3DJUB

Crystal structure of human btg2
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
121
structure length
121
Chain Sequence
TDMLPEIAAAVGFLSSLLRTRGCVSEQRLKVFSGALQEALTEHYKHHWFPEKPSKGSGYRCIRINHKMDPIISRVASQIGLSQPQLHQLLPSELTLWVDPYEVSYRIGEDGSICVLYEEAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of human BTG2 and mouse TIS21 involved in suppression of CAF1 deadenylase activity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Protein BTG2
total genus 35
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2008-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07742 BTG BTG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1120 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3djuB00
2D5RB 3E9VA 3DJUB 5CI8A 2Z15A 3DJNB 5CI9A
chains in the Genus database with same CATH superfamily
3SNHA 2AWYA 4Q7CA 4LDKA 2QUPA 4YL1A 5L3QA 3ZTMA 3IQTA 1MNDA 3L8JA 5COGA 4EKWA 4E7ZA 1SR2A 4MVOA 1ZVZA 1AVOB 1O5HA 2L6GA 4KC9A 3EPVA 2XLEA 4ONSA 4LDRA 3K1IA 4P6IC 1PD1A 1OCRC 4U5BE 5AC4A 3LEVA 5KYUA 3UMHA 1IZMA 2PNOA 3GWLA 5E3CA 5TJ5E 4D4NA 3CEXA 5KYUB 3NKDA 2PX0A 4JVSA 1VB5A 1LM3B 1OXBA 1UFBA 2HMZA 3UMIA 3AQBA 2J7PA 4E0IA 3ZWIA 2WZLA 3QMKA 1NBBA 1NU7D 2GDCA 4YJWA 1J8MF 1TR2A 1KTMA 3IQ5A 5F5HA 3G50A 3S28A 1ZW3A 4C3BA 1Z23A 1RMVA 5DLJA 3GEHA 1M56C 4DRIB 4U5DE 3LS1A 1T6UA 4WGYA 2R7RA 3DM5A 2D5RB 1MNEA 4QDLA 2IXOA 2LFDA 4K7BA 2XLDA 3C8GB 2CCYA 2V26A 4I44A 1RJ9A 2LP4A 4YN0B 3W2VA 3E9VA 3SP1A 1RXQA 2IXNA 4FWVA 5JT4A 3R2PA 3HJCA 2W4BA 3U9MA 4KI2A 4DJ9A 4J30B 1A7EA 3AG4C 1QVXA 4EIYA 1ZHXA 3QVYA 3SXZA 2G3KA 4CJGA 4DXWA 1QLEC 1ZYRF 2C04A 3M15A 3U9JA 1H9GA 2RSEB 2HV7A 2YEVA 3QW0A 3HNIA 4IAOA 2DYRC 3H65A 2WVQA 3KPHA 5DQZA 2P61A 4NTAA 1SMYF 3C18A 3W4YA 3TJ6A 4E18A 2NG1A 1M2VB 1RCPA 5DS4A 4MVUA 2NUPA 3G4XA 3KL4A 4MW3A 4D4XA 2I15A 3T9OA 3IEEA 2I8BA 2R7SA 4G7ZF 3EHMA 2PFDA 4JIOA 5EK0A 3TQOA 2QTVA 3FMSA 4CS7A 3GWNA 2QLAA 1S05A 3Q6NA 3FOPA 3VF0A 2C03A 2YKZA 3ABLC 1O3UA 4CS8A 2R03A 1OXKA 3I5PA 3U2LA 2Y69C 2OJQA 3Q7GA 1ORYA 3B71A 3JT1A 3NKEA 2YL7A 3TULA 5A69A 1JPJA 2CW0F 4IJJA 2YQYA 2A68F 2NSGA 2NUTB 3DD7A 3L8IA 4IARA 4N6CA 4U5CE 3R7CA 3T6JA 2B0JA 3PCVA 2R7QA 3U3BA 4AK9A 5B3IA 3U0CA 4I1OB 1C02A 1YA7O 2XLOA 3T4RA 3W8IA 1E2XA 2A69F 4CBEA 5A6BD 3EJNA 1YYXA 3C8ZA 2EPNA 3DE8A 3WG7C 5DS6A 1I4ZA 1OCCC 2EPMX 1D0YA 4P9TA 3KMIA 2QNLA 3F46A 1ZU5A 4O6NA 4IGGA 4EWCA 4LLEA 3FVYA 3WHNA 3JYHA 5CI9A 3TK0A 2GA0A 4GQHA 1FFTC 2PF4E 3CAXA 3EGDB 1WOLA 3RVZA 2CYDA 4NC3A 3VM6A 1YARO 1E84A 1HW2A 1C03A 5KYYB 4O6YA 1HMOA 1YAUO 3A11A 3DXJF 1D1CA 4Z9HA 4DBRA 3PHF2 1MMGA 1ZHTA 3KH2A 1RKEB 5L0IA 3GM3A 4PFOA 3PDMP 3VRCA 2XSEA 3DKAA 2B0HA 3IPMO 4BEMJ 3B0PA 3F47A 2HV6A 3SXKA 4I3MA 2DYSC 1QZXA 4IRUA 1D1AA 2HUJA 3ATPA 1K05A 4YT8A 4YL0A 5BQIA 2IBFA 5JP7A 4AL0A 3AG2C 3IQ6A 4L6RA 2ZXPA 3C63A 4YK5A 2W4MA 3GODA 1BDJB 1OW8A 4Z9IA 3AG1C 4AE4A 4XQ1A 2J8WA 3EG9B 2F22A 3NMIA 4CIHA 4G0HA 5KYYA 1FR0A 3M4BA 1DOVA 1GGQA 2D4UA 3NMJA 1DOWA 2R25A 1K40A 3S9OA 1ZHZA 1TFOB 4XPWA 4EBJA 3DAGA 2W45A 1KU2A 1Z7Qc 2ASRA 4ZLDA 1GS9A 2ZXOA 4HFFB 5AGFA 5JUAA 3HTKC 4MS2A 1Z63A 2PBEA 4OD4A 1PCXA 4MVQA 4NTFA 2P6VA 1YA9A 4BJ6C 2R7WA 2XXAA 2LCHA 3FXHA 2QE9A 2R7OA 4JJFA 3SXYA 3LNMB 3VYWA 2V3CC 4JE9A 3HLZA 1LI5A 1OR2A 4JTCB 3MYFA 3M4CA 4YT4A 3UGPA 3FOOA 2XS8A 3SEOA 3C62A 3ZSUA 4ER9A 1MMDA 3H2VA 1EA8A 2P1AA 3MLGA 3C8GD 3AJMA 1RKCA 1QSPA 2AP3A 3ZQYA 4CSAC 4JTAB 1V54C 1TFKB 1M2VA 2IXPA 3LNRA 2NUPB 4NY3A 2XXAB 3HNKA 2UUHA 4QI2A 4KNWA 1BR2A 1T9KA 2R05A 4NTBA 4LERA 2OCCC 5COMA 