3DJUB

Crystal structure of human btg2
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
121
structure length
121
Chain Sequence
TDMLPEIAAAVGFLSSLLRTRGCVSEQRLKVFSGALQEALTEHYKHHWFPEKPSKGSGYRCIRINHKMDPIISRVASQIGLSQPQLHQLLPSELTLWVDPYEVSYRIGEDGSICVLYEEAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of human BTG2 and mouse TIS21 involved in suppression of CAF1 deadenylase activity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Protein BTG2
total genus 35
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2008-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07742 BTG BTG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1120 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3djuB00
2Z15A 5CI8A 5CI9A 3DJNB 2D5RB 3E9VA 3DJUB
chains in the Genus database with same CATH superfamily
2J8WA 4H4KC 2Y69C 4ULVA 5COGA 4EWCA 4I1OB 4O6NA 5B3SC 1AVOB 2LSEA 1YDIA 5DVWA 1HW2A 3RYLA 2Q7RA 1IW7F 4GQHA 1H6GA 2R03A 3C8GB 4NCQA 3B0VC 4JCHA 2V3CC 2G3KA 3EGXB 3SNHA 4G0HA 2VASA 3LLIA 4FESA 4JURI 4BJ5C 1H7IA 2OEVA 2ZXPA 3TJ6A 2IXMA 3L8JA 1E86A 3F46A 1QSPA 1JR8A 4BG0A 1T6QA 2XRHA 2Q9CA 3C62A 3AG1C 2YEVA 4C7OB 3JZ0A 1E83A 2QLAA 1AEPA 1VTMP 3V5XA 2VCCA 4IWBA 1QLEC 2ZXWC 2Y39A 3AGUA 3DJUB 3ABLC 4O6MA 4U5BE 4AL1A 3GODA 1S7ZA 1Z3IX 2XL6A 4CIHA 3K33A 3AQBA 4GEHA 5EK0A 3RKOF 5KYXB 3EQLF 3K1IC 4MS2A 2EIMC 2I8BA 4HEAJ 5BQIA 1LS4A 1VLTA 1K05A 3HNLA 4CDYA 4DVZA 3IEEA 4JW1A 1WATA 4CBEA 4O7GA 3HJCA 4XLNF 1Q0KA 3JYHA 5KYNA 3JSEO 5L0DA 3C63A 2E87A 4MVSA 2GAQA 2G62A 4XTKA 3SXYA 3U2MA 3JT1A 1Q0GA 2R7UA 2HUJA 2VH3A 3LNMB 3SP1A 3EFOA 3TK0A 2XLHA 3LS1A 5IY5C 5KYUA 2H7VC 1MQVA 5F5HA 1FR0A 2HSBA 3NKEA 3EHNA 2WVNA 3DMDA 1F1MA 3QW0A 2IOQA 4Z9HA 2XS8A 4OIRF 4BPMA 1D0XA 1LM3B 1Z5ZA 2VCBA 1M2OA 1RKEB 3LEVA 3L1MA 3DJNB 2NUPB 3SYNA 4DBRA 3LLKA 3ZC4A 2KJGA 3LUTB 5L0GA 3GANA 5FCLA 1ORSC 3NYLA 2KYHA 4YT4A 2OU6A 2R7RA 4OIQF 3AQCA 3K66A 1LE2A 3M1CB 3NYMA 3W8HA 2EINC 3EGDA 4M63A 3W2WA 4RBNA 3A9CA 1C17M 4E7ZA 5A6AA 3CSKA 4JE9A 1OW8A 3X1OA 1ZW3A 1FFHA 4PJLA 3MFNA 1WTYA 2XLVA 3H2VA 3QTHA 4U5FE 3UR3C 1SZIA 4CX9A 1BR2A 4BJ6A 2IXNA 4OD5A 5T3WA 1SYQA 2MYSA 4DRIB 3CQZA 4Q4ZF 1GM5A 2LCHA 1UFBA 2KQ9A 2W4MA 1A41A 4MVOA 2WVOA 5L0IA 4Q5SF 4X0RA 2R7SA 1EKYA 4WGYA 4QDLA 1E85A 4JTDB 5A6BA 2B0JA 3T6GB 4DRJB 3WG7C 1U6HA 3KMIA 1LPEA 5COMA 1WOLA 1ZHZA 4KBLA 1WWPA 2HJMA 1MMNA 5B1AC 4PJJA 3B71A 1M2VB 3DE8A 4MW8A 3B0UX 1I4ZA 2O9XA 4Z9JA 5DS5A 2C04A 1V4AA 2LQGA 3HTKC 3G4ZA 3SZRA 5KYWA 1T9KA 3TJ5A 5K0IA 2XL8A 3JSZA 1LI5A 1YYXA 3EHMA 2A1DD 1HE1A 2NUPA 1L3PA 4N4WA 2KNHA 2JX0A 4IAOA 4XPXA 1VK5A 5CI8A 2YRFA 4JZAA 5DS4A 5A6JA 3HNIA 1MMGA 3FHDA 3I5PA 2XS1A 4C3EA 1KTMA 3NDBB 1W2WA 3EZIA 4K7BA 1FFTC 2EPOA 1Z23A 4FAPB 1MNEA 2YWAA 4CDAA 4LACB 3DZAA 3L0IA 4NQFA 3X2QC 4MW3A 2FAPB 3RQGA 3ZG1A 3N2ZB 1HMOA 2DYSC 1NU7D 1PV3A 3A11A 4CS7A 2XM4A 1M6TA 2JPUA 2XSEA 3JCUQ 3R2PA 4D4XA 3RQEA 2R7TA 1OR2A 1XWJA 2BE5F 2YHSA 3ECSA 3ZWIA 4H54A 1NFOA 2ZD9A 4BJ6C 2RD9A 3FMSA 3C8GD 2YLDA 4CJOA 2NUTB 2YLIA 1GS9A 3U0CA 4IJJA 4KI2A 2QE9A 4CS9C 2EPKX 1QQ3A 5AC5A 4Q7CA 2Q9AA 3ZDLA 2DB4A 2R7WA 4C7OA 3V7OA 3EPVA 5E3AA 3LNRA 4RD9A 3WAQA 4PFOA 3ABKC 2HKVA 3KYIA 3QZCA 4BJ5A 2R25A 4YL3A 1KNYA 4MVUA 1FNTc 5HSWA 1K04A 1LI7A 2G3VA 2J0WA 4G7OF 3K7DA 5KYXA 5A69A 3GM1A 2HMZA 2IYLD 1CGOA 3CZ6A 2I15A 1OCCC 5A6KA 4MTGA 4NY3A 2A0BA 2HV6A 3CAXA 4JIOA 1DOVA 3V5YA 4CS9A 5JVEA 1ST6A 1JMWA 1ZHYA 2J9UA 1D1AA 2ETSA 3QVYA 3WHNA 2OCCC 3U9JA 4F4BA 2M4EA 3EFOB 1WN0A 4PFPA 1SR2A 5E3CA 3Q7LA 5KYUB 2RSEB 