5BQGA

Crystal structure of mpges-1 bound to an inhibitor
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
148
structure length
148
Chain Sequence
SLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGKLRAPIRSVTYTLAQLPCASMALQILWEAARHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase/isomerase inhibitor
molecule keywords Prostaglandin E synthase
publication title Discovery and Characterization of 2-Acylaminoimidazole Microsomal Prostaglandin E Synthase-1 Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 64
structure length 148
sequence length 148
ec nomenclature ec 5.3.99.3: Prostaglandin-E synthase.
pdb deposition date 2015-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 5bqgA00
4NTBA 4J7YA 4YL1A 2UUIA 4J7TA 4AL1A 5BQHA 4WABA 5BQIA 3DWWA 4NTAA 3B29A 3PCVA 4JCZA 3HKKA 4YK5A 4YL3A 4JC7A 5HV9A 5BQGA 4BPMA 5K0IA 2PNOA 4YL0A 2Q7RA 2H8AA 4AL0A 3LEOA 2UUHA 4JRZA 4NTFA
chains in the Genus database with same CATH superfamily
1LI5A 3U3BA 2LSEA 2E87A 1MMAA 3HNIA 3PMRA 4LERA 1FNTc 1EQ1A 3BRJA 2L6FA 3K1IC 1ZVZA 2EPMX 1JRAA 4MTGA 1WOLA 2ASRA 3FMSA 2R7OA 4JTCB 2AVKA 5JLIA 3LS1A 3B0VC 3N0TA 3UMKA 2J8WA 4NQFA 5KYUB 4JCZA 2LFFA 4YK5A 5GPGB 1S7ZA 3MYIA 4M63A 1OKKA 5DLJA 4JE9A 2WZGA 4JTAB 4KNVA 3S27A 1MMNA 2V3CC 3U2MA 5JUAA 2LD6A 1VYKA 5L0HA 3GM1A 4MVSA 1JR8A 5EHHA 2XS8A 3WG7C 2Z15A 4E18A 4G7ZF 2KNHA 5KYNA 1RMVA 3QZCA 3GWLA 1TKNA 3RVYA 3Q7GA 5DVWA 4IARA 1K40A 4I1OB 1Z7Qc 2LK4A 3AGTA 2IXPA 2MHRA 2XLEA 3RF3A 1OW8A 2HFIA 4JCHA 4N6HA 5L3QA 1E83A 3T6BA 3V7OA 3KYJA 3FAJA 3QVYA 1E84A 4XLPF 1H9TA 2R02A 5B3SC 2JD3A 4Q4ZF 3US6A 3ITFA 3ZVRA 4DVYP 4W8PA 2VCAA 2MWQA 2OOCA 3U8PA 2EILC 1OXKA 2LIGA 4IAQA 4P9FA 1ZW2A 4QDLA 4Z9IA 2YLGA 4LLCA 2PBEA 4WGZA 3I5PA 5HV9A 4Q5SF 1JAFA 1LE4A 1N1CA 1TFOB 1H9GA 1Q0GA 1VLTA 2HSBA 2QNLA 3O39A 4L6RA 3M1CB 5E3AA 3DJUB 4BEJA 2OCCC 2YQYA 3EFOB 5A6BD 3RYLA 2OJQA 3DJNB 1RKCA 2VASA 4WJ0A 2WZLA 2J9BA 5KYUA 1LM3B 2YL7A 4OIPF 2CGEA 4CJOA 3U8VA 1NG1A 4IB4A 1G4WR 4AE4B 3UGPA 3POVA 4LDKA 3S28A 1ZHTA 4KC9A 3GEHA 3O10A 5BQHA 3U2LA 3ABLC 1BBHA 3AG3C 3ABKC 5JS5A 4W8KA 1BR1A 3DM5A 5DQZA 1TFKB 2Y69C 3SXYA 4CS8C 4JZAA 2EIJC 1LS4A 2YHSA 3B0PA 3IPMO 4XEFA 5DS6A 1PD0A 1YARO 4KI2A 2P61A 4Z9HA 4R32A 1IZMA 1OCRC 1V4AA 2J46A 3KKBA 2P7VA 3UMIA 4E0IA 3V5XA 2R7VA 1ORJA 5L0DA 2HMQA 5JVEA 2I8BA 3GEEA 4I3MA 4X0RA 2KC3A 1AUEA 3IHUA 2R7TA 4RBNA 3IQCA 3AQBA 4J7YA 3B9QA 1E85A 1A7EA 3DE9A 4K1OA 3RIPA 3S29A 4G78A 4MTOA 1MMGA 3E9VA 3FOOA 4J32B 3EFOA 2Y3DA 1RJ9B 3DWWA 