3DJUB

Crystal structure of human btg2
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
121
structure length
121
Chain Sequence
TDMLPEIAAAVGFLSSLLRTRGCVSEQRLKVFSGALQEALTEHYKHHWFPEKPSKGSGYRCIRINHKMDPIISRVASQIGLSQPQLHQLLPSELTLWVDPYEVSYRIGEDGSICVLYEEAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein BTG2
publication title Crystal structures of human BTG2 and mouse TIS21 involved in suppression of CAF1 deadenylase activity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 35
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2008-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07742 BTG BTG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1120 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3djuB00
2D5RB 2Z15A 3E9VA 5CI8A 5CI9A 3DJNB 3DJUB
chains in the Genus database with same CATH superfamily
5L3QA 4CS8C 1LIHA 3K1IA 3B9QA 3RIPA 3T4RA 3FAPB 4XLNF 3EHMA 3EQLF 2HMZA 5DLJA 1C02A 1Q0MA 4DRIB 3DE8A 1O5HA 5E2QA 3L8IA 3O10A 2A68F 3CQZA 4C7OB 3UMHA 1LVKA 3X1OA 3NKEA 1FMWA 1WWPA 1MMNA 2YLDA 1OKKA 1A7DA 2CNWD 3SEOA 4CS7A 2GDCA 3DJNB 3MYFA 5AGFA 1VTMP 4YL1A 3HNLA 1E83A 1E2XA 1YYJA 2QE9A 2UUHA 4KNWA 2HMQA 2WZFA 4DRJB 1WN0A 4CX9A 3IQCA 4IGGA 2A0UA 4Z9IA 1G8XA 5BQHA 2J9VA 4P9TA 1LM3B 4U5GA 3VF0A 4KC9A 1QSPA 4PJNA 4EWCA 3PDMP 2BE5F 1TWGA 2Q3TA 4C3DA 5L3VA 3C18A 2XLMA 4IWBA 3U3BA 3LNMB 5COGA 2HJMA 2FGYA 4CS8A 3HJCA 1YVIA 4LDKA 3ECSA 3V5YA 2ZXWC 3SZRA 2C04A 3S27A 1ST6A 3M79A 4H54A 3C8ZA 4AE4A 2QLAA 1D1CA 4JKVA 5B1AC 2O9XA 4U9EA 1BR2A 1SMYF 3N0TA 1EKYA 1CPRA 3FOPA 3AG2C 4GQHA 1D0YA 1ZW2A 4N6CA 3KKBA 5A6JA 1ZHYA 4DVYP 1RKEA 1QVXA 2P61A 4NY3A 3PMRA 4G7OF 4LACB 3U5SA 5KYXA 3WG7C 4E7ZA 2R7SA 4K0DA 1YZCA 3UR3C 1M2VA 1FAPB 3NG1A 4OD4A 4CDYA 5DS4A 4UDVA 1RJ9B 1YA7O 3NMJA 4XPXA 2Q4FA 4HEAJ 2XRHA 2PFDA 2UUIA 1Z63A 4HFFB 4WJ0A 1IZMA 1OCOC 2R7XA 1ZVZA 2PNOA 1O87A 2PX0A 2IXOA 4JEBA 2NUTB 3B29A 3EGDA 5L0DA 1C17M 2EPNA 3QW1A 4NTAA 3EG9B 2Q00A 1I4YA 5CI9A 5COMA 1AEPA 2P7VA 2V26A 4WGYA 1HE1A 4EBJA 2WL8A 3ZWIA 4Z9JA 3T9OA 2P0NA 4JCHA 4OINF 3JRMO 3UGPA 1I4ZA 1EI7A 1JMWA 2F22A 2LFFA 2VASA 1XZQA 2NSFA 2XLHA 4H4KC 4JC7A 4LDRA 4N4WA 4U9DA 4BJ5C 3ABKC 4OIOF 4JCZA 3S9OA 3PHF2 1OW7A 5EK0A 2J46A 2XSEA 4JTDB 4XTKA 2A0BA 1HW2A 1FFHA 1ORYA 3BEHA 2PX3A 3AGUA 4WABA 4AL0A 3RQFA 4PFPA 1C03A 5DQZA 1FMVA 1EA8A 1S05A 2IXPA 3DI5A 3IHUA 2CYDA 3CEXA 4XQ1A 4XWJA 5FZTA 5JP7A 5JT4A 3EZHA 3QZCA 4J7TA 1H7IA 3JCUQ 1A7VA 2H7VC 1LPEA 4QI2A 3Q7GA 3TOLA 4U5CE 5D92A 1SR2A 3BRJA 4JURI 2J7PA 2XXAB 3X2QC 1MMGA 2YEVA 1M56C 2OJQA 3RQGA 2YL0A 4AX2A 2G62A 4XEVA 2KC3A 2R03A 1ZHXA 2L6FA 1JR8A 2FAPB 2HJ3A 2NG1A 3B71A 1RKCA 2GWWA 3HNKA 3CAXA 2XS1A 3RKOF 3M4BA 3S90A 1I5NA 4KI2A 3EFOB 3JYYA 4MW8A 2L81A 2I15A 1MMDA 2KJGA 2VB6A 3M4CA 2Y39A 3OEOA 1A41A 4EBKA 5L0CA 2B0JA 3T6JA 4N6HA 1LS4A 2W45A 3WHNA 4BJ5A 3KPHA 5T3TA 4YL3A 1NZEA 4PJMA 3EJNA 4ER9A 3E70C 1U6HA 3W2VA 5JVEA 4O7GA 1GM5A 1MNDA 3GWLA 3ZC4A 3C62A 4B6IA 2EPMX 3KH2A 2WVQA 2WVOA 4K1OA 1ZHTA 4PJLA 5EGYA 3GWNA 3K6BA 1RJ9A 1VOMA 2YWAA 4YJWA 5CI8A 3QW0A 3KMIA 2ETSA 1ZZPA 1R4TA 2BL2A 3IQ5A 4PK4A 3SP1A 3U2MA 4N06A 1U0BB 4GYTA 2ZXPA 3O6XA 1ORJA 2NUTA 1OXKA 2AP3A 1F1MA 3LLKA 5JLIA 5D91A 1YARO 3EG9A 3GORA 3O55A 3V5XA 3WAQA 2EINC 3ATPA 4NC3A 2HZ8A 4MVZA 4MTGA 4XPWA 1UFBA 4G0HA 4U5EE 4JVSA 2XL6A 3POVA 3ITFA 3GEIA 2L6GA 4E17A 2H8AA 3VRCA 3C8GD 4G7HF 3M1CB 2XLWA 4MVRA 4DRHB 2CDQA 1AVOB 1ZU4A 2D4UA 3V5ZA 2GAQA 2QTVA 1QKRA 2JPUA 5KYUB 3TD7A 3Q7LA 5A6AA 3LEVA 4J7YA 3B0UX 2J0XA 1BDJB 1HMDA 1OKKD 