4K1OA 2MHRA 3SEOA 4LLEA 4ONSA 3UMHA 3JTLO 4NTFA 3GWLA 4CSAC 4U5CE 3RVYA 4PR9A 3NG1A 1XZQA 2J46A 4EIYA 3POVA 4IARA 3K1HA 4JJFA 1RKEA 4EBBA 1ZHTA 3ZVRA 2BL2A 1T01A 2OKUA 2Y3DA 4E17A 2NSFA 2YL7A 4ZLDA 1TFKB 2XLOA 3ITFA 4IRUA 5B1BC 3T4RA 3U8PA 3US6A 1TWGA 1GQAA 3M4CA 4C3DA 4J30B 1FMWA 1KU2A 4CIPA 1V55C 2OJED 4KNVA 1OW7A 2A6HF 4A2NB 3VRCA 4YL0A 3ZIBA 5COFA 5AGFA 3C7JA 3GM2A 2W9YA 3S9OA 1CPQA 1U89A 3FOOA 3BEHA 1B68A 2B0HA 3FAPB 4JJGA 3S27A 3WODF 1QKRA 4P6IC 2GDCA 2QY9A 4NTBA 1N1CA 4JEBA 4HFKB 2R7VA 5EGYA 3QMKA 2R05A 2AWCA 1TKNA 2P7VA 3U3BA 4BEMJ 3EH1A 2VC9A 4WJ0A 2M64A 2NG1A 1RJ9B 4LDQA 4IB4A 4PJMA 1VLSA 5F5FA 1ZU4A 4AL0A 2FFHA 2TMVP 4KNWA 3DKAA 4D4NA 1QZXA 3DM9B 1CGNA 4BJ1A 4DVYP 5DQZA 3EZHA 4BJTA 1U0BB 1YVIA 2KC3A 1Y6DA 3JYYA 1Z63A 2NSGA 3AG2C 3DAFA 4N06A 1RKCA 4I3MA 1LIHA 1NLXA 1PD1A 2Q4FA 1Z7Qc 3U5SA 4G7HF 2L81A 1VB5A 2X51A 3QW1A 1D1BA 3ASOC 4YT5A 1NFNA 1OQCA 1PD0A 3I5QA 2XM0A 2J45A 1Q0MA 1YA9A 1AUEA 3NMJA 4YWQA 1ZVZA 1CGME 2AVKA 2WZGA 1O3UA 4MVQA 2WVQA 2AP3A 3DWWA 2ZXRA 2CNWA 3AGTA 3AG3C 2XL4A 2XLMA 2WL8A 3SXZA 1VYKA 2Y3GA 2MWQA 2W4BA 4B6IA 1I4YA 2HZ8A 3LESA 2Y3HA 1G5ZA 1I5NA 1OCRC 2DYRC 2JD3A 2XLWA 3OWTA 4ULWA 1ZW2A 2WZLA 3GORA 3JRMO 1R4TA 3Q6NA 4EBJA 2DI3A 3KKBA 1JPNA 3M79A 1ORJA 1O87A 1H9GA 1V54C 2R7OA 3GEIA 4JRZA 3EG9B 1MMDA 1VMAA 3KH2A 1V74B 2CGEA 2HMQA 1G4WR 4XQ1A 3L34A 2NUTA 5T3TA 3VYWA 2ASRA 3O55A 2YVKA 1ZZPA 4YL1A 4ANJA 2YLGA 5E33A 2P61A 1BR4A 3VM6A 3BRJA 1T5OA 4NC3A 1LS1A 5D91A 2XXAA 4CSAA 2A6EF 3N24A 2H8AA 1YAUO 1T6IA 3GEEA 1TFOB 4W8PA 2PFDA 2CNWD 3O39A 1QVXA 3AJMA 4ZLCA 2CYDA 5JSLA 4AE4B 1M57C 1NG1A 1BR1A 1YZCA 5L0JA 4HFFB 3J06A 5CIVA 4DJ9A 1OW6A 5JRAA 4YJWA 2R02A 2GFHA 3H65A 4I1MA 1JAFA 3RW0A 2J7PD 3QVZA 4CJGA 4XEFA 2CW0F 2IXOA 4E7SA 1BZ4A 1T6UA 4OINF 2OJQA 3GWNA 2YL3A 4LERA 5BQGA 2Y3BA 4U5DE 3T6JA 1G8XA 4EBKA 4MNDA 1R5ID 3NYJA 3Q6MA 4XPWA 1G4US 2YQYA 3W8IA 4HE8D 3NMKA 3GM3A 1ZU5A 2H7OA 4XPYA 1YARO 2L6FA 2J9WA 3PMRA 4J32B 2UUIA 1ORYA 1YJGA 3IQ6A 3KL4A 3JRTA 3UNGC 3LS0A 3ZTZA 1NU9C 3C8ZA 4KC9A 3VF0A 2WZFA 2L7AA 4MTFA 4U5GA 3E9VA 4MVRA 4N6CA 4LLCA 1YLMA 1A7VA 1K40A 2Z15A 5DQTA 4CS8C 3HNJA 3UMIA 1A0BA 4J7YA 2PBEA 3DI5A 3ABMC 3DAGA 4Z9IA 2OQMA 3FDQA 4FX5A 4XEVA 1HW1A 1LKXA 1MMAA 2LFDA 3H2UA 2J9BA 3DM5A 2PX3A 2X0CA 4AX2A 4YT2A 5D92A 2R7XA 2HS5A 3HKKA 5L3VA 3DD7A 2J0XA 1D0ZA 4XWJA 4UDVA 2ICWG 1OCOC 3IQTA 2A69F 4P9FA 2EPLX 4U5EE 4DBQA 4AE4A 3ASNC 2QNLA 1JOGA 1LVKA 3LAYA 3RH3A 3U2LA 4E18A 4N6HA 4L6RA 4MQ9F 1RJ9A 1BDJB 3NRHA 3RIPA 3PDMP 1NSGB 1MNDA 3EH2A 1M56C 2AWYA 1FAPB 1RCPA 2ZPAA 2VB6A 2V26A 5BUOA 1NBBA 3S84A 1OCZC 3DXJF 3IQCA 2IM8A 3MYFA 4PK4A 4WABA 4YT8A 4JKVA 3PHF2 3TD7A 3RQFA 1OXKA 1HMDA 1QPUA 3S28A 3HNKA 3R7CA 3G4XA 1Y4CA 256BA 4RDAA 3FXHA 4E0HA 1ZHWA 1Q0FA 4YN0B 2LP4A 4NTAA 2PP4A 4QI0A 1IZMA 4JTAB 3TQOA 5F28E 3ZTMA 3CEXA 1TWHA 2P0NA 4U5HA 5E2QA 4MTOA 4JC7A 4YK5A 4O79A 2W45A 3FVYA 2Q3TA 3SXMA 2CDQA 2J9VA 3MX3A 4C3BA 2L6HA 3NMIA 2PX0A 4CDVA 1TWCA 3S90A 1ZYRF 5DS6A 3PCVA 2OG2A 3TOMA 3LEOA 3IQ5A 2A0UA 2YL1A 5EHHA 5L0HA 4XLPF 1J8MF 5JP7A 3RVZA 1EA8A 2QTVA 3G50A 4JCZA 3TULA 2Q9BA 1PCXA 3DE9A 4EKWA 2C03A 4XEKA 3UGPA 3M15A 5KYYA 3KYJA 3ZQYA 3EG9A 1BBHA 3FAJA 4FWVA 4EUKB 3MYIA 2OOCA 1OXBA 1DOWA 2P1AA 1Q0DA 1SF8A 3F47A 4IGGA 4P9TA 5B3IA 5JS5A 2P6VA 2R9RB 2HFIA 2VCAA 3AOUA 3UGOA 4BEJA 3S0XA 3NKDA 1D1CA 2FGYA 4ER9A 4G7ZF 3MBGA 2EPNA 3B29A 4WGZA 1APCA 2L6GA 4LDRA 2LK4A 3SXKA 5L0FA 5HV9A 3U3FA 3M4BA 1HE9A 2XXAB 1TWAA 1JRAA 4LDKA 1Z6AA 2KW3C 1HY5A 1GGQA 4G78A 3EJNA 3AG4C 4K0DA 