2OKUA 1C17M 4ER9A 4H4KC 2IXNA 3HKKA 5D92A 2WB7A 3U3FA 1Z23A 2H7BA 2NSGA 4J30B 1RKEB 2ZXPA 3AGUA 3FOPA 4AE4A 4C7OA 5BQGA 3NDBB 2R7SA 3JSZA 4RD9A 1ZW3A 2AWYA 4CIPA 2HV6A 5DS5A 3DD7A 2AP3A 2J0XA 1FMVA 3S9OA 3ZTMA 4EBJA 4ONSA 3KYIA 3C62A 1L3PA 3H2UA 4DRIB 4N6CA 3X2QC 2CYDA 3C8GB 3LAYA 3JCUQ 2DYSC 1NU7D 3LLIA 3CQZA 3TJ5A 2ZD9A 3U0CA 3Q6MA 3LNRA 2YRFA 3GWNA 4G7OF 2UUIA 2PX3A 1YDIA 2W4BA 4CS8A 3ASNC 3EG9A 3ZG1A 2J45A 2NUTB 2L6GA 2R03A 1DOWA 3GODA 4RDAA 2HKVA 2D4UA 3HNKA 4F4BA 5L0JA 1WATA 1SR2A 1KNYA 4QI2A 4MW3A 1YVIA 3HNLA 3O55A 1TQGA 1CGNA 1YA7O 1D0YA 2XLOA 5JRAA 2FAPB 4Z9JA 3TQOA 4ANJA 3LUTB 3EZHA 2RD9A 1C02A 2Q4FA 1O5HA 1ORSC 4PJJA 5CI8A 1MMDA 3HLZA 3C18A 4JRZA 4I1MA 4DOZA 2JPUA 3DE8A 3NMIA 2XLMA 3QW0A 5AGFA 3WODF 4C3DA 4C3BA 4E17A 2XXAB 1RKEA 2YL0A 5T1DB 2EPLX 3M79A 3T4RA 2A68F 256BA 3MLGA 4JEBA 4BJ1A 3G4ZA 3RQGA 4PJMA 2Y3GA 1M2VB 5FZTA 3S0XA 3K1HA 3FHDA 5DS4A 2KJGA 2L9JA 3C8GA 5E3CA 4WGYA 5COFA 4XLNF 4PFOA 1Y6DA 1NFNA 2W9YA 2QTVA 4OD5A 2XS1A 3I5QA 2PX0A 4YJWA 5K0IA 3JTLO 1A0BA 1NZEA 1VTMP 3VYWA 2NUTA 3QMKA 5F5FA 4D4NA 1SZIA 2P0NA 1LI7A 2Q9BA 1FTSA 2IM8A 4OINF 4U5DE 4DBRA 3W2WA 1Z6AA 3Q6NA 5JSLA 4Q7CA 3EJNA 3B0UX 1I5NA 1A7DA 3ECSA 1M56C 4AX2A 4EUKB 1VLSA 2HV7A 4H54A 2CW0F 1AVOB 3GORA 1Q0KA 2GFHA 2VCCA 3R2PA 4EKWA 4ZLCA 1ZU4A 1OXBA 2I15A 2R9RB 1A7VA 4YN0B 1D1AA 2QUPA 2F22A 2J9WA 2OQMA 4XPXA 1OR3A 3EGXA 2L6HA 5F28E 3ZQVA 1QKRA 4YT2A 5KYWA 2A0UA 2XXAA 1QSPA 1T6IA 2OEVA 2R05A 2VH3A 2L7AA 2PP4A 3L8JA 1G8XA 3B71A 1FMWA 1HE9A 1KU2A 2EIMC 3EH1A 3IQ6A 1L7CA 2GDCA 2A69F 5E33A 3VM6A 1LKXA 1M2VA 2ICWG 4AK9A 2R7WA 1FAPB 2A1DD 4PK4A 3SXMA 2UUHA 3FAPB 2TMVP 2R25A 4JKVA 1YYJA 4IRUA 1T9KA 2LQGA 2YL1A 3WHNA 1Q0DA 1XZPA 1ZHWA 4DRJB 3W8IA 2YWAA 4P6IC 5A69A 3ZWIA 1T5OA 1APCA 4A4AA 4YT4A 1D1CA 3EPVA 4GYTA 2EINC 2YL3A 1BR2A 2HJ3A 4JEAA 2XL4A 3ATPA 3SYNA 4N4WA 1U6HA 4KBLA 2YLDA 2ZXWC 3DZAA 3R7CA 3SZRA 3TULA 3CEXA 2AU5A 5B1AC 1ST6A 2VB6A 2CNWD 3F47A 3M15A 4BPMA 1T6QA 2XRHA 5CIVA 3EG9B 1T6UA 2C03A 2NSFA 2VC9A 5A6BA 1B68A 3LS0A 2OG2A 3U9MA 1LIHA 3DXJF 4NTFA 2O9XA 1ZYRF 2HUJA 1GGQA 3NMKA 3DI5A 4MVUA 3RQEA 3SXKA 3ZQYA 5EGYA 2Y3HA 1HMDA 2EIKC 2QE9A 3GM3A 3AOUA 3IQ5A 1K05A 3OWTA 2R7UA 1LPEA 3FDQA 1UFBA 1V74B 2CCYA 1CGOA 2A6HF 2HSQA 2G3VA 1CPQA 4U9DA 1BR4A 4FAPB 3EHNA 3GANA 4DJ9A 1LE2A 3LJBA 3X1OA 4JIOA 4MVZA 4E7SA 2CNWA 3HJCA 1QZXA 2LP4A 3DAFA 4LACB 4MVQA 1NFOA 4P9TA 3LNMB 4O6YA 1D0XA 4MQ9F 4O6NA 3ZDLA 2G62A 2EPNA 4FESA 3C63A 4E0HA 2Y39A 1ZHYA 2J7PD 1O87A 2KW3C 1M2OA 4U5GA 1VB5A 