3DJUB

Crystal structure of human btg2
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
121
structure length
121
Chain Sequence
b'TDMLPEIAAAVGFLSSLLRTRGCVSEQRLKVFSGALQEALTEHYKHHWFPEKPSKGSGYRCIRINHKMDPIISRVASQIGLSQPQLHQLLPSELTLWVDPYEVSYRIGEDGSICVLYEEAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein BTG2
publication title Crystal structures of human BTG2 and mouse TIS21 involved in suppression of CAF1 deadenylase activity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 35
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2008-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07742 BTG BTG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1120 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3djuB00
5CI9A 2D5RB 3E9VA 3DJUB 2Z15A 5CI8A 3DJNB
chains in the Genus database with same CATH superfamily
2J7PD 1TR2A 5DVWA 2OOCA 3T9OA 3KMIA 2FGYA 3RKOF 4NC3A 5DQZA 3UR3C 1OR3A 2EPLX 2IXOA 4NTBA 4D4NA 3U0CA 4PACA 4XLPF 4OINF 4QDLA 3B71A 3EFOB 3PHF2 2EPNA 1M56C 1K40A 3U8PA 3ZTZA 4YWQA 2R7TA 2A68F 4JC7A 2HV7A 2IYLD 4WGZA 3TD7A 4P9TA 4E7ZA 4XQ1A 1CGNA 1M2OA 2L6FA 4O7GA 3SYNA 3X1OA 3GORA 2YZSA 4XEVA 3JYHA 3VF0A 4AE4A 2G62A 5L0GA 4G7HF 1NU9C 1MMNA 2YL3A 1WGWA 3RIPA 4Z9JA 1MNEA 4DRIB 3ITFA 4MVMA 1LVKA 4J30B 3DXJF 1VOMA 4JURI 2ASRA 1HMOA 5A6AA 3FHDA 4GYTA 4CSAC 3M79A 4KC9A 3A9CA 2EPMX 3JRMO 4A4AA 1JPNA 3QMKA 2Q3TA 3RF3A 2YQYA 4IAOA 4KI2A 5CIVA 2J45A 2R7OA 4LDRA 3JYYA 3QVYA 4LERA 4F4BA 1VLTA 1WASA 2XL8A 2J9UA 2Y3HA 1HMDA 2O9XA 4U9EA 1NBBA 4U5CE 3QTHA 2LIGA 3V7OA 3EGDA 1YA9A 2NPUA 5KYXA 5EK0A 4MS2A 1OCZC 3KL4A 5A69A 2MWQA 5BQGA 1K04A 4FESA 1ZU5A 4AE4B 2XL4A 4JE9A 1I4ZA 1NLXA 4YT4A 2YKZA 2OEVA 2Y3GA 2NUTA 4E0IA 4E17A 4EIYA 4DRHB 3IQ6A 2OJED 3TOMA 2VB6A 2DYRC 4G78A 3RW0A 2BC5A 3KYJA 4G7OF 1XZQA 4MW8A 1FFTC 3AG4C 3E70C 3GWLA 4ULVA 4DJ9A 3B0PA 4O79A 2W4BA 5HV9A 3MBGA 1JPJA 3GM2A 4W8PA 5K0IA 1OCRC 3TK0A 1VLSA 1YDIA 2GA0A 3DAFA 2IM8A 1A7DA 1MMGA 2VCCA 3EH2A 4DBRA 3B0UX 1Z3IX 2L6HA 1HE9A 3AG2C 4KBLA 1G4WR 1E2XA 3EGDB 5KYXB 2VCBA 1MMAA 3Q6NA 3ZDLA 2HFIA 3R2PA 1OW7A 2Q7RA 3POVA 1G4US 2LFFA 3OEOA 4NY3A 1D1CA 2YL1A 3BRJA 2NUTB 2Q9CA 3C8GD 5A6KA 3F46A 4BEMJ 3EJNA 3I4UA 4Q7CA 1O87A 2W4MA 2KGOA 3N0TA 3N2ZB 3OWTA 5DS4A 4CSAA 2XLWA 1MNDA 4GQHA 4IARA 1QVXA 4J7TA 2R9RB 1E83A 2R02A 2B0JA 2VASA 1H6GA 2VCAA 2PP4A 3IQTA 2Y3BA 2AWYA 4I44A 2WL8A 2X0CA 3S9OA 3KPHA 3RH3A 4N06A 5KYYA 2PBEA 1B68A 2B0HA 3E9VA 3ZC4A 4CJOA 3UGPA 2L7AA 2NSGA 1FFHA 2RD9A 3UMHA 4MW3A 4C7OA 3H2UA 5HSWA 4UDVA 2PNOA 4U5FE 3LAYA 2AWCA 1G5ZA 3LLKA 4CIPA 2ICWG 3NYLA 3S84A 1N1CA 3G50A 1D0ZA 2ZPAA 4XPXA 1Q0FA 4WJ0A 1H9GA 2J7PA 2ZXWC 4ULWA 3V5XA 4BG0A 3U2LA 1C03A 3ABKC 2JX0A 3U8VA 4I1MA 5GPGB 2R03A 4JTAB 3ZQVA 4J32B 4XPWA 3LNRA 3K1IC 1PD1A 3GEHA 4PFPA 3S29A 3MYIA 4BJTA 2RSEB 3F47A 1DOWA 2LP4A 2QNLA 4LACB 2XSEA 4NTFA 1HW1A 2DI3A 3RYLA 4W8KA 4D4XA 1MMDA 3ATPA 5KYYB 4P9FA 3S28A 4G7ZF 2J0WA 1H9TA 1ORSC 1VYIA 2IBFA 3M1CB 4C7OB 1YZAA 1OCCC 4O6MA 2ZXPA 1TWAA 2L81A 2VH3A 2GFHA 1OCOC 3J06A 3QVZA 4OD4A 1NFOA 1WATA 3FXHA 2LQGA 3LS1A 2XXAA 1XWJA 2R7UA 3DM5A 1I4YA 1FR0A 2Y3DA 3ASNC 3DMDA 1ZHYA 2JPUA 4PR9A 4AL0A 4BJ5C 4BPMA 4NCQA 1JOGA 3AQBA 5E33A 3A11A 2CCYA 3NYJA 4QI2A 1VYKA 2EINC 3OA1A 2A1DD 2XLEA 4U5GA 4CIHA 1GQAA 4AK9A 1QPUA 1ZU4A 5JLIA 3LLIA 4A2NB 3FOOA 1O5HA 3AOUA 3N24A 4EHPA 2E87A 4YT2A 2ZD9A 2IOQA 3C7JA 4EWCA 3LJBA 1D1AA 1NG1A 2F22A 3WODF 1EKYA 2GWWA 5L0DA 5JUAA 3B29A 3H2VA 3K6BA 2M64A 3EZHA 3RQFA 5DS5A 3CEXA 2MYSA 2OKUA 1TWHA 3U3BA 