5TJ5E 3UMKA 3C18A 1SMYF 5JT4A 2XLDA 1RXQA 1VOMA 3Q7GA 3T9OA 4OIPF 3W2VA 1C02A 4DXWA 2KK1A 4CS8A 3B9QA 1OR3A 3VAYA 1JPJA 4IAQA 1D0YA 1RMVA 1OKKD 2BC5A 3GEHA 3V5ZA 3ZQVA 5AC4A 1ZHXA 2HJ3A 1CPRA 1FTSA 1C03A 3OEOA 4J7TA 1TR2A 3L8IA 5L0CA 3EGDB 5L3QA 3OA1A 4O6YA 5JUAA 3IPMO 1WASA 2KGOA 4MVMA 3T6BA 5CI9A 2Q00A 1E84A 2KSFA 2QUPA 1NZEA 3O10A 3I4UA 2L9JA 1EQ1A 3C8GA 4OD4A 2IXPA 4GYTA 1O5HA 2EIJC 4PJNA 1XZPA 1YA7O 3EGXA 4PACA 2UUHA 4E0IA 3ATPA 1L7CA 3RFYA 3O6XA 2OEXA 5JLIA 5DLJA 5A6BD 4JTCB 5KYYB 2PF4E 2EIKC 3MLGA 1EI7A 1VYIA 1WGWA 2AU5A 3IHUA 4R32A 1YYJA 3LJBA 2PNOA 3HLZA 2DGJA 2WB7A 2YZSA 2LIGA 3N0TA 4MVZA 3TOLA 2R7QA 5BQHA 4EHPA 2EPMX 2YKZA 1FMVA 4DRHB 2A68F 2HV7A 1UG7A 1M2VA 2GWWA 3ZSUA 2YL0A 4QI2A 3W4YA 4AK9A 3KPHA 2CCYA 1OKKA 4U9DA 2J7PA 1TQGA 2D5RB 4JEAA 2EILC 2XLEA 5FZTA 2H7BA 2GA0A 3RF3A 3E70C 1YZAA 3U8VA 5GPGB 4U9EA 4DOZA 1A7DA 5KYWB 4OIOF 5T1DB 3K1IA 3U9MA 1A7EA 4A4AA 2LFFA 4I44A 2NPUA 3K6BA 2F22A 2D4UA 1J8YF 4W8KA 2IBFA 1LE4A 3S29A 4JVSA 1H9TA 2LD6A 2ZXOA 3B0PA 1E2XA 3FOPA 2HSQA 1S05A
chains in the Genus database with same CATH topology
4H4KC 2Y69C 4EWCA 4I1OB 4O6NA 5B3SC 2LSEA 5DVWA 3RYLA 1IW7F 3B0VC 4JCHA 2V3CC 2G3KA 3EGXB 3SNHA 4G0HA 2VASA 3LLIA 4FESA 4JURI 4BJ5C 2ZXPA 2IXMA 3F46A 4BG0A 2XRHA 2Q9CA 3AG1C 2YEVA 4C7OB 4IWBA 1QLEC 2ZXWC 2Y39A 3DJUB 4O6MA 3ABLC 4U5BE 3GODA 1Z3IX 1S7ZA 4CIHA 3K33A 3AQBA 4GEHA 3RKOF 5KYXB 3EQLF 3K1IC 2EIMC 2I8BA 4HEAJ 4DVZA 3IEEA 4JW1A 4CBEA 4O7GA 3HJCA 4XLNF 3JYHA 5KYNA 2E87A 4XTKA 2G62A 2R7UA 3JT1A 2VH3A 3SP1A 3EFOA 5IY5C 3LS1A 5KYUA 2H7VC 5F5HA 3NKEA 3EHNA 2WVNA 3DMDA 2IOQA 4OIRF 1D0XA 1Z5ZA 3LEVA 1M2OA 3SYNA 4DBRA 3DJNB 2NUPB 3LLKA 3ZC4A 2KJGA 3GANA 5FCLA 3NYLA 4YT4A 2R7RA 4OIQF 3AQCA 3K66A 3M1CB 3NYMA 3W8HA 2EINC 3EGDA 4M63A 3W2WA 4RBNA 4E7ZA 3CSKA 3X1OA 1FFHA 4PJLA 3UR3C 4U5FE 1SZIA 1BR2A 4BJ6A 2IXNA 4OD5A 5T3WA 2MYSA 4Q4ZF 3CQZA 2KQ9A 2W4MA 2WVOA 4Q5SF 4X0RA 2R7SA 4QDLA 2B0JA 3WG7C 3KMIA 1ZHZA 4KBLA 1MMNA 5B1AC 4PJJA 1M2VB 3B0UX 2O9XA 5DS5A 2C04A 3HTKC 3SZRA 5KYWA 3JSZA 3EHMA 2A1DD 2NUPA 2KNHA 5CI8A 4IAOA 1VK5A 4JZAA 5DS4A 4C3EA 1MMGA 3FHDA 3I5PA 3NDBB 1W2WA 3EZIA 4K7BA 1FFTC 1Z23A 1MNEA 4LACB 3DZAA 3L0IA 3X2QC 3ZG1A 3N2ZB 2DYSC 1NU7D 4CS7A 2R7TA 2XSEA 3JCUQ 2BE5F 2YHSA 3ECSA 4BJ6C 2NUTB 4IJJA 4KI2A 4CS9C 4Q7CA 2Q9AA 2R7WA 4C7OA 3V7OA 3EPVA 5E3AA 3LNRA 4RD9A 4PFOA 3ABKC 3QZCA 4BJ5A 5HSWA 2J0WA 2G3VA 4G7OF 3K7DA 5KYXA 2IYLD 3CZ6A 1OCCC 4NY3A 4CS9A 2HV6A 1ST6A 1ZHYA 2J9UA 1D1AA 2OCCC 4F4BA 2M4EA 3EFOB 4PFPA 5E3CA 3Q7LA 5KYUB 3SEOA 4LLEA 3UMHA 4CSAC 4U5CE 3NG1A 2J46A 3POVA 4JJFA 3K1HA 4EBBA 1ZHTA 3ZVRA 2Y3DA 4ZLDA 4IRUA 3ITFA 3T4RA 5B1BC 1TWGA 4C3DA 4J30B 1FMWA 1KU2A 1V55C 4KNVA 2A6HF 4A2NB 3ZIBA 4OIOF 2W9YA 1Z63A 4JJGA 3S27A 3WODF 4P6IC 2QY9A 1N1CA 4HFKB 2R7VA 5EGYA 3QMKA 1TKNA 2P7VA 3EH1A 4WJ0A 2NG1A 1RJ9B 4PJMA 5F5FA 1ZU4A 2FFHA 4KNWA 1QZXA 3DM9B 4BJ1A 4DVYP 5DQZA 3EZHA 4BJTA 3AG2C 3DAFA 4N06A 4I3MA 1PD1A 4G7HF 2L81A 2X51A 1D1BA 3ASOC 4YT5A 1PD0A 3I5QA 2J45A 4YWQA 2WZGA 2WVQA 2ZXRA 2CNWA 3AG3C 2XL4A 2WL8A 1VYKA 2Y3GA 2MWQA 2W4BA 4B6IA 3LESA 2Y3HA 1OCRC 2DYRC 2JD3A 3OWTA 4ULWA 2WZLA 3Q6NA 3KKBA 1JPNA 1O87A 1V54C 2R7OA 3EG9B 1VMAA 1MMDA 3KH2A 2CGEA 3L34A 2NUTA 5T3TA 3VYWA 4ANJA 5E33A 1BR4A 5D91A 1LS1A 2XXAA 4CSAA 2A6EF 3N24A 2PFDA 2CNWD 3O39A 4ZLCA 4AE4B 1M57C 1NG1A 1BR1A 4HFFB 4YJWA 3H65A 2GFHA 4I1MA 2J7PD 4E7SA 2CW0F 2IXOA 4OINF 4LERA 3T6JA 2Y3BA 4U5DE 1G8XA 4MNDA 3NYJA 3Q6MA 3W8IA 4HE8D 1ZU5A 2H7OA 2J9WA 3PMRA 4J32B 3UNGC 3KL4A 3JRTA 