1FTSA 1T9KA 1M6TA 4MVOA 3ZTZA 1GQAA 1V74B 2IBFA 3JYHA 4DBRA 5IY5C 1GGQA 2LP4A 2P6VA 1OW8A 4HE8D 4NQFA 3EZIA 3VYWA 2YRFA 3L8JA 2A1DD 4PACA 1JPJA 3T6GB 2EPLX 2R7OA 4DJ9A 3ASNC 3S0XA 2LK4A 3LS0A 2WB7A 4EKWA 4U5FE 1WTYA 1BR1A 1OW6A 1YZAA 3SYNA 1YAUO 4YT5A 4EBBA 5L0JA 2XXAA 4MS2A 4MVQA 3S28A 2W4BA 2LD6A 1D0XA 2R05A 1H9TA 1NLXA 2HV7A 3HNJA 256BA 1HY5A 3W8HA 5KYNA 4EHPA 2Y3DA 1JOGA 4G7ZF 5T1DB 3HLZA 1DOWA 4LDQA 2GA0A 3C63A 5DS5A 1JAFA 1Z23A 1RMVA 1T6UA 1Q0FA 4NTFA 4YT8A 1EQ1A 2R7RA 2MWQA 1IW7F 4P6IC 2R7WA 4OIPF 3K1HA 4JTCB 3SXKA 2X51A 2IXNA 5COFA 4IAQA 4Q7CA 5A6BA 2OEVA 4JZAA 2P1AA 4Q4ZF 3UMKA 2OQMA 3ASOC 4EUKB 4CDAA 5HV9A 1TQGA 2HKVA 3H2UA 2GFHA 4YWQA 2J9BA 3IQ6A 3F47A 2RD9A 4YT2A 2DYSC 3W4YA 2G3VA 3E9VA 5JSLA 2WZLA 4CBEA 1AUEA 3DZAA 3OWTA 2KNHA 3JZ0A 3W8IA 3QMKA 1OCZC 2G3KA 4I44A 4MNDA 2IM8A 2QY9A 1Y6DA 3GEHA 1YA9A 3GM2A 3NMKA 3WODF 4YT4A 1KU2A 1KNYA 4ZLCA 4U5DE 3OA1A 3IEEA 5B3IA 3SXYA 3KL4A 4J30B 4ONSA 1FFTC 2HSQA 5FCLA 4C7OA 1U89A 2OU6A 2OOCA 4PFOA 4U5HA 2YL7A 2AVKA 4LLEA 3N2ZB 5L0GA 3G50A 3AOUA 1YJGA 3AGTA 5L0HA 2FFHA 2KGOA 5KYUA 3ZTMA 2KQ9A 3JSEO 4I1OB 3JT1A 2YL1A 2NSGA 3NRHA 3NYJA 4LLCA 5K0IA 2V3CC 1FR0A 3U9MA 1SYQA 4JRZA 3K7DA 4NCQA 2MYSA 1A7EA 2YHSA 2Z15A 1Y4CA 2A6HF 3JTLO 4CDVA 5JRAA 2DB4A 1NFOA 3H2VA 4ANJA 4DVZA 1PV3A 1NFNA 5B3SC 2XL4A 2OG2A 4QDLA 3SXZA 3U9JA 5BQGA 4JE9A 1TFOB 3DAGA 4AK9A 2DI3A 5KYWB 2JD3A 4U5BE 1G5ZA 3AQBA 2B0HA 1V55C 4JTAB 1WGWA 3NYLA 1Z7Qc 3QTHA 3FOOA 3LS1A 3NMIA 1NSGB 2H7BA 3U8VA 2J7PD 2R7VA 1SF8A 3CZ6A 1OR3A 1OCCC 3HTKC 1CGOA 3U2LA 3UGOA 3LJBA 1DOVA 1ZHZA 2J8WA 3RF3A 3EPVA 4W8KA 5KYYB 4JJGA 1HMOA 1M2OA 1T6IA 1VLSA 1K40A 3S84A 1A0BA 2J9WA 2Q9AA 2W9YA 3K66A 4HFKB 4MW3A 4E0IA 1Q0DA 3KYJA 3RYLA 1WATA 2OKUA 1MQVA 1LS1A 3DKAA 1OR2A 3I5QA 2Q7RA 4C3EA 1PD0A 3EH1A 1E85A 2YZSA 3MX3A 4ZLDA 3DM9B 2EIKC 2VH3A 3IQTA 5F28E 2TMVP 4MQ9F 1QPUA 2DYRC 4FX5A 3MFNA 2XLEA 3L0IA 1ZW3A 2I8BA 2XM0A 3MLGA 3JRTA 1CPQA 4L6RA 3U0CA 1LE4A 1D1AA 2KK1A 4CS9C 4O6MA 2YLIA 3DMDA 1B68A 4WGZA 1RXQA 2DGJA 3TK0A 2LIGA 3ZQYA 4E7SA 3DE9A 4DBQA 4CJGA 2PP4A 3GANA 3TULA 1XZPA 3DAFA 4ULWA 2EPKX 2CGEA 4NTBA 4I1MA 3RVYA 1H9GA 3PCVA 1QZXA 3LAYA 2R7TA 2Y3GA 2XL8A 4YL0A 4DXWA 3TJ5A 1L3PA 2MHRA 3LEOA 2HSBA 4CJOA 2EILC 3FDQA 5CIVA 3J06A 2X0CA 3I5PA 3O39A 1MNEA 1R5ID 4BPMA 2LFDA 2QUPA 2CNWA 4XEFA 3TOMA 3F46A 3M15A 4E0HA 3RFYA 5A69A 1CGME 2L6HA 3L1MA 3L34A 1GS9A 5L0IA 1Q0KA 2A69F 2J0WA 2XLOA 4FAPB 1BR4A 4CSAC 4GEHA 4J32B 1TR2A 4O6YA 4PJJA 2JX0A 2PBEA 2YLGA 1NU9C 3LLIA 3LNRA 5B1BC 1LKXA 5KYWA 2AU5A 2NUPB 4XPYA 4CS9A 2R7UA 2C03A 1ORSC 2KYHA 3ABMC 3RVZA 2ASRA 4OIRF 3NYMA 4ULVA 1VMAA 2IOQA 2J45A 3EFOA 3ZG1A 3FAJA 4IJJA 3ZIBA 4I3MA 3C7JA 3TQOA 4XLPF 1HE9A 2M4EA 2XLDA 1K05A 1D1BA 1MMAA 2OJED 3IPMO 2NPUA 4KBLA 5GPGB 3RW0A 4DOZA 5BUOA 5KYYA 1T5OA 2RSEB 2XLVA 1ZU5A 2YQYA 4FESA 3AJMA 2EIMC 2Q9CA 3G4XA 3A11A 1OQCA 3QVZA 1Z3IX 3RH3A 2LCHA 3ZVRA 3W2WA 4P9FA 5BQIA 3LUTB 4MTFA 3T6BA 2IYLD 1Q0GA 2XM4A 3S29A 1YLMA 5L0FA 2AWYA 1PCXA 2ZXOA 3NKDA 5A6BD 3FXHA 3MBGA 5AC4A 2VCBA 2YKZA 2ZPAA 3GODA 2H7OA 5DVWA 4CSAA 1H6GA 2HV6A 3Q6MA 3GM3A 5TJ5E 1NU7D 3Q6NA 4X0RA 4YK5A 4R32A 3UNGC 5E33A 5EHHA 1G4WR 1E84A 4K7BA 1YDIA 2R02A 3AG3C 5DQTA 4OIQF 3B0PA 2VCCA 1T01A 3AG1C 1VYIA 3EGXB 4YN0B 2W4MA 1ZHWA 2HFIA 3I4UA 3KYIA 4MTOA 1J8YF 3B0VC 3LESA 3AQCA 4Z9HA 4F4BA 4W8PA 3SXMA 2CCYA 5HSWA 4JJFA 1VK5A 2XS8A 4JW1A 4MVSA 3EHNA 3US6A 4A2NB 3C8GB 4BJ1A 1FNTc 2Q9BA 4OD5A 1V54C 2OCCC 4CIPA 4IAOA 4QI0A 5T3WA 1O3UA 1Z5ZA 2LQGA 3GEEA 4BEMJ 4BEJA 3MYIA 