4M63A 4CDYA 4B6IA 4CJOA 1A41A 5L0FA 1YLMA 3J06A 4O79A 2PP4A 3JSZA 1CGOA 4MTGA 4DVZA 3U3FA 4RBNA 5L0HA 3RF3A 2XL6A 2OEVA 4XLPF 3HNLA 2AU5A 3M79A 3WAQA 2BC5A 2LSEA 3S0XA 3JRTA 3JTLO 4DBQA 1AUEA 1R5ID 3GORA 2L81A 1TKNA 1I5NA 4XEKA 4BJTA 3V5XA 1ZHYA 1CGME 1SYQA 1Z5ZA 3QVZA 1FNTc 5E3AA 3GEEA 3CQZA 4PJMA 4FESA 3L0IA 4K0DA 3LEOA 1WASA 3EZIA 4W8KA 5CI8A 5K0IA 5JVEA 3RW0A 2VASA 3N2ZB 1FMVA 3RQEA 4P9FA 4DRJB 1JPNA 2LD6A 2UUIA 2KQ9A 2WVNA 3PMRA 2IYLD 1VMAA 4GYTA 3S29A 4XPXA 2DB4A 1VYKA 3ITFA 3ZVRA 3TJ5A 3S90A 4CIPA 2AWCA 4IB4A 2OG2A 4U9DA 3I4UA 3Q6MA 4JJGA 3A9CA 2Y3DA 2YRFA 1VK5A 4BJ6A 1HW1A 1MMNA 2HSBA 3K66A 3LS0A 1Q0KA 2GFHA 3B29A 4HE8D 2LFFA 1V4AA 2H8AA 4WJ0A 5L0DA 2EPOA 3ABKC 5COFA 3GEIA 5CIVA 5B3SC 2H7BA 4PACA 2E87A 2HMQA 1U89A 3MX3A 4HFKB 2ZPAA 2L6FA 1OR3A 2Q7RA 4MTOA 2XLWA 4W8PA 3EGXA 1G5ZA 1H6GA 2HJ3A 1FTSA 1JAFA 3GM1A 3V5ZA 1RKEA 1CGNA 4A2NB 4YWQA 3U8PA 1NZEA 3ASNC 3B0UX 3Q7LA 1CPRA 1EI7A 3HKKA 2ETSA 1VYIA 4MVZA 3LESA 4FAPB 2G62A 3US6A 2EIKC 2YZSA 3KYJA 4E0HA 1LE2A 2LQGA 4Z9JA 1OW6A 3V7OA 3NYJA 2DI3A 2FAPB 4BG0A 2Z15A 2M64A 2KC3A 2MYSA 4J7TA 4JW1A 4EHPA 5A6KA 2X51A 5T3WA 3MFNA 5F28E 4E17A 2FGYA 2OOCA 2VC9A 1XWJA 4JTDB 2XM4A 3EG9A 4JCZA 4AE4B 1JRAA 4MQ9F 5T3TA 3RKOF 2R02A 5JLIA 4C3DA 4C7OA 1D0XA 1JR8A 3FAJA 2OU6A 3RVYA 2LK4A 3UR3C 2XL4A 1Q0DA 5GPGB 3V5YA 4RD9A 4ULVA 2YLIA 4BJ5C 3MYIA 3SZRA 1KNYA 3N24A 5FCLA 1K04A 2WVOA 2OQMA 3ZG1A 1EQ1A 3EH1A 5EHHA 3S84A 1L3PA 3ECSA 4JCHA 3U5SA 4UDVA 3L34A 3UNGC 4EBKA 4J32B 4E7SA 3OEOA 1NFOA 1BR4A 2JX0A 2M4EA 1JOGA 4OIRF 3K7DA 1WGWA 4BJ1A 2Q9BA 2YVKA 2XLHA 2ZXWC 4NCQA 4CS9C 1NFNA 2VCBA 2O9XA 1JMWA 1NG1A 4KNVA 4XLNF 4MTFA 3RFYA 3UMKA 4BPMA 5F5FA 1E83A 2L7AA 1WTYA 3SYNA 2VCCA 4FX5A 4DVYP 5A6BA 1C17M 2CNWA 2EPKX 1HE9A 4KBLA 1OKKA 1OCOC 3JRMO 3B0VC 3BRJA 3K1HA 2J9VA 2NUTA 3TD7A 3U8VA 3O10A 1ORJA 2QY9A 2ZXRA 1TWCA 3JCUQ 1M57C 2A1DD 4ULWA 3RQGA 4OIPF 2ZD9A 1TWAA 2YHSA 2J9WA 4I1MA 4MVSA 4MNDA 5B1BC 5JSLA 2A6HF 2J0WA 2J7PD 3T6BA 1OW7A 5JRAA 4YT2A 4G7HF 1Z3IX 2JPUA 2GAQA 4PJNA 3AG3C 4XEVA 5DS5A 1BZ4A 3RIPA 2NSFA 2PX3A 2RD9A 3DJNB 3K33A 4N4WA 4CX9A 5L0GA 3ZQVA 3S27A 3LLKA 1ORSC 2Y3BA 3NYLA 1NLXA 2Q9AA 2Y3HA 3EHNA 3WODF 3FHDA 3CSKA 1Q0FA 2R9RB 4G78A 1MQVA 2KYHA 1YYJA 4XWJA 1HMDA 2LIGA 3LUTB 1H7IA 2YLGA 4DOZA 5IY5C 2X0CA 5KYWB 3ASOC 1XZPA 1Z6AA 2VB6A 1V74B 2YWAA 1A7DA 1ZU4A 2MHRA 3G4ZA 4F4BA 3UGOA 1BBHA 3IHUA 4QI0A 2Q00A 3GM2A 3ZTZA 5L3VA 3LLIA 3N0TA 4JZAA 3JSEO 3EH2A 1AEPA 1VOMA 2J45A 3LAYA 4IWBA 1T5OA 4C3EA 4LLCA 3M1CB 4U9EA 4O7GA 2Y39A 2EPLX 2J9UA 1T6QA 3AGTA 2CDQA 4X0RA 4O6MA 1G4WR 3JZ0A 4WABA 1LS4A 4JRZA 1FMWA 1H9TA 1TWHA 4PR9A 2EILC 2XL8A 4LDQA 5BQHA 1YZAA 4JEAA 3MBGA 3C7JA 3RQFA 4R32A 1QPUA 256BA 1D1BA 1R4TA 4HEAJ 1O87A 3ZIBA 1V55C 2J46A 2OJED 4PJJA 5KYXA 1LS1A 2BL2A 1T6IA 2HZ8A 3KKBA 2JD3A 2XLVA 4MVMA 1WATA 1UG7A 2A0UA 2Q4FA 4JURI 2J0XA 1LE4A 1S7ZA 3AQCA 3IQCA 3W2WA 3DAFA 2HFIA 2YL0A 1PV3A 3K6BA 2YLDA 4EBBA 2HKVA 1QQ3A 2EINC 2HJMA 4C7OB 3O55A 1QKRA 3DJUB 1YZCA 4Q4ZF 1NSGB 1F1MA 1G8XA 1TQGA 3T6GB 4CS9A 1OQCA 4ZLCA 1SF8A 4U5FE 5EGYA 5HSWA 2WZGA 2XRHA 3FDQA 4AL1A 2R7TA 2KW3C 2VCAA 2IXMA 4BEJA 4MVRA 2ICWG 2KK1A 2L9JA 3ABMC 5D91A 5A6JA 1HE1A 2EIJC 4XPYA 3TOMA 1BR1A 3NYMA 5L0JA 5KYNA 1CPQA 2NPUA 1MMAA 4PK4A 1M6TA 1I4YA 1ST6A 2G3VA 3LJBA 2A6EF 4OD5A 3C8GA 1TWGA 2KJGA 1ZW2A 1YVIA 1T01A 2HS5A 3O39A 3AOUA 5DVWA 4U5GA 3NG1A 5JS5A 4OINF 4CS8C 2Q3TA 2R7UA 2AVKA 1E86A 2GWWA 2L6HA 3ZC4A 3K1IC 1HY5A 1YDIA 3DMDA 1FAPB 3DI5A 2WL8A 3SXMA 4U5EE 2WZFA 1VLSA 4PFPA 5T1DB 