5BQGA

Crystal structure of mpges-1 bound to an inhibitor
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
148
structure length
148
Chain Sequence
SLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGKLRAPIRSVTYTLAQLPCASMALQILWEAARHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Prostaglandin E synthase
publication title Discovery and Characterization of 2-Acylaminoimidazole Microsomal Prostaglandin E Synthase-1 Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/isomerase inhibitor
total genus 64
structure length 148
sequence length 148
ec nomenclature ec 5.3.99.3: Prostaglandin-E synthase.
pdb deposition date 2015-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 5bqgA00
4J7YA 4WABA 4YL0A 3PCVA 4JRZA 2PNOA 2UUHA 3DWWA 5BQGA 5BQHA 4JC7A 4AL1A 4YL1A 5HV9A 4YK5A 4YL3A 4J7TA 4JCZA 4AL0A 3HKKA 2UUIA 5BQIA 2H8AA 3B29A 4NTAA 3LEOA 5K0IA 4NTFA 4NTBA 2Q7RA 4BPMA
chains in the Genus database with same CATH superfamily
4U9EA 2AP3A 1GS9A 1LPEA 1RKEA 2HFIA 3CQZA 4HEAJ 2P1AA 4MTFA 4JRZA 1ZHWA 4FWVA 4NC3A 3DM9B 5JUAA 3LAYA 4BJTA 4IGGA 3DZAA 2AU5A 1CPRA 3CZ6A 1WOLA 3NMKA 4PJMA 2P6VA 2L6GA 2ZXRA 1CGOA 5CI8A 5T3TA 3RIPA 4I1MA 1NLXA 2R7SA 4EWCA 3LUTB 3EGXA 2WZFA 2W4MA 3TOMA 2F22A 3C8GB 4NY3A 3FXHA 3LEOA 3Q6NA 4W8PA 5D92A 5B1AC 1LIHA 2W45A 5KYWB 3S0XA 2R7WA 4E17A 1V54C 2Z15A 3H65A 4PFPA 4G7OF 2IXNA 5L3QA 5B3SC 2I15A 4ZLDA 2OOCA 1D1AA 1T01A 1JPJA 1C17M 3H2UA 4MVUA 3LS0A 1TKNA 2Q00A 1ZHXA 3N24A 1DOWA 4PK4A 3DJUB 3PCVA 2ASRA 5T1DB 1RMVA 4O6NA 3C8ZA 3LNMB 3EHMA 2YWAA 4JTAB 2Q4FA 2UUHA 2OCCC 3H2VA 2DB4A 2VCBA 4YJWA 4XEFA 1JMWA 3QVYA 4YL3A 3VF0A 1I4YA 2YEVA 2R02A 3QTHA 2VCCA 3AGTA 2BL2A 2NPUA 2OJQA 1QKRA 3LESA 5L0JA 2Q9CA 2WL8A 2R7UA 2HJMA 1LM3B 1A7EA 3U2LA 1LE2A 1EKYA 3RYLA 5F5HA 1VLSA 1I5NA 2D5RB 4BJ6A 3NKEA 1N1CA 1S05A 4K7BA 1V55C 1S7ZA 3QZCA 4GQHA 2WVNA 5E33A 1PCXA 1V4AA 4A2NB 3C8GA 3DI5A 4AK9A 4CS9A 2WVOA 3DMDA 2KGOA 5FZTA 1M6TA 1AUEA 2J8WA 2KC3A 3LJBA 4N6CA 4BJ5C 3FMSA 2Y3GA 4JEBA 2EPMX 1KTMA 3US6A 1D0XA 2OEVA 1OCOC 3MYFA 4YT8A 2LK4A 1U6HA 2LFFA 2O9XA 1O5HA 1SMYF 3ZWIA 1TQGA 3G50A 4DBQA 3MX3A 1BR1A 1EI7A 2WZLA 2HJ3A 1ZHZA 2HMZA 3GEEA 3KH2A 3W2VA 3K1IA 3AJMA 1G8XA 3KYJA 1LKXA 3EQLF 4MVQA 1Q0MA 5L0CA 1E83A 2EIMC 1RXQA 2KYHA 1TWGA 3K66A 3AG3C 1H6GA 4BEMJ 3SNHA 256BA 2PFDA 2AWCA 2CDQA 3S84A 1E2XA 1WN0A 2A1DD 2YL7A 4QI0A 5B1BC 3EGDA 3TK0A 3ZDLA 3AG2C 3EHNA 2A0UA 3EFOA 3V7OA 3GANA 5AGFA 5JSLA 1DOVA 3O10A 1NFOA 1WWPA 1YDIA 1Z23A 2KK1A 4U5GA 5EK0A 4CJGA 