3AG1C 3VF0A 2J9UA 4YL1A 1D0ZA 2XLHA 4U5CE 1C03A 3VAYA 3KMIA 3KPHA 1PD1A 2KSFA 4XEVA 3RFYA 2ZXRA 3JYYA 2IOQA 2Q00A 5BQIA 4G0HA 3W2VA 1QVXA 3SNHA 2NPUA 5L0IA 5T3TA 2PFDA 4CDYA 1SMYF 3AG4C 3AJMA 4PR9A 4EWCA 4BJ6C 4A2NB 3Q7LA 4DVZA 1YA9A 5F5HA 3ASOC 3U5SA 5CI9A 1VMAA 2B0HA 4MVRA 4MTFA 3ZIBA 4AL0A 2C04A 4XPYA 4XTKA 1GQAA 1I4YA 1Q0MA 4C3EA 3K66A 2V26A 4J7TA 3TK0A 2DYRC 3NG1A 4B6IA 5HSWA 2KGOA 3EGXB 4G7HF 4K7BA 5KYWB 4PJNA 2GAQA 1A41A 1QLEC 2XLVA 4MW8A 2XSEA 2XL8A 1YZCA 4MNDA 4LDQA 5KYXA 2AWCA 1OW6A 2FFHA 4YT5A 1BDJB 2H7VC 2YZSA 4JVSA 4ULVA 4CDVA 3LEVA 3PCVA 1Y4CA 4N06A 1OKKD 2ETSA 2Q3TA 2GWWA 3DM9B 3GEIA 3NYMA 4YL3A 3SP1A 3WAQA 3LLKA 2ZXOA 3KL4A 3W8HA 4U5FE 4DBQA 2BE5F 1KTMA 2HMZA 2X51A 3CSKA 4GQHA 3JSEO 4ULWA 4UDVA 1TWHA 4U9EA 5D91A 4O7GA 1OCCC 2H8AA 1YLMA 3E70C 5TJ5E 4EBKA 5A6JA 5B3IA 5L0FA 1SF8A 3L34A 2EPOA 5A6AA 3UR3C 1LS1A 3NRHA 2WVQA 4YT8A 4QI0A 1IW7F 1OQCA 2YLIA 4XWJA 1VYIA 2OJED 2J9VA 3EQLF 4HFKB 2WZFA 5L3VA 1MNDA 1UG7A 3AQCA 3NYJA 2PF4E 1JPJA 1M6TA 4FX5A 4CSAC 4BJ6A 3EZIA 5AC5A 2XM0A 4O6MA 3CZ6A 1GS9A 3VRCA 3HNJA 4MVMA 2M4EA 3KH2A 3EHMA 3EH2A 1PCXA 4DXWA 5L0CA 1O3UA 2ZPAA 3M4BA 1WASA 5FCLA 3NMJA 1G4US 1U89A 4JJGA 5DQTA 3N24A 4DRHB 1YYXA 3IQTA 3MX3A 1MQVA 2A6EF 2NG1A 3U9JA 2KK1A 3W4YA 1NU9C 4AL1A 5A6KA 2BC5A 1OW7A 4CIHA 2A0BA 2L81A 2LCHA 4BJTA 1FFTC 2G3KA 3S90A 2D5RB 4LLEA 1NLXA 1V55C 3ZTZA 1FR0A 3EGDA 1E86A 3JRTA 4WABA 5KYYA 1OCOC 2BL2A 3ZC4A 4EBBA 1HE1A 3T9OA 2DI3A 5JT4A 3L1MA 2XLWA 4IAOA 1V54C 4JTDB 2KYHA 4U5BE 3T6JA 2R7RA 1EKYA 1HW1A 2IBFA 3A11A 4MS2A 2R7XA 1JOGA 4EHPA 2Y3BA 4JURI 4BEMJ 3GM2A 2IXMA 2J0WA 4CS7A 4C7OB 2FGYA 3HTKC 4JJFA 4MVOA 3UNGC 3K1IA 1K04A 3H65A 5BUOA 4HEAJ 3S84A 3RW0A 4CSAA 2H7OA 2XM4A 3FVYA 1YJGA 5JP7A 3NYLA 1ORYA 3RQFA 1EA8A 3UGOA 4BJ5C 4ZLDA 2DB4A 3TD7A 2LFDA 3QTHA 1CGME 1NSGB 1EI7A 3DAGA 3PDMP 3C7JA 3RKOF 1U0BB 1TWGA 1VK5A 1XZQA 4CJGA 1PV3A 1TR2A 2XL6A 4PJLA 1VOMA 3TJ6A 4HFFB 1MNEA 3N2ZB 4NCQA 3M4CA 1D1BA 4OD4A 2WVOA 2R7QA 1NBBA 3B29A 3JRMO 5E2QA 3SXZA 1J8MF 1RCPA 4PACA 1ZZPA 4HE8D 2P1AA 2HS5A 4XQ1A 2Q9CA 3FXHA 5IY5C 3H2VA 1R5ID 4JC7A 1YAUO 4I44A 5EK0A 3A9CA 1Q0FA 4XPWA 3JYHA 1Z5ZA 4LDRA 2Q7RA 4GEHA 3MFNA 1FFHA 2IXOA 2NUPB 2YKZA 5KYXB 1WTYA 3JT1A 3L0IA 3MYFA 4JW1A 2W4MA 3PHF2 3C8ZA 4O79A 4E7ZA 3G4XA 1GM5A 4NTBA 3F46A 1JMWA 2YEVA 1Z63A 4IWBA 2X0CA 2M64A 4U5EE 3JZ0A 4NY3A 4CS9C 2JX0A 1HMOA 2P6VA 4IGGA 2B0JA 3L8IA 4EIYA 3V5ZA 2EPKX 1OR2A 1AEPA 2DGJA 1TWAA 2OEXA 2QY9A 2W45A 4K0DA 4NC3A 1CPRA 1OCZC 1T01A 1QQ3A 1R4TA 2WL8A 