1XZQA 1N1CA 3DWWA 1A0BA 3X2QC 4OIQF 5BUOA 2R7VA 1LIHA 3EZHA 4LACB 4A4AA 3I5QA 4K1OA 3JYYA 4CSAA 2KSFA 4G7OF 4NQFA 1G4US 5B1AC 4XTKA 3TOLA 2XLMA 3DE9A 3QTHA 1LPEA 3OA1A 2IOQA 4XEFA 1RJ9B 3NRHA 3RH3A 3CZ6A 1E85A 1VTMP 1WWPA 4H54A 4AX2A 3NDBB 4DRHB 2CGEA 2P7VA 3HNJA 2EIMC 2J9BA 1J8YF 2XS1A 1U0BB 2FFHA 4CDVA 4U5HA 1LVKA 1NU9C 3VAYA 5BQGA 2Q9CA 1Y6DA 1M2OA 4JKVA 2OEXA 3DZAA 1ZHWA 3E70C 1U6HA 3RYLA 1OKKD 1FFHA 2A0BA 1IW7F 2CNWD 1L7CA 1Q0MA 1OCZC 1ZZPA 5AC5A 1APCA 3B9QA 3POVA 2WB7A 5L0CA 3AGUA 4CDAA 5KYWA 3EGDA 3EQLF 4EUKB 1PD0A 5KYXB 1SZIA 2H7VC 4MW8A 2P0NA 4BJ5A 2Y3GA 1D0ZA 4GEHA 4N06A 4ANJA 4J7YA 4WGZA 5HV9A 2YL3A 3L1MA 3O6XA 1LI7A 4YL3A 2H7OA 5D92A 5FZTA 1LKXA 3BEHA 4PJLA 3QW1A 2YL1A 4N6HA 3W8HA 2IM8A 3FAPB 2BE5F 4JEBA 3KYIA 3ZDLA 1GM5A 2XM0A 2DGJA 2R7XA 1W2WA 1EKYA 1VLTA 2KNHA 1A7VA 3EGXB 5DQTA 5A6AA 3OWTA 2MWQA 1Y4CA 2KGOA 1WN0A 3H2UA 4JC7A 3EFOB 5E2QA 2TMVP 3DM9B 3X1OA 2OKUA 3GANA 4IAQA 4YT5A 3EFOA 2W9YA 1GQAA 5E33A 4Q5SF 4OIOF 2VH3A 3U2MA 1B68A 4H4KC 4RDAA 3QZCA 2HSQA 1Q0GA 1YJGA 3NMKA
chains in the Genus database with same CATH topology
3SNHA 4Q7CA 5L3QA 1MNDA 4E7ZA 4KC9A 1O5HA 3EPVA 4P6IC 1PD1A 1OCRC 4U5BE 3LEVA 5KYUA 3UMHA 1IZMA 5E3CA 5KYUB 3NKDA 2PX0A 4JVSA 3UMIA 3AQBA 2J7PA 2WZLA 3QMKA 1NU7D 4YJWA 1J8MF 1TR2A 5F5HA 3S28A 4C3BA 1Z23A 5DLJA 1M56C 4U5DE 3LS1A 2R7RA 3DM5A 2D5RB 1MNEA 4QDLA 2IXOA 4K7BA 4I44A 2V26A 1RJ9A 4YN0B 3W2VA 3E9VA 3SP1A 2IXNA 4FWVA 3HJCA 2W4BA 4KI2A 4J30B 3AG4C 1ZHXA 2G3KA 1QLEC 1ZYRF 2C04A 2YEVA 2HV7A 4IAOA 2DYRC 3H65A 2WVQA 5DQZA 1SMYF 2NG1A 1M2VB 5DS4A 2NUPA 3KL4A 3IEEA 2I8BA 2R7SA 4G7ZF 3EHMA 2PFDA 2QTVA 4CS7A 3Q6NA 4CS8A 2C03A 3ABLC 3I5PA 2Y69C 3Q7GA 3JT1A 3NKEA 1JPJA 2CW0F 4IJJA 3DD7A 2A68F 2NUTB 3ZC4A 3T6JA 4U5CE 4G7HF 2XXAB 2B0JA 2R7QA 4AK9A 4I1OB 3W8IA 3T4RA 2A69F 4CBEA 3EJNA 3WG7C 5DS6A 1OCCC 1D0YA 3KMIA 3F46A 1ZU5A 4O6NA 4EWCA 4LLEA 3FVYA 3JYHA 5CI9A 1FFTC 2PF4E 3EGDB 5KYYB 4O6YA 4DBRA 3DXJF 1D1CA 3PHF2 1MMGA 1ZHTA 3KH2A 4PFOA 2XSEA 3B0PA 3F47A 2HV6A 4I3MA 2DYSC 1QZXA 4IRUA 1D1AA 4YT8A 3AG2C 2ZXPA 2W4MA 3GODA 4AE4A 3AG1C 3EG9B 4CIHA 4G0HA 5KYYA 1ZHZA 3DAGA 2W45A 1KU2A 4ZLDA 2ZXOA 4HFFB 1Z63A 3HTKC 4OD4A 1PCXA 2P6VA 4BJ6C 2R7WA 2R7OA 4JJFA 3VYWA 2V3CC 3HLZA 3UGPA 3SEOA 3ZSUA 1MMDA 3MLGA 4CSAC 1V54C 2IXPA 1M2VA 3LNRA 2NUPB 4NY3A 4QI2A 4KNWA 1BR2A 4LERA 2OCCC 4M63A 4B6IA 4O79A 2PP4A 3JSZA 4DVZA 4RBNA 4XLPF 2LSEA 3S0XA 3JRTA 4DBQA 2L81A 1TKNA 4BJTA 1ZHYA 1Z5ZA 5E3AA 3CQZA 4PJMA 4FESA 3L0IA 4K0DA 3EZIA 4W8KA 5CI8A 2VASA 3N2ZB 1FMVA 1JPNA 2WVNA 2KQ9A 3PMRA 2IYLD 1VMAA 4GYTA 3S29A 3ITFA 1VYKA 3ZVRA 2OG2A 3I4UA 3Q6MA 4JJGA 2Y3DA 1VK5A 4BJ6A 1MMNA 3K66A 3LS0A 4HE8D 2GFHA 4WJ0A 3ABKC 5B3SC 2H7BA 2E87A 3MX3A 4HFKB 2ZPAA 3EGXA 1FTSA 4YWQA 4A2NB 1NZEA 3ASNC 3B0UX 3Q7LA 1VYIA 3LESA 2G62A 2EIKC 2YZSA 3V7OA 3NYJA 4BG0A 2Z15A 2MYSA 4JW1A 2X51A 5T3WA 2FGYA 4AE4B 3EG9A 4MQ9F 5T3TA 3RKOF 4C3DA 4C7OA 1D0XA 3FAJA 3UR3C 2XL4A 4RD9A 4BJ5C 3SZRA 3N24A 5FCLA 2WVOA 3ZG1A 3EH1A 5EHHA 3ECSA 4JCHA 3L34A 3UNGC 4J32B 4E7SA 3OEOA 1BR4A 2M4EA 4OIRF 3K7DA 1WGWA 4BJ1A 2Q9BA 2ZXWC 4CS9C 4KNVA 2O9XA 4XLNF 1NG1A 3RFYA 5F5FA 3UMKA 3SYNA 4FX5A 4DVYP 2CNWA 4KBLA 1OKKA 1OCOC 3B0VC 3TD7A 3K1HA 2J9VA 2NUTA 4YT4A 4ULWA 3JCUQ 2QY9A 2ZXRA 1TWCA 2XXAA 1M57C 2A1DD 4OIPF 1TWAA 2YHSA 2J9WA 4I1MA 4MNDA 5B1BC 2A6HF 2J0WA 2J7PD 3T6BA 4YT2A 1Z3IX 4PJNA 3AG3C 5DS5A 3RIPA 3K33A 2PX3A 3DJNB 3S27A 3LLKA 2Y3BA 3NYLA 2Q9AA 2Y3HA 3EHNA 3WODF 3FHDA 3CSKA 4XWJA 4DOZA 5IY5C 5KYWB 3ASOC 1Z6AA 2VB6A 3UGOA 