1OKKD 1R5ID 4YWQA 5BUOA 3S28A 1OCZC 5DQTA 3AQBA 3TQOA 3LNRA 1NZEA 1NG1A 4J30B 4JCZA 1JOGA 1M2VA 4G7ZF 1YARO 4KI2A 2W9YA 3J06A 4N4WA 4NQFA 3UNGC 1YLMA 2B0JA 4NTFA 3U3BA 1LVKA 1VLTA 1GGQA 3T9OA 2NUTB 4CDAA 1LS4A 3RW0A 4PJNA 2KNHA 3A11A 2HV6A 3EH2A 1Y4CA 2IBFA 4CS7A 2OG2A 1J8MF 5HSWA 1OW6A 4JW1A 4IJJA 3SP1A 4K0DA 3VRCA 4OD4A 3RQEA 4UDVA 3CSKA 5CIVA 3DWWA 3DE8A 4AE4A 3DKAA 4PJLA 4AL1A 2BC5A 4YT5A 5A6BD 2CNWD 2NSGA 2P0NA 4KNVA 2NG1A 2EPOA 3BRJA 3G4XA 4H4KC 4I44A 4JVSA 5COGA 4PR9A 3NMJA 3NG1A 1WATA 2IXOA 2YRFA 3DD7A 3B29A 4ER9A 1HY5A 5EHHA 3UGOA 2J7PA 4FX5A 4LDQA 2PF4E 3SZRA 4YT2A 1F1MA 2J9UA 3UGPA 5L3VA 4EBBA 3ZC4A 2XL8A 5D91A 1BR2A 3ABLC 3DE9A 4U5BE 2EPLX 2XLWA 2GA0A 3HNJA 2M4EA 3EJNA 1ZZPA 1QVXA 3NMIA 3QW0A 1YYJA 2EINC 2MYSA 3JSEO 5JRAA 1G5ZA 1FTSA 1K05A 1Z7Qc 2WB7A 2NUTA 1ORJA 2D4UA 4ULVA 1PV3A 5DLJA 1JRAA 4IAOA 4MS2A 2Q9AA 4CS8A 4YL1A 2VC9A 2HZ8A 5F5FA 3HJCA 3LLIA 3W8HA 3QMKA 2J46A 4A4AA 4HFFB 1ZHTA 3M1CB 3UMIA 3FOPA 2RD9A 1YZCA 2Y3HA 5A6AA 4BG0A 1FFHA 5A6KA 5KYXA 2LSEA 3NRHA 4OIPF 4CSAC 4I1OB 1JAFA 1Z63A 3DAGA 3O55A 4IRUA 5L0IA 1SF8A 3LLKA 1OXBA 2EPNA 4G7HF 2R05A 2V26A 5EGYA 1G4WR 1XZPA 5COFA 3RQGA 3U0CA 4RDAA 4EBKA 3I5QA 3SXMA 4CDYA 1VB5A 3JTLO 2IXMA 1XZQA 1FFTC 3FOOA 2YLIA 2R7TA 2XLHA 2X51A 4IB4A 4K1OA 4C7OB 2HS5A 1OQCA 3B9QA 4C3DA 4JURI 1H9TA 2G62A 2EILC 3GWLA 3T6GB 3FDQA 1UG7A 3JRMO 1QPUA 4O6YA 3IPMO 1NBBA 2KJGA 3L1MA 2VB6A 3V5ZA 1NU9C 2CCYA 3UR3C 2L6FA 4O79A 1D0ZA 2G3VA 2H7VC 2HMQA 2KSFA 4IARA 1MMGA 3U9JA 2P61A 3TJ6A 3EPVA 4DBRA 1HE9A 5L0HA 2YL3A 3PMRA 4XPWA 2J9VA 5JP7A 2C03A 3TD7A 1HW2A 2ICWG 3WODF 2H7OA 4P6IC 5KYUB 4G0HA 2HKVA 3ASNC 1D0YA 4U5HA 4U5DE 2OKUA 4CDVA 2DYRC 3L8IA 2R7VA 5E2QA 3RFYA 4CIHA 5KYWA 1OXKA 1OCCC 1TFKB 4F4BA 2H7BA 4MQ9F 3ABKC 4JC7A 1IZMA 3EG9B 4DVZA 2YLGA 1BZ4A 1Z3IX 3B71A 3HNKA 5L0GA 1QQ3A 1HE1A 2PX3A 4CJOA 2VASA 5AC5A 2AVKA 1SR2A 3AGUA 3I5PA 3T4RA 2R25A 4E0HA 1TWHA 1U0BB 3DXJF 4EIYA 2GFHA 1MMNA 2XLVA 2A68F 3X1OA 2XM0A 2XLEA 3GODA 3IQ5A 4NTBA 2A69F 4BJ1A 4FAPB 1FNTc 3DAFA 4P9TA 3GEHA 4MVRA 2LQGA 1ORSC 3Q7LA 1YZAA 1EA8A 1OW7A 4DVYP 3T6JA 2NUPB 4X0RA 3B0VC 1NU7D 4MVSA 1HMDA 3ZVRA 2XS1A 3C18A 1A0BA 2L9JA 2PX0A 3U9MA 4CIPA 1O87A 2OEXA 5BQHA 4KBLA 4P9FA 5DVWA 1OR2A 2R7QA 1OCRC 5KYYB 5KYUA 3ABMC 2Y3DA 4OIRF 3MLGA 1TWAA 2J9BA 5F28E 3RF3A 3HKKA 3SXZA 4CSAA 1D1CA 1M57C 4ULWA 1QSPA 4C3BA 5AC4A 1VK5A 2QY9A 3M79A 4JZAA 2QNLA 3EG9A 4R32A 2XM4A 3QVZA 1I4ZA 4JJFA 3ITFA 1A7VA 2FAPB 4WABA 2XLDA 3S90A 1J8YF 1YAUO 2DGJA 3TULA 2HUJA 3IEEA 