3LS0A 1NU9C 4KC9A 2WZFA 4U5GA 3E9VA 4LLCA 2Z15A 5DQTA 4CS8C 3UMIA 3ABMC 3DAGA 3FDQA 4FX5A 1LKXA 1MMAA 3DM5A 2PX3A 4AX2A 4YT2A 5D92A 2R7XA 5L3VA 3DD7A 2J0XA 1D0ZA 4XWJA 1OCOC 2A69F 4U5EE 4DBQA 4AE4A 3ASNC 3LAYA 1LVKA 3RH3A 4MQ9F 1RJ9A 3NRHA 3RIPA 1MNDA 3EH2A 1M56C 2ZPAA 2VB6A 2V26A 5BUOA 4G7ZF 1OCZC 3DXJF 4PK4A 3PHF2 4YT8A 3TD7A 3S28A 4RDAA 1ZHWA 4YN0B 2PP4A 4QI0A 1IZMA 1TWHA 4U5HA 5E2QA 4O79A 2W45A 3FVYA 2Q3TA 4C3BA 2CDQA 2J9VA 3MX3A 2PX0A 1TWCA 1ZYRF 5DS6A 2OG2A 5EHHA 4XLPF 1J8MF 2QTVA 2Q9BA 1PCXA 2C03A 3UGPA 5KYYA 3EG9A 3FAJA 4FWVA 1SF8A 3F47A 2P6VA 3UGOA 4BEJA 3S0XA 3NKDA 1D1CA 2FGYA 2XXAB 1TWAA 1Z6AA 2KW3C 3EJNA 3AG4C 4K0DA 3UMKA 1SMYF 1VOMA 3Q7GA 4OIPF 3W2VA 4CS8A 3B9QA 3VAYA 1JPJA 1D0YA 1OKKD 1ZHXA 1FTSA 3OEOA 5L3QA 1TR2A 3EGDB 3OA1A 4O6YA 3T6BA 2KGOA 5CI9A 1NZEA 3I4UA 2L9JA 4OD4A 2IXPA 4GYTA 1O5HA 2EIJC 4PJNA 3EGXA 3RFYA 3O6XA 5DLJA 5KYYB 2PF4E 2EIKC 3MLGA 1WGWA 1VYIA 3LJBA 3HLZA 2DGJA 2WB7A 2YZSA 3N0TA 2R7QA 1FMVA 2A68F 2HV7A 1M2VA 3ZSUA 4QI2A 4AK9A 1OKKA 2J7PA 2D5RB 2EILC 2H7BA 3E70C 4DOZA 5KYWB 5T1DB 4I44A 3K6BA 4W8KA 1J8YF 3S29A 4JVSA 2ZXOA 3B0PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z15 A;  5CI8 A;  5CI9 A;  3DJN B;  2D5R B;  3E9V A;  3DJU B; 
#chains in the Genus database with same CATH topology
 2J8W A;  4H4K C;  2Y69 C;  4ULV A;  5COG A;  4EWC A;  4I1O B;  4O6N A;  5B3S C;  1AVO B;  2LSE A;  1YDI A;  5DVW A;  1HW2 A;  3RYL A;  2Q7R A;  1IW7 F;  4GQH A;  1H6G A;  2R03 A;  3C8G B;  4NCQ A;  3B0V C;  4JCH A;  2V3C C;  2G3K A;  3EGX B;  3SNH A;  4G0H A;  2VAS A;  3LLI A;  4FES A;  4JUR I;  4BJ5 C;  1H7I A;  2OEV A;  2ZXP A;  3TJ6 A;  2IXM A;  3L8J A;  1E86 A;  3F46 A;  1QSP A;  1JR8 A;  4BG0 A;  1T6Q A;  2XRH A;  2Q9C A;  3C62 A;  3AG1 C;  2YEV A;  4C7O B;  3JZ0 A;  1E83 A;  2QLA A;  1AEP A;  1VTM P;  3V5X A;  2VCC A;  4IWB A;  1QLE C;  2ZXW C;  2Y39 A;  3AGU A;  3DJU B;  3ABL C;  4O6M A;  4U5B E;  4AL1 A;  3GOD A;  1S7Z A;  1Z3I X;  2XL6 A;  4CIH A;  3K33 A;  3AQB A;  4GEH A;  5EK0 A;  3RKO F;  5KYX B;  3EQL F;  3K1I C;  4MS2 A;  2EIM C;  2I8B A;  4HEA J;  5BQI A;  1LS4 A;  1VLT A;  1K05 A;  3HNL A;  4CDY A;  4DVZ A;  3IEE A;  4JW1 A;  1WAT A;  4CBE A;  4O7G A;  3HJC A;  4XLN F;  1Q0K A;  3JYH A;  5KYN A;  3JSE O;  5L0D A;  3C63 A;  2E87 A;  4MVS A;  2GAQ A;  2G62 A;  4XTK A;  3SXY A;  3U2M A;  3JT1 A;  1Q0G A;  2R7U A;  2HUJ A;  2VH3 A;  3LNM B;  3SP1 A;  3EFO A;  3TK0 A;  2XLH A;  3LS1 A;  5IY5 C;  5KYU A;  2H7V C;  1MQV A;  5F5H A;  1FR0 A;  2HSB A;  3NKE A;  3EHN A;  2WVN A;  3DMD A;  1F1M A;  3QW0 A;  2IOQ A;  4Z9H A;  2XS8 A;  4OIR F;  4BPM A;  1D0X A;  1LM3 B;  1Z5Z A;  2VCB A;  1M2O A;  1RKE B;  3LEV A;  3L1M A;  3DJN B;  2NUP B;  3SYN A;  4DBR A;  3LLK A;  3ZC4 A;  2KJG A;  3LUT B;  5L0G A;  3GAN A;  5FCL A;  1ORS C;  3NYL A;  2KYH A;  4YT4 A;  2OU6 A;  2R7R A;  4OIQ F;  3AQC A;  3K66 A;  1LE2 A;  3M1C B;  3NYM A;  3W8H A;  2EIN C;  3EGD A;  4M63 A;  3W2W A;  4RBN A;  3A9C A;  1C17 M;  4E7Z A;  5A6A A;  3CSK A;  4JE9 A;  1OW8 A;  3X1O A;  1ZW3 A;  1FFH A;  4PJL A;  3MFN A;  1WTY A;  2XLV A;  3H2V A;  3QTH A;  4U5F E;  3UR3 C;  1SZI A;  4CX9 A;  1BR2 A;  4BJ6 A;  2IXN A;  4OD5 A;  5T3W A;  1SYQ A;  2MYS A;  4DRI B;  3CQZ A;  4Q4Z F;  1GM5 A;  2LCH A;  1UFB A;  2KQ9 A;  2W4M A;  1A41 A;  4MVO A;  2WVO A;  5L0I A;  4Q5S F;  4X0R A;  2R7S A;  1EKY A;  4WGY A;  4QDL A;  1E85 A;  4JTD B;  5A6B A;  2B0J A;  3T6G B;  4DRJ B;  3WG7 C;  1U6H A;  3KMI