1ZU4A 4F4BA 4QI0A 5L3VA 3LLIA 3N0TA 4JZAA 3EH2A 2J45A 1VOMA 4IWBA 3LAYA 4C3EA 4LLCA 3M1CB 4O7GA 2Y39A 2J9UA 2CDQA 4X0RA 4O6MA 1FMWA 1TWHA 2EILC 1D1BA 4HEAJ 1O87A 3ZIBA 1V55C 2J46A 5KYXA 4PJJA 1LS1A 3KKBA 2JD3A 4JURI 2J0XA 1S7ZA 3AQCA 3W2WA 3DAFA 3K6BA 4EBBA 2EINC 4C7OB 3DJUB 4Q4ZF 1G8XA 4CS9A 4ZLCA 1SF8A 4U5FE 5EGYA 5HSWA 2WZGA 2XRHA 3FDQA 2R7TA 2KW3C 2IXMA 4BEJA 2L9JA 3ABMC 5D91A 2EIJC 5KYNA 1BR1A 3NYMA 1MMAA 4PK4A 1ST6A 2G3VA 3LJBA 2A6EF 4OD5A 1TWGA 2KJGA 3O39A 5DVWA 4U5GA 3NG1A 4OINF 4CS8C 2Q3TA 2R7UA 3K1IC 3DMDA 2WL8A 4U5EE 2WZFA 4PFPA 5T1DB 1N1CA 3X2QC 4OIQF 5BUOA 2R7VA 3EZHA 4LACB 3I5QA 4CSAA 4G7OF 5B1AC 4XTKA 3OA1A 2IOQA 1RJ9B 3NRHA 3RH3A 3CZ6A 3NDBB 4AX2A 2CGEA 2P7VA 2EIMC 1J8YF 2FFHA 4U5HA 1LVKA 1NU9C 3VAYA 2Q9CA 1M2OA 3DZAA 1ZHWA 3E70C 3RYLA 1OKKD 1FFHA 2CNWD 1IW7F 1OCZC 3B9QA 3POVA 2WB7A 5KYWA 3EGDA 3EQLF 1PD0A 5KYXB 1SZIA 2H7VC 4BJ5A 2Y3GA 1D0ZA 4GEHA 4N06A 4ANJA 3O6XA 2H7OA 5D92A 1LKXA 4PJLA 3W8HA 2BE5F 2R7XA 2DGJA 1W2WA 2KNHA 3EGXB 5DQTA 3OWTA 2MWQA 2KGOA 3EFOB 5E2QA 3DM9B 3X1OA 3GANA 4YT5A 5E33A 3EFOA 2W9YA 4Q5SF 4OIOF 2VH3A 4H4KC 4RDAA 3QZCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D5R B;  3E9V A;  3DJU B;  5CI8 A;  2Z15 A;  3DJN B;  5CI9 A; 
#chains in the Genus database with same CATH topology
 3SNH A;  2AWY A;  4Q7C A;  4LDK A;  2QUP A;  4YL1 A;  5L3Q A;  3ZTM A;  3IQT A;  1MND A;  3L8J A;  5COG A;  4EKW A;  4E7Z A;  1SR2 A;  4MVO A;  1ZVZ A;  1AVO B;  1O5H A;  2L6G A;  4KC9 A;  3EPV A;  2XLE A;  4ONS A;  4LDR A;  3K1I A;  4P6I C;  1PD1 A;  1OCR C;  4U5B E;  5AC4 A;  3LEV A;  5KYU A;  3UMH A;  1IZM A;  2PNO A;  3GWL A;  5E3C A;  5TJ5 E;  4D4N A;  3CEX A;  5KYU B;  3NKD A;  2PX0 A;  4JVS A;  1VB5 A;  1LM3 B;  1OXB A;  1UFB A;  2HMZ A;  3UMI A;  3AQB A;  2J7P A;  4E0I A;  3ZWI A;  2WZL A;  3QMK A;  1NBB A;  1NU7 D;  2GDC A;  4YJW A;  1J8M F;  1TR2 A;  1KTM A;  3IQ5 A;  5F5H A;  3G50 A;  3S28 A;  1ZW3 A;  4C3B A;  1Z23 A;  1RMV A;  5DLJ A;  3GEH A;  1M56 C;  4DRI B;  4U5D E;  3LS1 A;  1T6U A;  4WGY A;  2R7R A;  3DM5 A;  2D5R B;  1MNE A;  4QDL A;  2IXO A;  2LFD A;  4K7B A;  2XLD A;  3C8G B;  2CCY A;  2V26 A;  4I44 A;  1RJ9 A;  2LP4 A;  4YN0 B;  3W2V A;  3E9V A;  3SP1 A;  1RXQ A;  2IXN A;  4FWV A;  5JT4 A;  3R2P A;  3HJC A;  2W4B A;  3U9M A;  4KI2 A;  4DJ9 A;  4J30 B;  1A7E A;  3AG4 C;  1QVX A;  4EIY A;  1ZHX A;  3QVY A;  3SXZ A;  2G3K A;  4CJG A;  4DXW A;  1QLE C;  1ZYR F;  2C04 A;  3M15 A;  3U9J A;  1H9G A;  2RSE B;  2HV7 A;  2YEV A;  3QW0 A;  3HNI A;  4IAO A;  2DYR C;  3H65 A;  2WVQ A;  3KPH A;  5DQZ A;  2P61 A;  4NTA A;  1SMY F;  3C18 A;  3W4Y A;  3TJ6 A;  4E18 A;  2NG1 A;  1M2V B;  1RCP A;  5DS4 A;  4MVU A;  2NUP A;  3G4X A;  3KL4 A;  4MW3 A;  4D4X A;  2I15 A;  3T9O A;  3IEE A;  2I8B A;  2R7S A;  4G7Z F;  3EHM A;  2PFD A;  4JIO A;  5EK0 A;  3TQO A;  2QTV A;  3FMS A;  4CS7 A;  3GWN A;  2QLA A;  1S05 A;  3Q6N A;  3FOP A;  3VF0 A;  2C03 A;  2YKZ A;  3ABL C;  1O3U A;  4CS8 A;  2R03 A;  1OXK A;  3I5P A;  3U2L A;  2Y69 C;  2OJQ A;  3Q7G A;  1ORY A;  3B71 A;  3JT1 A;  3NKE A;  2YL7 A;  3TUL A;  5A69 A;  1JPJ A;  2CW0 F;  4IJJ A;  2YQY A;  2A68 F;  2NSG A;  2NUT B;  3DD7 A;  3L8I A;  4IAR A;  4N6C A;  4U5C E;  3R7C A;  3T6J A;  2B0J A;  3PCV A;  2R7Q A;  3U3B A;  4AK9 A;  5B3I A;  3U0C A;  4I1O B;  1C02 A;  1YA7 O;  2XLO A;  3T4R A;  3W8I A;  1E2X A;  2A69 F;  4CBE A;  5A6B D;  3EJN A;  1YYX A;  3C8Z A;  2EPN A;  3DE8 A;  3WG7 C;  5DS6 A;  1I4Z A;  1OCC