1QPUA 1F1MA 4BG0A 4XEKA 1RXQA 1YZAA 2YVKA 3NKEA 2RSEB 3RVZA 3TOMA 3V5YA 4D4XA 3J06A 4BJ5A 1H7IA 1JPNA 1WWPA 1ZHXA 1E2XA 3NKDA 2IYLD 4CDAA 3ABMC 3K33A 4KNWA 1H6GA 1S05A 3AG2C 3BEHA 3K6BA 4YL0A 1HW2A 3K7DA 2KQ9A 5COGA 3IEEA 3CAXA 3LEOA 2Q9AA 4IJJA 4U5HA 2J7PA 4FWVA 3MBGA 2CDQA 1TWCA 3SEOA 3QW1A 2QLAA 4OIQF 1G5ZA 2OU6A 3ZSUA 1W2WA 1Z3IX 3DKAA 1DOVA 3G50A 1M57C 3LESA 2MYSA 1I4ZA 2WVNA 1WN0A 4PFPA 3C8GD 2NUPA 4OIRF 4NTAA 1J8YF 5T3WA 3O6XA 4CBEA 1XWJA 2HZ8A 2GA0A 3OEOA 1HY5A 1LVKA 5B1BC 1ZHZA 5L0GA 1BZ4A 4OIOF 2PNOA 3OA1A 3EGDB 3T6GB 3I4UA 3RH3A 5KYYB 4CS9A 3TOLA 3UMHA 1SYQA 1ZU5A 1RJ9A 5COMA 5AC4A 2VCBA 3DMDA 4CX9A 1WGWA 4YWQA 2HJMA 2XLDA 3QVZA
chains in the Genus database with same CATH topology
4NTBA 4J7YA 4YL1A 2UUIA 4J7TA 4AL1A 5BQHA 4WABA 5BQIA 3DWWA 4NTAA 3B29A 3PCVA 4JCZA 3HKKA 4YK5A 4YL3A 4JC7A 5HV9A 5BQGA 4BPMA 5K0IA 2PNOA 4YL0A 2Q7RA 2H8AA 4AL0A 3LEOA 2UUHA 4JRZA 4NTFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NTB A;  4J7Y A;  4YL1 A;  2UUI A;  4J7T A;  4AL1 A;  5BQH A;  4WAB A;  5BQI A;  3DWW A;  4NTA A;  3B29 A;  3PCV A;  4JCZ A;  3HKK A;  4YK5 A;  4YL3 A;  4JC7 A;  5HV9 A;  5BQG A;  4BPM A;  5K0I A;  2PNO A;  4YL0 A;  2Q7R A;  2H8A A;  4AL0 A;  3LEO A;  2UUH A;  4JRZ A;  4NTF A; 
#chains in the Genus database with same CATH topology
 1LI5 A;  3U3B A;  2LSE A;  2E87 A;  1MMA A;  3HNI A;  3PMR A;  4LER A;  1FNT c;  1EQ1 A;  3BRJ A;  2L6F A;  3K1I C;  1ZVZ A;  2EPM X;  1JRA A;  4MTG A;  1WOL A;  2ASR A;  3FMS A;  2R7O A;  4JTC B;  2AVK A;  5JLI A;  3LS1 A;  3B0V C;  3N0T A;  3UMK A;  2J8W A;  4NQF A;  5KYU B;  4JCZ A;  2LFF A;  4YK5 A;  5GPG B;  1S7Z A;  3MYI A;  4M63 A;  1OKK A;  5DLJ A;  4JE9 A;  2WZG A;  4JTA B;  4KNV A;  3S27 A;  1MMN A;  2V3C C;  3U2M A;  5JUA A;  2LD6 A;  1VYK A;  5L0H A;  3GM1 A;  4MVS A;  1JR8 A;  5EHH A;  2XS8 A;  3WG7 C;  2Z15 A;  4E18 A;  4G7Z F;  2KNH A;  5KYN A;  1RMV A;  3QZC A;  3GWL A;  1TKN A;  3RVY A;  3Q7G A;  5DVW A;  4IAR A;  1K40 A;  4I1O B;  1Z7Q c;  2LK4 A;  3AGT A;  2IXP A;  2MHR A;  2XLE A;  3RF3 A;  1OW8 A;  2HFI A;  4JCH A;  4N6H A;  5L3Q A;  1E83 A;  3T6B A;  3V7O A;  3KYJ A;  3FAJ A;  3QVY A;  1E84 A;  4XLP F;  1H9T A;  2R02 A;  5B3S C;  2JD3 A;  4Q4Z F;  3US6 A;  3ITF A;  3ZVR A;  4DVY P;  4W8P A;  2VCA A;  2MWQ A;  2OOC A;  3U8P A;  2EIL C;  1OXK A;  2LIG A;  4IAQ A;  4P9F A;  1ZW2 A;  4QDL A;  4Z9I A;  2YLG A;  4LLC A;  2PBE A;  4WGZ A;  3I5P A;  5HV9 A;  4Q5S F;  1JAF A;  1LE4 A;  1N1C