3K6BA 2B0HA 3OA1A 1YVIA 2JPUA 4MVZA 3RQFA 4XEVA 5T3WA 3C7JA 5JT4A 2PNOA 3U3FA 5A6JA 1LE4A 3JRTA 1Q0GA 1JR8A 2J0WA 3MFNA 3U8VA 3CAXA 1T6QA 2QUPA 2YZSA 3I4UA 4JE9A 2LIGA 1RKEB 4O6MA 3RVYA 3RKOF 1C02A 1WTYA 2J45A 5COMA 5TJ5E 4YT4A 3LS1A 2EIKC 4Z9HA 5IY5C 3B0UX 1VTMP 4MTOA 3ZIBA 3S27A 4ONSA 4N06A 5JVEA 3KKBA 1YJGA 4LLCA 3W4YA 4O7GA 5KYYA 1W2WA 4WGZA 3KMIA 2A0BA 4LDRA 4BPMA 1ZYRF 1M2OA 1VYKA 2J9WA 4DOZA 5B3IA 3PHF2 2LD6A 4U5EE 3JZ0A 4N6HA 4E18A 3U8PA 1GQAA 2Y39A 3AG1C 3JT1A 3BEHA 3SYNA 2OU6A 4XEKA 1D1BA 3EGXB 4BJ5A 1A41A 2WZGA 1MMAA 4IWBA 3EZIA 2CW0F 3ECSA 2MWQA 1H9GA 1OKKA 3ZTMA 4CS9C 3WHNA 1R4TA 2IM8A 2YL0A 1BBHA 1CGNA 2HSBA 4LLEA 4AX2A 1PD0A 2YLDA 4HE8D 4XPXA 5HV9A 1SYQA 2GAQA 3POVA 1NFNA 2A6HF 3AOUA 2TMVP 4NTAA 4J32B 4HFKB 1FMVA 3TOLA 1E84A 1IW7F 1MMDA 2RSEB 4OINF 1PD1A 3HNIA 5L0DA 4DRHB 1RCPA 3Q6MA 2A6EF 3IHUA 1Q0FA 3FHDA 4QI2A 2IYLD 3GM2A 1KU2A 2R9RB 1T6IA 2YL1A 2ZXOA 3FVYA 4MW3A 4Q5SF 1Z6AA 3K1IC 3S29A 5DS6A 1ZHYA 2J0XA 3UMHA 4ANJA 2V3CC 3FAJA 5A69A 5A6BA 1GM5A 2CNWA 1RJ9B 3LEVA 4MNDA 5DQZA 3PDMP 1NSGB 1ORYA 1QLEC 2EIJC 1O3UA 1K40A 3C63A 3C8GD 3NKDA 1VOMA 1FR0A 3K33A 3KYIA 3SEOA 4MVOA 5JLIA 2XL6A 1Q0DA 4U9DA 3S9OA 4XQ1A 1ZW2A 3ZG1A 5KYNA 2Q9BA 1TR2A 5BQIA 3F47A 2ETSA 3K1HA 4JCHA 2XS8A 3ASOC 4JJGA 2EPKX 1QZXA 4XLPF 3E9VA 3C62A 1Q0KA 4JTDB 1M56C 3ATPA 2R7RA 4J7YA 1EQ1A 5DS4A 1U89A 3N0TA 1HMOA 1WASA 4M63A 2ZXPA 4LERA 2YHSA 3GM1A 1BDJB 4CBEA 2LCHA 3X2QC 2VCAA 3CEXA 3MYIA 4PACA 1MNDA 4EUKB 4PJJA 1LI7A 1T6UA 2PBEA 4OIOF 2LP4A 3ZSUA 4ZLCA 1WGWA 2XRHA 3JYHA 2YKZA 3RH3A 4KC9A 2E87A 1L7CA 4YN0B 1L3PA 1UFBA 4YK5A 3RVZA 4Z9JA 1ZU5A 2XLMA 4OIQF 1FMWA 3WAQA 4DXWA 1FAPB 1RJ9A 2M64A 2UUIA 3R2PA 5CI9A 3T6BA 4EHPA 5JS5A 2DYSC 3HTKC 2G3KA 3M4BA 4MW8A 1YA9A 4FESA 5K0IA 5E3AA 1AEPA 1ZW3A 1E85A 2X0CA 3AG4C 3EGDB 3GM3A 4C7OA 3EFOB 2HV7A 4DJ9A 4XLNF 4C3EA 1TWCA 2W4BA 3AQCA 1APCA 2FGYA 4OD5A 2L81A 1SZIA 3GEIA 3L8JA 2Y69C 2IOQA 1MQVA 4BEJA 1M2VB 2KW3C 3O6XA 4B6IA 2GWWA 4GYTA 2XXAB 1AVOB 4G78A 3VAYA 2YQYA 4D4XA 1OR3A 1VMAA 3OWTA 1KNYA 2CGEA 3DJNB 2QTVA 2HSQA 2KQ9A 1G4US 5E3CA 1XWJA 4XPYA 1T5OA 3VYWA 1E86A 3Q7GA 2IXPA 1Z5ZA 2FFHA 2LFDA 3L0IA 4CS8C 3JSZA 2MHRA 3F46A 3W8IA 3IQTA 4JTCB 2NSFA 1BR4A 1MNEA 2Y3BA 3M4CA 3HNLA 4H54A 2GDCA 2XSEA 4NCQA 3V5XA 3ZQVA 4AE4B 5L0FA 2WVQA 2J7PD 4LACB 1K04A 3GWNA 3KPHA 1VYIA 4JEAA 2JD3A 4PFOA 3U2MA 2OQMA 1OW8A 3L34A 3NYJA 4XWJA 5GPGB 1YA7O 2XL4A 3M15A 4KNWA 3NYMA 3IQ6A 1CPQA 2QE9A 2QLAA 1LS1A 3SXYA 1HW1A 2I8BA 4I3MA 3K7DA 2DI3A 3HLZA 4EBJA 