C;  2EPM X;  1D0Y A;  4P9T A;  3KMI A;  2QNL A;  3F46 A;  1ZU5 A;  4O6N A;  4IGG A;  4EWC A;  4LLE A;  3FVY A;  3WHN A;  3JYH A;  5CI9 A;  3TK0 A;  2GA0 A;  4GQH A;  1FFT C;  2PF4 E;  3CAX A;  3EGD B;  1WOL A;  3RVZ A;  2CYD A;  4NC3 A;  3VM6 A;  1YAR O;  1E84 A;  1HW2 A;  1C03 A;  5KYY B;  4O6Y A;  1HMO A;  1YAU O;  3A11 A;  3DXJ F;  1D1C A;  4Z9H A;  4DBR A;  3PHF 2;  1MMG A;  1ZHT A;  3KH2 A;  1RKE B;  5L0I A;  3GM3 A;  4PFO A;  3PDM P;  3VRC A;  2XSE A;  3DKA A;  2B0H A;  3IPM O;  4BEM J;  3B0P A;  3F47 A;  2HV6 A;  3SXK A;  4I3M A;  2DYS C;  1QZX A;  4IRU A;  1D1A A;  2HUJ A;  3ATP A;  1K05 A;  4YT8 A;  4YL0 A;  5BQI A;  2IBF A;  5JP7 A;  4AL0 A;  3AG2 C;  3IQ6 A;  4L6R A;  2ZXP A;  3C63 A;  4YK5 A;  2W4M A;  3GOD A;  1BDJ B;  1OW8 A;  4Z9I A;  3AG1 C;  4AE4 A;  4XQ1 A;  2J8W A;  3EG9 B;  2F22 A;  3NMI A;  4CIH A;  4G0H A;  5KYY A;  1FR0 A;  3M4B A;  1DOV A;  1GGQ A;  2D4U A;  3NMJ A;  1DOW A;  2R25 A;  1K40 A;  3S9O A;  1ZHZ A;  1TFO B;  4XPW A;  4EBJ A;  3DAG A;  2W45 A;  1KU2 A;  1Z7Q c;  2ASR A;  4ZLD A;  1GS9 A;  2ZXO A;  4HFF B;  5AGF A;  5JUA A;  3HTK C;  4MS2 A;  1Z63 A;  2PBE A;  4OD4 A;  1PCX A;  4MVQ A;  4NTF A;  2P6V A;  1YA9 A;  4BJ6 C;  2R7W A;  2XXA A;  2LCH A;  3FXH A;  2QE9 A;  2R7O A;  4JJF A;  3SXY A;  3LNM B;  3VYW A;  2V3C C;  4JE9 A;  3HLZ A;  1LI5 A;  1OR2 A;  4JTC B;  3MYF A;  3M4C A;  4YT4 A;  3UGP A;  3FOO A;  2XS8 A;  3SEO A;  3C62 A;  3ZSU A;  4ER9 A;  1MMD A;  3H2V A;  1EA8 A;  2P1A A;  3MLG A;  3C8G D;  3AJM A;  1RKC A;  1QSP A;  2AP3 A;  3ZQY A;  4CSA C;  4JTA B;  1V54 C;  1TFK B;  1M2V A;  2IXP A;  3LNR A;  2NUP B;  4NY3 A;  2XXA B;  3HNK A;  2UUH A;  4QI2 A;  4KNW A;  1BR2 A;  1T9K A;  2R05 A;  4NTB A;  4LER A;  2OCC C;  5COM A;  4M63 A;  4CDY A;  4B6I A;  4CJO A;  1A41 A;  5L0F A;  1YLM A;  3J06 A;  4O79 A;  2PP4 A;  3JSZ A;  1CGO A;  4MTG A;  4DVZ A;  3U3F A;  4RBN A;  5L0H A;  3RF3 A;  2XL6 A;  2OEV A;  4XLP F;  3HNL A;  2AU5 A;  3M79 A;  3WAQ A;  2BC5 A;  2LSE A;  3S0X A;  3JRT A;  3JTL O;  4DBQ A;  1AUE A;  1R5I D;  3GOR A;  2L81 A;  1TKN A;  1I5N A;  4XEK A;  4BJT A;  3V5X A;  1ZHY A;  1CGM E;  1SYQ A;  1Z5Z A;  3QVZ A;  1FNT c;  5E3A A;  3GEE A;  3CQZ A;  4PJM A;  4FES A;  3L0I A;  4K0D A;  3LEO A;  1WAS A;  3EZI A;  4W8K A;  5CI8 A;  5K0I A;  5JVE A;  3RW0 A;  2VAS A;  3N2Z B;  1FMV A;  3RQE A;  4P9F A;  4DRJ B;  1JPN A;  2LD6 A;  2UUI A;  2KQ9 A;  2WVN A;  3PMR A;  2IYL D;  1VMA A;  4GYT A;  3S29 A;  4XPX A;  2DB4 A;  1VYK A;  3ITF A;  3ZVR A;  3TJ5 A;  3S90 A;  4CIP A;  2AWC A;  4IB4 A;  2OG2 A;  4U9D A;  3I4U A;  3Q6M A;  4JJG A;  3A9C A;  2Y3D A;  2YRF A;  1VK5 A;  4BJ6 A;  1HW1 A;  1MMN A;  2HSB A;  3K66 A;  3LS0 A;  1Q0K A;  2GFH A;  3B29 A;  4HE8 D;  2LFF A;  1V4A A;  2H8A A;  4WJ0 A;  5L0D A;  2EPO A;  3ABK C;  5COF A;  3GEI A;  5CIV A;  5B3S C;  2H7B A;  4PAC A;  2E87 A;  2HMQ A;  1U89 A;  3MX3 A;  4HFK B;  2ZPA A;  2L6F A;  1OR3 A;  2Q7R A;  4MTO A;  2XLW A;  4W8P A;  3EGX A;  1G5Z A;  1H6G A;  2HJ3 A;  1FTS A;  1JAF A;  3GM1 A;  3V5Z A;  1RKE A;  1CGN A;  4A2N B;  4YWQ A;  3U8P A;  1NZE A;  3ASN C;  3B0U X;  3Q7L A;  1CPR A;  1EI7 A;  3HKK A;  2ETS A;  1VYI A;  4MVZ A;  3LES A;  4FAP B;  2G62 A;  3US6 A;  2EIK C;  2YZS A;  3KYJ A;  4E0H A;  1LE2 A;  2LQG A;  4Z9J A;  1OW6 A;  3V7O A;  3NYJ A;  2DI3 A;  2FAP B;  4BG0 A;  2Z15 A;  2M64 A;  2KC3 A;  2MYS A;  4J7T A;  4JW1 A;  4EHP A;  5A6K A;  2X51 A;  5T3W A;  3MFN A;  