1GM5A 2J46A 2XXAB 3JZ0A 4ER9A 5KYWA 5F5HA 2KYHA 2YRFA 3IPMO 1RJ9A 5EHHA 3C62A 3LUTB 3LESA 3DM9B 5FCLA 1V54C 1MQVA 3C18A 3CAXA 3U5SA 4KNVA 2WZGA 1A0BA 2H7OA 3K1IA 5BQIA 4IB4A 3TJ5A 1U89A 2BE5F 1ORYA 1JMWA 4RD9A 2AU5A 4YL0A 1HE1A 1PV3A 1PD0A 3HJCA 2KNHA 2XS8A 4MVUA 3SXYA 5T1DB 3T4RA 1E84A 1FMVA 4EKWA 2EIMC 5E2QA 4MTOA 2HKVA 1KTMA 2EPOA 4MVZA 3C8GA 2KC3A 1QKRA 1C02A 1ZYRF 1V4AA 2P7VA 3UMKA 2ZXRA 1FTSA 1LI7A 4OIOF 4R32A 3O39A 4BJ5A 3KYIA 3ECSA 3S90A 1RJ9B 3JCUQ 5DQTA 2BL2A 2P1AA 3RFYA 3SP1A 3SEOA 1KU2A 1D0YA 1ZHTA 3SXMA 1TWCA 1AVOB 3GEIA 3M15A 1BZ4A 1JRAA 5COFA 1NSGB 1S7ZA 4PFOA 4U5DE 3U2MA 3ZQYA 3W4YA 4JRZA 4LDKA 4M63A 3B0VC 1Z6AA 1CGME 1A7EA 2ETSA 3K1HA 2WVOA 1Q0KA 1FNTc 3SZRA 1T9KA 2HV6A 2OJQA 4YJWA 1NU7D 2Q9AA 2UUIA 5L0JA 3JT1A 1FAPB 3ABLC 1U0BB 2J8WA 1OKKA 3IHUA 3DZAA 2J9BA 4CDVA 4N6HA 2W45A 2AP3A 1GGQA 3I5PA 3C8GB 1A7VA 1LPEA 3GM3A 3NMIA 4JTCB 1SMYF 5L0CA 1L3PA 4U5EE 2C04A 2HZ8A 4YN0B 4JVSA 3SNHA 5E3AA 4E18A 1OW8A 1A41A 1W2WA 1Z7Qc 2G3VA 2EIKC 2YHSA 4PJNA 3NG1A 4CS8C 4EBKA 1BDJB 1F1MA 4LLCA 4I1OB 1VB5A 5COMA 4CS7A 4CBEA 3ABMC 2CDQA 1K05A 3PDMP 1LE2A 2HJMA 1T6UA 3DJUB 2PFDA 3HNJA 3FMSA 2X51A 4JZAA 4PJMA 4Q4ZF 4O6NA 5EGYA 2LFDA 4YL1A 2PF4E 3S27A 3T6GB 3VYWA 2KSFA 1D0XA 2DGJA 4FAPB 2R7QA 3EZIA 5A6BD 4EBBA 1OKKD 2R7RA 4DVZA 1DOVA 4MVOA 5CI9A 1E85A 1ST6A 1QSPA 3LEVA 4K7BA 2KQ9A 2A6HF 3IQ5A 3UNGC 2IXPA 1UFBA 2WVQA 3VAYA 1AEPA 3U9MA 4P6IC 4BEJA 2H8AA 5CI8A 1YYJA 4GEHA 2XS1A 3Q7LA 3T6BA 2WVNA 1BBHA 3TQOA 1TKNA 2DYSC 2P0NA 2W9YA 3EHMA 4XEKA 1Z63A 4MVSA 4JJFA 2LCHA 1TWGA 3NKDA 2OEXA 5A6JA 5L0HA 4MQ9F 1QLEC 5IY5C 2KW3C 4FX5A 4XWJA 3JTLO 2PX3A 1Q0DA 4XLNF 3ZIBA 1LS4A 1JAFA 1Q0MA 1YA7O 2EPKX 2J9VA 2P61A 2Q9BA 1O3UA 3O6XA 3ZTMA 1RXQA 2XLMA 3HTKC 2XLVA 3NMJA 4IWBA 2L9JA 2A69F 1OXBA 1QZXA 3BEHA 4N6CA 4BJ1A 3GWNA 1IW7F 2Y69C 4H4KC 1LS1A 4N4WA 1HY5A 1TFOB 5E3CA 4NQFA 4IAQA 1M2VA 3B9QA 3FOPA 4HFKB 1YLMA 3W2WA 2HMZA 2OU6A 3DI5A 3U3FA 4EUKB 4KNWA 4RDAA 2LSEA 2Q4FA 3DWWA 4JEAA 4C3BA 1HW2A 5F28E 2V3CC 2FAPB 2XLDA 1JR8A 2I15A 3AG3C 3L8JA 3G4ZA 4YK5A 3WHNA 4BJ6C 5JRAA 4CX9A 3M4CA 3EQLF 2EIJC 2LK4A 3EGXA 3CQZA 4Z9IA 5F5FA 1SF8A 1AUEA 1VTMP 3AGUA 4CS9C 1XZPA 2YWAA 4MNDA 3G4XA 3PCVA 3QZCA 4HEAJ 4PJLA 4OIRF 5DS6A 4ZLDA 2MHRA 4YL3A 1R4TA 3ZWIA 3CZ6A 2XRHA 3RQGA 3L8IA 1TQGA 3EG9A 1YAUO 5JSLA 4DOZA 4HFFB 3Q6MA 5L0IA 2GAQA 4XPYA 1SR2A 3EH1A 1M2VB 5BUOA 2KJGA 2VC9A 1WN0A 1T01A 1Q0GA 3EHNA 4IJJA 5AC4A 2V26A 2M4EA 3FDQA 3L34A 2IXNA 3CSKA 2YLIA 3KH2A 4YT5A 1CPQA 4MVQA 3T6JA 4CDAA 1I5NA 1QQ3A 2NSFA 3MFNA 2GDCA 1NFNA 2XM0A 1ZHXA 2EILC 4HE8D 1T5OA 3M4BA 5D91A 3C8ZA 3HLZA 3HKKA 5JP7A 1BR1A 1BR2A 5JVEA 3EGXB 1E86A 1RMVA 4OIPF 256BA 4E0HA 2XLOA 3K33A 1IZMA 4LDQA 3VM6A 3DAGA 2WZFA 3L1MA 5KYWB 2CGEA 5T3WA 4U9DA 3QW0A 3V5YA 2A6EF 1WOLA 4IGGA 2CW0F 2CYDA 1GS9A 2UUHA 1LM3B 1VMAA 2CNWD 4FWVA 3AGTA 4CJGA 3EG9B 1EQ1A 4JCHA 1J8YF 3AG1C 3AJMA 4JEBA 2ZXOA 3NRHA 2YEVA 1BR4A 3MLGA 3NMKA 3RVYA 3KKBA 1ZW2A 2PX0A 4IRUA 3IEEA 3GODA 2NUPA 1SYQA 5JT4A 5A6BA 2Y39A 1CGOA 5L3VA 3DKAA 4JW1A 2A0UA 4YT8A 5DLJA 4OD5A 1YJGA 4BJ6A 1FMWA 2G3KA 1V74B 2HMQA 4PK4A 4MVRA 4CDYA 1EI7A 5FZTA 2DB4A 1C17M 2JD3A 2P6VA 2WZLA 3JSZA 3K66A 3Q7GA 3AQCA 4I3MA 3ZSUA 4CS9A 5KYUA 1LI5A 4K1OA 3GM1A 3GANA 3K7DA 5AGFA 4Z9HA 3UGOA 4WABA 3MX3A 3O10A 4DBQA 2D4UA 3UMIA 4ZLCA 3WAQA 2XM4A 2H7VC 1ZHWA 3ZVRA 2R7XA 1TFKB 2YLDA 3W2VA 4AL1A 2R7VA 2D5RB 4ONSA 1T6IA 1WWPA 1J8MF 2QUPA 3NKEA 3V5ZA 5BQHA 3HNLA 5L3QA 3LNMB 2A0BA 2NUPB 1L7CA 4X0RA 3MYFA 4JTDB 1M57C 3LEOA 5JS5A 4QI0A 1RCPA 