A;  1LPE A;  5COM A;  1WOL A;  1ZHZ A;  4KBL A;  1WWP A;  2HJM A;  1MMN A;  5B1A C;  4PJJ A;  3B71 A;  1M2V B;  3DE8 A;  4MW8 A;  3B0U X;  1I4Z A;  2O9X A;  4Z9J A;  5DS5 A;  2C04 A;  1V4A A;  2LQG A;  3HTK C;  3G4Z A;  3SZR A;  5KYW A;  1T9K A;  3TJ5 A;  5K0I A;  2XL8 A;  3JSZ A;  1LI5 A;  1YYX A;  3EHM A;  2A1D D;  1HE1 A;  2NUP A;  1L3P A;  4N4W A;  2KNH A;  2JX0 A;  4IAO A;  4XPX A;  1VK5 A;  5CI8 A;  2YRF A;  4JZA A;  5DS4 A;  5A6J A;  3HNI A;  1MMG A;  3FHD A;  3I5P A;  2XS1 A;  4C3E A;  1KTM A;  3NDB B;  1W2W A;  3EZI A;  4K7B A;  1FFT C;  2EPO A;  1Z23 A;  4FAP B;  1MNE A;  2YWA A;  4CDA A;  4LAC B;  3DZA A;  3L0I A;  4NQF A;  3X2Q C;  4MW3 A;  2FAP B;  3RQG A;  3ZG1 A;  3N2Z B;  1HMO A;  2DYS C;  1NU7 D;  1PV3 A;  3A11 A;  4CS7 A;  2XM4 A;  1M6T A;  2JPU A;  2XSE A;  3JCU Q;  3R2P A;  4D4X A;  3RQE A;  2R7T A;  1OR2 A;  1XWJ A;  2BE5 F;  2YHS A;  3ECS A;  3ZWI A;  4H54 A;  1NFO A;  2ZD9 A;  4BJ6 C;  2RD9 A;  3FMS A;  3C8G D;  2YLD A;  4CJO A;  2NUT B;  2YLI A;  1GS9 A;  3U0C A;  4IJJ A;  4KI2 A;  2QE9 A;  4CS9 C;  2EPK X;  1QQ3 A;  5AC5 A;  4Q7C A;  2Q9A A;  3ZDL A;  2DB4 A;  2R7W A;  4C7O A;  3V7O A;  3EPV A;  5E3A A;  3LNR A;  4RD9 A;  3WAQ A;  4PFO A;  3ABK C;  2HKV A;  3KYI A;  3QZC A;  4BJ5 A;  2R25 A;  4YL3 A;  1KNY A;  4MVU A;  1FNT c;  5HSW A;  1K04 A;  1LI7 A;  2G3V A;  2J0W A;  4G7O F;  3K7D A;  5KYX A;  5A69 A;  3GM1 A;  2HMZ A;  2IYL D;  1CGO A;  3CZ6 A;  2I15 A;  1OCC C;  5A6K A;  4MTG A;  4NY3 A;  2A0B A;  2HV6 A;  3CAX A;  4JIO A;  1DOV A;  3V5Y A;  4CS9 A;  5JVE A;  1ST6 A;  1JMW A;  1ZHY A;  2J9U A;  1D1A A;  2ETS A;  3QVY A;  3WHN A;  2OCC C;  3U9J A;  4F4B A;  2M4E A;  3EFO B;  1WN0 A;  4PFP A;  1SR2 A;  5E3C A;  3Q7L A;  5KYU B;  2RSE B;  4K1O A;  2MHR A;  3SEO A;  4LLE A;  4ONS A;  3UMH A;  3JTL O;  4NTF A;  3GWL A;  4CSA C;  4U5C E;  3RVY A;  4PR9 A;  3NG1 A;  1XZQ A;  2J46 A;  4EIY A;  3POV A;  4IAR A;  3K1H A;  4JJF A;  1RKE A;  4EBB A;  1ZHT A;  3ZVR A;  2BL2 A;  1T01 A;  2OKU A;  2Y3D A;  4E17 A;  2NSF A;  2YL7 A;  4ZLD A;  1TFK B;  2XLO A;  3ITF A;  4IRU A;  5B1B C;  3T4R A;  3U8P A;  3US6 A;  1TWG A;  1GQA A;  3M4C A;  4C3D A;  4J30 B;  1FMW A;  1KU2 A;  4CIP A;  1V55 C;  2OJE D;  4KNV A;  1OW7 A;  2A6H F;  4A2N B;  3VRC A;  4YL0 A;  3ZIB A;  5COF A;  5AGF A;  3C7J A;  3GM2 A;  2W9Y A;  3S9O A;  1CPQ A;  1U89 A;  3FOO A;  3BEH A;  1B68 A;  2B0H A;  3FAP B;  4JJG A;  3S27 A;  3WOD F;  1QKR A;  4P6I C;  2GDC A;  2QY9 A;  4NTB A;  1N1C A;  4JEB A;  4HFK B;  2R7V A;  5EGY A;  3QMK A;  2R05 A;  2AWC A;  1TKN A;  2P7V A;  3U3B A;  4BEM J;  3EH1 A;  2VC9 A;  4WJ0 A;  2M64 A;  2NG1 A;  1RJ9 B;  4LDQ A;  4IB4 A;  4PJM A;  1VLS A;  5F5F A;  1ZU4 A;  4AL0 A;  2FFH A;  2TMV P;  4KNW A;  3DKA A;  4D4N A;  1QZX A;  3DM9 B;  1CGN A;  4BJ1 A;  4DVY P;  5DQZ A;  3EZH A;  4BJT A;  1U0B B;  1YVI A;  2KC3 A;  1Y6D A;  3JYY A;  1Z63 A;  2NSG A;  3AG2 C;  3DAF A;  4N06 A;  1RKC A;  4I3M A;  1LIH A;  1NLX A;  1PD1 A;  2Q4F A;  1Z7Q c;  3U5S A;  4G7H F;  2L81 A;  1VB5 A;  2X51 A;  3QW1 A;  1D1B A;  3ASO C;  4YT5 A;  1NFN A;  1OQC A;  1PD0 A;  3I5Q A;  2XM0 A;  2J45 A;  1Q0M A;  1YA9 A;  1AUE A;  3NMJ A;  4YWQ A;  1ZVZ A;  1CGM E;  2AVK A;  2WZG A;  1O3U A;  4MVQ A;  2WVQ A;  2AP3 A;  3DWW A;  2ZXR A;  2CNW A;  3AGT A;  3AG3 C;  2XL4 A;  2XLM A;  2WL8 A;  3SXZ A;  1VYK A;  2Y3G A;  2MWQ A;  2W4B A;  4B6I A;  1I4Y A;  2HZ8 A;  3LES A;  2Y3H A;  1G5Z A;  1I5N A;  