5BQGA

Crystal structure of mpges-1 bound to an inhibitor
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
148
structure length
148
Chain Sequence
b'SLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGKLRAPIRSVTYTLAQLPCASMALQILWEAARHL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Prostaglandin E synthase
publication title Discovery and Characterization of 2-Acylaminoimidazole Microsomal Prostaglandin E Synthase-1 Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/isomerase inhibitor
total genus 64
structure length 148
sequence length 148
ec nomenclature ec 5.3.99.3: Prostaglandin-E synthase.
pdb deposition date 2015-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 5bqgA00
3DWWA 4J7YA 3PCVA 4J7TA 5HV9A 4JCZA 4NTBA 5K0IA 4YL1A 4YL0A 3HKKA 2Q7RA 2UUIA 4NTFA 5BQHA 4AL1A 2PNOA 4NTAA 4JRZA 4WABA 4JC7A 2H8AA 3B29A 4AL0A 4YK5A 3LEOA 2UUHA 5BQIA 5BQGA 4BPMA 4YL3A
chains in the Genus database with same CATH superfamily
2KGOA 2R7VA 3DJNB 2R7UA 2OKUA 4MQ9F 2HSBA 1NSGB 2L6HA 2ZXWC 3QW1A 4E7ZA 4J7TA 1G5ZA 3I4UA 2LP4A 1M2OA 5COGA 1FMWA 1MNDA 5L0FA 2LQGA 2HV6A 3TD7A 2P7VA 1TR2A 5KYUB 5AC4A 4XEKA 1OW7A 1R4TA 3W2WA 3MYFA 3NMJA 3NKDA 4CJOA 5B3IA 5JS5A 3UGOA 1TWHA 4Z9JA 2EIKC 3B9QA 4JCHA 5B3SC 5BQHA 4C7OB 4DVYP 3MLGA 5D92A 1H7IA 2ETSA 1VOMA 2J7PD 4N06A 2I15A 3GODA 4K7BA 3WODF 3TK0A 2UUHA 2IXMA 2L7AA 3V7OA 2J9WA 3S27A 4E0IA 4BPMA 3NMIA 1WASA 3L34A 3U3BA 2R7QA 1V54C 4BJ6C 1IW7F 3E9VA 3LS1A 3NDBB 3RQFA 2HFIA 3EH1A 1QLEC 3DXJF 3L1MA 2Q9CA 3JTLO 4U5CE 4DJ9A 4EBJA 2M4EA 4U5BE 4XPWA 3N0TA 2G3VA 1PV3A 3KYIA 4BJ6A 5EHHA 4JJGA 3EGXA 4YL0A 1LS1A 3TULA 5E3AA 1BR2A 5EK0A 2DB4A 2PX0A 3KPHA 4JJFA 5GPGB 3BEHA 4NTFA 3R7CA 3ZQYA 4NY3A 5L0CA 1BDJB 4ZLCA 5A6JA 1G4WR 1PCXA 3GANA 2HKVA 2WZGA 1NZEA 5B1BC 2J8WA 4U5DE 4WGYA 2BE5F 2AWYA 3IQ5A 4YK5A 4AL0A 5A6KA 5L0IA 5COMA 1GS9A 1LI7A 2L6GA 5CI8A 1OKKA 2J45A 1NU7D 4JEAA 3RW0A 4HE8D 4JIOA 2G3KA 3M1CB 1LS4A 1U0BB 2ZD9A 3N2ZB 5L0GA 3F46A 1G8XA 4LDRA 3U5SA 3LESA 2OQMA 3ABKC 1ZHZA 4XPXA 4XPYA 4FESA 4PFOA 1LI5A 1BR4A 2B0JA 2OJED 5KYUA 3X2QC 3CEXA 1MMDA 1K40A 2NSGA 3EGDB 1RMVA 4CS9A 3OWTA 3UNGC 1ZYRF 2NUTB 2YHSA 3EFOB 1A7VA 5A6BA 4NC3A 3EG9B 3S90A 3GORA 1L3PA 2J9UA 2XS1A 2LIGA 3Q6NA 5F5HA 1ZHWA 4C7OA 3OEOA 1G4US 3FDQA 1FAPB 1H6GA 2H7OA 4O6MA 2R02A 4XLNF 1VLTA 4PACA 1OCCC 4AE4B 3GWNA 3AJMA 4MW3A 2CNWD 2IM8A 2WL8A 3FAJA 1NFOA 1CPQA 3IQCA 1Q0MA 4JTCB 4NQFA 2R7SA 1BR1A 5F28E 1YVIA 1QZXA 1ORJA 1NU9C 2R7WA 3N24A 4U5FE 1Z23A 3SZRA 4AK9A 