3RQEA 4DRJB 4JCZA 2C03A 2HUJA 1Y4CA 4NTAA 1OXKA 3I5QA 1ZW3A 3R7CA 5AC5A 3C63A 4JIOA 4PJJA 2R7SA 2H7BA 1LIHA 5TJ5E 3TJ6A 4EBJA 2J9WA 4E7SA 2NG1A 4DXWA 5KYUB 2OG2A 2WB7A 1Z23A 3TOLA 5B3SC 1OQCA 2OCCC 1YZCA 5B1AC 4RBNA 2Z15A 1D1BA 5B1BC 1OR2A 3US6A 4U5HA 1RKCA 3JSEO 4XEFA 2I8BA 3QW1A 3DE9A 2YL7A 4JJGA 1R5ID 1YYXA 3IQCA 5D92A 4Q5SF 2XLHA 3DD7A 1ZZPA 1T6QA 2YL0A 2J0XA 2QE9A 4H54A 5L0FA 1WTYA 3JRTA 2L6GA 2HJ3A 4G0HA 3TULA 1V55C 1EA8A 3FVYA 2QY9A 5COGA 3W8IA 2Q00A 3DE8A 1RKEA 1UG7A 3DJNB 4LLEA 3ASOC 1VK5A 1G8XA 1YVIA 3VRCA 2YLGA 3LS0A 4J7YA 1Z5ZA 2QTVA 1M6TA 4B6IA 1NZEA 1U6HA 4K0DA 1SZIA 1LE4A 2LD6A 4WGYA 3RVZA 3SXKA 5B3IA 1YARO 1ZHZA 1ORJA 3FAJA 1PCXA 4MTGA 1OW6A 1APCA 1S05A 4C3DA 4CS8A 1KNYA 4O6YA 3WG7C 3NYMA 3O55A 4JKVA 4MTFA 2IXMA 2HSQA 4U5BE 4AX2A 3EFOA 1Y6DA 4OIQF 4L6RA 2FFHA 3EPVA 3S0XA 4C3EA 2HS5A 2HSBA 1LKXA 2OQMA 2R7WA 2KK1A 3ZG1A 5KYNA 3GEEA 2QLAA 2YVKA 3FAPB 2R05A 3NDBB 2AVKA 1H7IA 4DVYP 3PMRA 5T3TA 1RKEB 3HNKA 2TMVP 3W8HA 2R25A 3L0IA 2CNWA 3H65A 4XTKA 3U9JA 3X2QC 4ANJA 3SXZA 1CPRA 3HNIA 1ZVZA 2XL6A
chains in the Genus database with same CATH topology
2J7PD 1TR2A 5DVWA 3KMIA 2FGYA 3RKOF 5DQZA 3UR3C 2IXOA 4XLPF 4OINF 4QDLA 3EFOB 3PHF2 1M56C 2R7TA 4YWQA 2A68F 2HV7A 2IYLD 3TD7A 4E7ZA 1M2OA 3SYNA 4O7GA 3X1OA 4AE4A 2YZSA 3JYHA 4G7HF 2G62A 1NU9C 1MMNA 1WGWA 3RIPA 1MNEA 3ITFA 1LVKA 4J30B 3DXJF 1VOMA 4JURI 3FHDA 4GYTA 4CSAC 4KC9A 1JPNA 3QMKA 2Q3TA 4IAOA 4KI2A 2J45A 2R7OA 4F4BA 4LERA 2J9UA 2Y3HA 2O9XA 4U5CE 3V7OA 3EGDA 5KYXA 1OCZC 3KL4A 2MWQA 4FESA 1ZU5A 4AE4B 2XL4A 4YT4A 2Y3GA 2NUTA 2VB6A 2DYRC 4G7OF 1FFTC 3AG4C 3E70C 3B0PA 4O79A 2W4BA 1JPJA 1OCRC 3DAFA 1MMGA 3EH2A 4DBRA 3B0UX 1Z3IX 3AG2C 4KBLA 3EGDB 5KYXB 1MMAA 3Q6NA 3POVA 3OEOA 4NY3A 1D1CA 2NUTB 2Q9CA 3F46A 3EJNA 3I4UA 4Q7CA 1O87A 2W4MA 2KGOA 3N0TA 3N2ZB 3OWTA 5DS4A 4CSAA 1MNDA 2VASA 2B0JA 4I44A 2PP4A 2Y3BA 2WL8A 3RH3A 4N06A 5KYYA 3E9VA 3ZC4A 3UGPA 1FFHA 3UMHA 4C7OA 5HSWA 4U5FE 3LAYA 3LLKA 3NYLA 1N1CA 1D0ZA 2ZPAA 4WJ0A 2J7PA 2ZXWC 4ULWA 4BG0A 3ABKC 4I1MA 4J32B 3LNRA 3K1IC 1PD1A 4PFPA 3S29A 4BJTA 3F47A 3RYLA 4LACB 2XSEA 4W8KA 1MMDA 5KYYB 3S28A 4G7ZF 2J0WA 1VYIA 3M1CB 4C7OB 1OCCC 4O6MA 2ZXPA 1TWAA 2L81A 2VH3A 2GFHA 1OCOC 4OD4A 3LS1A 2XXAA 2R7UA 3DM5A 2Y3DA 3ASNC 3DMDA 1ZHYA 4BJ5C 3AQBA 5E33A 3NYJA 4QI2A 1VYKA 2EINC 3OA1A 2A1DD 4U5GA 4CIHA 4AK9A 1ZU4A 3LLIA 4A2NB 1O5HA 3N24A 2E87A 4YT2A 2IOQA 4EWCA 3LJBA 1D1AA 1NG1A 3WODF 3K6BA 3EZHA 5DS5A 2MYSA 1TWHA 2J46A 2XXAB 5KYWA 5F5HA 1RJ9A 5EHHA 3LESA 3DM9B 5FCLA 1V54C 4KNVA 2WZGA 2H7OA 2BE5F 4RD9A 1PD0A 3HJCA 2KNHA 3T4RA 5T1DB 1FMVA 2EIMC 5E2QA 1ZYRF 2P7VA 3UMKA 2ZXRA 1FTSA 4OIOF 4BJ5A 3O39A 3ECSA 1RJ9B 3JCUQ 5DQTA 3RFYA 3SP1A 3SEOA 1KU2A 1D0YA 1ZHTA 1TWCA 1S7ZA 4PFOA 4U5DE 4M63A 3B0VC 1Z6AA 3K1HA 2WVOA 3SZRA 2HV6A 4YJWA 1NU7D 2Q9AA 5F5FA 3JT1A 3ABLC 1OKKA 3DZAA 2W45A 3I5PA 1SMYF 4U5EE 2C04A 4YN0B 4JVSA 3SNHA 5E3AA 1W2WA 2G3VA 2EIKC 2YHSA 4PJNA 3NG1A 4CS8C 4LLCA 4CS7A 4I1OB 4CBEA 3ABMC 2CDQA 3DJUB 2PFDA 2X51A 4JZAA 4PJMA 4Q4ZF 4O6NA 5EGYA 2PF4E 3S27A 3VYWA 1D0XA 2DGJA 2R7QA 3EZIA 4EBBA 1OKKD 2R7RA 4DVZA 5CI9A 1ST6A 4K7BA 3LEVA 2KQ9A 2A6HF 3UNGC 2IXPA 2WVQA 3VAYA 4P6IC 4BEJA 5CI8A 4GEHA 3Q7LA 3T6BA 2WVNA 1TKNA 2DYSC 2W9YA 3EHMA 1Z63A 4JJFA 1TWGA 3NKDA 4MQ9F 1QLEC 5IY5C 2KW3C 4FX5A 4XWJA 2PX3A 4XLNF 3ZIBA 2Q9BA 2J9VA 3O6XA 4IWBA 2L9JA 2A69F 1QZXA 4BJ1A 1IW7F 2Y69C 4H4KC 1LS1A 5E3CA 1M2VA 3B9QA 4HFKB 3W2WA 4KNWA 4RDAA 2LSEA 4C3BA 2V3CC 3AG3C 4BJ6C 3EQLF 2EIJC 3EGXA 3CQZA 1SF8A 4CS9C 4MNDA 