1OCR C;  2DYR C;  2JD3 A;  2XLW A;  3OWT A;  4ULW A;  1ZW2 A;  2WZL A;  3GOR A;  3JRM O;  1R4T A;  3Q6N A;  4EBJ A;  2DI3 A;  3KKB A;  1JPN A;  3M79 A;  1ORJ A;  1O87 A;  1H9G A;  1V54 C;  2R7O A;  3GEI A;  4JRZ A;  3EG9 B;  1MMD A;  1VMA A;  3KH2 A;  1V74 B;  2CGE A;  2HMQ A;  1G4W R;  4XQ1 A;  3L34 A;  2NUT A;  5T3T A;  3VYW A;  2ASR A;  3O55 A;  2YVK A;  1ZZP A;  4YL1 A;  4ANJ A;  2YLG A;  5E33 A;  2P61 A;  1BR4 A;  3VM6 A;  3BRJ A;  1T5O A;  4NC3 A;  1LS1 A;  5D91 A;  2XXA A;  4CSA A;  2A6E F;  3N24 A;  2H8A A;  1YAU O;  1T6I A;  3GEE A;  1TFO B;  4W8P A;  2PFD A;  2CNW D;  3O39 A;  1QVX A;  3AJM A;  4ZLC A;  2CYD A;  5JSL A;  4AE4 B;  1M57 C;  1NG1 A;  1BR1 A;  1YZC A;  5L0J A;  4HFF B;  3J06 A;  5CIV A;  4DJ9 A;  1OW6 A;  5JRA A;  4YJW A;  2R02 A;  2GFH A;  3H65 A;  4I1M A;  1JAF A;  3RW0 A;  2J7P D;  3QVZ A;  4CJG A;  4XEF A;  2CW0 F;  2IXO A;  4E7S A;  1BZ4 A;  1T6U A;  4OIN F;  2OJQ A;  3GWN A;  2YL3 A;  4LER A;  5BQG A;  2Y3B A;  4U5D E;  3T6J A;  1G8X A;  4EBK A;  4MND A;  1R5I D;  3NYJ A;  3Q6M A;  4XPW A;  1G4U S;  2YQY A;  3W8I A;  4HE8 D;  3NMK A;  3GM3 A;  1ZU5 A;  2H7O A;  4XPY A;  1YAR O;  2L6F A;  2J9W A;  3PMR A;  4J32 B;  2UUI A;  1ORY A;  1YJG A;  3IQ6 A;  3KL4 A;  3JRT A;  3UNG C;  3LS0 A;  3ZTZ A;  1NU9 C;  3C8Z A;  4KC9 A;  3VF0 A;  2WZF A;  2L7A A;  4MTF A;  4U5G A;  3E9V A;  4MVR A;  4N6C A;  4LLC A;  1YLM A;  1A7V A;  1K40 A;  2Z15 A;  5DQT A;  4CS8 C;  3HNJ A;  3UMI A;  1A0B A;  4J7Y A;  2PBE A;  3DI5 A;  3ABM C;  3DAG A;  4Z9I A;  2OQM A;  3FDQ A;  4FX5 A;  4XEV A;  1HW1 A;  1LKX A;  1MMA A;  2LFD A;  3H2U A;  2J9B A;  3DM5 A;  2PX3 A;  2X0C A;  4AX2 A;  4YT2 A;  5D92 A;  2R7X A;  2HS5 A;  3HKK A;  5L3V A;  3DD7 A;  2J0X A;  1D0Z A;  4XWJ A;  4UDV A;  2ICW G;  1OCO C;  3IQT A;  2A69 F;  4P9F A;  2EPL X;  4U5E E;  4DBQ A;  4AE4 A;  3ASN C;  2QNL A;  1JOG A;  1LVK A;  3LAY A;  3RH3 A;  3U2L A;  4E18 A;  4N6H A;  4L6R A;  4MQ9 F;  1RJ9 A;  1BDJ B;  3NRH A;  3RIP A;  3PDM P;  1NSG B;  1MND A;  3EH2 A;  1M56 C;  2AWY A;  1FAP B;  1RCP A;  2ZPA A;  2VB6 A;  2V26 A;  5BUO A;  1NBB A;  3S84 A;  1OCZ C;  3DXJ F;  3IQC A;  2IM8 A;  3MYF A;  4PK4 A;  4WAB A;  4YT8 A;  4JKV A;  3PHF 2;  3TD7 A;  3RQF A;  1OXK A;  1HMD A;  1QPU A;  3S28 A;  3HNK A;  3R7C A;  3G4X A;  1Y4C A;  256B A;  4RDA A;  3FXH A;  4E0H A;  1ZHW A;  1Q0F A;  4YN0 B;  2LP4 A;  4NTA A;  2PP4 A;  4QI0 A;  1IZM A;  4JTA B;  3TQO A;  5F28 E;  3ZTM A;  3CEX A;  1TWH A;  2P0N A;  4U5H A;  5E2Q A;  4MTO A;  4JC7 A;  4YK5 A;  4O79 A;  2W45 A;  3FVY A;  2Q3T A;  3SXM A;  2CDQ A;  2J9V A;  3MX3 A;  4C3B A;  2L6H A;  3NMI A;  2PX0 A;  4CDV A;  1TWC A;  3S90 A;  1ZYR F;  5DS6 A;  3PCV A;  2OG2 A;  3TOM A;  3LEO A;  3IQ5 A;  2A0U A;  2YL1 A;  5EHH A;  5L0H A;  4XLP F;  1J8M F;  5JP7 A;  3RVZ A;  1EA8 A;  2QTV A;  3G50 A;  4JCZ A;  3TUL A;  2Q9B A;  1PCX A;  3DE9 A;  4EKW A;  2C03 A;  4XEK A;  3UGP A;  3M15 A;  5KYY A;  3KYJ A;  3ZQY A;  3EG9 A;  1BBH A;  3FAJ A;  4FWV A;  4EUK B;  3MYI A;  2OOC A;  1OXB A;  1DOW A;  2P1A A;  1Q0D A;  1SF8 A;  3F47 A;  4IGG A;  4P9T A;  5B3I A;  5JS5 A;  2P6V A;  2R9R B;  2HFI A;  2VCA A;  3AOU A;  3UGO A;  4BEJ A;  3S0X A;  3NKD A;  1D1C A;  2FGY A;  4ER9 A;  4G7Z F;  3MBG A;  2EPN A;  3B29 A;  4WGZ A;  1APC A;  2L6G A;  4LDR A;  2LK4 A;  3SXK A;  5L0F A;  5HV9 A;  3U3F A;  3M4B A;  1HE9 A;  2XXA B;  1TWA A;  1JRA A;  4LDK A;  1Z6A A;  2KW3 C;  1HY5 A;  1GGQ A;  4G78 