4Q7CA 2OJED 2NUPA 3OEOA 1JPNA 4JKVA 3FAPB 4AL0A 5DS5A 2C04A 2H8AA 3DM5A 3ZTZA 3G4ZA 2XXAA 4E7SA 3E70C 3A9CA 2Q3TA 4JIOA 3N2ZB 4RD9A 2XLOA 4WJ0A 3R7CA 2PP4A 4MTGA 5FCLA 2YVKA 4Q4ZF 2ZPAA 2Q7RA 2R7XA 3TJ5A 3ZQYA 1A7DA 2VH3A 4E7ZA 3NDBB 4DRJB 3EH1A 4WGYA 3GORA 1V74B 4W8KA 3O39A 3QW1A 1ST6A 4MVMA 4YL0A 3UMKA 4LDKA 3VM6A 3SXKA 2AWYA 2P7VA 2JX0A 2R03A 3EZHA 3KL4A 4QDLA 3W2WA 4BJ6C 3JCUQ 2ZXWC 4U5CE 4EKWA 5KYXB 1CGME 2L6HA 3V5YA 4RBNA 3JYYA 2L7AA 5BQGA 3B0PA 1ZVZA 2ZD9A 3WG7C 1H7IA 4IAQA 4DRIB 4D4NA 4GEHA 4J7TA 3U5SA 4U5FE 2BE5F 2CYDA 4E0IA 4Z9IA 1T9KA 3MBGA 3NYLA 1ZU4A 1LI5A 1RKCA 1YYXA 4L6RA 1B68A 1C03A 3IQCA 4XTKA 1TFOB 4CX9A 1Y6DA 2R7OA
chains in the Genus database with same CATH topology
4J7YA 4WABA 4YL0A 3PCVA 4JRZA 2PNOA 2UUHA 3DWWA 5BQGA 5BQHA 4JC7A 4AL1A 4YL1A 5HV9A 4YK5A 4YL3A 4J7TA 4JCZA 4AL0A 3HKKA 2UUIA 5BQIA 2H8AA 3B29A 4NTAA 3LEOA 5K0IA 4NTFA 4NTBA 2Q7RA 4BPMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J7Y A;  4WAB A;  4YL0 A;  3PCV A;  4JRZ A;  2PNO A;  2UUH A;  3DWW A;  5BQG A;  5BQH A;  4JC7 A;  4AL1 A;  4YL1 A;  5HV9 A;  4YK5 A;  4YL3 A;  4J7T A;  4JCZ A;  4AL0 A;  3HKK A;  2UUI A;  5BQI A;  2H8A A;  3B29 A;  4NTA A;  3LEO A;  5K0I A;  4NTF A;  4NTB A;  2Q7R A;  4BPM A; 
#chains in the Genus database with same CATH topology
 4U9E A;  2AP3 A;  1GS9 A;  1LPE A;  1RKE A;  2HFI A;  3CQZ A;  4HEA J;  2P1A A;  4MTF A;  4JRZ A;  1ZHW A;  4FWV A;  4NC3 A;  3DM9 B;  5JUA A;  3LAY A;  4BJT A;  4IGG A;  3DZA A;  2AU5 A;  1CPR A;  3CZ6 A;  1WOL A;  3NMK A;  4PJM A;  2P6V A;  2L6G A;  2ZXR A;  1CGO A;  5CI8 A;  5T3T A;  3RIP A;  4I1M A;  1NLX A;  2R7S A;  4EWC A;  3LUT B;  3EGX A;  2WZF A;  2W4M A;  3TOM A;  2F22 A;  3C8G B;  4NY3 A;  3FXH A;  3LEO A;  3Q6N A;  4W8P A;  5D92 A;  5B1A C;  1LIH A;  2W45 A;  5KYW B;  3S0X A;  2R7W A;  4E17 A;  1V54 C;  2Z15 A;  3H65 A;  4PFP A;  4G7O F;  2IXN A;  5L3Q A;  5B3S C;  2I15 A;  4ZLD A;  2OOC A;  1D1A A;  1T01 A;  1JPJ A;  1C17 M;  3H2U A;  4MVU A;  3LS0 A;  1TKN A;  2Q00 A;  1ZHX A;  3N24 A;  1DOW A;  4PK4 A;  3DJU B;  3PCV A;  2ASR A;  5T1D B;  1RMV A;  4O6N A;  3C8Z A;  3LNM B;  3EHM A;  2YWA A;  4JTA B;  2Q4F A;  2UUH A;  2OCC C;  3H2V A;  2DB4 A;  2VCB A;  4YJW A;  4XEF A;  1JMW A;  3QVY A;  4YL3 A;  3VF0 A;  1I4Y A;  2YEV A;  2R02 A;  3QTH A;  2VCC A;  3AGT A;  2BL2 A;  2NPU A;  2OJQ A;  1QKR A;  3LES A;  5L0J A;  2Q9C A;  2WL8 A;  2R7U A;  2HJM A;  1LM3 B;  1A7E A;  3U2L A;  1LE2 A;  1EKY A;  