3FHDA 5DS6A 2BC5A 2ZXRA 3HNIA 2L7AA 4RBNA 1WOLA 2CW0F 3ZSUA 4CIHA 2VC9A 1E86A 3DD7A 1N1CA 3CSKA 1TKNA 4M63A 3G4ZA 4BJ6C 3EH2A 3DXJF 3DJUB 1LI5A 2J9UA 2R25A 4MVMA 4RD9A 4D4XA 2IXMA 4EIYA 3DM5A 4G78A 1TWCA 2L9JA 3TJ6A 4BG0A 2WZGA 1KTMA 2NUPA 2Y3BA 2LSEA 3A9CA 4JEAA 5F5FA 4LERA 1JRAA 1TFKB 2D5RB 2E87A 1TWHA 3FMSA 4AL1A 1BZ4A 1TWAA 1VB5A 3R7CA 4KNVA 1BBHA 2Y69C 1CGNA 4FWVA 3SNHA 1L7CA 2HS5A 3ZDLA 5JUAA 5E3AA 1QLEC 2YL3A 3K1IC 1K04A 2QNLA 1VYKA 4MVUA 4PR9A 1M57C 4IB4A 1HW1A 2EIJC 1UG7A 1PD1A 2Y3HA 3V7OA 1LI7A 2HUJA 2R9RB 5E3CA 3VM6A 3NDBB 3UMIA 2KW3C 3ABLC 3VAYA 4AE4B 2VCAA 2WVNA 3JSZA 2ICWG 4IARA 4C3BA 3U8PA 2M64A 1T6QA 4JIOA 1G4US 1LE2A 1V4AA 2OEXA 3GM1A 1OCRC 4BJ6A 5F5HA 1QQ3A 1RKEB 1NG1A 1JPNA 1J8MF 2R7QA 1W2WA 1WASA 2YVKA 2PF4E 5KYXB 2EPOA 3H65A 3ZQVA 5JS5A 4IRUA 1D0ZA 1M2VB 5AC5A 1XWJA 2A6EF 3EGXA 3RQEA 1SZIA 3U3FA 4BJTA 3DWWA 1S7ZA 1OXBA 3FVYA 3QVYA 2AWCA 4Q5SF 4D4NA 1YYXA 4A4AA 1ZYRF 2KSFA 4O6NA 3R2PA 1RCPA 4E18A 2ZD9A 1VLTA 1Z6AA 3HKKA 4O79A 4XEKA 1APCA 3K33A 3N24A 4RDAA 3EGDB 1NBBA 3C8GA 5A6KA 3AG4C
chains in the Genus database with same CATH topology
5L3QA 4CS8C 3B9QA 3RIPA 3T4RA 4XLNF 3EHMA 3EQLF 5DLJA 1O5HA 5E2QA 2A68F 3CQZA 4C7OB 3UMHA 1LVKA 3X1OA 3NKEA 1FMWA 1MMNA 1OKKA 2CNWD 3SEOA 4CS7A 3DJNB 4KNWA 2WZFA 1G8XA 2J9VA 4U5GA 4KC9A 4PJNA 4EWCA 2BE5F 1TWGA 2Q3TA 4C3DA 5L3VA 4IWBA 2FGYA 4CS8A 3HJCA 3ECSA 2ZXWC 3SZRA 2C04A 3S27A 1ST6A 4AE4A 1D1CA 5B1AC 2O9XA 1BR2A 1SMYF 3N0TA 3AG2C 1D0YA 3KKBA 1ZHYA 4DVYP 4NY3A 3PMRA 4G7OF 4LACB 5KYXA 3WG7C 4E7ZA 2R7SA 4K0DA 3UR3C 1M2VA 3NG1A 4OD4A 5DS4A 1RJ9B 4HEAJ 2XRHA 2PFDA 1Z63A 2R7XA 4HFFB 4WJ0A 1IZMA 1OCOC 1O87A 2PX0A 2IXOA 2NUTB 3EGDA 3EG9B 5CI9A 2P7VA 2V26A 2WL8A 4JCHA 4OINF 3UGPA 2VASA 4H4KC 4BJ5C 4OIOF 3NDBB 3ABKC 3PHF2 2J46A 2XSEA 4XTKA 1FFHA 2PX3A 4PFPA 5DQZA 1FMVA 2IXPA 4XWJA 3EZHA 3QZCA 3JCUQ 2H7VC 4QI2A 3Q7GA 4U5CE 5D92A 4JURI 2J7PA 2XXAB 3X2QC 1MMGA 2YEVA 1M56C 4AX2A 2G62A 1ZHXA 2NG1A 4KI2A 3RKOF 3EFOB 2L81A 2KJGA 1MMDA 3OEOA 2VB6A 2Y39A 2B0JA 3T6JA 4BJ5A 2W45A 5T3TA 1NZEA 4PJMA 3EJNA 3E70C 3W2VA 4O7GA 1MNDA 3ZC4A 4B6IA 3KH2A 2WVQA 2WVOA 5EGYA 1ZHTA 4PJLA 3K6BA 1RJ9A 1VOMA 4YJWA 5CI8A 3KMIA 3SP1A 4PK4A 4N06A 4GYTA 2ZXPA 3O6XA 2NUTA 3LLKA 5D91A 3EG9A 2EINC 4G0HA 4U5EE 4JVSA 3POVA 3ITFA 4G7HF 3M1CB 2CDQA 1ZU4A 2QTVA 5KYUB 3TD7A 3Q7LA 3LEVA 3B0UX 2J0XA 1OKKD 1FTSA 4DBRA 3JYHA 5IY5C 2P6VA 4HE8D 3VYWA 3EZIA 2A1DD 1JPJA 2R7OA 3S0XA 3ASNC 3LS0A 2WB7A 4U5FE 1BR1A 3SYNA 4YT5A 4EBBA 2XXAA 3S28A 2W4BA 1D0XA 2HV7A 3W8HA 5KYNA 2Y3DA 4G7ZF 5T1DB 3HLZA 5DS5A 1Z23A 4YT8A 2MWQA 1IW7F 4P6IC 2R7WA 4OIPF 3K1HA 2X51A 2IXNA 4Q7CA 4JZAA 4Q4ZF 3UMKA 3ASOC 2GFHA 4YWQA 3F47A 4YT2A 2DYSC 2G3VA 3E9VA 2WZLA 4CBEA 3DZAA 3OWTA 2KNHA 3W8IA 3QMKA 1OCZC 2G3KA 4I44A 4MNDA 3WODF 2QY9A 4YT4A 1KU2A 4ZLCA 4U5DE 3OA1A 3IEEA 3KL4A 4J30B 1FFTC 4C7OA 5FCLA 4PFOA 4U5HA 4LLEA 3N2ZB 2FFHA 2KGOA 5KYUA 2KQ9A 4I1OB 3JT1A 3NRHA 4LLCA 3NYJA 2V3CC 3K7DA 2MYSA 2YHSA 2Z15A 2A6HF 4ANJA 4DVZA 5B3SC 2XL4A 2OG2A 4QDLA 3DAGA 4AK9A 5KYWB 2JD3A 4U5BE 3AQBA 1V55C 1WGWA 3NYLA 3LS1A 2H7BA 2J7PD 2R7VA 1SF8A 3CZ6A 3HTKC 1OCCC 3UGOA 3LJBA 1ZHZA 3EPVA 4W8KA 5KYYB 4JJGA 1M2OA 2J9WA 2Q9AA 2W9YA 3K66A 4HFKB 3RYLA 4BEJA 3I5QA 1LS1A 4C3EA 2R7RA 1PD0A 3EH1A 4ZLDA 2YZSA 3MX3A 3DM9B 2EIKC 2VH3A 4MQ9F 2DYRC 4FX5A 3L0IA 2I8BA 3MLGA 3JRTA 1D1AA 4CS9C 4O6MA 3DMDA 2DGJA 4E7SA 4DBQA 2PP4A 3GANA 3DAFA 4ULWA 2CGEA 4I1MA 1QZXA 3LAYA 2R7TA 2Y3GA 2EILC 3FDQA 3I5PA 3O39A 1MNEA 2CNWA 3F46A 3RFYA 3L34A 2A69F 2J0WA 