5F28 E;  4E17 A;  2FGY A;  2OOC A;  2VC9 A;  1XWJ A;  4JTD B;  2XM4 A;  3EG9 A;  4JCZ A;  4AE4 B;  1JRA A;  4MQ9 F;  5T3T A;  3RKO F;  2R02 A;  5JLI A;  4C3D A;  4C7O A;  1D0X A;  1JR8 A;  3FAJ A;  2OU6 A;  3RVY A;  2LK4 A;  3UR3 C;  2XL4 A;  1Q0D A;  5GPG B;  3V5Y A;  4RD9 A;  4ULV A;  2YLI A;  4BJ5 C;  3MYI A;  3SZR A;  1KNY A;  3N24 A;  5FCL A;  1K04 A;  2WVO A;  2OQM A;  3ZG1 A;  1EQ1 A;  3EH1 A;  5EHH A;  3S84 A;  1L3P A;  3ECS A;  4JCH A;  3U5S A;  4UDV A;  3L34 A;  3UNG C;  4EBK A;  4J32 B;  4E7S A;  3OEO A;  1NFO A;  1BR4 A;  2JX0 A;  2M4E A;  1JOG A;  4OIR F;  3K7D A;  1WGW A;  4BJ1 A;  2Q9B A;  2YVK A;  2XLH A;  2ZXW C;  4NCQ A;  4CS9 C;  1NFN A;  2VCB A;  2O9X A;  1JMW A;  1NG1 A;  4KNV A;  4XLN F;  4MTF A;  3RFY A;  3UMK A;  4BPM A;  5F5F A;  1E83 A;  2L7A A;  1WTY A;  3SYN A;  2VCC A;  4FX5 A;  4DVY P;  5A6B A;  1C17 M;  2CNW A;  2EPK X;  1HE9 A;  4KBL A;  1OKK A;  1OCO C;  3JRM O;  3B0V C;  3BRJ A;  3K1H A;  2J9V A;  2NUT A;  3TD7 A;  3U8V A;  3O10 A;  1ORJ A;  2QY9 A;  2ZXR A;  1TWC A;  3JCU Q;  1M57 C;  2A1D D;  4ULW A;  3RQG A;  4OIP F;  2ZD9 A;  1TWA A;  2YHS A;  2J9W A;  4I1M A;  4MVS A;  4MND A;  5B1B C;  5JSL A;  2A6H F;  2J0W A;  2J7P D;  3T6B A;  1OW7 A;  5JRA A;  4YT2 A;  4G7H F;  1Z3I X;  2JPU A;  2GAQ A;  4PJN A;  3AG3 C;  4XEV A;  5DS5 A;  1BZ4 A;  3RIP A;  2NSF A;  2PX3 A;  2RD9 A;  3DJN B;  3K33 A;  4N4W A;  4CX9 A;  5L0G A;  3ZQV A;  3S27 A;  3LLK A;  1ORS C;  2Y3B A;  3NYL A;  1NLX A;  2Q9A A;  2Y3H A;  3EHN A;  3WOD F;  3FHD A;  3CSK A;  1Q0F A;  2R9R B;  4G78 A;  1MQV A;  2KYH A;  1YYJ A;  4XWJ A;  1HMD A;  2LIG A;  3LUT B;  1H7I A;  2YLG A;  4DOZ A;  5IY5 C;  2X0C A;  5KYW B;  3ASO C;  1XZP A;  1Z6A A;  2VB6 A;  1V74 B;  2YWA A;  1A7D A;  1ZU4 A;  2MHR A;  3G4Z A;  4F4B A;  3UGO A;  1BBH A;  3IHU A;  4QI0 A;  2Q00 A;  3GM2 A;  3ZTZ A;  5L3V A;  3LLI A;  3N0T A;  4JZA A;  3JSE O;  3EH2 A;  1AEP A;  1VOM A;  2J45 A;  3LAY A;  4IWB A;  1T5O A;  4C3E A;  4LLC A;  3M1C B;  4U9E A;  4O7G A;  2Y39 A;  2EPL X;  2J9U A;  1T6Q A;  3AGT A;  2CDQ A;  4X0R A;  4O6M A;  1G4W R;  3JZ0 A;  4WAB A;  1LS4 A;  4JRZ A;  1FMW A;  1H9T A;  1TWH A;  4PR9 A;  2EIL C;  2XL8 A;  4LDQ A;  5BQH A;  1YZA A;  4JEA A;  3MBG A;  3C7J A;  3RQF A;  4R32 A;  1QPU A;  256B A;  1D1B A;  1R4T A;  4HEA J;  1O87 A;  3ZIB A;  1V55 C;  2J46 A;  2OJE D;  4PJJ A;  5KYX A;  1LS1 A;  2BL2 A;  1T6I A;  2HZ8 A;  3KKB A;  2JD3 A;  2XLV A;  4MVM A;  1WAT A;  1UG7 A;  2A0U A;  2Q4F A;  4JUR I;  2J0X A;  1LE4 A;  1S7Z A;  3AQC A;  3IQC A;  3W2W A;  3DAF A;  2HFI A;  2YL0 A;  1PV3 A;  3K6B A;  2YLD A;  4EBB A;  2HKV A;  1QQ3 A;  2EIN C;  2HJM A;  4C7O B;  3O55 A;  1QKR A;  3DJU B;  1YZC A;  4Q4Z F;  1NSG B;  1F1M A;  1G8X A;  1TQG A;  3T6G B;  4CS9 A;  1OQC A;  4ZLC A;  1SF8 A;  4U5F E;  5EGY A;  5HSW A;  2WZG A;  2XRH A;  3FDQ A;  4AL1 A;  2R7T A;  2KW3 C;  2VCA A;  2IXM A;  4BEJ A;  4MVR A;  2ICW G;  2KK1 A;  2L9J A;  3ABM C;  5D91 A;  5A6J A;  1HE1 A;  2EIJ C;  4XPY A;  3TOM A;  1BR1 A;  3NYM A;  5L0J A;  5KYN A;  1CPQ A;  2NPU A;  1MMA A;  4PK4 A;  1M6T A;  1I4Y A;  1ST6 A;  2G3V A;  3LJB A;  2A6E F;  4OD5 A;  3C8G A;  1TWG A;  2KJG A;  1ZW2 A;  1YVI A;  1T01 A;  2HS5 A;  3O39 A;  3AOU A;  5DVW A;  4U5G A;  3NG1 A;  5JS5 A;  4OIN F;  4CS8 C;  2Q3T A;  2R7U A;  2AVK A;  1E86 A;  2GWW A;  2L6H A;  3ZC4 A;  3K1I C;  1HY5 A;  1YDI A;  3DMD A;  1FAP B;  3DI5 A;  2WL8 A;  3SXM A;  4U5E E;  2WZF