3RYL A;  5F5H A;  1VLS A;  1I5N A;  2D5R B;  4BJ6 A;  3NKE A;  1N1C A;  1S05 A;  4K7B A;  1V55 C;  1S7Z A;  3QZC A;  4GQH A;  2WVN A;  5E33 A;  1PCX A;  1V4A A;  4A2N B;  3C8G A;  3DI5 A;  4AK9 A;  4CS9 A;  2WVO A;  3DMD A;  2KGO A;  5FZT A;  1M6T A;  1AUE A;  2J8W A;  2KC3 A;  3LJB A;  4N6C A;  4BJ5 C;  3FMS A;  2Y3G A;  4JEB A;  2EPM X;  1KTM A;  3US6 A;  1D0X A;  2OEV A;  1OCO C;  3MYF A;  4YT8 A;  2LK4 A;  1U6H A;  2LFF A;  2O9X A;  1O5H A;  1SMY F;  3ZWI A;  1TQG A;  3G50 A;  4DBQ A;  3MX3 A;  1BR1 A;  1EI7 A;  2WZL A;  2HJ3 A;  1ZHZ A;  2HMZ A;  3GEE A;  3KH2 A;  3W2V A;  3K1I A;  3AJM A;  1G8X A;  3KYJ A;  1LKX A;  3EQL F;  4MVQ A;  1Q0M A;  5L0C A;  1E83 A;  2EIM C;  1RXQ A;  2KYH A;  1TWG A;  3K66 A;  3AG3 C;  1H6G A;  4BEM J;  3SNH A;  256B A;  2PFD A;  2AWC A;  2CDQ A;  3S84 A;  1E2X A;  1WN0 A;  2A1D D;  2YL7 A;  4QI0 A;  5B1B C;  3EGD A;  3TK0 A;  3ZDL A;  3AG2 C;  3EHN A;  2A0U A;  3EFO A;  3V7O A;  3GAN A;  5AGF A;  5JSL A;  1DOV A;  3O10 A;  1NFO A;  1WWP A;  1YDI A;  1Z23 A;  2KK1 A;  4U5G A;  5EK0 A;  4CJG A;  1OKK D;  1R5I D;  4YWQ A;  5BUO A;  3S28 A;  1OCZ C;  5DQT A;  3AQB A;  3TQO A;  3LNR A;  1NZE A;  1NG1 A;  4J30 B;  4JCZ A;  1JOG A;  1M2V A;  4G7Z F;  1YAR O;  4KI2 A;  2W9Y A;  3J06 A;  4N4W A;  4NQF A;  3UNG C;  1YLM A;  2B0J A;  4NTF A;  3U3B A;  1LVK A;  1VLT A;  1GGQ A;  3T9O A;  2NUT B;  4CDA A;  1LS4 A;  3RW0 A;  4PJN A;  2KNH A;  3A11 A;  2HV6 A;  3EH2 A;  1Y4C A;  2IBF A;  4CS7 A;  2OG2 A;  1J8M F;  5HSW A;  1OW6 A;  4JW1 A;  4IJJ A;  3SP1 A;  4K0D A;  3VRC A;  4OD4 A;  3RQE A;  4UDV A;  3CSK A;  5CIV A;  3DWW A;  3DE8 A;  4AE4 A;  3DKA A;  4PJL A;  4AL1 A;  2BC5 A;  4YT5 A;  5A6B D;  2CNW D;  2NSG A;  2P0N A;  4KNV A;  2NG1 A;  2EPO A;  3BRJ A;  3G4X A;  4H4K C;  4I44 A;  4JVS A;  5COG A;  4PR9 A;  3NMJ A;  3NG1 A;  1WAT A;  2IXO A;  2YRF A;  3DD7 A;  3B29 A;  4ER9 A;  1HY5 A;  5EHH A;  3UGO A;  2J7P A;  4FX5 A;  4LDQ A;  2PF4 E;  3SZR A;  4YT2 A;  1F1M A;  2J9U A;  3UGP A;  5L3V A;  4EBB A;  3ZC4 A;  2XL8 A;  5D91 A;  1BR2 A;  3ABL C;  3DE9 A;  4U5B E;  2EPL X;  2XLW A;  2GA0 A;  3HNJ A;  2M4E A;  3EJN A;  1ZZP A;  1QVX A;  3NMI A;  3QW0 A;  1YYJ A;  2EIN C;  2MYS A;  3JSE O;  5JRA A;  1G5Z A;  1FTS A;  1K05 A;  1Z7Q c;  2WB7 A;  2NUT A;  1ORJ A;  2D4U A;  4ULV A;  1PV3 A;  5DLJ A;  1JRA A;  4IAO A;  4MS2 A;  2Q9A A;  4CS8 A;  4YL1 A;  2VC9 A;  2HZ8 A;  5F5F A;  3HJC A;  3LLI A;  3W8H A;  3QMK A;  2J46 A;  4A4A