1BR4A 4CSAC 4GEHA 4J32B 1TR2A 4O6YA 4PJJA 1NU9C 3LLIA 3LNRA 5B1BC 1LKXA 5KYWA 2NUPB 4CS9A 2R7UA 2C03A 3ABMC 4OIRF 3NYMA 1VMAA 2IOQA 2J45A 3EFOA 3ZG1A 3FAJA 4IJJA 3ZIBA 4I3MA 4XLPF 2M4EA 1D1BA 1MMAA 4KBLA 4DOZA 5KYYA 5BUOA 4FESA 1ZU5A 2EIMC 2Q9CA 1Z3IX 3RH3A 3ZVRA 3W2WA 3T6BA 2IYLD 3S29A 1PCXA 2ZXOA 3NKDA 2ZPAA 3GODA 2H7OA 5DVWA 4CSAA 2HV6A 3Q6MA 5EHHA 3UNGC 1NU7D 3Q6NA 4X0RA 4OIQF 5E33A 4K7BA 3AG3C 5DQTA 3B0PA 3AG1C 1VYIA 3EGXB 4YN0B 2W4MA 1ZHWA 3I4UA 1J8YF 3B0VC 3LESA 3AQCA 4F4BA 5HSWA 4JJFA 1VK5A 4JW1A 3EHNA 4A2NB 4BJ1A 2Q9BA 4OD5A 1V54C 2OCCC 4IAOA 4QI0A 5T3WA 1Z5ZA 5DS6A 3FHDA 2ZXRA 4RBNA 3ZSUA 2CW0F 4CIHA 3DD7A 1N1CA 3CSKA 1TKNA 4M63A 4BJ6C 3EH2A 3DXJF 3DJUB 2J9UA 4RD9A 2IXMA 3DM5A 1TWCA 2L9JA 4BG0A 2WZGA 2NUPA 2Y3BA 2LSEA 5F5FA 4LERA 2D5RB 2E87A 1TWHA 1TWAA 4KNVA 2Y69C 3SNHA 4FWVA 5E3AA 1QLEC 3K1IC 1VYKA 1M57C 2EIJC 1PD1A 2Y3HA 3V7OA 5E3CA 3UMIA 2KW3C 3ABLC 3VAYA 4AE4B 2WVNA 3JSZA 4C3BA 4BJ6A 1OCRC 5F5HA 1NG1A 1JPNA 1J8MF 2R7QA 1W2WA 5KYXB 2PF4E 3H65A 4IRUA 1D0ZA 1M2VB 4BJTA 2A6EF 3EGXA 1SZIA 3FVYA 1S7ZA 4Q5SF 1ZYRF 4O6NA 1Z6AA 4O79A 3K33A 3N24A 4RDAA 3EGDB 3AG4C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D5R B;  2Z15 A;  3E9V A;  5CI8 A;  5CI9 A;  3DJN B;  3DJU B; 
#chains in the Genus database with same CATH topology
 5L3Q A;  4CS8 C;  1LIH A;  3K1I A;  3B9Q A;  3RIP A;  3T4R A;  3FAP B;  4XLN F;  3EHM A;  3EQL F;  2HMZ A;  5DLJ A;  1C02 A;  1Q0M A;  4DRI B;  3DE8 A;  1O5H A;  5E2Q A;  3L8I A;  3O10 A;  2A68 F;  3CQZ A;  4C7O B;  3UMH A;  1LVK A;  3X1O A;  3NKE A;  1FMW A;  1WWP A;  1MMN A;  2YLD A;  1OKK A;  1A7D A;  2CNW D;  3SEO A;  4CS7 A;  2GDC A;  3DJN B;  3MYF A;  5AGF A;  1VTM P;  4YL1 A;  3HNL A;  1E83 A;  1E2X A;  1YYJ A;  2QE9 A;  2UUH A;  4KNW A;  2HMQ A;  2WZF A;  4DRJ B;  1WN0 A;  4CX9 A;  3IQC A;  4IGG A;  2A0U A;  4Z9I A;  1G8X A;  5BQH A;  2J9V A;  4P9T A;  1LM3 B;  4U5G A;  3VF0 A;  4KC9 A;  1QSP A;  4PJN A;  4EWC A;  3PDM P;  2BE5 F;  1TWG A;  2Q3T A;  4C3D A;  5L3V A;  3C18 A;  2XLM A;  4IWB A;  3U3B A;  3LNM B;  5COG A;  2HJM A;  2FGY A;  4CS8 A;  3HJC A;  1YVI A;  4LDK A;  3ECS A;  3V5Y A;  2ZXW C;  3SZR A;  2C04 A;  3S27 A;  1ST6 A;  3M79 A;  4H54 A;  3C8Z A;  4AE4 A;  2QLA A;  1D1C A;  4JKV A;  5B1A C;  2O9X A;  4U9E A;  1BR2 A;  1SMY F;  3N0T A;  1EKY A;  1CPR A;  3FOP A;  3AG2 C;  4GQH A;  1D0Y A;  1ZW2 A;  4N6C A;  3KKB A;  5A6J A;  1ZHY A;  4DVY P;  1RKE A;  1QVX A;  2P61 A;  4NY3 A;  3PMR A;  4G7O F;  4LAC B;  3U5S A;  5KYX A;  3WG7 C;  4E7Z A;  2R7S A;  4K0D A;  1YZC A;  3UR3 C;  1M2V A;  1FAP B;  3NG1 A;  4OD4 A;  4CDY A;  5DS4 A;  4UDV A;  1RJ9 B;  1YA7 O;  3NMJ A;  4XPX A;  2Q4F A;  4HEA J;  2XRH A;  2PFD A;  2UUI A;  1Z63 A;  4HFF B;  4WJ0 A;  1IZM A;  1OCO C;  2R7X A;  1ZVZ A;  2PNO A;  1O87 A;  2PX0 A;  2IXO A;  4JEB A;  2NUT B;  3B29 A;  3EGD A;  5L0D A;  1C17 M;  2EPN A;  3QW1 A;  4NTA A;  3EG9 B;  2Q00 A;  1I4Y A;  5CI9 A;  5COM A;  1AEP A;  2P7V A;  2V26 A;  4WGY A;  1HE1 A;  4EBJ A;  2WL8 A;  3ZWI A;  4Z9J A;  3T9O A;  2P0N A;  4JCH A;  4OIN F;  3JRM O;  3UGP A;  1I4Z A;  1EI7 A;  1JMW A;  2F22 A;  2LFF A;  2VAS A;  1XZQ A;  2NSF A;  2XLH A;  4H4K C;  4JC7 A;  4LDR A;  4N4W A;  4U9D A;  4BJ5 C;  3ABK C;  4OIO F;  4JCZ A;  3S9O A;  3PHF 2;  1OW7 A;  5EK0 A;  2J46 A;  2XSE A;  4JTD B;  4XTK A;  2A0B A;  1HW2 A;  1FFH A;  1ORY A;  3BEH A;  2PX3 A;  3AGU A;  4WAB A;  4AL0 A;  3RQF A;  4PFP A;  1C03 A;  5DQZ A;  1FMV A;  