5K0IA 2Q4FA 1HMDA 3ATPA 3HKKA 1Q0DA 4OIQF 1S05A 1MMGA 1T01A 3L8JA 4MTFA 2R7RA 4IJJA 4EBKA 3KL4A 2C04A 1YYJA 1ZHXA 1HW1A 3QVZA 1TFKB 1V55C 4OD5A 2J0WA 3NKEA 3DKAA 1O87A 4E17A 4LERA 1AEPA 1D1AA 2XM4A 1YARO 1NBBA 2OEXA 2XL8A 3EHMA 1K05A 3RYLA 3ZG1A 5KYNA 4ULWA 3C7JA 1LVKA 2A6EF 1UFBA 3HJCA 1LE2A 4BEMJ 3T6BA 4JE9A 5KYYB 2H7VC 1XWJA 2H7BA 3Q6MA 2IOQA 4H4KC 2A69F 1M6TA 3M4BA 3CZ6A 3QTHA 4MW8A 2I8BA 1M56C 4K1OA 1FMVA 3FMSA 3ZTZA 3C8GB 5DVWA 2L9JA 3Q7GA 3PMRA 3M15A 1QSPA 4YT2A 2HMZA 2DYSC 3C8ZA 3EGDA 3FVYA 3F47A 3AQBA 1QQ3A 3RQEA 2NUTA 2UUIA 3EFOA 2Q3TA 4A2NB 3B0VC 3EG9A 2KW3C 4MTOA 4N6HA 4U9DA 1HY5A 3KMIA 1I4YA 4PR9A 3VAYA 1ST6A 1KU2A 1B68A 2R25A 4FX5A 4L6RA 4BG0A 5KYXB 2R7XA 3JT1A 3UR3C 2QE9A 3K1IA 4JVSA 3NYLA 4OINF 3LEOA 5BQIA 4AE4A 4KNWA 4UDVA 2Y3DA 4DBRA 5BQGA 3ZIBA 3ASOC 1VMAA 1Z7Qc 3B0UX 2QTVA 1SMYF 2XSEA 2G62A 2JD3A 3PCVA 1NFNA 1O5HA 1YLMA 2DYRC 2XLOA 3KH2A 1T6QA 3ABLC 4FAPB 2NPUA 2KNHA 2IXNA 1TQGA 1YA9A 4MVUA 4DBQA 1Y6DA 3SXKA 4DOZA 4F4BA 3R2PA 4Q4ZF 4LDQA 3LLKA 1OKKD 2F22A 4IARA 2L81A 2YEVA 3LLIA 1H9GA 2J0XA 2NG1A 2L6FA 3S28A 3AG4C 4DVZA 2AU5A 4OIPF 5L0HA 3J06A 2EILC 1LE4A 2JX0A 3DAGA 2Y69C 4YT4A 5KYYA 2KK1A 2OU6A 3LJBA 4XWJA 5A6BD 5KYWB 2OOCA 3FHDA 4N6CA 3ZWIA 3U2MA 3W4YA 4HFKB 4Z9IA 1CGOA 4GEHA 4U9EA 4IAOA 3JYHA 3QMKA 1A41A 3C8GA 1C03A 1YA7O 2HS5A 4GQHA 4O6YA 3IHUA 4JEBA 4ZLDA 2VCAA 4MVSA 2WZFA 4E0HA 4ER9A 5KYXA 3FOOA 3RF3A 1FFHA 2OCCC 4LACB 3DJUB 2X0CA 1Y4CA 1MQVA 2HJMA 1E85A 3QVYA 2W4MA 2Q9AA 1RKEB 2A0UA 3I5PA 2EPNA 2Y3GA 2PP4A 2XLVA 3EZIA 4BJ5C 4CS8C 5L3VA 1O3UA 2RD9A 3LUTB 1LPEA 3UMIA 3EZHA 4BJ5A 4NCQA 5IY5C 3E70C 4O6NA 2R7TA 5DS4A 4JCZA 4I1MA 4C3BA 2XRHA 3T4RA 5F5FA 3AG3C 2XS8A 1TWCA 4G0HA 3RVYA 2YWAA 3FXHA 4MVZA 3SXMA 1XZPA 1DOVA 3PHF2 2YL3A 5E3CA 1YZCA 5B1AC 3G4ZA 2PNOA 4JZAA 4N4WA 2LSEA 3ABMC 3U3FA 3WAQA 3JRTA 4DRHB 3K66A 4CDAA 4RBNA 1E83A 4JURI 2OG2A 4JRZA 2YZSA 3PDMP 1ZU5A 2WVNA 2ZXPA 4JC7A 2CDQA 1M57C 1SR2A 3Q7LA 3TOMA 2YKZA 2FGYA 4W8KA 2YVKA 2HZ8A 2P0NA 3W2VA 1BZ4A 3U8VA 3ZDLA 4U5HA 3HNLA 3GM3A 1GM5A 1E2XA 4JW1A 4XQ1A 4CIHA 2WVQA 5KYWA 4BJ1A 1IZMA 3DAFA 3C18A 3H2UA 1HMOA 1JMWA 2KSFA 1F1MA 1YYXA 4OD4A 4XEVA 1Z63A 3LAYA 3GEEA 2JPUA 3FAPB 1Z5ZA 4ANJA 1T5OA 1GQAA 4BJTA 1J8MF 1ORYA 3A11A 3GWLA 3RVZA 1GGQA 2IYLD 3LNRA 3EPVA 3UMHA 2C03A 1M2VB 1JPNA 2EINC 2M64A 3CSKA 1HW2A 1AVOB 3H65A 2V3CC 2YLGA 1ZHTA 1XZQA 2A0BA 2A68F 1KTMA 4PJMA 1RKEA 3U2LA 2PBEA 3ZQVA 4CS7A 5DQZA 2EPMX 3TQOA 1LM3B 1RKCA 2Y3HA 2YRFA 3GM2A 2OEVA 4YJWA 3OA1A 3W8HA 4DRJB 