A;  4HFF B;  1ZHT A;  3M1C B;  3UMI A;  3FOP A;  2RD9 A;  1YZC A;  2Y3H A;  5A6A A;  4BG0 A;  1FFH A;  5A6K A;  5KYX A;  2LSE A;  3NRH A;  4OIP F;  4CSA C;  4I1O B;  1JAF A;  1Z63 A;  3DAG A;  3O55 A;  4IRU A;  5L0I A;  1SF8 A;  3LLK A;  1OXB A;  2EPN A;  4G7H F;  2R05 A;  2V26 A;  5EGY A;  1G4W R;  1XZP A;  5COF A;  3RQG A;  3U0C A;  4RDA A;  4EBK A;  3I5Q A;  3SXM A;  4CDY A;  1VB5 A;  3JTL O;  2IXM A;  1XZQ A;  1FFT C;  3FOO A;  2YLI A;  2R7T A;  2XLH A;  2X51 A;  4IB4 A;  4K1O A;  4C7O B;  2HS5 A;  1OQC A;  3B9Q A;  4C3D A;  4JUR I;  1H9T A;  2G62 A;  2EIL C;  3GWL A;  3T6G B;  3FDQ A;  1UG7 A;  3JRM O;  1QPU A;  4O6Y A;  3IPM O;  1NBB A;  2KJG A;  3L1M A;  2VB6 A;  3V5Z A;  1NU9 C;  2CCY A;  3UR3 C;  2L6F A;  4O79 A;  1D0Z A;  2G3V A;  2H7V C;  2HMQ A;  2KSF A;  4IAR A;  1MMG A;  3U9J A;  2P61 A;  3TJ6 A;  3EPV A;  4DBR A;  1HE9 A;  5L0H A;  2YL3 A;  3PMR A;  4XPW A;  2J9V A;  5JP7 A;  2C03 A;  3TD7 A;  1HW2 A;  2ICW G;  3WOD F;  2H7O A;  4P6I C;  5KYU B;  4G0H A;  2HKV A;  3ASN C;  1D0Y A;  4U5H A;  4U5D E;  2OKU A;  4CDV A;  2DYR C;  3L8I A;  2R7V A;  5E2Q A;  3RFY A;  4CIH A;  5KYW A;  1OXK A;  1OCC C;  1TFK B;  4F4B A;  2H7B A;  4MQ9 F;  3ABK C;  4JC7 A;  1IZM A;  3EG9 B;  4DVZ A;  2YLG A;  1BZ4 A;  1Z3I X;  3B71 A;  3HNK A;  5L0G A;  1QQ3 A;  1HE1 A;  2PX3 A;  4CJO A;  2VAS A;  5AC5 A;  2AVK A;  1SR2 A;  3AGU A;  3I5P A;  3T4R A;  2R25 A;  4E0H A;  1TWH A;  1U0B B;  3DXJ F;  4EIY A;  2GFH A;  1MMN A;  2XLV A;  2A68 F;  3X1O A;  2XM0 A;  2XLE A;  3GOD A;  3IQ5 A;  4NTB A;  2A69 F;  4BJ1 A;  4FAP B;  1FNT c;  3DAF A;  4P9T A;  3GEH A;  4MVR A;  2LQG A;  1ORS C;  3Q7L A;  1YZA A;  1EA8 A;  1OW7 A;  4DVY P;  3T6J A;  2NUP B;  4X0R A;  3B0V C;  1NU7 D;  4MVS A;  1HMD A;  3ZVR A;  2XS1 A;  3C18 A;  1A0B A;  2L9J A;  2PX0 A;  3U9M A;  4CIP A;  1O87 A;  2OEX A;  5BQH A;  4KBL A;  4P9F A;  5DVW A;  1OR2 A;  2R7Q A;  1OCR C;  5KYY B;  5KYU A;  3ABM C;  2Y3D A;  4OIR F;  3MLG A;  1TWA A;  2J9B A;  5F28 E;  3RF3 A;  3HKK A;  3SXZ A;  4CSA A;  1D1C A;  1M57 C;  4ULW A;  1QSP A;  4C3B A;  5AC4 A;  1VK5 A;  2QY9 A;  3M79 A;  4JZA A;  2QNL A;  3EG9 A;  4R32 A;  2XM4 A;  3QVZ A;  1I4Z A;  4JJF A;  3ITF A;  1A7V A;  2FAP B;  4WAB A;  2XLD A;  3S90 A;  1J8Y F;  1YAU O;  2DGJ A;  3TUL A;  2HUJ A;  3IEE A;  3K6B A;  2B0H A;  3OA1 A;  1YVI A;  2JPU A;  4MVZ A;  3RQF A;  4XEV A;  5T3W A;  3C7J A;  5JT4 A;  2PNO A;  3U3F A;  5A6J A;  1LE4 A;  3JRT A;  1Q0G A;  