1EA8 A;  1S05 A;  2IXP A;  3DI5 A;  3IHU A;  2CYD A;  3CEX A;  4XQ1 A;  4XWJ A;  5FZT A;  5JP7 A;  5JT4 A;  3EZH A;  3QZC A;  4J7T A;  1H7I A;  3JCU Q;  1A7V A;  2H7V C;  1LPE A;  4QI2 A;  3Q7G A;  3TOL A;  4U5C E;  5D92 A;  1SR2 A;  3BRJ A;  4JUR I;  2J7P A;  2XXA B;  3X2Q C;  1MMG A;  2YEV A;  1M56 C;  2OJQ A;  3RQG A;  2YL0 A;  4AX2 A;  2G62 A;  4XEV A;  2KC3 A;  2R03 A;  1ZHX A;  2L6F A;  1JR8 A;  2FAP B;  2HJ3 A;  2NG1 A;  3B71 A;  1RKC A;  2GWW A;  3HNK A;  3CAX A;  2XS1 A;  3RKO F;  3M4B A;  3S90 A;  1I5N A;  4KI2 A;  3EFO B;  3JYY A;  4MW8 A;  2L81 A;  2I15 A;  1MMD A;  2KJG A;  2VB6 A;  3M4C A;  2Y39 A;  3OEO A;  1A41 A;  4EBK A;  5L0C A;  2B0J A;  3T6J A;  4N6H A;  1LS4 A;  2W45 A;  3WHN A;  4BJ5 A;  3KPH A;  5T3T A;  4YL3 A;  1NZE A;  4PJM A;  3EJN A;  4ER9 A;  3E70 C;  1U6H A;  3W2V A;  5JVE A;  4O7G A;  1GM5 A;  1MND A;  3GWL A;  3ZC4 A;  3C62 A;  4B6I A;  2EPM X;  3KH2 A;  2WVQ A;  2WVO A;  4K1O A;  1ZHT A;  4PJL A;  5EGY A;  3GWN A;  3K6B A;  1RJ9 A;  1VOM A;  2YWA A;  4YJW A;  5CI8 A;  3QW0 A;  3KMI A;  2ETS A;  1ZZP A;  1R4T A;  2BL2 A;  3IQ5 A;  4PK4 A;  3SP1 A;  3U2M A;  4N06 A;  1U0B B;  4GYT A;  2ZXP A;  3O6X A;  1ORJ A;  2NUT A;  1OXK A;  2AP3 A;  1F1M A;  3LLK A;  5JLI A;  5D91 A;  1YAR O;  3EG9 A;  3GOR A;  3O55 A;  3V5X A;  3WAQ A;  2EIN C;  3ATP A;  4NC3 A;  2HZ8 A;  4MVZ A;  4MTG A;  4XPW A;  1UFB A;  4G0H A;  4U5E E;  4JVS A;  2XL6 A;  3POV A;  3ITF A;  3GEI A;  2L6G A;  4E17 A;  2H8A A;  3VRC A;  3C8G D;  4G7H F;  3M1C B;  2XLW A;  4MVR A;  4DRH B;  2CDQ A;  1AVO B;  1ZU4 A;  2D4U A;  3V5Z A;  2GAQ A;  2QTV A;  1QKR A;  2JPU A;  5KYU B;  3TD7 A;  3Q7L A;  5A6A A;  3LEV A;  4J7Y A;  3B0U X;  2J0X A;  1BDJ B;  1HMD A;  1OKK D;  1FTS A;  1T9K A;  1M6T A;  4MVO A;  3ZTZ A;  1GQA A;  1V74 B;  2IBF A;  3JYH A;  4DBR A;  5IY5 C;  1GGQ A;  2LP4 A;  2P6V A;  1OW8 A;  4HE8 D;  4NQF A;  3EZI A;  3VYW A;  2YRF A;  3L8J A;  2A1D D;  4PAC A;  1JPJ A;  3T6G B;  2EPL X;  2R7O A;  4DJ9 A;  3ASN C;  3S0X A;  2LK4 A;  3LS0 A;  2WB7 A;  4EKW A;  4U5F E;  1WTY A;  1BR1 A;  1OW6 A;  1YZA A;  3SYN A;  1YAU O;  4YT5 A;  4EBB A;  5L0J A;  2XXA A;  4MS2 A;  4MVQ A;  3S28 A;  2W4B A;  2LD6 A;  1D0X A;  2R05 A;  1H9T A;  1NLX A;  2HV7 A;  3HNJ A;  256B A;  1HY5 A;  3W8H A;  5KYN A;  4EHP A;  2Y3D A;  1JOG A;  4G7Z F;  5T1D B;  3HLZ A;  1DOW A;  4LDQ A;  2GA0 A;  3C63 A;  5DS5 A;  1JAF A;  1Z23 A;  1RMV A;  1T6U A;  1Q0F A;  4NTF A;  4YT8 A;  1EQ1 A;  2R7R A;  2MWQ A;  1IW7 F;  4P6I C;  2R7W A;  4OIP F;  3K1H A;  4JTC B;  3SXK A;  2X51 A;  2IXN A;  5COF A;  4IAQ A;  4Q7C A;  5A6B A;  2OEV A;  4JZA A;  2P1A A;  4Q4Z F;  3UMK A;  2OQM A;  3ASO C;  4EUK B;  4CDA A;  5HV9 A;  1TQG A;  2HKV A;  3H2U A;  2GFH A;  4YWQ A;  2J9B A;  3IQ6 A;  3F47 A;  2RD9 A;  4YT2 A;  2DYS C;  3W4Y A;  2G3V A;  3E9V A;  5JSL A;  2WZL A;  4CBE A;  1AUE A;  3DZA A;  3OWT A;  2KNH A;  3JZ0 A;  3W8I A;  3QMK A;  1OCZ C;  2G3K A;  4I44 A;  4MND A;  2IM8 A;  2QY9 A;  1Y6D A;  3GEH A;  1YA9 A;  3GM2 A;  3NMK A;  3WOD F;  4YT4 A;  1KU2 A;  1KNY A;  4ZLC A;  4U5D E;  3OA1 A;  3IEE A;  5B3I A;  3SXY A;  3KL4 A;  4J30 B;  4ONS A;  1FFT C;  2HSQ A;  5FCL A;  4C7O A;  1U89 A;  2OU6 A;  2OOC A;  4PFO A;  4U5H A;  2YL7 A;  2AVK A;  4LLE A;  3N2Z B;  5L0G A;  3G50 A;  3AOU A;  1YJG A;  3AGT A;  5L0H A;  2FFH A;  2KGO A;  5KYU A;  3ZTM A;  2KQ9 A;  3JSE O;  4I1O B;  3JT1 A;  2YL1 A;  2NSG A;  3NRH A;  3NYJ A;  4LLC A;  