A;  1VLS A;  4PFP A;  5T1D B;  1XZQ A;  1N1C A;  3DWW A;  1A0B A;  3X2Q C;  4OIQ F;  5BUO A;  2R7V A;  1LIH A;  3EZH A;  4LAC B;  4A4A A;  3I5Q A;  4K1O A;  3JYY A;  4CSA A;  2KSF A;  4G7O F;  4NQF A;  1G4U S;  5B1A C;  4XTK A;  3TOL A;  2XLM A;  3DE9 A;  3QTH A;  1LPE A;  3OA1 A;  2IOQ A;  4XEF A;  1RJ9 B;  3NRH A;  3RH3 A;  3CZ6 A;  1E85 A;  1VTM P;  1WWP A;  4H54 A;  4AX2 A;  3NDB B;  4DRH B;  2CGE A;  2P7V A;  3HNJ A;  2EIM C;  2J9B A;  1J8Y F;  2XS1 A;  1U0B B;  2FFH A;  4CDV A;  4U5H A;  1LVK A;  1NU9 C;  3VAY A;  5BQG A;  2Q9C A;  1Y6D A;  1M2O A;  4JKV A;  2OEX A;  3DZA A;  1ZHW A;  3E70 C;  1U6H A;  3RYL A;  1OKK D;  1FFH A;  2A0B A;  1IW7 F;  2CNW D;  1L7C A;  1Q0M A;  1OCZ C;  1ZZP A;  5AC5 A;  1APC A;  3B9Q A;  3POV A;  2WB7 A;  5L0C A;  3AGU A;  4CDA A;  5KYW A;  3EGD A;  3EQL F;  4EUK B;  1PD0 A;  5KYX B;  1SZI A;  2H7V C;  4MW8 A;  2P0N A;  4BJ5 A;  2Y3G A;  1D0Z A;  4GEH A;  4N06 A;  4ANJ A;  4J7Y A;  4WGZ A;  5HV9 A;  2YL3 A;  3L1M A;  3O6X A;  1LI7 A;  4YL3 A;  2H7O A;  5D92 A;  5FZT A;  1LKX A;  3BEH A;  4PJL A;  3QW1 A;  2YL1 A;  4N6H A;  3W8H A;  2IM8 A;  3FAP B;  2BE5 F;  4JEB A;  3KYI A;  3ZDL A;  1GM5 A;  2XM0 A;  2DGJ A;  2R7X A;  1W2W A;  1EKY A;  1VLT A;  2KNH A;  1A7V A;  3EGX B;  5DQT A;  5A6A A;  3OWT A;  2MWQ A;  1Y4C A;  2KGO A;  1WN0 A;  3H2U A;  4JC7 A;  3EFO B;  5E2Q A;  2TMV P;  3DM9 B;  3X1O A;  2OKU A;  3GAN A;  4IAQ A;  4YT5 A;  3EFO A;  2W9Y A;  1GQA A;  5E33 A;  4Q5S F;  4OIO F;  2VH3 A;  3U2M A;  1B68 A;  4H4K C;  4RDA A;  3QZC A;  2HSQ A;  1Q0G A;  1YJG A;  3NMK A; 
#chains in the Genus database with same CATH homology
 3SNH A;  4Q7C A;  5L3Q A;  1MND A;  4E7Z A;  4KC9 A;  1O5H A;  3EPV A;  4P6I C;  1PD1 A;  1OCR C;  4U5B E;  3LEV A;  5KYU A;  3UMH A;  1IZM A;  5E3C A;  5KYU B;  3NKD A;  2PX0 A;  4JVS A;  3UMI A;  3AQB A;  2J7P A;  2WZL A;  3QMK A;  1NU7 D;  4YJW A;  1J8M F;  1TR2 A;  5F5H A;  3S28 A;  4C3B A;  1Z23 A;  5DLJ A;  1M56 C;  4U5D E;  3LS1 A;  2R7R A;  3DM5 A;  2D5R B;  1MNE A;  4QDL A;  2IXO A;  4K7B A;  4I44 A;  2V26 A;  1RJ9 A;  4YN0 B;  3W2V A;  3E9V A;  3SP1 A;  2IXN A;  4FWV A;  3HJC A;  2W4B A;  4KI2 A;  4J30 B;  3AG4 C;  1ZHX A;  2G3K A;  1QLE C;  1ZYR F;  2C04 A;  2YEV A;  2HV7 A;  4IAO A;  2DYR C;  3H65 A;  2WVQ A;  5DQZ A;  1SMY F;  2NG1 A;  1M2V B;  5DS4 A;  2NUP A;  3KL4 A;  3IEE A;  2I8B A;  2R7S A;  4G7Z F;  3EHM A;  2PFD A;  2QTV A;  4CS7 A;  3Q6N A;  4CS8 A;  2C03 A;  3ABL C;  3I5P A;  2Y69 C;  3Q7G A;  3JT1 A;  3NKE A;  1JPJ A;  2CW0 F;  4IJJ A;  3DD7 A;  2A68 F;  2NUT B;  3ZC4 A;  3T6J A;  4U5C E;  4G7H F;  2XXA B;  2B0J A;  2R7Q A;  4AK9 A;  4I1O B;  3W8I A;  3T4R A;  2A69 F;  4CBE A;  3EJN A;  3WG7 C;  5DS6 A;  1OCC C;  1D0Y A;  3KMI A;  3F46 A;  1ZU5 A;  4O6N A;  4EWC A;  4LLE A;  3FVY A;  3JYH A;  5CI9 A;  1FFT C;  2PF4 E;  3EGD B;  5KYY B;  4O6Y A;  4DBR A;  3DXJ F;  1D1C A;  3PHF 2;  1MMG A;  1ZHT A;  3KH2 A;  4PFO A;  2XSE A;  3B0P A;  3F47 A;  2HV6 A;  4I3M A;  2DYS C;  1QZX A;  4IRU A;  1D1A A;  4YT8 A;  3AG2 C;  2ZXP A;  2W4M A;  3GOD A;  4AE4 A;  3AG1 C;  3EG9 B;  4CIH A;  4G0H A;  5KYY A;  1ZHZ A;  3DAG A;  2W45 A;  1KU2 A;  4ZLD A;  2ZXO A;  4HFF B;  1Z63 A;  3HTK C;  4OD4 A;  1PCX A;  2P6V A;  4BJ6 C;  2R7W A;  2R7O A;  4JJF A;  3VYW A;  2V3C C;  3HLZ A;  3UGP A;  3SEO A;  3ZSU A;  1MMD A;  3MLG A;  4CSA C;  1V54 C;  2IXP A;  1M2V A;  3LNR A;  2NUP B;  4NY3 A;  4QI2 A;  4KNW A;  1BR2 A;  