A;  3EJN A;  3AG4 C;  4K0D A;  5TJ5 E;  3UMK A;  3C18 A;  1SMY F;  5JT4 A;  2XLD A;  1RXQ A;  1VOM A;  3Q7G A;  3T9O A;  4OIP F;  3W2V A;  1C02 A;  4DXW A;  2KK1 A;  4CS8 A;  3B9Q A;  1OR3 A;  3VAY A;  1JPJ A;  4IAQ A;  1D0Y A;  1RMV A;  1OKK D;  2BC5 A;  3GEH A;  3V5Z A;  3ZQV A;  5AC4 A;  1ZHX A;  2HJ3 A;  1CPR A;  1FTS A;  1C03 A;  3OEO A;  4J7T A;  1TR2 A;  3L8I A;  5L0C A;  3EGD B;  5L3Q A;  3OA1 A;  4O6Y A;  5JUA A;  3IPM O;  1WAS A;  2KGO A;  4MVM A;  3T6B A;  5CI9 A;  2Q00 A;  1E84 A;  2KSF A;  2QUP A;  1NZE A;  3O10 A;  3I4U A;  2L9J A;  1EQ1 A;  3C8G A;  4OD4 A;  2IXP A;  4GYT A;  1O5H A;  2EIJ C;  4PJN A;  1XZP A;  1YA7 O;  3EGX A;  4PAC A;  2UUH A;  4E0I A;  3ATP A;  1L7C A;  3RFY A;  3O6X A;  2OEX A;  5JLI A;  5DLJ A;  5A6B D;  4JTC B;  5KYY B;  2PF4 E;  2EIK C;  3MLG A;  1EI7 A;  1VYI A;  1WGW A;  2AU5 A;  3IHU A;  4R32 A;  1YYJ A;  3LJB A;  2PNO A;  3HLZ A;  2DGJ A;  2WB7 A;  2YZS A;  2LIG A;  3N0T A;  4MVZ A;  3TOL A;  2R7Q A;  5BQH A;  4EHP A;  2EPM X;  2YKZ A;  1FMV A;  4DRH B;  2A68 F;  2HV7 A;  1UG7 A;  1M2V A;  2GWW A;  3ZSU A;  2YL0 A;  4QI2 A;  3W4Y A;  4AK9 A;  3KPH A;  2CCY A;  1OKK A;  4U9D A;  2J7P A;  1TQG A;  2D5R B;  4JEA A;  2EIL C;  2XLE A;  5FZT A;  2H7B A;  2GA0 A;  3RF3 A;  3E70 C;  1YZA A;  3U8V A;  5GPG B;  4U9E A;  4DOZ A;  1A7D A;  5KYW B;  4OIO F;  5T1D B;  3K1I A;  3U9M A;  1A7E A;  4A4A A;  2LFF A;  4I44 A;  2NPU A;  3K6B A;  2F22 A;  2D4U A;  1J8Y F;  4W8K A;  2IBF A;  1LE4 A;  3S29 A;  4JVS A;  1H9T A;  2LD6 A;  2ZXO A;  3B0P A;  1E2X A;  3FOP A;  2HSQ A;  1S05 A; 
#chains in the Genus database with same CATH homology
 4H4K C;  2Y69 C;  4EWC A;  4I1O B;  4O6N A;  5B3S C;  2LSE A;  5DVW A;  3RYL A;  1IW7 F;  3B0V C;  4JCH A;  2V3C C;  2G3K A;  3EGX B;  3SNH A;  4G0H A;  2VAS A;  3LLI A;  4FES A;  4JUR I;  4BJ5 C;  2ZXP A;  2IXM A;  3F46 A;  4BG0 A;  2XRH A;  2Q9C A;  3AG1 C;  2YEV A;  4C7O B;  4IWB A;  1QLE C;  2ZXW C;  2Y39 A;  3DJU B;  4O6M A;  3ABL C;  4U5B E;  3GOD A;  1Z3I X;  1S7Z A;  4CIH A;  3K33 A;  3AQB A;  4GEH A;  3RKO F;  5KYX B;  3EQL F;  3K1I C;  2EIM C;  2I8B A;  4HEA J;  4DVZ A;  3IEE A;  4JW1 A;  4CBE A;  4O7G A;  3HJC A;  4XLN F;  3JYH A;  5KYN A;  2E87 A;  4XTK A;  2G62 A;  2R7U A;  3JT1 A;  2VH3 A;  3SP1 A;  3EFO A;  5IY5 C;  3LS1 A;  5KYU A;  2H7V C;  5F5H A;  3NKE A;  3EHN A;  2WVN A;  3DMD A;  2IOQ A;  4OIR F;  1D0X A;  1Z5Z A;  3LEV A;  1M2O A;  3SYN A;  4DBR A;  3DJN B;  2NUP B;  3LLK A;  3ZC4 A;  2KJG A;  3GAN A;  5FCL A;  3NYL A;  4YT4 A;  2R7R A;  4OIQ F;  3AQC A;  3K66 A;  3M1C B;  3NYM A;  3W8H A;  2EIN C;  3EGD A;  4M63 A;  3W2W A;  4RBN A;  4E7Z A;  3CSK A;  3X1O A;  1FFH A;  4PJL A;  3UR3 C;  4U5F E;  1SZI A;  1BR2 A;  4BJ6 A;  2IXN A;  4OD5 A;  5T3W A;  2MYS A;  4Q4Z F;  3CQZ A;  2KQ9 A;  2W4M A;  2WVO A;  4Q5S F;  4X0R A;  2R7S A;  4QDL A;  2B0J A;  3WG7 C;  3KMI A;  1ZHZ A;  4KBL A;  1MMN A;  5B1A C;  4PJJ A;  1M2V B;  3B0U X;  2O9X A;  5DS5 A;  2C04 A;  3HTK C;  3SZR A;  5KYW A;  3JSZ A;  3EHM A;  2A1D D;  2NUP A;  2KNH A;  5CI8 A;  4IAO A;  1VK5 A;  4JZA A;  5DS4 A;  4C3E A;  1MMG A;  3FHD A;  3I5P A;  3NDB B;  1W2W A;  3EZI A;  4K7B A;  1FFT C;  1Z23 A;  1MNE A;  4LAC B;  3DZA A;  3L0I A;  3X2Q C;  3ZG1 A;  3N2Z B;  2DYS C;  1NU7 D;  4CS7 A;  2R7T A;  2XSE A;  3JCU Q;  2BE5 F;  2YHS A;  3ECS A;  4BJ6 C;  2NUT B;  4IJJ A;  4KI2 A;  4CS9 C;  4Q7C A;  2Q9A A;  2R7W A;  4C7O A;  3V7O A;  3EPV A;  