5K0I A;  2V3C C;  1FR0 A;  3U9M A;  1SYQ A;  4JRZ A;  3K7D A;  4NCQ A;  2MYS A;  1A7E A;  2YHS A;  2Z15 A;  1Y4C A;  2A6H F;  3JTL O;  4CDV A;  5JRA A;  2DB4 A;  1NFO A;  3H2V A;  4ANJ A;  4DVZ A;  1PV3 A;  1NFN A;  5B3S C;  2XL4 A;  2OG2 A;  4QDL A;  3SXZ A;  3U9J A;  5BQG A;  4JE9 A;  1TFO B;  3DAG A;  4AK9 A;  2DI3 A;  5KYW B;  2JD3 A;  4U5B E;  1G5Z A;  3AQB A;  2B0H A;  1V55 C;  4JTA B;  1WGW A;  3NYL A;  1Z7Q c;  3QTH A;  3FOO A;  3LS1 A;  3NMI A;  1NSG B;  2H7B A;  3U8V A;  2J7P D;  2R7V A;  1SF8 A;  3CZ6 A;  1OR3 A;  1OCC C;  3HTK C;  1CGO A;  3U2L A;  3UGO A;  3LJB A;  1DOV A;  1ZHZ A;  2J8W A;  3RF3 A;  3EPV A;  4W8K A;  5KYY B;  4JJG A;  1HMO A;  1M2O A;  1T6I A;  1VLS A;  1K40 A;  3S84 A;  1A0B A;  2J9W A;  2Q9A A;  2W9Y A;  3K66 A;  4HFK B;  4MW3 A;  4E0I A;  1Q0D A;  3KYJ A;  3RYL A;  1WAT A;  2OKU A;  1MQV A;  1LS1 A;  3DKA A;  1OR2 A;  3I5Q A;  2Q7R A;  4C3E A;  1PD0 A;  3EH1 A;  1E85 A;  2YZS A;  3MX3 A;  4ZLD A;  3DM9 B;  2EIK C;  2VH3 A;  3IQT A;  5F28 E;  2TMV P;  4MQ9 F;  1QPU A;  2DYR C;  4FX5 A;  3MFN A;  2XLE A;  3L0I A;  1ZW3 A;  2I8B A;  2XM0 A;  3MLG A;  3JRT A;  1CPQ A;  4L6R A;  3U0C A;  1LE4 A;  1D1A A;  2KK1 A;  4CS9 C;  4O6M A;  2YLI A;  3DMD A;  1B68 A;  4WGZ A;  1RXQ A;  2DGJ A;  3TK0 A;  2LIG A;  3ZQY A;  4E7S A;  3DE9 A;  4DBQ A;  4CJG A;  2PP4 A;  3GAN A;  3TUL A;  1XZP A;  3DAF A;  4ULW A;  2EPK X;  2CGE A;  4NTB A;  4I1M A;  3RVY A;  1H9G A;  3PCV A;  1QZX A;  3LAY A;  2R7T A;  2Y3G A;  2XL8 A;  4YL0 A;  4DXW A;  3TJ5 A;  1L3P A;  2MHR A;  3LEO A;  2HSB A;  4CJO A;  2EIL C;  3FDQ A;  5CIV A;  3J06 A;  2X0C A;  3I5P A;  3O39 A;  1MNE A;  1R5I D;  4BPM A;  2LFD A;  2QUP A;  2CNW A;  4XEF A;  3TOM A;  3F46 A;  3M15 A;  4E0H A;  3RFY A;  5A69 A;  1CGM E;  2L6H A;  3L1M A;  3L34 A;  1GS9 A;  5L0I A;  1Q0K A;  2A69 F;  2J0W A;  2XLO A;  4FAP B;  1BR4 A;  4CSA C;  4GEH A;  4J32 B;  1TR2 A;  4O6Y A;  4PJJ A;  2JX0 A;  2PBE A;  2YLG A;  1NU9 C;  3LLI A;  3LNR A;  5B1B C;  1LKX A;  5KYW A;  2AU5 A;  2NUP B;  4XPY A;  4CS9 A;  2R7U A;  2C03 A;  1ORS C;  2KYH A;  3ABM C;  3RVZ A;  2ASR A;  4OIR F;  3NYM A;  4ULV A;  1VMA A;  2IOQ A;  2J45 A;  3EFO A;  3ZG1 A;  3FAJ A;  4IJJ A;  3ZIB A;  4I3M A;  3C7J A;  3TQO A;  4XLP F;  1HE9 A;  2M4E A;  2XLD A;  1K05 A;  1D1B A;  1MMA A;  2OJE D;  3IPM O;  2NPU A;  4KBL A;  5GPG B;  3RW0 A;  4DOZ A;  5BUO A;  5KYY A;  1T5O A;  2RSE B;  2XLV A;  1ZU5 A;  2YQY A;  4FES A;  3AJM A;  2EIM C;  2Q9C A;  3G4X A;  3A11 A;  1OQC A;  3QVZ A;  1Z3I X;  3RH3 A;  2LCH A;  3ZVR A;  3W2W A;  4P9F A;  5BQI A;  3LUT B;  4MTF A;  3T6B A;  2IYL D;  1Q0G A;  2XM4 A;  3S29 A;  1YLM A;  5L0F A;  2AWY A;  1PCX A;  2ZXO A;  3NKD A;  5A6B D;  3FXH A;  3MBG A;  5AC4 A;  2VCB A;  2YKZ A;  2ZPA A;  3GOD A;  2H7O A;  5DVW A;  4CSA A;  1H6G A;  2HV6 A;  3Q6M A;  3GM3 A;  5TJ5 E;  1NU7 D;  3Q6N A;  4X0R A;  4YK5 A;  4R32 A;  3UNG C;  5E33 A;  5EHH A;  1G4W R;  1E84 A;  4K7B A;  1YDI A;  2R02 A;  3AG3 C;  5DQT A;  4OIQ F;  3B0P A;  2VCC A;  1T01 A;  3AG1 C;  1VYI A;  3EGX B;  4YN0 B;  2W4M A;  1ZHW A;  2HFI A;  3I4U A;  3KYI A;  4MTO A;  1J8Y F;  3B0V C;  3LES A;  3AQC A;  4Z9H A;  4F4B A;  4W8P A;  3SXM A;  2CCY A;  5HSW A;  4JJF A;  1VK5 A;  2XS8 A;  4JW1 A;  4MVS A;  3EHN A;  3US6 A;  4A2N B;  3C8G B;  4BJ1 A;  1FNT c;  2Q9B A;  4OD5 A;  1V54 C;  2OCC C;  4CIP A;  4IAO A;  4QI0 A;  5T3W A;  1O3U A;  1Z5Z A;  2LQG A;  3GEE A;  4BEM J;  4BEJ A;  