1EQ1A 3AG1C 4XEFA 1RJ9B 1T9KA 2EPLX 2D4UA 3NYMA 4YWQA 3EJNA 1OCOC 5A69A 4KI2A 1TKNA 3IEEA 5L0DA 2AWCA 3HNKA 4PJJA 4PFPA 5JUAA 1I4ZA 2Y3BA 4O79A 4ULVA 2XM0A 3V5XA 2TMVP 4CIPA 3VYWA 4CX9A 2KQ9A 3U9JA 3SEOA 5FCLA 3DI5A 4XLPF 4MVRA 4Q5SF 4NTAA 2OJQA 1ORSC 2EPOA 3X1OA 1SYQA 2GDCA 3JYYA 4G7ZF 3V5YA 2QUPA 1RCPA 4ONSA 2CCYA 1OW8A 2LFFA 1VK5A 2PX3A 2VCBA 4IGGA 2VH3A 4EBBA 5D91A 5DS6A 5DLJA 4E18A 5JVEA 4FWVA 1YJGA 4P9FA 4QDLA 4CJGA 1E86A 2A1DD 3W8IA 2QLAA 3VRCA 1A7DA 2XLEA 1A0BA 1HE9A 2XLDA 2P6VA 2EPKX 2YL1A 4CSAC 2MHRA 1V4AA 2RSEB 2AVKA 2XLWA 1TWGA 5HV9A 1WN0A 4NTBA 3CAXA 2PFDA 2X51A 2CNWA 2V26A 1S7ZA 3POVA 1LKXA 2D5RB 3JZ0A 2HV7A 3JCUQ 4OIRF 1VLSA 1J8YF 2Q7RA 1C02A 3MBGA 2KC3A 2YLDA 3LNMB 3L8IA 3GEHA 3SNHA 1Z3IX 2EIJC 2XLMA 3B71A 1M2VA 1WTYA 2PF4E 1OXBA 3AGUA 3NYJA 4J30B 3DM9B 4OIOF 4AX2A 2MYSA 3DZAA 3JSZA 3RKOF 4H54A 2EIMC 1CGNA 2VB6A 2W45A 2B0HA 3QZCA 4LDKA 4PJNA 4CDYA 5DS5A 4MNDA 1MMNA 1TFOB 2XLHA 1PD0A 4IWBA 2LCHA 3IQTA 4DRIB 1RJ9A 3DD7A 3H2VA 3I5QA 4LLCA 4U5GA 1A7EA 1JPJA 4E7SA 2WZLA 2R7OA 3S84A 2GFHA 1ZVZA 1WWPA 1YDIA 2A6HF 2NUPB 3KKBA 2KJGA 3T6JA 5COFA 4XTKA 3RQGA 4B6IA 3AOUA 1ZW2A 1RXQA 3IQ6A 2ZPAA 3M79A 1OCZC 4JTDB 5T3WA 3DMDA 4D4NA 2HSQA 4YT8A 4JKVA 3S29A 1E84A 1VB5A 2CYDA 1JRAA 4CSAA 2VASA 1UG7A 2IXPA 2H8AA 3TJ6A 5JSLA 1AUEA 1C17M 3AG2C 4LLEA 4MVQA 1T6IA 3ZTMA 4G7OF 2XXAB 3O55A 1D0XA 3O10A 3HNIA 3S0XA 4Q7CA 4EUKB 4BEJA 1Z6AA 1MMAA 1JR8A 4MTGA 4CS8A 1QPUA 2J46A 2J9BA 2R9RB 4I44A 2LK4A 4I3MA 4Z9HA 3TOLA 3V5ZA 1OCRC 1WOLA 3T6GB 4HEAJ 4MVMA 4W8PA 3VF0A 1U6HA 3NRHA 1EKYA 3VM6A 1L7CA 2MWQA 4M63A 3DE9A 3HLZA 3K6BA 5AC5A 3G4XA 5HSWA 4JTAB 5DQTA 3C63A 3U0CA 2HUJA 3FOPA 3ECSA 2GAQA 3WG7C 3BRJA 2XL4A 5EGYA 1I5NA 1MNEA 1U89A 2YL0A 3B29A 2AP3A 3MFNA 3EHNA 3QW0A 4CBEA 3K33A 5CI9A 1VTMP 1TWAA 4R32A 5T1DB 5T3TA 3DM5A 3IPMO 1OW6A 2YLIA 1QKRA 1KNYA 3K7DA 4J32B 3DWWA 3UGPA 2J7PA 1D1CA 1Q0GA 3L0IA 4J7YA 4CS9C 1T6UA 2Q9BA 4A4AA 3JSEO 4DXWA 5BUOA 1APCA 3NMKA 1VYIA 3RFYA 1CPRA 5JP7A 2QNLA 3EQLF 3ZSUA 3RH3A 1PD1A 1V74B 2R03A 3EH2A 5JLIA 3G50A 2NUPA 1ZZPA 4P9TA 4RDAA 4G78A 3GM1A 4C3EA 5E2QA 2VCCA 2Y39A 2YL7A 2CGEA 4EWCA 2ASRA 4PJLA 2IXOA 2QY9A 3U9MA 3AGTA 4KBLA 1H9TA 1EA8A 3ASNC 3S9OA 1CGME 1D0ZA 3NG1A 4U5EE 1K04A 2YQYA 5FZTA 1YAUO 4PK4A 1JAFA 1BBHA 2WVOA 2BC5A 2XXAA 1FR0A 1OXKA 3B0PA 5L0JA 1FTSA 1FNTc 3MX3A 4IAQA 5A6AA 1VYKA 1W2WA 3US6A 3SYNA 3SP1A 2FAPB 1WATA 2GWWA 3LS0A 5TJ5E 4IRUA 1OR3A 1FFTC 2W9YA 3JRMO 1Q0KA 4QI0A 2HMQA 2BL2A 4I1OB 3LEVA 4K0DA 5JT4A 2LD6A 1JOGA 