;  4BJT A;  3EG9 B;  1D0Z A;  3DAG A;  3JT1 A;  3NDB B;  3EJN A;  2CNW A;  1ZU5 A;  3JRT A;  4YT5 A;  4IRU A;  3O6X A;  4H4K C;  4O79 A;  3NYJ A;  3EPV A;  3AG4 C;  3ZG1 A;  4XTK A;  1PD0 A;  2Q9B A;  2M4E A;  3ZVR A;  4U5C E;  5E33 A;  2A69 F;  5E3C A;  4YT8 A;  5EHH A;  5HSW A;  4I3M A;  3S29 A;  2XRH A;  4JUR I;  2DYR C;  4KBL A;  5DS6 A;  3UNG C;  4AE4 A;  1ZHZ A;  4DVZ A;  5T1D B;  2VB6 A;  4O6N A;  3HTK C;  1QLE C;  3UR3 C;  4Q4Z F;  2Y3G A;  1OCZ C;  5T3W A;  4QDL A;  2OCC C;  3AG3 C;  3EFO A;  1ZU4 A;  4OIQ F;  1ZHW A;  4GYT A;  2LSE A;  2DGJ A;  3DM5 A;  3JCU Q;  3L0I A;  4C7O A;  3EGX B;  1TKN A;  3SYN A;  1RJ9 A;  4IAO A;  5L3Q A;  3EQL F;  3PMR A;  1MMA A;  2V3C C;  3GOD A;  4PJJ A;  3VAY A;  3DM9 B;  5B1A C;  4XLN F;  5CI9 A;  4C3E A;  4U5H A;  2R7R A;  5FCL A;  1M57 C;  1SF8 A;  3DXJ F;  3PHF 2;  1BR1 A;  4BJ6 A;  2IYL D;  3RIP A;  2HV6 A;  2IXO A;  3NG1 A;  2EIN C;  1BR4 A;  3LS1 A;  3Q7G A;  2EIJ C;  5D92 A;  2G3V A;  4P6I C;  4WJ0 A;  3JYH A;  3K1H A;  3WG7 C;  1N1C A;  2R7X A;  2MWQ A;  4OIO F;  4U5B E;  1FFT C;  3EGD A;  2CW0 F;  4FWV A;  2VAS A;  4HEA J;  3N0T A;  1IZM A;  3Q7L A;  3H65 A;  3ZSU A;  2KGO A;  2IXP A;  1V55 C;  3EGX A;  2Y69 C;  3KL4 A;  4G0H A;  5KYU B;  1M2O A;  4Q7C A;  2W45 A;  1M56 C;  1LS1 A;  2NUP B;  3KH2 A;  1D0Y A;  4JJF A;  3OEO A;  1FMW A;  2WZL A;  2C03 A;  5DS5 A;  3ECS A;  2WL8 A;  4U5F E;  1Z5Z A;  3EH2 A;  4RDA A;  3RKO F;  3L34 A;  3CQZ A;  2P6V A;  1LKX A;  4AK9 A;  4CS7 A;  4OD4 A;  4G7Z F;  4LLC A;  4JVS A;  1MMG A;  1MNE A;  4LER A;  5DS4 A;  1FFH A;  4C3B A;  2EIM C;  3F46 A;  1FTS A;  3DD7 A;  3RFY A;  2WVO A;  5KYX B;  3SNH A;  5DQZ A;  3QZC A;  2X51 A;  3K6B A;  2H7B A;  4IWB A;  3POV A;  3EH1 A;  4O6M A;  4HFK B;  3QMK A;  3LES A;  4CS8 C;  3SZR A;  4LLE A;  2J0X A;  3B0U X;  5KYU A;  4HFF B;  2NUP A;  4DOZ A;  2R7Q A;  3Q6M A;  3UGP A;  5B3S C;  2A1D D;  3AQC A;  2R7W A;  4XWJ A;  3T6B A;  4YWQ A;  4NY3 A;  1PCX A;  4BEJ A;  2Q9C A;  3DMD A;  2KW3 C;  2A68 F;  3IEE A;  4G7H F;  2R7V A;  1V54 C;  2PF4 E;  3LLI A;  3ZIB A;  2IXM A;  3Q6N A;  3EGD B;  4YN0 B;  5KYX A;  1VMA A;  3O39 A;  3WOD F;  1JPJ A;  2KNH A;  1ZHT A;  4G7O F;  3W8H A;  3X1O A;  3K33 A;  2ZXP A;  2GFH A;  2XXA B;  1NG1 A;  2FFH A;  2Y39 A;  1PD1 A;  3K1I C;  1MMN A;  2J0W A;  5E2Q A;  2R7T A;  4KI2 A;  4C3D A;  3MX3 A;  4OIN F;  2WVN A;  3FAJ A;  2R7O A;  3I5P A;  4MQ9 F;  2ZPA A;  2KQ9 A;  3KKB A;  3W2V A;  2CGE A;  4ZLD A;  1FMV A;  3LLK A;  2V26 A;  3B0V C;  4CIH A;  3GAN A;  4J30 B;  4Q5S F;  4CSA C;  4U5D E;  4RD9 A;  2R7S A;  1ZHY A;  2J9W A;  1O87 A;  1M2V A;  4I1M A;  4FES A;  4U5E E;  2ZXR A;  1D1C A;  3MLG A;  4FX5 A;  1SMY F;  2QY9 A;  3K7D A;  1OCR C;  2I8B A;  5F5H A;  1IW7 F;  3FDQ A;  4PJN A;  2HV7 A;  3AG2 C;  2Q3T A;  3EZI A;  3T6J A;  3JSZ A;  4MND A;  4DVY P;  3UMK A;  3NKD A;  3ITF A;  2XXA A;  1LVK A;  1SZI A;  1KU2 A;  3HLZ A;  4OIR F;  3KMI A;  4CS9 A;  2R7U A;  4CBE A;  2WZF A;  2PP4 A;  2G3K A;  1VYK A;  1VOM A;  2E87 A;  2P7V A;  1TWG A;  5EGY A;  2ZXO A;  2L9J A;  4ANJ A;  3SEO A;  3ASN C;  1ST6 A;  4ULW A;  2OG2 A;  3EHN A;  3DZA A;  4KC9 A;  3EZH A;  5E3A A;  4W8K A;  3DJU B;  3B9Q A;  3LS0 A;  1WGW A;  5KYN A;  2B0J A;  2ZXW C;  4BG0 A;  3V7O A;  2YHS A;  1BR2 A;  1Z6A A;  2WVQ A;  4YT4 A;  5KYY B;  3I4U A;  5F5F A;  5IY5 C;  3NYL A;  3UMI A;  3B0P A;  3F47 A;  3FVY A;  3NKE A;  3LJB A;  1J8Y F;  3K66 A;  2A6E F;  2WZG A;  4M63 A;  2D5R B;  4DBR A;  1D1B A;  1QZX A;  2JD3 A;  1OCC C;  1Z23 A;  2KJG A;  2BE5 F;  4K0D A;  4A2N B;  4DBQ A;  5KYW B;  2O9X A;  3E9V A;  4PFP A;  3S0X A;  3N2Z B;  4OIP F;  3EHM A;  4BJ6 C;  4JW1 A;  5L3V A;  1S7Z A;  2Y3H A;  3SP1 A;  4QI0 A;  3N24 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...