1YAUO

Structure of archeabacterial 20s proteasome- pa26 complex
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
228
structure length
218
Chain Sequence
KRAALIQNLRDSYTETSSFAVIEEWAAGTLQEIEGIAKAAAEAHGVIRNSTYGRAQAEKSPEQLLGVLQRYQDLCHNVYCQAETIRTVIAIRIPEHKEEDNLGVAVQHAVLKIIDELEIKTLGSGEKSGSGGAPTPIGMYALREYLSARSTVEDKLLGGGSQSPSLLLELRQIDADFMLKVELATTHLSTMVRAVINAYLLNWKKLIQPRTGSDHMVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase activator
molecule keywords Proteasome alpha subunit
publication title The 1.9 A structure of a proteasome-11S activator complex and implications for proteasome-PAN/PA700 interactions.
pubmed doi rcsb
source organism Thermoplasma acidophilum
total genus 82
structure length 218
sequence length 228
chains with identical sequence P, Q, R, S, T, U
ec nomenclature
pdb deposition date 2004-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF02252 PA28_beta Proteasome activator pa28 beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.180 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Proteasome activator pa28, C-terminal domain 1yauO01
3IPMO 1YA7O 1FNTc 1YARO 3JSEO 1Z7Qc 3JRMO 1AVOB 3JTLO 1YAUO
chains in the Genus database with same CATH superfamily
1LS4A 3M15A 4RD9A 3U2MA 4G7OF 2I8BA 5CIVA 3FXHA 4LDRA 4CJGA 3L8IA 2JX0A 1RCPA 4EBKA 3JYHA 4OIPF 5T3TA 2KYHA 4N6HA 1TWGA 4ZLDA 3GEHA 2LK4A 3AGUA 1EKYA 2QY9A 1I4YA 4J7YA 2NUTB 3ZDLA 1NFNA 2HS5A 3ZG1A 2X0CA 3IQTA 4OD5A 4PFOA 3I5PA 3ECSA 4CDVA 3SEOA 2C04A 3C18A 2GWWA 2WZGA 1L7CA 3WAQA 2QUPA 2H7OA 1YAUO 2WVOA 2AP3A 3CQZA 4JEAA 4OD4A 4U5HA 1IZMA 4ZLCA 5E3AA 4MS2A 4EBBA 2GFHA 1I4ZA 3UR3C 2NUTA 2Y3GA 2HSBA 2W4MA 4E0IA 3M79A 2Q7RA 3E70C 3ZQVA 3LLKA 2I15A 4JJGA 1BZ4A 3ABKC 3RKOF 3WHNA 3EJNA 3K7DA 1CPQA 2HFIA 2HMQA 3HNIA 4U5FE 5B1BC 1TR2A 2X51A 2MWQA 3VAYA 1SZIA 2WZFA 3FVYA 4HFFB 4U5BE 1ZHWA 4U9EA 1JRAA 1NLXA 2P0NA 1OR3A 3EQLF 1K04A 2YL3A 2LCHA 2Z15A 3NMJA 4P9FA 4N4WA 2EPMX 1B68A 3T6BA 1CPRA 3B0PA 2PP4A 2ZXRA 3X1OA 1G5ZA 3TOMA 3MYIA 1D1AA 3U3BA 1T01A 1Z7Qc 4C7OB 3LNMB 3AGTA 4NCQA 2PX3A 4PJMA 4NQFA 1RKCA 1A41A 5T3WA 2XLDA 2WB7A 4WGZA 5JLIA 1LPEA 2XLVA 1YYXA 2PF4E 3R2PA 4NC3A 1MMNA 2J9UA 2EILC 4CS8A 3QVZA 3U8VA 2WL8A 3Q7GA 4E0HA 1FTSA 3EH1A 4XLPF 3V5ZA 1SMYF 3U9JA 4C7OA 1LVKA 1GGQA 1N1CA 3IQ5A 2G3KA 4XQ1A 5D91A 1R4TA 