2E87A 3SXYA 3SXZA 4KC9A 2KYHA 4YT5A 1QVXA 1Q0FA 4MS2A 5CIVA 5AGFA 1ZW3A 5JRAA 3U8PA 1N1CA 1HE1A 1WGWA 4GYTA 3KYJA 3O6XA 4CDVA 3HTKC 1EI7A 4P6IC 4YN0B 4EIYA 1DOWA 3HNJA 3A9CA 5E33A 4IB4A 1D1BA 1NLXA 3C8GD 1R5ID 2DI3A 3K1HA 4D4XA 2ZXRA 1OR2A 2HJ3A 2Q00A 3DE8A 2W4BA 3C62A 3O39A 3TJ5A 2R05A 2ZXOA 2GA0A 3M4CA 2P61A 3ZC4A 1D0YA 4MVOA 3ZVRA 4QI2A 3ITFA 4WJ0A 1OQCA 2IBFA 3UMKA 4RD9A 4YL1A 1ZU4A 3CQZA 4EKWA 3EGXB 4X0RA 2LFDA 3AQCA 4HFFB 3T9OA 3MYIA 3K1IC 1LIHA 2NSFA 4WGZA 4G7HF 1SF8A 4AL1A 1YZAA 2WB7A 1SZIA 1ZHYA 4O7GA 2XL6A 4C3DA 256BA 5L3QA 4WABA 2FFHA 2CW0F 2VC9A 2DGJA 2P1AA 4EHPA 2J9VA 3RIPA 3GEIA 4KNVA 2ICWG 1NG1A 2O9XA 3WHNA 2Z15A 4YL3A
chains in the Genus database with same CATH topology
3DWWA 4J7YA 3PCVA 4J7TA 5HV9A 4JCZA 4NTBA 5K0IA 4YL1A 4YL0A 3HKKA 2Q7RA 2UUIA 4NTFA 5BQHA 4AL1A 2PNOA 4NTAA 4JRZA 4WABA 4JC7A 2H8AA 3B29A 4AL0A 4YK5A 3LEOA 2UUHA 5BQIA 5BQGA 4BPMA 4YL3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DWW A;  4J7Y A;  3PCV A;  4J7T A;  5HV9 A;  4JCZ A;  4NTB A;  5K0I A;  4YL1 A;  4YL0 A;  3HKK A;  2Q7R A;  2UUI A;  4NTF A;  5BQH A;  4AL1 A;  2PNO A;  4NTA A;  4JRZ A;  4WAB A;  4JC7 A;  2H8A A;  3B29 A;  4AL0 A;  4YK5 A;  3LEO A;  2UUH A;  5BQI A;  5BQG A;  4BPM A;  4YL3 A; 
#chains in the Genus database with same CATH topology
 2KGO A;  2R7V A;  3DJN B;  2R7U A;  2OKU A;  4MQ9 F;  2HSB A;  1NSG B;  2L6H A;  2ZXW C;  3QW1 A;  4E7Z A;  4J7T A;  1G5Z A;  3I4U A;  2LP4 A;  1M2O A;  5COG A;  1FMW A;  1MND A;  5L0F A;  2LQG A;  2HV6 A;  3TD7 A;  2P7V A;  1TR2 A;  5KYU B;  5AC4 A;  4XEK A;  1OW7 A;  1R4T A;  3W2W A;  3MYF A;  3NMJ A;  3NKD A;  4CJO A;  5B3I A;  5JS5 A;  3UGO A;  1TWH A;  4Z9J A;  2EIK C;  3B9Q A;  4JCH A;  5B3S C;  5BQH A;  4C7O B;  4DVY P;  3MLG A;  5D92 A;  1H7I A;  2ETS A;  1VOM A;  2J7P D;  4N06 A;  2I15 A;  3GOD A;  4K7B A;  3WOD F;  3TK0 A;  2UUH A;  2IXM A;  2L7A A;  3V7O A;  2J9W A;  3S27 A;  4E0I A;  4BPM A;  3NMI A;  1WAS A;  3L34 A;  3U3B A;  2R7Q A;  1V54 C;  4BJ6 C;  1IW7 F;  3E9V A;  3LS1 A;  3NDB B;  3RQF A;  2HFI A;  3EH1 A;  1QLE C;  3DXJ F;  3L1M A;  2Q9C A;  3JTL O;  4U5C E;  4DJ9 A;  4EBJ A;  2M4E A;  4U5B E;  4XPW A;  3N0T A;  2G3V A;  1PV3 A;  3KYI A;  4BJ6 A;  5EHH A;  4JJG A;  3EGX A;  4YL0 A;  1LS1 A;  3TUL A;  5E3A A;  1BR2 A;  5EK0 A;  2DB4 A;  2PX0 A;  3KPH A;  4JJF A;  5GPG B;  3BEH A;  4NTF A;  3R7C A;  3ZQY A;  4NY3 A;  5L0C A;  1BDJ B;  4ZLC A;  5A6J A;  1G4W R;  1PCX A;  3GAN A;  2HKV A;  