A;  1TFO B;  1H9G A;  1Q0G A;  1VLT A;  2HSB A;  2QNL A;  3O39 A;  4L6R A;  3M1C B;  5E3A A;  3DJU B;  4BEJ A;  2OCC C;  2YQY A;  3EFO B;  5A6B D;  3RYL A;  2OJQ A;  3DJN B;  1RKC A;  2VAS A;  4WJ0 A;  2WZL A;  2J9B A;  5KYU A;  1LM3 B;  2YL7 A;  4OIP F;  2CGE A;  4CJO A;  3U8V A;  1NG1 A;  4IB4 A;  1G4W R;  4AE4 B;  3UGP A;  3POV A;  4LDK A;  3S28 A;  1ZHT A;  4KC9 A;  3GEH A;  3O10 A;  5BQH A;  3U2L A;  3ABL C;  1BBH A;  3AG3 C;  3ABK C;  5JS5 A;  4W8K A;  1BR1 A;  3DM5 A;  5DQZ A;  1TFK B;  2Y69 C;  3SXY A;  4CS8 C;  4JZA A;  2EIJ C;  1LS4 A;  2YHS A;  3B0P A;  3IPM O;  4XEF A;  5DS6 A;  1PD0 A;  1YAR O;  4KI2 A;  2P61 A;  4Z9H A;  4R32 A;  1IZM A;  1OCR C;  1V4A A;  2J46 A;  3KKB A;  2P7V A;  3UMI A;  4E0I A;  3V5X A;  2R7V A;  1ORJ A;  5L0D A;  2HMQ A;  5JVE A;  2I8B A;  3GEE A;  4I3M A;  4X0R A;  2KC3 A;  1AUE A;  3IHU A;  2R7T A;  4RBN A;  3IQC A;  3AQB A;  4J7Y A;  3B9Q A;  1E85 A;  1A7E A;  3DE9 A;  4K1O A;  3RIP A;  3S29 A;  4G78 A;  4MTO A;  1MMG A;  3E9V A;  3FOO A;  4J32 B;  3EFO A;  2Y3D A;  1RJ9 B;  3DWW A;  2OKU A;  1C17 M;  4ER9 A;  4H4K C;  2IXN A;  3HKK A;  5D92 A;  2WB7 A;  3U3F A;  1Z23 A;  2H7B A;  2NSG A;  4J30 B;  1RKE B;  2ZXP A;  3AGU A;  3FOP A;  4AE4 A;  4C7O A;  5BQG A;  3NDB B;  2R7S A;  3JSZ A;  4RD9 A;  1ZW3 A;  2AWY A;  4CIP A;  2HV6 A;  5DS5 A;  3DD7 A;  2AP3 A;  2J0X A;  1FMV A;  3S9O A;  3ZTM A;  4EBJ A;  4ONS A;  3KYI A;  3C62 A;  1L3P A;  3H2U A;  4DRI B;  4N6C A;  3X2Q C;  2CYD A;  3C8G B;  3LAY A;  3JCU Q;  2DYS C;  1NU7 D;  3LLI A;  3CQZ A;  3TJ5 A;  2ZD9 A;  3U0C A;  3Q6M A;  3LNR A;  2YRF A;  3GWN A;  4G7O F;  2UUI A;  2PX3 A;  1YDI A;  2W4B A;  4CS8 A;  3ASN C;  3EG9 A;  3ZG1 A;  2J45 A;  2NUT B;  2L6G A;  2R03 A;  1DOW A;  3GOD A;  4RDA A;  2HKV A;  2D4U A;  3HNK A;  4F4B A;  5L0J A;  1WAT A;  1SR2 A;  1KNY A;  4QI2 A;  4MW3 A;  1YVI A;  3HNL A;  3O55 A;  1TQG A;  1CGN A;  1YA7 O;  1D0Y A;  2XLO A;  5JRA A;  2FAP B;  4Z9J A;  3TQO A;  4ANJ A;  3LUT B;  3EZH A;  2RD9 A;  1C02 A;  2Q4F A;  1O5H A;  1ORS C;  4PJJ A;  5CI8 A;  1MMD A;  3HLZ A;  3C18 A;  4JRZ A;  4I1M A;  4DOZ A;  2JPU A;  3DE8 A;  3NMI A;  2XLM A;  3QW0 A;  5AGF A;  3WOD F;  4C3D A;  4C3B A;  4E17 A;  2XXA B;  1RKE A;  2YL0 A;  5T1D B;  2EPL X;  3M79 A;  3T4R A;  2A68 F;  256B A;  3MLG A;  4JEB A;  4BJ1 A;  3G4Z A;  3RQG A;  4PJM A;  2Y3G A;  1M2V B;  5FZT A;  3S0X A;  3K1H A;  3FHD A;  5DS4 A;  2KJG A;  2L9J A;  3C8G A;  5E3C A;  4WGY A;  