3MYI A;  3FHD A;  5DS6 A;  2BC5 A;  2ZXR A;  3HNI A;  2L7A A;  4RBN A;  1WOL A;  2CW0 F;  3ZSU A;  4CIH A;  2VC9 A;  1E86 A;  3DD7 A;  1N1C A;  3CSK A;  1TKN A;  4M63 A;  3G4Z A;  4BJ6 C;  3EH2 A;  3DXJ F;  3DJU B;  1LI5 A;  2J9U A;  2R25 A;  4MVM A;  4RD9 A;  4D4X A;  2IXM A;  4EIY A;  3DM5 A;  4G78 A;  1TWC A;  2L9J A;  3TJ6 A;  4BG0 A;  2WZG A;  1KTM A;  2NUP A;  2Y3B A;  2LSE A;  3A9C A;  4JEA A;  5F5F A;  4LER A;  1JRA A;  1TFK B;  2D5R B;  2E87 A;  1TWH A;  3FMS A;  4AL1 A;  1BZ4 A;  1TWA A;  1VB5 A;  3R7C A;  4KNV A;  1BBH A;  2Y69 C;  1CGN A;  4FWV A;  3SNH A;  1L7C A;  2HS5 A;  3ZDL A;  5JUA A;  5E3A A;  1QLE C;  2YL3 A;  3K1I C;  1K04 A;  2QNL A;  1VYK A;  4MVU A;  4PR9 A;  1M57 C;  4IB4 A;  1HW1 A;  2EIJ C;  1UG7 A;  1PD1 A;  2Y3H A;  3V7O A;  1LI7 A;  2HUJ A;  2R9R B;  5E3C A;  3VM6 A;  3NDB B;  3UMI A;  2KW3 C;  3ABL C;  3VAY A;  4AE4 B;  2VCA A;  2WVN A;  3JSZ A;  2ICW G;  4IAR A;  4C3B A;  3U8P A;  2M64 A;  1T6Q A;  4JIO A;  1G4U S;  1LE2 A;  1V4A A;  2OEX A;  3GM1 A;  1OCR C;  4BJ6 A;  5F5H A;  1QQ3 A;  1RKE B;  1NG1 A;  1JPN A;  1J8M F;  2R7Q A;  1W2W A;  1WAS A;  2YVK A;  2PF4 E;  5KYX B;  2EPO A;  3H65 A;  3ZQV A;  5JS5 A;  4IRU A;  1D0Z A;  1M2V B;  5AC5 A;  1XWJ A;  2A6E F;  3EGX A;  3RQE A;  1SZI A;  3U3F A;  4BJT A;  3DWW A;  1S7Z A;  1OXB A;  3FVY A;  3QVY A;  2AWC A;  4Q5S F;  4D4N A;  1YYX A;  4A4A A;  1ZYR F;  2KSF A;  4O6N A;  3R2P A;  1RCP A;  4E18 A;  2ZD9 A;  1VLT A;  1Z6A A;  3HKK A;  4O79 A;  4XEK A;  1APC A;  3K33 A;  3N24 A;  4RDA A;  3EGD B;  1NBB A;  3C8G A;  5A6K A;  3AG4 C; 
#chains in the Genus database with same CATH homology
 5L3Q A;  4CS8 C;  3B9Q A;  3RIP A;  3T4R A;  4XLN F;  3EHM A;  3EQL F;  5DLJ A;  1O5H A;  5E2Q A;  2A68 F;  3CQZ A;  4C7O B;  3UMH A;  1LVK A;  3X1O A;  3NKE A;  1FMW A;  1MMN A;  1OKK A;  2CNW D;  3SEO A;  4CS7 A;  3DJN B;  4KNW A;  2WZF A;  1G8X A;  2J9V A;  4U5G A;  4KC9 A;  4PJN A;  4EWC A;  2BE5 F;  1TWG A;  2Q3T A;  4C3D A;  5L3V A;  4IWB A;  2FGY A;  4CS8 A;  3HJC A;  3ECS A;  2ZXW C;  3SZR A;  2C04 A;  3S27 A;  1ST6 A;  4AE4 A;  1D1C A;  5B1A C;  2O9X A;  1BR2 A;  1SMY F;  3N0T A;  3AG2 C;  1D0Y A;  3KKB A;  1ZHY A;  4DVY P;  4NY3 A;  3PMR A;  4G7O F;  4LAC B;  5KYX A;  3WG7 C;  4E7Z A;  2R7S A;  4K0D A;  3UR3 C;  1M2V A;  3NG1 A;  4OD4 A;  5DS4 A;  1RJ9 B;  4HEA J;  2XRH A;  2PFD A;  1Z63 A;  2R7X A;  4HFF B;  4WJ0 A;  1IZM A;  1OCO C;  1O87 A;  2PX0 A;  2IXO A;  2NUT B;  3EGD A;  3EG9 B;  5CI9 A;  2P7V A;  2V26 A;  2WL8 A;  4JCH A;  4OIN F;  3UGP A;  2VAS A;  4H4K C;  4BJ5 C;  4OIO F;  3NDB B;  3ABK C;  3PHF 2;  2J46 A;  2XSE A;  4XTK A;  1FFH A;  2PX3 A;  4PFP A;  5DQZ A;  1FMV A;  2IXP A;  4XWJ A;  3EZH A;  3QZC A;  3JCU Q;  2H7V C;  4QI2 A;  3Q7G A;  4U5C E;  5D92 A;  4JUR I;  2J7P A;  2XXA B;  3X2Q C;  1MMG A;  2YEV A;  1M56 C;  4AX2 A;  2G62 A;  1ZHX A;  2NG1 A;  4KI2 A;  3RKO F;  3EFO B;  2L81 A;  2KJG A;  1MMD A;  3OEO A;  2VB6 A;  2Y39 A;  2B0J A;  3T6J A;  4BJ5 A;  2W45 A;  5T3T A;  1NZE A;  4PJM A;  3EJN A;  3E70 C;  3W2V A;  4O7G A;  1MND A;  3ZC4 A;  4B6I A;  3KH2 A;  2WVQ A;  2WVO A;  5EGY A;  1ZHT A;  4PJL A;  3K6B A;  1RJ9 A;  1VOM A;  4YJW A;  5CI8 A;  3KMI A;  3SP1 A;  4PK4 A;  4N06 A;  4GYT A;  2ZXP A;  3O6X A;  2NUT A;  3LLK A;  5D91 A;  3EG9 A;  2EIN C;  4G0H A;  4U5E E;  4JVS A;  3POV A;  3ITF A;  4G7H F;  3M1C B;  2CDQ A;  1ZU4 A;  2QTV A;  5KYU B;  3TD7 A;  3Q7L A;  3LEV A;  3B0U X;  