5E3A A;  3LNR A;  4RD9 A;  4PFO A;  3ABK C;  3QZC A;  4BJ5 A;  5HSW A;  2J0W A;  2G3V A;  4G7O F;  3K7D A;  5KYX A;  2IYL D;  3CZ6 A;  1OCC C;  4NY3 A;  4CS9 A;  2HV6 A;  1ST6 A;  1ZHY A;  2J9U A;  1D1A A;  2OCC C;  4F4B A;  2M4E A;  3EFO B;  4PFP A;  5E3C A;  3Q7L A;  5KYU B;  3SEO A;  4LLE A;  3UMH A;  4CSA C;  4U5C E;  3NG1 A;  2J46 A;  3POV A;  4JJF A;  3K1H A;  4EBB A;  1ZHT A;  3ZVR A;  2Y3D A;  4ZLD A;  4IRU A;  3ITF A;  3T4R A;  5B1B C;  1TWG A;  4C3D A;  4J30 B;  1FMW A;  1KU2 A;  1V55 C;  4KNV A;  2A6H F;  4A2N B;  3ZIB A;  4OIO F;  2W9Y A;  1Z63 A;  4JJG A;  3S27 A;  3WOD F;  4P6I C;  2QY9 A;  1N1C A;  4HFK B;  2R7V A;  5EGY A;  3QMK A;  1TKN A;  2P7V A;  3EH1 A;  4WJ0 A;  2NG1 A;  1RJ9 B;  4PJM A;  5F5F A;  1ZU4 A;  2FFH A;  4KNW A;  1QZX A;  3DM9 B;  4BJ1 A;  4DVY P;  5DQZ A;  3EZH A;  4BJT A;  3AG2 C;  3DAF A;  4N06 A;  4I3M A;  1PD1 A;  4G7H F;  2L81 A;  2X51 A;  1D1B A;  3ASO C;  4YT5 A;  1PD0 A;  3I5Q A;  2J45 A;  4YWQ A;  2WZG A;  2WVQ A;  2ZXR A;  2CNW A;  3AG3 C;  2XL4 A;  2WL8 A;  1VYK A;  2Y3G A;  2MWQ A;  2W4B A;  4B6I A;  3LES A;  2Y3H A;  1OCR C;  2DYR C;  2JD3 A;  3OWT A;  4ULW A;  2WZL A;  3Q6N A;  3KKB A;  1JPN A;  1O87 A;  1V54 C;  2R7O A;  3EG9 B;  1VMA A;  1MMD A;  3KH2 A;  2CGE A;  3L34 A;  2NUT A;  5T3T A;  3VYW A;  4ANJ A;  5E33 A;  1BR4 A;  5D91 A;  1LS1 A;  2XXA A;  4CSA A;  2A6E F;  3N24 A;  2PFD A;  2CNW D;  3O39 A;  4ZLC A;  4AE4 B;  1M57 C;  1NG1 A;  1BR1 A;  4HFF B;  4YJW A;  3H65 A;  2GFH A;  4I1M A;  2J7P D;  4E7S A;  2CW0 F;  2IXO A;  4OIN F;  4LER A;  3T6J A;  2Y3B A;  4U5D E;  1G8X A;  4MND A;  3NYJ A;  3Q6M A;  3W8I A;  4HE8 D;  1ZU5 A;  2H7O A;  2J9W A;  3PMR A;  4J32 B;  3UNG C;  3KL4 A;  3JRT A;  3LS0 A;  1NU9 C;  4KC9 A;  2WZF A;  4U5G A;  3E9V A;  4LLC A;  2Z15 A;  5DQT A;  4CS8 C;  3UMI A;  3ABM C;  3DAG A;  3FDQ A;  4FX5 A;  1LKX A;  1MMA A;  3DM5 A;  2PX3 A;  4AX2 A;  4YT2 A;  5D92 A;  2R7X A;  5L3V A;  3DD7 A;  2J0X A;  1D0Z A;  4XWJ A;  1OCO C;  2A69 F;  4U5E E;  4DBQ A;  4AE4 A;  3ASN C;  3LAY A;  1LVK A;  3RH3 A;  4MQ9 F;  1RJ9 A;  3NRH A;  3RIP A;  1MND A;  3EH2 A;  1M56 C;  2ZPA A;  2VB6 A;  2V26 A;  5BUO A;  4G7Z F;  1OCZ C;  3DXJ F;  4PK4 A;  3PHF 2;  4YT8 A;  3TD7 A;  3S28 A;  4RDA A;  1ZHW A;  4YN0 B;  2PP4 A;  4QI0 A;  1IZM A;  1TWH A;  4U5H A;  5E2Q A;  4O79 A;  2W45 A;  3FVY A;  2Q3T A;  4C3B A;  2CDQ A;  2J9V A;  3MX3 A;  2PX0 A;  1TWC A;  1ZYR F;  5DS6 A;  2OG2 A;  5EHH A;  4XLP F;  1J8M F;  2QTV A;  2Q9B A;  1PCX A;  2C03 A;  3UGP A;  5KYY A;  3EG9 A;  3FAJ A;  4FWV A;  1SF8 A;  3F47 A;  2P6V A;  3UGO A;  4BEJ A;  3S0X A;  3NKD A;  1D1C A;  2FGY A;  2XXA B;  1TWA A;  1Z6A A;  2KW3 C;  3EJN A;  3AG4 C;  4K0D A;  3UMK A;  1SMY F;  1VOM A;  3Q7G A;  4OIP F;  3W2V A;  4CS8 A;  3B9Q A;  3VAY A;  1JPJ A;  1D0Y A;  1OKK D;  1ZHX A;  1FTS A;  3OEO A;  5L3Q A;  1TR2 A;  3EGD B;  3OA1 A;  4O6Y A;  3T6B A;  2KGO A;  5CI9 A;  1NZE A;  3I4U A;  2L9J A;  4OD4 A;  2IXP A;  4GYT A;  1O5H A;  2EIJ C;  4PJN A;  3EGX A;  3RFY A;  3O6X A;  5DLJ A;  5KYY B;  2PF4 E;  2EIK C;  3MLG A;  1WGW A;  1VYI A;  3LJB A;  3HLZ A;  2DGJ A;  2WB7 A;  2YZS A;  3N0T A;  2R7Q A;  1FMV A;  2A68 F;  2HV7 A;  1M2V A;  3ZSU A;  4QI2 A;  4AK9 A;  1OKK A;  2J7P A;  2D5R B;  2EIL C;  2H7B A;  3E70 C;  4DOZ A;  5KYW B;  5T1D B;  4I44 A;  3K6B A;  4W8K A;  1J8Y F;  3S29 A;  4JVS A;  2ZXO A;  3B0P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...