3QZCA 4HEAJ 4PJLA 4OIRF 5DS6A 4ZLDA 3CZ6A 2XRHA 3EG9A 4HFFB 3Q6MA 3EH1A 1M2VB 5BUOA 2KJGA 3EHNA 4IJJA 2V26A 2M4EA 3FDQA 3L34A 2IXNA 3CSKA 3KH2A 4YT5A 3T6JA 1ZHXA 2EILC 4HE8D 5D91A 3ZVRA 3HLZA 1BR1A 1BR2A 3EGXB 4OIPF 3K33A 1IZMA 3DAGA 2WZFA 5KYWB 2CGEA 5T3WA 2A6EF 2CW0F 4FWVA 1VMAA 2CNWD 3EG9B 4JCHA 1J8YF 3AG1C 2ZXOA 3NRHA 2YEVA 1BR4A 3MLGA 3KKBA 2PX0A 4IRUA 3IEEA 3GODA 2NUPA 2Y39A 5L3VA 4JW1A 4YT8A 5DLJA 4OD5A 4BJ6A 1FMWA 2G3KA 4PK4A 2P6VA 2JD3A 2WZLA 3Q7GA 3JSZA 4I3MA 3K66A 3ZSUA 3AQCA 4DOZA 4CS9A 5KYUA 3GANA 3K7DA 3UGOA 3MX3A 4DBQA 3UMIA 4ZLCA 2H7VC 1ZHWA 2R7XA 2R7VA 3W2VA 2D5RB 1J8MF 3NKEA 5L3QA 4X0RA 2NUPB 1M57C 4QI0A 2C03A 3I5QA 4PJJA 2R7SA 2H7BA 5KYUB 4E7SA 2J9WA 2NG1A 2OG2A 2WB7A 1Z23A 5B3SC 2OCCC 5B1AC 4RBNA 2Z15A 1D1BA 5B1BC 4U5HA 2I8BA 4JJGA 5D92A 4Q5SF 3DD7A 2J0XA 3JRTA 4G0HA 1V55C 3FVYA 3W8IA 2QY9A 3DJNB 4LLEA 3ASOC 1VK5A 1G8XA 3LS0A 4B6IA 1Z5ZA 2QTVA 1NZEA 4K0DA 1SZIA 1ZHZA 3FAJA 1PCXA 4CS8A 4C3DA 4O6YA 3WG7C 3NYMA 2IXMA 4U5BE 4AX2A 3EFOA 4OIQF 2FFHA 3EPVA 3S0XA 4C3EA 2R7WA 1LKXA 3ZG1A 5KYNA 3NDBB 4DVYP 3PMRA 5T3TA 3W8HA 3L0IA 2CNWA 3H65A 4XTKA 3X2QC 4ANJA 3HTKC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CI9 A;  2D5R B;  3E9V A;  3DJU B;  2Z15 A;  5CI8 A;  3DJN B; 
#chains in the Genus database with same CATH topology
 2J7P D;  1TR2 A;  5DVW A;  2OOC A;  3T9O A;  3KMI A;  2FGY A;  3RKO F;  4NC3 A;  5DQZ A;  3UR3 C;  1OR3 A;  2EPL X;  2IXO A;  4NTB A;  4D4N A;  3U0C A;  4PAC A;  4XLP F;  4OIN F;  4QDL A;  3B71 A;  3EFO B;  3PHF 2;  2EPN A;  1M56 C;  1K40 A;  3U8P A;  3ZTZ A;  4YWQ A;  2R7T A;  2A68 F;  4JC7 A;  2HV7 A;  2IYL D;  4WGZ A;  3TD7 A;  4P9T A;  4E7Z A;  4XQ1 A;  1CGN A;  1M2O A;  2L6F A;  4O7G A;  3SYN A;  3X1O A;  3GOR A;  2YZS A;  4XEV A;  3JYH A;  3VF0 A;  4AE4 A;  2G62 A;  5L0G A;  4G7H F;  1NU9 C;  1MMN A;  2YL3 A;  1WGW A;  3RIP A;  4Z9J A;  1MNE A;  4DRI B;  3ITF A;  4MVM A;  1LVK A;  4J30 B;  3DXJ F;  1VOM A;  4JUR I;  2ASR A;  1HMO A;  5A6A A;  3FHD A;  4GYT A;  4CSA C;  3M79 A;  4KC9 A;  3A9C A;  2EPM X;  3JRM O;  4A4A A;  1JPN A;  3QMK A;  2Q3T A;  3RF3 A;  2YQY A;  4IAO A;  4KI2 A;  5CIV A;  2J45 A;  2R7O A;  4LDR A;  3JYY A;  3QVY A;  4LER A;  4F4B A;  1VLT A;  1WAS A;  2XL8 A;  2J9U A;  2Y3H A;  1HMD A;  2O9X A;  4U9E A;  1NBB A;  4U5C E;  3QTH A;  2LIG A;  3V7O A;  3EGD A;  1YA9 A;  2NPU A;  5KYX A;  5EK0 A;  4MS2 A;  1OCZ C;  3KL4 A;  5A69 A;  2MWQ A;  5BQG A;  1K04 A;  4FES A;  1ZU5 A;  4AE4 B;  2XL4 A;  4JE9 A;  1I4Z A;  1NLX A;  4YT4 A;  2YKZ A;  2OEV A;  2Y3G A;  2NUT A;  4E0I A;  4E17 A;  4EIY A;  4DRH B;  3IQ6 A;  2OJE D;  3TOM A;  2VB6 A;  2DYR C;  4G78 A;  3RW0 A;  2BC5 A;  3KYJ A;  4G7O F;  1XZQ A;  4MW8 A;  1FFT C;  3AG4 C;  3E70 C;  3GWL A;  4ULV A;  4DJ9 A;  3B0P A;  4O79 A;  2W4B A;  5HV9 A;  3MBG A;  1JPJ A;  3GM2 A;  4W8P A;  5K0I A;  1OCR C;  3TK0 A;  1VLS A;  1YDI A;  2GA0 A;  3DAF A;  2IM8 A;  1A7D A;  1MMG A;  2VCC A;  3EH2 A;  4DBR A;  3B0U X;  1Z3I X;  2L6H A;  1HE9 A;  3AG2 C;  4KBL A;  1G4W R;  1E2X A;  3EGD B;  5KYX B;  2VCB A;  1MMA A;  3Q6N A;  3ZDL A;  2HFI A;  3R2P A;  1OW7 A;  2Q7R A;  3POV A;  1G4U S;  2LFF A;  3OEO A;  4NY3 A;  1D1C A;  2YL1 A;  3BRJ A;  2NUT B;  2Q9C A;  3C8G D;  5A6K A;  3F46 A;  4BEM J;  3EJN A;  3I4U A;  4Q7C A;  1O87 A;  2W4M A;  2KGO A;  3N0T A;  3N2Z B;  3OWT A;  5DS4 A;  4CSA A;  2XLW A;  1MND A;  4GQH A;  4IAR A;  1QVX A;  4J7T A;  2R9R B;  1E83 A;  2R02 A;  2B0J A;  2VAS A;  