2J0X A;  1OKK D;  1FTS A;  4DBR A;  3JYH A;  5IY5 C;  2P6V A;  4HE8 D;  3VYW A;  3EZI A;  2A1D D;  1JPJ A;  2R7O A;  3S0X A;  3ASN C;  3LS0 A;  2WB7 A;  4U5F E;  1BR1 A;  3SYN A;  4YT5 A;  4EBB A;  2XXA A;  3S28 A;  2W4B A;  1D0X A;  2HV7 A;  3W8H A;  5KYN A;  2Y3D A;  4G7Z F;  5T1D B;  3HLZ A;  5DS5 A;  1Z23 A;  4YT8 A;  2MWQ A;  1IW7 F;  4P6I C;  2R7W A;  4OIP F;  3K1H A;  2X51 A;  2IXN A;  4Q7C A;  4JZA A;  4Q4Z F;  3UMK A;  3ASO C;  2GFH A;  4YWQ A;  3F47 A;  4YT2 A;  2DYS C;  2G3V A;  3E9V A;  2WZL A;  4CBE A;  3DZA A;  3OWT A;  2KNH A;  3W8I A;  3QMK A;  1OCZ C;  2G3K A;  4I44 A;  4MND A;  3WOD F;  2QY9 A;  4YT4 A;  1KU2 A;  4ZLC A;  4U5D E;  3OA1 A;  3IEE A;  3KL4 A;  4J30 B;  1FFT C;  4C7O A;  5FCL A;  4PFO A;  4U5H A;  4LLE A;  3N2Z B;  2FFH A;  2KGO A;  5KYU A;  2KQ9 A;  4I1O B;  3JT1 A;  3NRH A;  4LLC A;  3NYJ A;  2V3C C;  3K7D A;  2MYS A;  2YHS A;  2Z15 A;  2A6H F;  4ANJ A;  4DVZ A;  5B3S C;  2XL4 A;  2OG2 A;  4QDL A;  3DAG A;  4AK9 A;  5KYW B;  2JD3 A;  4U5B E;  3AQB A;  1V55 C;  1WGW A;  3NYL A;  3LS1 A;  2H7B A;  2J7P D;  2R7V A;  1SF8 A;  3CZ6 A;  3HTK C;  1OCC C;  3UGO A;  3LJB A;  1ZHZ A;  3EPV A;  4W8K A;  5KYY B;  4JJG A;  1M2O A;  2J9W A;  2Q9A A;  2W9Y A;  3K66 A;  4HFK B;  3RYL A;  4BEJ A;  3I5Q A;  1LS1 A;  4C3E A;  2R7R A;  1PD0 A;  3EH1 A;  4ZLD A;  2YZS A;  3MX3 A;  3DM9 B;  2EIK C;  2VH3 A;  4MQ9 F;  2DYR C;  4FX5 A;  3L0I A;  2I8B A;  3MLG A;  3JRT A;  1D1A A;  4CS9 C;  4O6M A;  3DMD A;  2DGJ A;  4E7S A;  4DBQ A;  2PP4 A;  3GAN A;  3DAF A;  4ULW A;  2CGE A;  4I1M A;  1QZX A;  3LAY A;  2R7T A;  2Y3G A;  2EIL C;  3FDQ A;  3I5P A;  3O39 A;  1MNE A;  2CNW A;  3F46 A;  3RFY A;  3L34 A;  2A69 F;  2J0W A;  1BR4 A;  4CSA C;  4GEH A;  4J32 B;  1TR2 A;  4O6Y A;  4PJJ A;  1NU9 C;  3LLI A;  3LNR A;  5B1B C;  1LKX A;  5KYW A;  2NUP B;  4CS9 A;  2R7U A;  2C03 A;  3ABM C;  4OIR F;  3NYM A;  1VMA A;  2IOQ A;  2J45 A;  3EFO A;  3ZG1 A;  3FAJ A;  4IJJ A;  3ZIB A;  4I3M A;  4XLP F;  2M4E A;  1D1B A;  1MMA A;  4KBL A;  4DOZ A;  5KYY A;  5BUO A;  4FES A;  1ZU5 A;  2EIM C;  2Q9C A;  1Z3I X;  3RH3 A;  3ZVR A;  3W2W A;  3T6B A;  2IYL D;  3S29 A;  1PCX A;  2ZXO A;  3NKD A;  2ZPA A;  3GOD A;  2H7O A;  5DVW A;  4CSA A;  2HV6 A;  3Q6M A;  5EHH A;  3UNG C;  1NU7 D;  3Q6N A;  4X0R A;  4OIQ F;  5E33 A;  4K7B A;  3AG3 C;  5DQT A;  3B0P A;  3AG1 C;  1VYI A;  3EGX B;  4YN0 B;  2W4M A;  1ZHW A;  3I4U A;  1J8Y F;  3B0V C;  3LES A;  3AQC A;  4F4B A;  5HSW A;  4JJF A;  1VK5 A;  4JW1 A;  3EHN A;  4A2N B;  4BJ1 A;  2Q9B A;  4OD5 A;  1V54 C;  2OCC C;  4IAO A;  4QI0 A;  5T3W A;  1Z5Z A;  5DS6 A;  3FHD A;  2ZXR A;  4RBN A;  3ZSU A;  2CW0 F;  4CIH A;  3DD7 A;  1N1C A;  3CSK A;  1TKN A;  4M63 A;  4BJ6 C;  3EH2 A;  3DXJ F;  3DJU B;  2J9U A;  4RD9 A;  2IXM A;  3DM5 A;  1TWC A;  2L9J A;  4BG0 A;  2WZG A;  2NUP A;  2Y3B A;  2LSE A;  5F5F A;  4LER A;  2D5R B;  2E87 A;  1TWH A;  1TWA A;  4KNV A;  2Y69 C;  3SNH A;  4FWV A;  5E3A A;  1QLE C;  3K1I C;  1VYK A;  1M57 C;  2EIJ C;  1PD1 A;  2Y3H A;  3V7O A;  5E3C A;  3UMI A;  2KW3 C;  3ABL C;  3VAY A;  4AE4 B;  2WVN A;  3JSZ A;  4C3B A;  4BJ6 A;  1OCR C;  5F5H A;  1NG1 A;  1JPN A;  1J8M F;  2R7Q A;  1W2W A;  5KYX B;  2PF4 E;  3H65 A;  4IRU A;  1D0Z A;  1M2V B;  4BJT A;  2A6E F;  3EGX A;  1SZI A;  3FVY A;  1S7Z A;  4Q5S F;  1ZYR F;  4O6N A;  1Z6A A;  4O79 A;  3K33 A;  3N24 A;  4RDA A;  3EGD B;  3AG4 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...