1JR8 A;  2J0W A;  3MFN A;  3U8V A;  3CAX A;  1T6Q A;  2QUP A;  2YZS A;  3I4U A;  4JE9 A;  2LIG A;  1RKE B;  4O6M A;  3RVY A;  3RKO F;  1C02 A;  1WTY A;  2J45 A;  5COM A;  5TJ5 E;  4YT4 A;  3LS1 A;  2EIK C;  4Z9H A;  5IY5 C;  3B0U X;  1VTM P;  4MTO A;  3ZIB A;  3S27 A;  4ONS A;  4N06 A;  5JVE A;  3KKB A;  1YJG A;  4LLC A;  3W4Y A;  4O7G A;  5KYY A;  1W2W A;  4WGZ A;  3KMI A;  2A0B A;  4LDR A;  4BPM A;  1ZYR F;  1M2O A;  1VYK A;  2J9W A;  4DOZ A;  5B3I A;  3PHF 2;  2LD6 A;  4U5E E;  3JZ0 A;  4N6H A;  4E18 A;  3U8P A;  1GQA A;  2Y39 A;  3AG1 C;  3JT1 A;  3BEH A;  3SYN A;  2OU6 A;  4XEK A;  1D1B A;  3EGX B;  4BJ5 A;  1A41 A;  2WZG A;  1MMA A;  4IWB A;  3EZI A;  2CW0 F;  3ECS A;  2MWQ A;  1H9G A;  1OKK A;  3ZTM A;  4CS9 C;  3WHN A;  1R4T A;  2IM8 A;  2YL0 A;  1BBH A;  1CGN A;  2HSB A;  4LLE A;  4AX2 A;  1PD0 A;  2YLD A;  4HE8 D;  4XPX A;  5HV9 A;  1SYQ A;  2GAQ A;  3POV A;  1NFN A;  2A6H F;  3AOU A;  2TMV P;  4NTA A;  4J32 B;  4HFK B;  1FMV A;  3TOL A;  1E84 A;  1IW7 F;  1MMD A;  2RSE B;  4OIN F;  1PD1 A;  3HNI A;  5L0D A;  4DRH B;  1RCP A;  3Q6M A;  2A6E F;  3IHU A;  1Q0F A;  3FHD A;  4QI2 A;  2IYL D;  3GM2 A;  1KU2 A;  2R9R B;  1T6I A;  2YL1 A;  2ZXO A;  3FVY A;  4MW3 A;  4Q5S F;  1Z6A A;  3K1I C;  3S29 A;  5DS6 A;  1ZHY A;  2J0X A;  3UMH A;  4ANJ A;  2V3C C;  3FAJ A;  5A69 A;  5A6B A;  1GM5 A;  2CNW A;  1RJ9 B;  3LEV A;  4MND A;  5DQZ A;  3PDM P;  1NSG B;  1ORY A;  1QLE C;  2EIJ C;  1O3U A;  1K40 A;  3C63 A;  3C8G D;  3NKD A;  1VOM A;  1FR0 A;  3K33 A;  3KYI A;  3SEO A;  4MVO A;  5JLI A;  2XL6 A;  1Q0D A;  4U9D A;  3S9O A;  4XQ1 A;  1ZW2 A;  3ZG1 A;  5KYN A;  2Q9B A;  1TR2 A;  5BQI A;  3F47 A;  2ETS A;  3K1H A;  4JCH A;  2XS8 A;  3ASO C;  4JJG A;  2EPK X;  1QZX A;  4XLP F;  3E9V A;  3C62 A;  1Q0K A;  4JTD B;  1M56 C;  3ATP A;  2R7R A;  4J7Y A;  1EQ1 A;  5DS4 A;  1U89 A;  3N0T A;  1HMO A;  1WAS A;  4M63 A;  2ZXP A;  4LER A;  2YHS A;  3GM1 A;  1BDJ B;  4CBE A;  2LCH A;  3X2Q C;  2VCA A;  3CEX A;  3MYI A;  4PAC A;  1MND A;  4EUK B;  4PJJ A;  1LI7 A;  1T6U A;  2PBE A;  4OIO F;  2LP4 A;  3ZSU A;  4ZLC A;  1WGW A;  2XRH A;  3JYH A;  2YKZ A;  3RH3 A;  4KC9 A;  2E87 A;  1L7C A;  4YN0 B;  1L3P A;  1UFB A;  4YK5 A;  3RVZ A;  4Z9J A;  1ZU5 A;  2XLM A;  4OIQ F;  1FMW A;  3WAQ A;  4DXW A;  1FAP B;  1RJ9 A;  2M64 A;  2UUI A;  3R2P A;  5CI9 A;  3T6B A;  4EHP A;  5JS5 A;  2DYS C;  3HTK C;  2G3K A;  3M4B A;  4MW8 A;  1YA9 A;  4FES A;  5K0I A;  5E3A A;  1AEP A;  1ZW3 