1H6G A;  2VCA A;  2PP4 A;  3IQT A;  2Y3B A;  2AWY A;  4I44 A;  2WL8 A;  2X0C A;  3S9O A;  3KPH A;  3RH3 A;  4N06 A;  5KYY A;  2PBE A;  1B68 A;  2B0H A;  3E9V A;  3ZC4 A;  4CJO A;  3UGP A;  2L7A A;  2NSG A;  1FFH A;  2RD9 A;  3UMH A;  4MW3 A;  4C7O A;  3H2U A;  5HSW A;  4UDV A;  2PNO A;  4U5F E;  3LAY A;  2AWC A;  1G5Z A;  3LLK A;  4CIP A;  2ICW G;  3NYL A;  3S84 A;  1N1C A;  3G50 A;  1D0Z A;  2ZPA A;  4XPX A;  1Q0F A;  4WJ0 A;  1H9G A;  2J7P A;  2ZXW C;  4ULW A;  3V5X A;  4BG0 A;  3U2L A;  1C03 A;  3ABK C;  2JX0 A;  3U8V A;  4I1M A;  5GPG B;  2R03 A;  4JTA B;  3ZQV A;  4J32 B;  4XPW A;  3LNR A;  3K1I C;  1PD1 A;  3GEH A;  4PFP A;  3S29 A;  3MYI A;  4BJT A;  2RSE B;  3F47 A;  1DOW A;  2LP4 A;  2QNL A;  4LAC B;  2XSE A;  4NTF A;  1HW1 A;  2DI3 A;  3RYL A;  4W8K A;  4D4X A;  1MMD A;  3ATP A;  5KYY B;  4P9F A;  3S28 A;  4G7Z F;  2J0W A;  1H9T A;  1ORS C;  1VYI A;  2IBF A;  3M1C B;  4C7O B;  1YZA A;  1OCC C;  4O6M A;  2ZXP A;  1TWA A;  2L81 A;  2VH3 A;  2GFH A;  1OCO C;  3J06 A;  3QVZ A;  4OD4 A;  1NFO A;  1WAT A;  3FXH A;  2LQG A;  3LS1 A;  2XXA A;  1XWJ A;  2R7U A;  3DM5 A;  1I4Y A;  1FR0 A;  2Y3D A;  3ASN C;  3DMD A;  1ZHY A;  2JPU A;  4PR9 A;  4AL0 A;  4BJ5 C;  4BPM A;  4NCQ A;  1JOG A;  3AQB A;  5E33 A;  3A11 A;  2CCY A;  3NYJ A;  4QI2 A;  1VYK A;  2EIN C;  3OA1 A;  2A1D D;  2XLE A;  4U5G A;  4CIH A;  1GQA A;  4AK9 A;  1QPU A;  1ZU4 A;  5JLI A;  3LLI A;  4A2N B;  3FOO A;  1O5H A;  3AOU A;  3N24 A;  4EHP A;  2E87 A;  4YT2 A;  2ZD9 A;  2IOQ A;  3C7J A;  4EWC A;  3LJB A;  1D1A A;  1NG1 A;  2F22 A;  3WOD F;  1EKY A;  2GWW A;  5L0D A;  5JUA A;  3B29 A;  3H2V A;  3K6B A;  2M64 A;  3EZH A;  3RQF A;  5DS5 A;  3CEX A;  2MYS A;  2OKU A;  1TWH A;  3U3B A;  1GM5 A;  2J46 A;  2XXA B;  3JZ0 A;  4ER9 A;  5KYW A;  5F5H A;  2KYH A;  2YRF A;  3IPM O;  1RJ9 A;  5EHH A;  3C62 A;  3LUT B;  3LES A;  3DM9 B;  5FCL A;  1V54 C;  1MQV A;  3C18 A;  3CAX A;  3U5S A;  4KNV A;  2WZG A;  1A0B A;  2H7O A;  3K1I A;  5BQI A;  4IB4 A;  3TJ5 A;  1U89 A;  2BE5 F;  1ORY A;  1JMW A;  4RD9 A;  2AU5 A;  4YL0 A;  1HE1 A;  1PV3 A;  1PD0 A;  3HJC A;  2KNH A;  2XS8 A;  4MVU A;  3SXY A;  5T1D B;  3T4R A;  1E84 A;  1FMV A;  4EKW A;  2EIM C;  5E2Q A;  4MTO A;  2HKV A;  1KTM A;  2EPO A;  4MVZ A;  3C8G A;  2KC3 A;  1QKR A;  1C02 A;  1ZYR F;  1V4A A;  2P7V A;  3UMK A;  2ZXR A;  1FTS A;  1LI7 A;  4OIO F;  4R32 A;  3O39 A;  4BJ5 A;  3KYI A;  3ECS A;  3S90 A;  1RJ9 B;  3JCU Q;  5DQT A;  2BL2 A;  2P1A A;  3RFY A;  3SP1 A;  3SEO A;  1KU2 A;  1D0Y A;  1ZHT A;  3SXM A;  1TWC A;  1AVO B;  3GEI A;  3M15 A;  1BZ4 A;  1JRA A;  5COF A;  1NSG B;  1S7Z A;  4PFO A;  4U5D E;  3U2M A;  3ZQY A;  3W4Y A;  4JRZ A;  4LDK A;  4M63 A;  3B0V C;  1Z6A A;  1CGM E;  1A7E A;  2ETS A;  3K1H A;  2WVO A;  1Q0K A;  1FNT c;  3SZR A;  1T9K A;  2HV6 A;  2OJQ A;  4YJW A;  1NU7 D;  2Q9A A;  2UUI A;  5L0J A;  3JT1 A;  1FAP B;  3ABL C;  1U0B B;  2J8W A;  1OKK A;  3IHU A;  3DZA A;  2J9B A;  4CDV A;  4N6H A;  2W45 A;  2AP3 A;  1GGQ A;  3I5P A;  3C8G B;  1A7V A;  1LPE A;  3GM3 A;  3NMI A;  4JTC B;  1SMY F;  5L0C A;  1L3P A;  4U5E E;  2C04 A;  2HZ8 A;  4YN0 B;  4JVS A;  3SNH A;  5E3A A;  4E18 A;  1OW8 A;  1A41 A;  1W2W A;  1Z7Q c;  2G3V A;  2EIK C;  2YHS A;  4PJN A;  3NG1 A;  4CS8 C;  4EBK A;  1BDJ B;  1F1M A;  4LLC A;  4I1O B;  1VB5 A;  5COM A;  4CS7 A;  4CBE A;  3ABM C;  2CDQ A;  1K05 A;  3PDM P;  1LE2 A;  2HJM A;  1T6U A;  3DJU B;  2PFD A;  3HNJ A;  3FMS A;  2X51 A;  