5COF A;  4XLN F;  4PFO A;  1Y6D A;  1NFN A;  2W9Y A;  2QTV A;  4OD5 A;  2XS1 A;  3I5Q A;  2PX0 A;  4YJW A;  5K0I A;  3JTL O;  1A0B A;  1NZE A;  1VTM P;  3VYW A;  2NUT A;  3QMK A;  5F5F A;  4D4N A;  1SZI A;  2P0N A;  1LI7 A;  2Q9B A;  1FTS A;  2IM8 A;  4OIN F;  4U5D E;  4DBR A;  3W2W A;  1Z6A A;  3Q6N A;  5JSL A;  4Q7C A;  3EJN A;  3B0U X;  1I5N A;  1A7D A;  3ECS A;  1M56 C;  4AX2 A;  4EUK B;  1VLS A;  2HV7 A;  4H54 A;  2CW0 F;  1AVO B;  3GOR A;  1Q0K A;  2GFH A;  2VCC A;  3R2P A;  4EKW A;  4ZLC A;  1ZU4 A;  1OXB A;  2I15 A;  2R9R B;  1A7V A;  4YN0 B;  1D1A A;  2QUP A;  2F22 A;  2J9W A;  2OQM A;  4XPX A;  1OR3 A;  3EGX A;  2L6H A;  5F28 E;  3ZQV A;  1QKR A;  4YT2 A;  5KYW A;  2A0U A;  2XXA A;  1QSP A;  1T6I A;  2OEV A;  2R05 A;  2VH3 A;  2L7A A;  2PP4 A;  3L8J A;  1G8X A;  3B71 A;  1FMW A;  1HE9 A;  1KU2 A;  2EIM C;  3EH1 A;  3IQ6 A;  1L7C A;  2GDC A;  2A69 F;  5E33 A;  3VM6 A;  1LKX A;  1M2V A;  2ICW G;  4AK9 A;  2R7W A;  1FAP B;  2A1D D;  4PK4 A;  3SXM A;  2UUH A;  3FAP B;  2TMV P;  2R25 A;  4JKV A;  1YYJ A;  4IRU A;  1T9K A;  2LQG A;  2YL1 A;  3WHN A;  1Q0D A;  1XZP A;  1ZHW A;  4DRJ B;  3W8I A;  2YWA A;  4P6I C;  5A69 A;  3ZWI A;  1T5O A;  1APC A;  4A4A A;  4YT4 A;  1D1C A;  3EPV A;  4GYT A;  2EIN C;  2YL3 A;  1BR2 A;  2HJ3 A;  4JEA A;  2XL4 A;  3ATP A;  3SYN A;  4N4W A;  1U6H A;  4KBL A;  2YLD A;  2ZXW C;  3DZA A;  3R7C A;  3SZR A;  3TUL A;  3CEX A;  2AU5 A;  5B1A C;  1ST6 A;  2VB6 A;  2CNW D;  3F47 A;  3M15 A;  4BPM A;  1T6Q A;  2XRH A;  5CIV A;  3EG9 B;  1T6U A;  2C03 A;  2NSF A;  2VC9 A;  5A6B A;  1B68 A;  3LS0 A;  2OG2 A;  3U9M A;  1LIH A;  3DXJ F;  4NTF A;  2O9X A;  1ZYR F;  2HUJ A;  1GGQ A;  3NMK A;  3DI5 A;  4MVU A;  3RQE A;  3SXK A;  3ZQY A;  5EGY A;  2Y3H A;  1HMD A;  2EIK C;  2QE9 A;  3GM3 A;  3AOU A;  3IQ5 A;  1K05 A;  3OWT A;  2R7U A;  1LPE A;  3FDQ A;  1UFB A;  1V74 B;  2CCY A;  1CGO A;  2A6H F;  2HSQ A;  2G3V A;  1CPQ A;  4U9D A;  1BR4 A;  4FAP B;  3EHN A;  3GAN A;  4DJ9 A;  1LE2 A;  3LJB A;  3X1O A;  4JIO A;  4MVZ A;  4E7S A;  2CNW A;  3HJC A;  1QZX A;  2LP4 A;  3DAF A;  4LAC B;  4MVQ A;  1NFO A;  4P9T A;  3LNM B;  4O6Y A;  1D0X A;  4MQ9 F;  4O6N A;  3ZDL A;  2G62 A;  2EPN A;  4FES A;  3C63 A;  4E0H A;  2Y39 A;  1ZHY A;  2J7P D;  1O87 A;  2KW3 C;  1M2O A;  4U5G A;  1VB5 A;  3AG1 C;  3VF0 A;  2J9U A;  4YL1 A;  1D0Z A;  2XLH A;  4U5C E;  1C03 A;  3VAY A;  3KMI A;  3KPH A;  1PD1 A;  2KSF A;  4XEV A;  3RFY A;  2ZXR A;  3JYY A;  2IOQ A;  2Q00 A;  5BQI A;  4G0H A;  3W2V A;  1QVX A;  3SNH A;  2NPU A;  5L0I A;  5T3T A;  2PFD A;  4CDY A;  1SMY F;  3AG4 C;  3AJM A;  4PR9 A;  4EWC A;  4BJ6 C;  4A2N B;  3Q7L A;  4DVZ A;  1YA9 A;  5F5H A;  3ASO C;  3U5S A;  5CI9 A;  1VMA A;  2B0H A;  4MVR A;  4MTF A;  3ZIB A;  4AL0 A;  2C04 A;  4XPY A;  4XTK A;  1GQA A;  1I4Y A;  1Q0M A;  4C3E A;  3K66 A;  2V26 A;  4J7T A;  3TK0 A;  2DYR C;  3NG1 A;  4B6I A;  5HSW A;  2KGO A;  3EGX B;  4G7H F;  4K7B A;  5KYW B;  4PJN A;  2GAQ A;  1A41 A;  1QLE C;  2XLV A;  4MW8 A;  2XSE A;  2XL8 A;  1YZC A;  4MND A;  4LDQ A;  5KYX A;  2AWC A;  1OW6 A;  2FFH A;  4YT5 A;  1BDJ B;  2H7V C;  2YZS A;  4JVS A;  4ULV A;  4CDV A;  3LEV A;  3PCV A;  1Y4C A;  4N06 A;  1OKK D;  2ETS A;  2Q3T A;  2GWW A;  3DM9 B;  3GEI A;  3NYM A;  4YL3 A;  3SP1 A;  3WAQ A;  3LLK A;  2ZXO A;  3KL4 A;  3W8H A;  4U5F E;  4DBQ A;  2BE5 F;  1KTM A;  2HMZ A;  2X51 A;  3CSK A;  4GQH A;  3JSE O;  4ULW A;  4UDV A;  1TWH A;  4U9E A;  5D91 A;  4O7G A;  1OCC C;  2H8A A;  1YLM A;  3E70 C;  5TJ5 E;  4EBK A;  5A6J A;  5B3I A;  5L0F A;  1SF8 A;  3L34 A;  2EPO A;  5A6A A;  3UR3 C;  1LS1 A;  3NRH A;  2WVQ A;  4YT8 A;  4QI0 A;  1IW7 F;  1OQC A;  2YLI A;  4XWJ A;  1VYI A;  2OJE D;  2J9V A;  3EQL F;  4HFK B;  2WZF A;  5L3V A;  1MND A;  1UG7 A;  3AQC A;  3NYJ A;  2PF4 E;  1JPJ A;  1M6T A;  4FX5 A;  4CSA C;  4BJ6 A;  3EZI A;  5AC5 A;  2XM0 A;  4O6M A;  3CZ6 A;  1GS9 A;  3VRC A;  3HNJ A;  4MVM A;  2M4E A;  3KH2 A;  3EHM A;  3EH2 A;  1PCX A;  4DXW A;  5L0C A;  1O3U A;  2ZPA A;  3M4B A;  1WAS A;  5FCL A;  3NMJ A;  1G4U S;  1U89 A;  4JJG A;  5DQT A;  3N24 A;  4DRH B;  1YYX A;  3IQT A;  3MX3 A;  1MQV A;  2A6E F;  2NG1 A;  3U9J A;  2KK1 A;  3W4Y A;  1NU9 C;  4AL1 A;  5A6K A;  2BC5 A;  1OW7 A;  4CIH A;  2A0B A;  2L81 A;  2LCH A;  4BJT A;  1FFT C;  2G3K A;  3S90 A;  2D5R B;  4LLE A;  1NLX A;  1V55 C;  3ZTZ A;  1FR0 A;  3EGD A;  1E86 A;  3JRT A;  4WAB A;  5KYY A;  1OCO C;  2BL2 A;  3ZC4 A;  4EBB A;  1HE1 A;  3T9O A;  2DI3 A;  5JT4 A;  3L1M A;  2XLW A;  4IAO A;  1V54 C;  4JTD B;  2KYH A;  4U5B E;  3T6J A;  2R7R A;  1EKY A;  1HW1 A;  2IBF A;  3A11 A;  4MS2 A;  2R7X A;  1JOG A;  4EHP A;  2Y3B A;  4JUR I;  4BEM J;  3GM2 A;  2IXM A;  2J0W A;  4CS7 A;  4C7O B;  2FGY A;  3HTK C;  4JJF A;  4MVO A;  3UNG C;  3K1I A;  1K04 A;  3H65 A;  5BUO A;  4HEA J;  3S84 A;  3RW0 A;  4CSA A;  2H7O A;  2XM4 A;  3FVY A;  1YJG A;  5JP7 A;  3NYL A;  1ORY A;  3RQF A;  1EA8 A;  3UGO A;  4BJ5 C;  4ZLD A;  