2WZG A;  1NZE A;  5B1B C;  2J8W A;  4U5D E;  4WGY A;  2BE5 F;  2AWY A;  3IQ5 A;  4YK5 A;  4AL0 A;  5A6K A;  5L0I A;  5COM A;  1GS9 A;  1LI7 A;  2L6G A;  5CI8 A;  1OKK A;  2J45 A;  1NU7 D;  4JEA A;  3RW0 A;  4HE8 D;  4JIO A;  2G3K A;  3M1C B;  1LS4 A;  1U0B B;  2ZD9 A;  3N2Z B;  5L0G A;  3F46 A;  1G8X A;  4LDR A;  3U5S A;  3LES A;  2OQM A;  3ABK C;  1ZHZ A;  4XPX A;  4XPY A;  4FES A;  4PFO A;  1LI5 A;  1BR4 A;  2B0J A;  2OJE D;  5KYU A;  3X2Q C;  3CEX A;  1MMD A;  1K40 A;  2NSG A;  3EGD B;  1RMV A;  4CS9 A;  3OWT A;  3UNG C;  1ZYR F;  2NUT B;  2YHS A;  3EFO B;  1A7V A;  5A6B A;  4NC3 A;  3EG9 B;  3S90 A;  3GOR A;  1L3P A;  2J9U A;  2XS1 A;  2LIG A;  3Q6N A;  5F5H A;  1ZHW A;  4C7O A;  3OEO A;  1G4U S;  3FDQ A;  1FAP B;  1H6G A;  2H7O A;  4O6M A;  2R02 A;  4XLN F;  1VLT A;  4PAC A;  1OCC C;  4AE4 B;  3GWN A;  3AJM A;  4MW3 A;  2CNW D;  2IM8 A;  2WL8 A;  3FAJ A;  1NFO A;  1CPQ A;  3IQC A;  1Q0M A;  4JTC B;  4NQF A;  2R7S A;  1BR1 A;  5F28 E;  1YVI A;  1QZX A;  1ORJ A;  1NU9 C;  2R7W A;  3N24 A;  4U5F E;  1Z23 A;  3SZR A;  4AK9 A;  5K0I A;  2Q4F A;  1HMD A;  3ATP A;  3HKK A;  1Q0D A;  4OIQ F;  1S05 A;  1MMG A;  1T01 A;  3L8J A;  4MTF A;  2R7R A;  4IJJ A;  4EBK A;  3KL4 A;  2C04 A;  1YYJ A;  1ZHX A;  1HW1 A;  3QVZ A;  1TFK B;  1V55 C;  4OD5 A;  2J0W A;  3NKE A;  3DKA A;  1O87 A;  4E17 A;  4LER A;  1AEP A;  1D1A A;  2XM4 A;  1YAR O;  1NBB A;  2OEX A;  2XL8 A;  3EHM A;  1K05 A;  3RYL A;  3ZG1 A;  5KYN A;  4ULW A;  3C7J A;  1LVK A;  2A6E F;  1UFB A;  3HJC A;  1LE2 A;  4BEM J;  3T6B A;  4JE9 A;  5KYY B;  2H7V C;  1XWJ A;  2H7B A;  3Q6M A;  2IOQ A;  4H4K C;  2A69 F;  1M6T A;  3M4B A;  3CZ6 A;  3QTH A;  4MW8 A;  2I8B A;  1M56 C;  4K1O A;  1FMV A;  3FMS A;  3ZTZ A;  3C8G B;  5DVW A;  2L9J A;  3Q7G A;  3PMR A;  3M15 A;  1QSP A;  4YT2 A;  2HMZ A;  2DYS C;  3C8Z A;  3EGD A;  3FVY A;  3F47 A;  3AQB A;  1QQ3 A;  3RQE A;  2NUT A;  2UUI A;  3EFO A;  2Q3T A;  4A2N B;  3B0V C;  3EG9 A;  2KW3 C;  4MTO A;  4N6H A;  4U9D A;  1HY5 A;  3KMI A;  1I4Y A;  4PR9 A;  3VAY A;  1ST6 A;  1KU2 A;  1B68 A;  2R25 A;  4FX5 A;  4L6R A;  4BG0 A;  5KYX B;  2R7X A;  3JT1 A;  3UR3 C;  2QE9 A;  3K1I A;  4JVS A;  3NYL A;  4OIN F;  3LEO A;  5BQI A;  4AE4 A;  4KNW A;  4UDV A;  2Y3D A;  4DBR A;  5BQG A;  3ZIB A;  3ASO C;  1VMA A;  1Z7Q c;  3B0U X;  2QTV A;  1SMY F;  2XSE A;  2G62 A;  2JD3 A;  3PCV A;  1NFN A;  1O5H A;  1YLM A;  2DYR C;  2XLO A;  3KH2 A;  1T6Q A;  3ABL C;  4FAP B;  2NPU A;  2KNH