4JZA A;  4PJM A;  4Q4Z F;  4O6N A;  5EGY A;  2LFD A;  4YL1 A;  2PF4 E;  3S27 A;  3T6G B;  3VYW A;  2KSF A;  1D0X A;  2DGJ A;  4FAP B;  2R7Q A;  3EZI A;  5A6B D;  4EBB A;  1OKK D;  2R7R A;  4DVZ A;  1DOV A;  4MVO A;  5CI9 A;  1E85 A;  1ST6 A;  1QSP A;  3LEV A;  4K7B A;  2KQ9 A;  2A6H F;  3IQ5 A;  3UNG C;  2IXP A;  1UFB A;  2WVQ A;  3VAY A;  1AEP A;  3U9M A;  4P6I C;  4BEJ A;  2H8A A;  5CI8 A;  1YYJ A;  4GEH A;  2XS1 A;  3Q7L A;  3T6B A;  2WVN A;  1BBH A;  3TQO A;  1TKN A;  2DYS C;  2P0N A;  2W9Y A;  3EHM A;  4XEK A;  1Z63 A;  4MVS A;  4JJF A;  2LCH A;  1TWG A;  3NKD A;  2OEX A;  5A6J A;  5L0H A;  4MQ9 F;  1QLE C;  5IY5 C;  2KW3 C;  4FX5 A;  4XWJ A;  3JTL O;  2PX3 A;  1Q0D A;  4XLN F;  3ZIB A;  1LS4 A;  1JAF A;  1Q0M A;  1YA7 O;  2EPK X;  2J9V A;  2P61 A;  2Q9B A;  1O3U A;  3O6X A;  3ZTM A;  1RXQ A;  2XLM A;  3HTK C;  2XLV A;  3NMJ A;  4IWB A;  2L9J A;  2A69 F;  1OXB A;  1QZX A;  3BEH A;  4N6C A;  4BJ1 A;  3GWN A;  1IW7 F;  2Y69 C;  4H4K C;  1LS1 A;  4N4W A;  1HY5 A;  1TFO B;  5E3C A;  4NQF A;  4IAQ A;  1M2V A;  3B9Q A;  3FOP A;  4HFK B;  1YLM A;  3W2W A;  2HMZ A;  2OU6 A;  3DI5 A;  3U3F A;  4EUK B;  4KNW A;  4RDA A;  2LSE A;  2Q4F A;  3DWW A;  4JEA A;  4C3B A;  1HW2 A;  5F28 E;  2V3C C;  2FAP B;  2XLD A;  1JR8 A;  2I15 A;  3AG3 C;  3L8J A;  3G4Z A;  4YK5 A;  3WHN A;  4BJ6 C;  5JRA A;  4CX9 A;  3M4C A;  3EQL F;  2EIJ C;  2LK4 A;  3EGX A;  3CQZ A;  4Z9I A;  5F5F A;  1SF8 A;  1AUE A;  1VTM P;  3AGU A;  4CS9 C;  1XZP A;  2YWA A;  4MND A;  3G4X A;  3PCV A;  3QZC A;  4HEA J;  4PJL A;  4OIR F;  5DS6 A;  4ZLD A;  2MHR A;  4YL3 A;  1R4T A;  3ZWI A;  3CZ6 A;  2XRH A;  3RQG A;  3L8I A;  1TQG A;  3EG9 A;  1YAU O;  5JSL A;  4DOZ A;  4HFF B;  3Q6M A;  5L0I A;  2GAQ A;  4XPY A;  1SR2 A;  3EH1 A;  1M2V B;  5BUO A;  2KJG A;  2VC9 A;  1WN0 A;  1T01 A;  1Q0G A;  3EHN A;  4IJJ A;  5AC4 A;  2V26 A;  2M4E A;  3FDQ A;  3L34 A;  2IXN A;  3CSK A;  2YLI A;  3KH2 A;  4YT5 A;  1CPQ A;  4MVQ A;  3T6J A;  4CDA A;  1I5N A;  1QQ3 A;  2NSF A;  3MFN A;  2GDC A;  1NFN A;  2XM0 A;  1ZHX A;  2EIL C;  4HE8 D;  1T5O A;  3M4B A;  5D91 A;  3C8Z A;  3HLZ A;  3HKK A;  5JP7 A;  1BR1 A;  1BR2 A;  5JVE A;  3EGX B;  1E86 A;  1RMV A;  4OIP F;  256B A;  4E0H A;  2XLO A;  3K33 A;  1IZM A;  4LDQ A;  3VM6 A;  3DAG A;  2WZF A;  3L1M A;  5KYW B;  2CGE A;  5T3W A;  4U9D A;  3QW0 A;  3V5Y A;  2A6E F;  1WOL A;  4IGG A;  2CW0 F;  2CYD A;  1GS9 A;  2UUH A;  1LM3 B;  1VMA A;  2CNW D;  4FWV A;  3AGT A;  4CJG A;  3EG9 B;  1EQ1 A;  4JCH A;  1J8Y F;  3AG1 C;  3AJM A;  4JEB A;  2ZXO A;  3NRH A;  2YEV A;  1BR4 A;  3MLG A;  3NMK A;  3RVY A;  3KKB A;  1ZW2 A;  2PX0 A;  4IRU A;  3IEE A;  3GOD A;  2NUP A;  1SYQ A;  5JT4 A;  5A6B A;  2Y39 A;  1CGO A;  5L3V A;  3DKA A;  4JW1 A;  2A0U A;  4YT8 A;  5DLJ A;  4OD5 A;  1YJG A;  4BJ6 A;  1FMW A;  2G3K A;  1V74 B;  2HMQ A;  4PK4 A;  4MVR A;  4CDY A;  1EI7 A;  5FZT A;  2DB4 A;  1C17 M;  2JD3 A;  2P6V A;  2WZL A;  3JSZ A;  3K66 A;  3Q7G A;  3AQC A;  4I3M A;  3ZSU A;  4CS9 A;  5KYU A;  1LI5 A;  4K1O A;  3GM1 A;  3GAN A;  3K7D A;  5AGF A;  4Z9H A;  3UGO A;  4WAB A;  3MX3 A;  3O10 A;  4DBQ A;  2D4U A;  3UMI A;  4ZLC A;  3WAQ A;  2XM4 A;  2H7V C;  1ZHW A;  3ZVR A;  2R7X A;  1TFK B;  2YLD A;  3W2V A;  4AL1 A;  2R7V A;  2D5R B;  4ONS A;  1T6I A;  1WWP A;  1J8M F;  2QUP A;  3NKE A;  3V5Z A;  5BQH A;  3HNL A;  5L3Q A;  3LNM B;  2A0B A;  2NUP B;  1L7C A;  4X0R A;  3MYF A;  4JTD B;  1M57 C;  3LEO A;  5JS5 A;  4QI0 A;  