A;  1E85 A;  2X0C A;  3AG4 C;  3EGD B;  3GM3 A;  4C7O A;  3EFO B;  2HV7 A;  4DJ9 A;  4XLN F;  4C3E A;  1TWC A;  2W4B A;  3AQC A;  1APC A;  2FGY A;  4OD5 A;  2L81 A;  1SZI A;  3GEI A;  3L8J A;  2Y69 C;  2IOQ A;  1MQV A;  4BEJ A;  1M2V B;  2KW3 C;  3O6X A;  4B6I A;  2GWW A;  4GYT A;  2XXA B;  1AVO B;  4G78 A;  3VAY A;  2YQY A;  4D4X A;  1OR3 A;  1VMA A;  3OWT A;  1KNY A;  2CGE A;  3DJN B;  2QTV A;  2HSQ A;  2KQ9 A;  1G4U S;  5E3C A;  1XWJ A;  4XPY A;  1T5O A;  3VYW A;  1E86 A;  3Q7G A;  2IXP A;  1Z5Z A;  2FFH A;  2LFD A;  3L0I A;  4CS8 C;  3JSZ A;  2MHR A;  3F46 A;  3W8I A;  3IQT A;  4JTC B;  2NSF A;  1BR4 A;  1MNE A;  2Y3B A;  3M4C A;  3HNL A;  4H54 A;  2GDC A;  2XSE A;  4NCQ A;  3V5X A;  3ZQV A;  4AE4 B;  5L0F A;  2WVQ A;  2J7P D;  4LAC B;  1K04 A;  3GWN A;  3KPH A;  1VYI A;  4JEA A;  2JD3 A;  4PFO A;  3U2M A;  2OQM A;  1OW8 A;  3L34 A;  3NYJ A;  4XWJ A;  5GPG B;  1YA7 O;  2XL4 A;  3M15 A;  4KNW A;  3NYM A;  3IQ6 A;  1CPQ A;  2QE9 A;  2QLA A;  1LS1 A;  3SXY A;  1HW1 A;  2I8B A;  4I3M A;  3K7D A;  2DI3 A;  3HLZ A;  4EBJ A;  4Q7C A;  2OJE D;  2NUP A;  3OEO A;  1JPN A;  4JKV A;  3FAP B;  4AL0 A;  5DS5 A;  2C04 A;  2H8A A;  3DM5 A;  3ZTZ A;  3G4Z A;  2XXA A;  4E7S A;  3E70 C;  3A9C A;  2Q3T A;  4JIO A;  3N2Z B;  4RD9 A;  2XLO A;  4WJ0 A;  3R7C A;  2PP4 A;  4MTG A;  5FCL A;  2YVK A;  4Q4Z F;  2ZPA A;  2Q7R A;  2R7X A;  3TJ5 A;  3ZQY A;  1A7D A;  2VH3 A;  4E7Z A;  3NDB B;  4DRJ B;  3EH1 A;  4WGY A;  3GOR A;  1V74 B;  4W8K A;  3O39 A;  3QW1 A;  1ST6 A;  4MVM A;  4YL0 A;  3UMK A;  4LDK A;  3VM6 A;  3SXK A;  2AWY A;  2P7V A;  2JX0 A;  2R03 A;  3EZH A;  3KL4 A;  4QDL A;  3W2W A;  4BJ6 C;  3JCU Q;  2ZXW C;  4U5C E;  4EKW A;  5KYX B;  1CGM E;  2L6H A;  3V5Y A;  4RBN A;  3JYY A;  2L7A A;  5BQG A;  3B0P A;  1ZVZ A;  2ZD9 A;  3WG7 C;  1H7I A;  4IAQ A;  4DRI B;  4D4N A;  4GEH A;  4J7T A;  3U5S A;  4U5F E;  2BE5 F;  2CYD A;  4E0I A;  4Z9I A;  1T9K A;  3MBG A;  3NYL A;  1ZU4 A;  1LI5 A;  1RKC A;  1YYX A;  4L6R A;  1B68 A;  1C03 A;  3IQC A;  4XTK A;  1TFO B;  4CX9 A;  1Y6D A;  2R7O A; 
#chains in the Genus database with same CATH homology
 4J7Y A;  4WAB A;  4YL0 A;  3PCV A;  4JRZ A;  2PNO A;  2UUH A;  3DWW A;  5BQG A;  5BQH A;  4JC7 A;  4AL1 A;  4YL1 A;  5HV9 A;  4YK5 A;  4YL3 A;  4J7T A;  4JCZ A;  4AL0 A;  3HKK A;  2UUI A;  5BQI A;  2H8A A;  3B29 A;  4NTA A;  3LEO A;  5K0I A;  4NTF A;  4NTB A;  2Q7R A;  4BPM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...