A;  2IXN A;  1TQG A;  1YA9 A;  4MVU A;  4DBQ A;  1Y6D A;  3SXK A;  4DOZ A;  4F4B A;  3R2P A;  4Q4Z F;  4LDQ A;  3LLK A;  1OKK D;  2F22 A;  4IAR A;  2L81 A;  2YEV A;  3LLI A;  1H9G A;  2J0X A;  2NG1 A;  2L6F A;  3S28 A;  3AG4 C;  4DVZ A;  2AU5 A;  4OIP F;  5L0H A;  3J06 A;  2EIL C;  1LE4 A;  2JX0 A;  3DAG A;  2Y69 C;  4YT4 A;  5KYY A;  2KK1 A;  2OU6 A;  3LJB A;  4XWJ A;  5A6B D;  5KYW B;  2OOC A;  3FHD A;  4N6C A;  3ZWI A;  3U2M A;  3W4Y A;  4HFK B;  4Z9I A;  1CGO A;  4GEH A;  4U9E A;  4IAO A;  3JYH A;  3QMK A;  1A41 A;  3C8G A;  1C03 A;  1YA7 O;  2HS5 A;  4GQH A;  4O6Y A;  3IHU A;  4JEB A;  4ZLD A;  2VCA A;  4MVS A;  2WZF A;  4E0H A;  4ER9 A;  5KYX A;  3FOO A;  3RF3 A;  1FFH A;  2OCC C;  4LAC B;  3DJU B;  2X0C A;  1Y4C A;  1MQV A;  2HJM A;  1E85 A;  3QVY A;  2W4M A;  2Q9A A;  1RKE B;  2A0U A;  3I5P A;  2EPN A;  2Y3G A;  2PP4 A;  2XLV A;  3EZI A;  4BJ5 C;  4CS8 C;  5L3V A;  1O3U A;  2RD9 A;  3LUT B;  1LPE A;  3UMI A;  3EZH A;  4BJ5 A;  4NCQ A;  5IY5 C;  3E70 C;  4O6N A;  2R7T A;  5DS4 A;  4JCZ A;  4I1M A;  4C3B A;  2XRH A;  3T4R A;  5F5F A;  3AG3 C;  2XS8 A;  1TWC A;  4G0H A;  3RVY A;  2YWA A;  3FXH A;  4MVZ A;  3SXM A;  1XZP A;  1DOV A;  3PHF 2;  2YL3 A;  5E3C A;  1YZC A;  5B1A C;  3G4Z A;  2PNO A;  4JZA A;  4N4W A;  2LSE A;  3ABM C;  3U3F A;  3WAQ A;  3JRT A;  4DRH B;  3K66 A;  4CDA A;  4RBN A;  1E83 A;  4JUR I;  2OG2 A;  4JRZ A;  2YZS A;  3PDM P;  1ZU5 A;  2WVN A;  2ZXP A;  4JC7 A;  2CDQ A;  1M57 C;  1SR2 A;  3Q7L A;  3TOM A;  2YKZ A;  2FGY A;  4W8K A;  2YVK A;  2HZ8 A;  2P0N A;  3W2V A;  1BZ4 A;  3U8V A;  3ZDL A;  4U5H A;  3HNL A;  3GM3 A;  1GM5 A;  1E2X A;  4JW1 A;  4XQ1 A;  4CIH A;  2WVQ A;  5KYW A;  4BJ1 A;  1IZM A;  3DAF A;  3C18 A;  3H2U A;  1HMO A;  1JMW A;  2KSF A;  1F1M A;  1YYX A;  4OD4 A;  4XEV A;  1Z63 A;  3LAY A;  3GEE A;  2JPU A;  3FAP B;  1Z5Z A;  4ANJ A;  1T5O A;  1GQA A;  4BJT A;  1J8M F;  1ORY A;  3A11 A;  3GWL A;  3RVZ A;  1GGQ A;  2IYL D;  3LNR A;  3EPV A;  3UMH A;  2C03 A;  1M2V B;  1JPN A;  2EIN C;  2M64 A;  3CSK A;  1HW2 A;  1AVO B;  3H65 A;  2V3C C;  2YLG A;  1ZHT A;  1XZQ A;  2A0B A;  2A68 F;  1KTM A;  4PJM A;  1RKE A;  3U2L A;  2PBE A;  3ZQV A;  4CS7 A;  5DQZ A;  2EPM X;  3TQO A;  1LM3 B;  1RKC A;  2Y3H A;  2YRF A;  3GM2 A;  2OEV A;  4YJW A;  3OA1 A;  3W8H A;  4DRJ B;  1EQ1 A;  3AG1 C;  4XEF A;  1RJ9 B;  1T9K A;  2EPL X;  2D4U A;  3NYM A;  4YWQ A;  3EJN A;  1OCO C;  5A69 A;  4KI2 A;  1TKN A;  3IEE A;  5L0D A;  2AWC A;  