1RCP A;  3RQE A;  4DRJ B;  4JCZ A;  2C03 A;  2HUJ A;  1Y4C A;  4NTA A;  1OXK A;  3I5Q A;  1ZW3 A;  3R7C A;  5AC5 A;  3C63 A;  4JIO A;  4PJJ A;  2R7S A;  2H7B A;  1LIH A;  5TJ5 E;  3TJ6 A;  4EBJ A;  2J9W A;  4E7S A;  2NG1 A;  4DXW A;  5KYU B;  2OG2 A;  2WB7 A;  1Z23 A;  3TOL A;  5B3S C;  1OQC A;  2OCC C;  1YZC A;  5B1A C;  4RBN A;  2Z15 A;  1D1B A;  5B1B C;  1OR2 A;  3US6 A;  4U5H A;  1RKC A;  3JSE O;  4XEF A;  2I8B A;  3QW1 A;  3DE9 A;  2YL7 A;  4JJG A;  1R5I D;  1YYX A;  3IQC A;  5D92 A;  4Q5S F;  2XLH A;  3DD7 A;  1ZZP A;  1T6Q A;  2YL0 A;  2J0X A;  2QE9 A;  4H54 A;  5L0F A;  1WTY A;  3JRT A;  2L6G A;  2HJ3 A;  4G0H A;  3TUL A;  1V55 C;  1EA8 A;  3FVY A;  2QY9 A;  5COG A;  3W8I A;  2Q00 A;  3DE8 A;  1RKE A;  1UG7 A;  3DJN B;  4LLE A;  3ASO C;  1VK5 A;  1G8X A;  1YVI A;  3VRC A;  2YLG A;  3LS0 A;  4J7Y A;  1Z5Z A;  2QTV A;  1M6T A;  4B6I A;  1NZE A;  1U6H A;  4K0D A;  1SZI A;  1LE4 A;  2LD6 A;  4WGY A;  3RVZ A;  3SXK A;  5B3I A;  1YAR O;  1ZHZ A;  1ORJ A;  3FAJ A;  1PCX A;  4MTG A;  1OW6 A;  1APC A;  1S05 A;  4C3D A;  4CS8 A;  1KNY A;  4O6Y A;  3WG7 C;  3NYM A;  3O55 A;  4JKV A;  4MTF A;  2IXM A;  2HSQ A;  4U5B E;  4AX2 A;  3EFO A;  1Y6D A;  4OIQ F;  4L6R A;  2FFH A;  3EPV A;  3S0X A;  4C3E A;  2HS5 A;  2HSB A;  1LKX A;  2OQM A;  2R7W A;  2KK1 A;  3ZG1 A;  5KYN A;  3GEE A;  2QLA A;  2YVK A;  3FAP B;  2R05 A;  3NDB B;  2AVK A;  1H7I A;  4DVY P;  3PMR A;  5T3T A;  1RKE B;  3HNK A;  2TMV P;  3W8H A;  2R25 A;  3L0I A;  2CNW A;  3H65 A;  4XTK A;  3U9J A;  3X2Q C;  4ANJ A;  3SXZ A;  1CPR A;  3HNI A;  1ZVZ A;  2XL6 A; 
#chains in the Genus database with same CATH homology
 2J7P D;  1TR2 A;  5DVW A;  3KMI A;  2FGY A;  3RKO F;  5DQZ A;  3UR3 C;  2IXO A;  4XLP F;  4OIN F;  4QDL A;  3EFO B;  3PHF 2;  1M56 C;  2R7T A;  4YWQ A;  2A68 F;  2HV7 A;  2IYL D;  3TD7 A;  4E7Z A;  1M2O A;  3SYN A;  4O7G A;  3X1O A;  4AE4 A;  2YZS A;  3JYH A;  4G7H F;  2G62 A;  1NU9 C;  1MMN A;  1WGW A;  3RIP A;  1MNE A;  3ITF A;  1LVK A;  4J30 B;  3DXJ F;  1VOM A;  4JUR I;  3FHD A;  4GYT A;  4CSA C;  4KC9 A;  1JPN A;  3QMK A;  2Q3T A;  4IAO A;  4KI2 A;  2J45 A;  2R7O A;  4F4B A;  4LER A;  2J9U A;  2Y3H A;  2O9X A;  4U5C E;  3V7O A;  3EGD A;  5KYX A;  1OCZ C;  3KL4 A;  2MWQ A;  4FES A;  1ZU5 A;  4AE4 B;  2XL4 A;  4YT4 A;  2Y3G A;  2NUT A;  2VB6 A;  2DYR C;  4G7O F;  1FFT C;  3AG4 C;  3E70 C;  3B0P A;  4O79 A;  2W4B A;  1JPJ A;  1OCR C;  3DAF A;  1MMG A;  3EH2 A;  4DBR A;  3B0U X;  1Z3I X;  3AG2 C;  4KBL A;  3EGD B;  5KYX B;  1MMA A;  3Q6N A;  3POV A;  3OEO A;  4NY3 A;  1D1C A;  2NUT B;  2Q9C A;  3F46 A;  3EJN A;  3I4U A;  4Q7C A;  1O87 A;  2W4M A;  2KGO A;  3N0T A;  3N2Z B;  3OWT A;  5DS4 A;  4CSA A;  1MND A;  2VAS A;  2B0J A;  4I44 A;  2PP4 A;  2Y3B A;  2WL8 A;  3RH3 A;  4N06 A;  5KYY A;  3E9V A;  3ZC4 A;  3UGP A;  1FFH A;  3UMH A;  4C7O A;  5HSW A;  4U5F E;  3LAY A;  3LLK A;  3NYL A;  1N1C A;  1D0Z A;  2ZPA A;  4WJ0 A;  2J7P A;  2ZXW C;  4ULW A;  4BG0 A;  3ABK C;  4I1M A;  4J32 B;  3LNR A;  3K1I C;  1PD1 A;  4PFP A;  3S29 A;  4BJT A;  3F47 A;  3RYL A;  4LAC B;  2XSE A;  4W8K A;  1MMD A;  5KYY B;  3S28 A;  4G7Z F;  2J0W A;  1VYI A;  3M1C B;  4C7O B;  1OCC C;  4O6M A;  2ZXP A;  1TWA A;  2L81 A;  2VH3 A;  2GFH A;  1OCO C;  4OD4 A;  3LS1 A;  2XXA A;  2R7U A;  3DM5 A;  2Y3D A;  3ASN C;  3DMD A;  1ZHY A;  4BJ5 C;  3AQB A;  5E33 A;  3NYJ A;  4QI2 A;  1VYK A;  2EIN C;  3OA1 A;  2A1D D;  4U5G A;  4CIH A;  4AK9 A;  1ZU4 A;  3LLI A;  4A2N B;  1O5H A;  3N24 A;  2E87 A;  4YT2 A;  2IOQ A;  4EWC A;  3LJB A;  1D1A A;  1NG1 A;  3WOD F;  3K6B A;  3EZH A;  5DS5 A;  2MYS A;  1TWH A;  2J46 A;  2XXA B;  5KYW A;  5F5H A;  1RJ9 A;  5EHH A;  3LES A;  3DM9 B;  5FCL A;  1V54 C;  4KNV A;  2WZG A;  2H7O A;  2BE5 F;  4RD9 A;  1PD0 A;  3HJC A;  2KNH A;  3T4R A;  5T1D B;  1FMV A;  2EIM C;  5E2Q A;  1ZYR F;  2P7V A;  3UMK A;  2ZXR A;  1FTS A;  4OIO F;  4BJ5 A;  3O39 A;  3ECS A;  1RJ9 B;  3JCU Q;  5DQT A;  3RFY A;  3SP1 A;  3SEO A;  1KU2 A;  1D0Y A;  1ZHT A;  1TWC A;  1S7Z A;  4PFO A;  4U5D E;  4M63 A;  3B0V C;  1Z6A A;  3K1H A;  2WVO A;  3SZR A;  2HV6 A;  4YJW A;  1NU7 D;  2Q9A A;  5F5F A;  3JT1 A;  3ABL C;  1OKK A;  3DZA A;  2W45 A;  3I5P A;  1SMY F;  4U5E E;  2C04 A;  4YN0 B;  4JVS A;  3SNH A;  5E3A A;  1W2W A;  2G3V A;  2EIK C;  2YHS A;  4PJN A;  3NG1 A;  4CS8 C;  4LLC A;  4CS7 A;  4I1O B;  4CBE A;  3ABM C;  2CDQ A;  3DJU B;  2PFD A;  2X51 A;  4JZA A;  4PJM A;  4Q4Z F;  4O6N A;  5EGY A;  2PF4 E;  3S27 A;  3VYW A;  1D0X A;  2DGJ A;  2R7Q A;  3EZI A;  4EBB A;  1OKK D;  2R7R A;  4DVZ A;  5CI9 A;  1ST6 A;  4K7B A;  3LEV A;  2KQ9 A;  2A6H F;  3UNG C;  2IXP A;  2WVQ A;  3VAY A;  4P6I C;  4BEJ A;  5CI8 A;  4GEH A;  3Q7L A;  3T6B A;  2WVN A;  1TKN A;  2DYS C;  2W9Y A;  3EHM A;  1Z63 A;  4JJF A;  1TWG A;  3NKD A;  4MQ9 F;  1QLE C;  5IY5 C;  2KW3 C;  4FX5 A;  4XWJ A;  2PX3 A;  4XLN F;  3ZIB A;  2Q9B A;  2J9V A;  3O6X A;  4IWB A;  2L9J A;  2A69 F;  1QZX A;  4BJ1 A;  1IW7 F;  2Y69 C;  4H4K C;  1LS1 A;  5E3C A;  1M2V A;  3B9Q A;  4HFK B;  3W2W A;  4KNW A;  4RDA A;  2LSE A;  4C3B A;  2V3C C;  3AG3 C;  4BJ6 C;  3EQL F;  2EIJ C;  3EGX A;  3CQZ A;  1SF8 A;  4CS9 C;  4MND A;  3QZC A;  4HEA J;  4PJL A;  4OIR F;  5DS6 A;  4ZLD A;  3CZ6 A;  2XRH A;  3EG9 A;  4HFF B;  3Q6M A;  3EH1 A;  1M2V B;  5BUO A;  2KJG A;  3EHN A;  4IJJ A;  2V26 A;  2M4E A;  3FDQ A;  3L34 A;  2IXN A;  3CSK A;  3KH2 A;  4YT5 A;  3T6J A;  1ZHX A;  2EIL C;  4HE8 D;  5D91 A;  3ZVR A;  3HLZ A;  1BR1 A;  1BR2 A;  3EGX B;  4OIP F;  3K33 A;  1IZM A;  3DAG A;  2WZF A;  5KYW B;  2CGE A;  5T3W A;  2A6E F;  2CW0 F;  4FWV A;  1VMA A;  2CNW D;  3EG9 B;  4JCH A;  1J8Y F;  3AG1 C;  2ZXO A;  3NRH A;  2YEV A;  1BR4 A;  3MLG A;  3KKB A;  2PX0 A;  4IRU A;  3IEE A;  3GOD A;  2NUP A;  2Y39 A;  5L3V A;  4JW1 A;  4YT8 A;  5DLJ A;  4OD5 A;  4BJ6 A;  1FMW A;  2G3K A;  4PK4 A;  2P6V A;  2JD3 A;  2WZL A;  3Q7G A;  3JSZ A;  4I3M A;  3K66 A;  3ZSU A;  3AQC A;  4DOZ A;  4CS9 A;  5KYU A;  3GAN A;  3K7D A;  3UGO A;  3MX3 A;  4DBQ A;  3UMI A;  4ZLC A;  2H7V C;  1ZHW A;  2R7X A;  2R7V A;  3W2V A;  2D5R B;  1J8M F;  3NKE A;  5L3Q A;  4X0R A;  2NUP B;  1M57 C;  4QI0 A;  2C03 A;  3I5Q A;  4PJJ A;  2R7S A;  2H7B A;  5KYU B;  4E7S A;  2J9W A;  2NG1 A;  2OG2 A;  2WB7 A;  1Z23 A;  5B3S C;  2OCC C;  5B1A C;  4RBN A;  2Z15 A;  1D1B A;  5B1B C;  4U5H A;  2I8B A;  4JJG A;  5D92 A;  4Q5S F;  3DD7 A;  2J0X A;  3JRT A;  4G0H A;  1V55 C;  3FVY A;  3W8I A;  2QY9 A;  3DJN B;  4LLE A;  3ASO C;  1VK5 A;  1G8X A;  3LS0 A;  4B6I A;  1Z5Z A;  2QTV A;  1NZE A;  4K0D A;  1SZI A;  1ZHZ A;  3FAJ A;  1PCX A;  4CS8 A;  4C3D A;  4O6Y A;  3WG7 C;  3NYM A;  2IXM A;  4U5B E;  4AX2 A;  3EFO A;  4OIQ F;  2FFH A;  3EPV A;  3S0X A;  4C3E A;  2R7W A;  1LKX A;  3ZG1 A;  5KYN A;  3NDB B;  4DVY P;  3PMR A;  5T3T A;  3W8H A;  3L0I A;  2CNW A;  3H65 A;  4XTK A;  3X2Q C;  4ANJ A;  3HTK C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...