4LER A;  2OCC C;  4M63 A;  4B6I A;  4O79 A;  2PP4 A;  3JSZ A;  4DVZ A;  4RBN A;  4XLP F;  2LSE A;  3S0X A;  3JRT A;  4DBQ A;  2L81 A;  1TKN A;  4BJT A;  1ZHY A;  1Z5Z A;  5E3A A;  3CQZ A;  4PJM A;  4FES A;  3L0I A;  4K0D A;  3EZI A;  4W8K A;  5CI8 A;  2VAS A;  3N2Z B;  1FMV A;  1JPN A;  2WVN A;  2KQ9 A;  3PMR A;  2IYL D;  1VMA A;  4GYT A;  3S29 A;  3ITF A;  1VYK A;  3ZVR A;  2OG2 A;  3I4U A;  3Q6M A;  4JJG A;  2Y3D A;  1VK5 A;  4BJ6 A;  1MMN A;  3K66 A;  3LS0 A;  4HE8 D;  2GFH A;  4WJ0 A;  3ABK C;  5B3S C;  2H7B A;  2E87 A;  3MX3 A;  4HFK B;  2ZPA A;  3EGX A;  1FTS A;  4YWQ A;  4A2N B;  1NZE A;  3ASN C;  3B0U X;  3Q7L A;  1VYI A;  3LES A;  2G62 A;  2EIK C;  2YZS A;  3V7O A;  3NYJ A;  4BG0 A;  2Z15 A;  2MYS A;  4JW1 A;  2X51 A;  5T3W A;  2FGY A;  4AE4 B;  3EG9 A;  4MQ9 F;  5T3T A;  3RKO F;  4C3D A;  4C7O A;  1D0X A;  3FAJ A;  3UR3 C;  2XL4 A;  4RD9 A;  4BJ5 C;  3SZR A;  3N24 A;  5FCL A;  2WVO A;  3ZG1 A;  3EH1 A;  5EHH A;  3ECS A;  4JCH A;  3L34 A;  3UNG C;  4J32 B;  4E7S A;  3OEO A;  1BR4 A;  2M4E A;  4OIR F;  3K7D A;  1WGW A;  4BJ1 A;  2Q9B A;  2ZXW C;  4CS9 C;  4KNV A;  2O9X A;  4XLN F;  1NG1 A;  3RFY A;  5F5F A;  3UMK A;  3SYN A;  4FX5 A;  4DVY P;  2CNW A;  4KBL A;  1OKK A;  1OCO C;  3B0V C;  3TD7 A;  3K1H A;  2J9V A;  2NUT A;  4YT4 A;  4ULW A;  3JCU Q;  2QY9 A;  2ZXR A;  1TWC A;  2XXA A;  1M57 C;  2A1D D;  4OIP F;  1TWA A;  2YHS A;  2J9W A;  4I1M A;  4MND A;  5B1B C;  2A6H F;  2J0W A;  2J7P D;  3T6B A;  4YT2 A;  1Z3I X;  4PJN A;  3AG3 C;  5DS5 A;  3RIP A;  3K33 A;  2PX3 A;  3DJN B;  3S27 A;  3LLK A;  2Y3B A;  3NYL A;  2Q9A A;  2Y3H A;  3EHN A;  3WOD F;  3FHD A;  3CSK A;  4XWJ A;  4DOZ A;  5IY5 C;  5KYW B;  3ASO C;  1Z6A A;  2VB6 A;  3UGO A;  1ZU4 A;  4F4B A;  4QI0 A;  5L3V A;  3LLI A;  3N0T A;  4JZA A;  3EH2 A;  2J45 A;  1VOM A;  4IWB A;  3LAY A;  4C3E A;  4LLC A;  3M1C B;  4O7G A;  2Y39 A;  2J9U A;  2CDQ A;  4X0R A;  4O6M A;  1FMW A;  1TWH A;  2EIL C;  1D1B A;  4HEA J;  1O87 A;  3ZIB A;  1V55 C;  2J46 A;  5KYX A;  4PJJ A;  1LS1 A;  3KKB A;  2JD3 A;  4JUR I;  2J0X A;  1S7Z A;  3AQC A;  3W2W A;  3DAF A;  3K6B A;  4EBB A;  2EIN C;  4C7O B;  3DJU B;  4Q4Z F;  1G8X A;  4CS9 A;  4ZLC A;  1SF8 A;  4U5F E;  5EGY A;  5HSW A;  2WZG A;  2XRH A;  3FDQ A;  2R7T A;  2KW3 C;  2IXM A;  4BEJ A;  2L9J A;  3ABM C;  5D91 A;  2EIJ C;  5KYN A;  1BR1 A;  3NYM A;  1MMA A;  4PK4 A;  1ST6 A;  2G3V A;  3LJB A;  2A6E F;  4OD5 A;  1TWG A;  2KJG A;  3O39 A;  5DVW A;  4U5G A;  3NG1 A;  4OIN F;  4CS8 C;  2Q3T A;  2R7U A;  3K1I C;  3DMD A;  2WL8 A;  4U5E E;  2WZF A;  4PFP A;  5T1D B;  1N1C A;  3X2Q C;  4OIQ F;  5BUO A;  2R7V A;  3EZH A;  4LAC B;  3I5Q A;  4CSA A;  4G7O F;  5B1A C;  4XTK A;  3OA1 A;  2IOQ A;  1RJ9 B;  3NRH A;  3RH3 A;  3CZ6 A;  3NDB B;  4AX2 A;  2CGE A;  2P7V A;  2EIM C;  1J8Y F;  2FFH A;  4U5H A;  1LVK A;  1NU9 C;  3VAY A;  2Q9C A;  1M2O A;  3DZA A;  1ZHW A;  3E70 C;  3RYL A;  1OKK D;  1FFH A;  2CNW D;  1IW7 F;  1OCZ C;  3B9Q A;  3POV A;  2WB7 A;  5KYW A;  3EGD A;  3EQL F;  1PD0 A;  5KYX B;  1SZI A;  2H7V C;  4BJ5 A;  2Y3G A;  1D0Z A;  4GEH A;  4N06 A;  4ANJ A;  3O6X A;  2H7O A;  5D92 A;  1LKX A;  4PJL A;  3W8H A;  2BE5 F;  2R7X A;  2DGJ A;  1W2W A;  2KNH A;  3EGX B;  5DQT A;  3OWT A;  2MWQ A;  2KGO A;  3EFO B;  5E2Q A;  3DM9 B;  3X1O A;  3GAN A;  4YT5 A;  5E33 A;  3EFO A;  2W9Y A;  4Q5S F;  4OIO F;  2VH3 A;  4H4K C;  4RDA A;  3QZC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...