3HNK A;  4PJJ A;  4PFP A;  5JUA A;  1I4Z A;  2Y3B A;  4O79 A;  4ULV A;  2XM0 A;  3V5X A;  2TMV P;  4CIP A;  3VYW A;  4CX9 A;  2KQ9 A;  3U9J A;  3SEO A;  5FCL A;  3DI5 A;  4XLP F;  4MVR A;  4Q5S F;  4NTA A;  2OJQ A;  1ORS C;  2EPO A;  3X1O A;  1SYQ A;  2GDC A;  3JYY A;  4G7Z F;  3V5Y A;  2QUP A;  1RCP A;  4ONS A;  2CCY A;  1OW8 A;  2LFF A;  1VK5 A;  2PX3 A;  2VCB A;  4IGG A;  2VH3 A;  4EBB A;  5D91 A;  5DS6 A;  5DLJ A;  4E18 A;  5JVE A;  4FWV A;  1YJG A;  4P9F A;  4QDL A;  4CJG A;  1E86 A;  2A1D D;  3W8I A;  2QLA A;  3VRC A;  1A7D A;  2XLE A;  1A0B A;  1HE9 A;  2XLD A;  2P6V A;  2EPK X;  2YL1 A;  4CSA C;  2MHR A;  1V4A A;  2RSE B;  2AVK A;  2XLW A;  1TWG A;  5HV9 A;  1WN0 A;  4NTB A;  3CAX A;  2PFD A;  2X51 A;  2CNW A;  2V26 A;  1S7Z A;  3POV A;  1LKX A;  2D5R B;  3JZ0 A;  2HV7 A;  3JCU Q;  4OIR F;  1VLS A;  1J8Y F;  2Q7R A;  1C02 A;  3MBG A;  2KC3 A;  2YLD A;  3LNM B;  3L8I A;  3GEH A;  3SNH A;  1Z3I X;  2EIJ C;  2XLM A;  3B71 A;  1M2V A;  1WTY A;  2PF4 E;  1OXB A;  3AGU A;  3NYJ A;  4J30 B;  3DM9 B;  4OIO F;  4AX2 A;  2MYS A;  3DZA A;  3JSZ A;  3RKO F;  4H54 A;  2EIM C;  1CGN A;  2VB6 A;  2W45 A;  2B0H A;  3QZC A;  4LDK A;  4PJN A;  4CDY A;  5DS5 A;  4MND A;  1MMN A;  1TFO B;  2XLH A;  1PD0 A;  4IWB A;  2LCH A;  3IQT A;  4DRI B;  1RJ9 A;  3DD7 A;  3H2V A;  3I5Q A;  4LLC A;  4U5G A;  1A7E A;  1JPJ A;  4E7S A;  2WZL A;  2R7O A;  3S84 A;  2GFH A;  1ZVZ A;  1WWP A;  1YDI A;  2A6H F;  2NUP B;  3KKB A;  2KJG A;  3T6J A;  5COF A;  4XTK A;  3RQG A;  4B6I A;  3AOU A;  1ZW2 A;  1RXQ A;  3IQ6 A;  2ZPA A;  3M79 A;  1OCZ C;  4JTD B;  5T3W A;  3DMD A;  4D4N A;  2HSQ A;  4YT8 A;  4JKV A;  3S29 A;  1E84 A;  1VB5 A;  2CYD A;  1JRA A;  4CSA A;  2VAS A;  1UG7 A;  2IXP A;  2H8A A;  3TJ6 A;  5JSL A;  1AUE A;  1C17 M;  3AG2 C;  4LLE A;  4MVQ A;  1T6I A;  3ZTM A;  4G7O F;  2XXA B;  3O55 A;  1D0X A;  3O10 A;  3HNI A;  3S0X A;  4Q7C A;  4EUK B;  4BEJ A;  1Z6A A;  1MMA A;  1JR8 A;  4MTG A;  4CS8 A;  1QPU A;  2J46 A;  2J9B A;  2R9R B;  4I44 A;  2LK4 A;  4I3M A;  4Z9H A;  3TOL A;  3V5Z A;  1OCR C;  1WOL A;  3T6G B;  4HEA J;  4MVM A;  4W8P A;  3VF0 A;  1U6H A;  3NRH A;  1EKY A;  3VM6 A;  1L7C A;  2MWQ A;  4M63 A;  3DE9 A;  3HLZ A;  3K6B A;  5AC5 A;  3G4X A;  5HSW A;  4JTA B;  5DQT A;  3C63 A;  3U0C A;  2HUJ A;  3FOP A;  3ECS A;  2GAQ A;  3WG7 C;  3BRJ A;  2XL4 A;  5EGY A;  1I5N A;  1MNE A;  1U89 A;  2YL0 A;  3B29 A;  2AP3 A;  3MFN A;  3EHN A;  3QW0 A;  4CBE A;  3K33 A;  5CI9 