3FAJA 2XLMA 4ULWA 4IARA 1WATA 3DWWA 3GWNA 5F5FA 3UMHA 4OIOF 4PK4A 4JTAB 4BJ6C 1V74B 5EGYA 5T1DB 4YWQA 1HMOA 3EZIA 3U3FA 3TULA 2EIMC 1U6HA 4YJWA 5KYNA 3KH2A 3OA1A 3SP1A 1A7VA 1OCRC 2WZLA 3NYMA 1YYJA 1FMWA 4RDAA 4AL1A 4C3BA 1Z5ZA 3US6A 3V7OA 1NSGB 1YVIA 3L1MA 1V4AA 3GWLA 1D1CA 2VCBA 4IGGA 5L3QA 3QZCA 3U8PA 5DS4A 1JR8A 3VYWA 2CDQA 4HFKB 2GDCA 2AWYA 3KYJA 4ANJA 1QVXA 1LE2A 1Q0MA 1WASA 2KW3C 1EA8A 5B3IA 1OCOC 3I5QA 3VM6A 3DMDA 4R32A 4XEVA 2VCCA 1FMVA 1M56C 3QTHA 3CZ6A 4JZAA 4NTBA 2OG2A 2R7XA 1YZAA 1M57C 3HNKA 3NMIA 3TD7A 2BC5A 1QPUA 4K7BA 3NYJA 3EH2A 4JTDB 3GM1A 2EINC 3K1IC 1YA9A 4L6RA 3TJ6A 1RKEB 3V5YA 2J9BA 5AC4A 2ZD9A 5L0JA 3S0XA 3RIPA 2J0XA 1A7EA 4CDAA 1HW2A 1HE9A 3T6JA 4CDYA 3N2ZB 3QVYA 4IB4A 5BQHA 1LI5A 2J46A 2Q9BA 2R7QA 3ATPA 5F5HA 3MBGA 1LIHA 3DJUB 1NG1A 2OEVA 3JCUQ 4JE9A 4XPYA 2DB4A 1ZVZA 1QZXA 2JD3A 5COFA 1YLMA 3RH3A 5COMA 2EIKC 1YDIA 1BR1A 3EFOB 4JJFA 4MVRA 3RFYA 1E86A 4OIRF 4BPMA 3NYLA 1CGME 1RKEA 1GM5A 2A69F 1G4WR 2YHSA 3MYFA 3FAPB 2YL7A 4CBEA 1MMAA 2A0UA 2QE9A 5B1AC 5B3SC 2M4EA 1KU2A 1QSPA 2RD9A 1CGNA 2ZXWC 3NKEA 4RBNA 2IM8A 4MTGA 3TK0A 3ZTZA 3N0TA 4OIQF 1AEPA 3X2QC 3LEVA 3EFOA 1AVOB 2OU6A 4ONSA 4YT5A 1S05A 2H7VC 2KGOA 3TQOA 2YQYA 3BEHA 2NPUA 1E84A 1OKKD 5EK0A 2QTVA 2CGEA 5CI8A 3RVZA 2XXAA 4C3DA 1BR2A 2L6GA 3S84A 3S90A 3H2UA 5GPGB 4DJ9A 3U9MA 4MW3A 3AG1C 4JTCB 4MTFA 4YK5A 4MVQA 1Y4CA 1VYKA 1D0YA 3W8IA 1FR0A 2NSFA 4LDQA 2HKVA 2JPUA 4BJ5C 4DXWA 4AE4B 4JKVA 2ZXOA 2B0JA 2J0WA 3QW1A 1FFTC 1YA7O 4GYTA 4J7TA 5TJ5E 2QNLA 4I3MA 2J9VA 1HW1A 2YRFA 3DD7A 3EGXB 4IAQA 2AWCA 2NG1A 4KC9A 4CS7A 1O5HA 2AVKA 3EHMA 1OCZC 5D92A 4U5EE 3DZAA 4Q7CA 4XWJA 4AE4A 1Z63A 4QI2A 2W45A 2OJQA 1DOWA 4HE8D 1ZHXA 4M63A 5AC5A 3KL4A 4J30B 2J7PD 2NSGA 4CSAC 4YT2A 4F4BA 4EBJA 2KK1A 4NTFA 5KYWB 4FWVA 1O3UA 2XM0A 1W2WA 3A9CA 2IYLD 2DI3A 4Z9IA 2Y3DA 2WVNA 1QKRA 4WGYA 3T6GB 2J9WA 2HZ8A 5A6BA 3JZ0A 1EI7A 5L0IA 1TWHA 2Y69C 1JOGA 3GORA 4JC7A 4Z9JA 3WG7C 1MMGA 3Q7LA 4U9DA 5DVWA 2IOQA 5JSLA 2BL2A 5HSWA 5L0GA 3SXYA 3IPMO 5KYWA 3DM9B 3F46A 1NZEA 2VB6A 3AQCA 1OCCC 2A0BA 2GAQA 3DJNB 3E9VA 4E17A 1V55C 4YT4A 3RF3A 1LI7A 3V5XA 4CJOA 2XRHA 4FX5A 4G0HA 4LDKA 3QMKA 3C8GB 2ASRA 3M4BA 3NG1A 3MLGA 2XM4A 1M6TA 4CX9A 1TQGA 3G4ZA 2R9RB 4H54A 2EPNA 4A4AA 1WTYA 2Q9AA 4BJTA 3JSEO 3T9OA 1XZQA 4O6YA 3NKDA 2IXNA 4CIHA 3L0IA 4P6IC 1OW8A 4FESA 5DQZA 