2DB4 A;  3TD7 A;  2LFD A;  3QTH A;  1CGM E;  1NSG B;  1EI7 A;  3DAG A;  3PDM P;  3C7J A;  3RKO F;  1U0B B;  1TWG A;  1VK5 A;  1XZQ A;  4CJG A;  1PV3 A;  1TR2 A;  2XL6 A;  4PJL A;  1VOM A;  3TJ6 A;  4HFF B;  1MNE A;  3N2Z B;  4NCQ A;  3M4C A;  1D1B A;  4OD4 A;  2WVO A;  2R7Q A;  1NBB A;  3B29 A;  3JRM O;  5E2Q A;  3SXZ A;  1J8M F;  1RCP A;  4PAC A;  1ZZP A;  4HE8 D;  2P1A A;  2HS5 A;  4XQ1 A;  2Q9C A;  3FXH A;  5IY5 C;  3H2V A;  1R5I D;  4JC7 A;  1YAU O;  4I44 A;  5EK0 A;  3A9C A;  1Q0F A;  4XPW A;  3JYH A;  1Z5Z A;  4LDR A;  2Q7R A;  4GEH A;  3MFN A;  1FFH A;  2IXO A;  2NUP B;  2YKZ A;  5KYX B;  1WTY A;  3JT1 A;  3L0I A;  3MYF A;  4JW1 A;  2W4M A;  3PHF 2;  3C8Z A;  4O79 A;  4E7Z A;  3G4X A;  1GM5 A;  4NTB A;  3F46 A;  1JMW A;  2YEV A;  1Z63 A;  4IWB A;  2X0C A;  2M64 A;  4U5E E;  3JZ0 A;  4NY3 A;  4CS9 C;  2JX0 A;  1HMO A;  2P6V A;  4IGG A;  2B0J A;  3L8I A;  4EIY A;  3V5Z A;  2EPK X;  1OR2 A;  1AEP A;  2DGJ A;  1TWA A;  2OEX A;  2QY9 A;  2W45 A;  4K0D A;  4NC3 A;  1CPR A;  1OCZ C;  1T01 A;  1QQ3 A;  1R4T A;  2WL8 A;  1QPU A;  1F1M A;  4BG0 A;  4XEK A;  1RXQ A;  1YZA A;  2YVK A;  3NKE A;  2RSE B;  3RVZ A;  3TOM A;  3V5Y A;  4D4X A;  3J06 A;  4BJ5 A;  1H7I A;  1JPN A;  1WWP A;  1ZHX A;  1E2X A;  3NKD A;  2IYL D;  4CDA A;  3ABM C;  3K33 A;  4KNW A;  1H6G A;  1S05 A;  3AG2 C;  3BEH A;  3K6B A;  4YL0 A;  1HW2 A;  3K7D A;  2KQ9 A;  5COG A;  3IEE A;  3CAX A;  3LEO A;  2Q9A A;  4IJJ A;  4U5H A;  2J7P A;  4FWV A;  3MBG A;  2CDQ A;  1TWC A;  3SEO A;  3QW1 A;  2QLA A;  4OIQ F;  1G5Z A;  2OU6 A;  3ZSU A;  1W2W A;  1Z3I X;  3DKA A;  1DOV A;  3G50 A;  1M57 C;  3LES A;  2MYS A;  1I4Z A;  2WVN A;  1WN0 A;  4PFP A;  3C8G D;  2NUP A;  4OIR F;  4NTA A;  1J8Y F;  5T3W A;  3O6X A;  4CBE A;  1XWJ A;  2HZ8 A;  2GA0 A;  3OEO A;  1HY5 A;  1LVK A;  5B1B C;  1ZHZ A;  5L0G A;  1BZ4 A;  4OIO F;  2PNO A;  3OA1 A;  3EGD B;  3T6G B;  3I4U A;  3RH3 A;  5KYY B;  4CS9 A;  3TOL A;  3UMH A;  1SYQ A;  1ZU5 A;  1RJ9 A;  5COM A;  5AC4 A;  2VCB A;  3DMD A;  4CX9 A;  1WGW A;  4YWQ A;  2HJM A;  2XLD A;  3QVZ A; 
#chains in the Genus database with same CATH homology
 4NTB A;  4J7Y A;  4YL1 A;  2UUI A;  4J7T A;  4AL1 A;  5BQH A;  4WAB A;  5BQI A;  3DWW A;  4NTA A;  3B29 A;  3PCV A;  4JCZ A;  3HKK A;  4YK5 A;  4YL3 A;  4JC7 A;  5HV9 A;  5BQG A;  4BPM A;  5K0I A;  2PNO A;  4YL0 A;  2Q7R A;  2H8A A;  4AL0 A;  3LEO A;  2UUH A;  4JRZ A;  4NTF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...