A;  1VTM P;  1TWA A;  4R32 A;  5T1D B;  5T3T A;  3DM5 A;  3IPM O;  1OW6 A;  2YLI A;  1QKR A;  1KNY A;  3K7D A;  4J32 B;  3DWW A;  3UGP A;  2J7P A;  1D1C A;  1Q0G A;  3L0I A;  4J7Y A;  4CS9 C;  1T6U A;  2Q9B A;  4A4A A;  3JSE O;  4DXW A;  5BUO A;  1APC A;  3NMK A;  1VYI A;  3RFY A;  1CPR A;  5JP7 A;  2QNL A;  3EQL F;  3ZSU A;  3RH3 A;  1PD1 A;  1V74 B;  2R03 A;  3EH2 A;  5JLI A;  3G50 A;  2NUP A;  1ZZP A;  4P9T A;  4RDA A;  4G78 A;  3GM1 A;  4C3E A;  5E2Q A;  2VCC A;  2Y39 A;  2YL7 A;  2CGE A;  4EWC A;  2ASR A;  4PJL A;  2IXO A;  2QY9 A;  3U9M A;  3AGT A;  4KBL A;  1H9T A;  1EA8 A;  3ASN C;  3S9O A;  1CGM E;  1D0Z A;  3NG1 A;  4U5E E;  1K04 A;  2YQY A;  5FZT A;  1YAU O;  4PK4 A;  1JAF A;  1BBH A;  2WVO A;  2BC5 A;  2XXA A;  1FR0 A;  1OXK A;  3B0P A;  5L0J A;  1FTS A;  1FNT c;  3MX3 A;  4IAQ A;  5A6A A;  1VYK A;  1W2W A;  3US6 A;  3SYN A;  3SP1 A;  2FAP B;  1WAT A;  2GWW A;  3LS0 A;  5TJ5 E;  4IRU A;  1OR3 A;  1FFT C;  2W9Y A;  3JRM O;  1Q0K A;  4QI0 A;  2HMQ A;  2BL2 A;  4I1O B;  3LEV A;  4K0D A;  5JT4 A;  2LD6 A;  1JOG A;  2E87 A;  3SXY A;  3SXZ A;  4KC9 A;  2KYH A;  4YT5 A;  1QVX A;  1Q0F A;  4MS2 A;  5CIV A;  5AGF A;  1ZW3 A;  5JRA A;  3U8P A;  1N1C A;  1HE1 A;  1WGW A;  4GYT A;  3KYJ A;  3O6X A;  4CDV A;  3HTK C;  1EI7 A;  4P6I C;  4YN0 B;  4EIY A;  1DOW A;  3HNJ A;  3A9C A;  5E33 A;  4IB4 A;  1D1B A;  1NLX A;  3C8G D;  1R5I D;  2DI3 A;  3K1H A;  4D4X A;  2ZXR A;  1OR2 A;  2HJ3 A;  2Q00 A;  3DE8 A;  2W4B A;  3C62 A;  3O39 A;  3TJ5 A;  2R05 A;  2ZXO A;  2GA0 A;  3M4C A;  2P61 A;  3ZC4 A;  1D0Y A;  4MVO A;  3ZVR A;  4QI2 A;  3ITF A;  4WJ0 A;  1OQC A;  2IBF A;  3UMK A;  4RD9 A;  4YL1 A;  1ZU4 A;  3CQZ A;  4EKW A;  3EGX B;  4X0R A;  2LFD A;  3AQC A;  4HFF B;  3T9O A;  3MYI A;  3K1I C;  1LIH A;  2NSF A;  4WGZ A;  4G7H F;  1SF8 A;  4AL1 A;  1YZA A;  2WB7 A;  1SZI A;  1ZHY A;  4O7G A;  2XL6 A;  4C3D A;  256B A;  5L3Q A;  4WAB A;  2FFH A;  2CW0 F;  2VC9 A;  2DGJ A;  2P1A A;  4EHP A;  2J9V A;  3RIP A;  3GEI A;  4KNV A;  2ICW G;  1NG1 A;  2O9X A;  3WHN A;  2Z15 A;  4YL3 A; 
#chains in the Genus database with same CATH homology
 3DWW A;  4J7Y A;  3PCV A;  4J7T A;  5HV9 A;  4JCZ A;  4NTB A;  5K0I A;  4YL1 A;  4YL0 A;  3HKK A;  2Q7R A;  2UUI A;  4NTF A;  5BQH A;  4AL1 A;  2PNO A;  4NTA A;  4JRZ A;  4WAB A;  4JC7 A;  2H8A A;  3B29 A;  4AL0 A;  4YK5 A;  3LEO A;  2UUH A;  5BQI A;  5BQG A;  4BPM A;  4YL3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...