3C8GA 2R7VA 3C62A 1H7IA 3CEXA 3EPVA 3O6XA 3UMIA 4G78A 3ZQYA 1A7DA 3FOOA 2MYSA 3GEIA 3MX3A 5BUOA 3B29A 3G50A 3ZWIA 4YL1A 2QLAA 2LP4A 2A6HF 2OJED 2VH3A 4PJJA 3O10A 3UGOA 2IXOA 5KYUB 1RMVA 4FAPB 1T6IA 2L81A 1E2XA 2R03A 3DKAA 3EGDB 4PR9A 2P7VA 2OKUA 4N06A 4DRJB 1M2OA 3PCVA 2G62A 2R05A 2NUPB 3N24A 3AG3C 3DI5A 4BEMJ 2D4UA 4JEBA 3L34A 3B71A 2EPOA 5L0HA 4KNWA 3ABLC 1PCXA 3AG4C 4N6CA 4DBQA 5FCLA 2CNWA 3KKBA 1ZW3A 3LS1A 4JW1A 3S27A 5DLJA 5JRAA 1L3PA 4XTKA 5KYUA 3AOUA 3EGDA 3NDBB 1K40A 3LLIA 4XPXA 1ORJA 1PD0A 1WWPA 2NUPA 1H6GA 1ZW2A 3LESA 4GEHA 3SZRA 3U5SA 4CS8C 1Y6DA 3RQEA 5A6KA 3GODA 3KYIA 3RVYA 4MQ9F 3M1CB 3KMIA 2RSEB 3VF0A 4KNVA 1JPNA 3LAYA 4IAOA 4A2NB 1GQAA 3AG2C 3GM2A 3MFNA 3A11A 3FMSA 4ULVA 5JS5A 4JVSA 3TJ5A 2PFDA 3O39A 4HEAJ 3EZHA 1ST6A 2W4BA 1Q0FA 3PDMP 1YARO 2XSEA 3W8HA 2Q9CA 1A0BA 3JTLO 3JYYA 3O55A 5AGFA 4AX2A 2VCAA 2V26A 1K05A 4OINF 2FGYA 3HNJA 2R7SA 3FOPA 1ZYRF 4O79A 1ORYA 1ZHYA 1H9TA 4BJ1A 2XLWA 3RQFA 2UUHA 2KC3A 1YJGA 2HMZA 3DM5A 4PFPA 4NTAA 4XEKA 2XL6A 2IXPA 1IW7F 4LACB 4BJ5A 1G8XA 1S7ZA 1RJ9B 1MNDA 1CGOA 3JRTA 1ZHTA 1U89A 1SYQA 3ZVRA 2OEXA 1KTMA 2Y3BA 4E18A 3K66A 3RQGA 3RW0A 4CS9C 1OQCA 3G4XA 4WJ0A 2A6EF 1T6UA 3B9QA 2LFFA 4IJJA 4K0DA 1NU7D 2UUIA 4KI2A 2FAPB 1TKNA 5JT4A 2P61A 3FHDA 3LJBA 1BDJB 3CSKA 1M2VB 1LKXA 2R02A 4E7SA 1XWJA 1G4US 4J32B 2J7PA 3HKKA 3LEOA 3B0UX 2YKZA 3Q6NA 3TOLA 1R5ID 2LQGA 3IQCA 1V54C 2IXMA 2O9XA 4CSAA 4EIYA 4IWBA 3JRMO 4LLCA 4B6IA 2ICWG 2XLHA 1JAFA 1JMWA 4W8PA 4EHPA 2YLGA 4BG0A 1OW7A 2YWAA 1FNTc 4MTOA 3WODF 1VLTA 1AUEA 5HV9A 4O6MA 3C8ZA 1ZZPA 3K6BA 2V3CC 2XL8A 3IQ6A 5JUAA 4XPWA 3K33A 1OW6A 2CW0F 1UFBA 4AK9A 3JT1A 3EGXA 3GM3A 4NY3A 4XEFA 1LS1A 1KNYA 2YL1A 5E33A 3SYNA 3PMRA 1J8YF 2EPLX 4MVMA 1SR2A 1JPJA 4G7ZF 1XZPA 4EWCA 3ITFA 3SXKA 3W2VA 2J45A 1WN0A 4H4KC 3B0VC 2HSQA 3UNGC 4EKWA 1D1BA 3UMKA 3IEEA 3PHF2 2YLDA 1VMAA 3HJCA 2W9YA 4P9TA 4U5GA 1HE1A 3FDQA 4Q5SF 2FFHA 3NRHA 4UDVA 2PBEA 5BQIA 5DS5A 1T9KA 4LLEA 4PJLA 1Z3IX 2YVKA 5KYXB 4AL0A 1ZHZA 4BJ6A 1LM3B 3K1HA 256BA 1O87A 1D0XA 2M64A 2R7TA 5DQTA 3HTKC 1QLEC 2VASA 2D5RB 1Z6AA 2E87A 1Z23A 5CI9A 2R7OA 4LERA 2PX0A 4QDLA 2DGJA 5L0FA 1OXBA 4MW8A 1MNEA 1Q0KA 2H8AA 2A1DD 2PNOA 3GEEA 4GQHA 4YL0A 5L0CA 5KYXA 2F22A 3SXZA 1TFOB 3EG9B 2L9JA 4O7GA 4E7ZA 5F28E 1E83A 3DE9A 3H65A 1H9GA 4YT8A 1QQ3A 4WABA 2LSEA 3HNLA 1ZU4A 4X0RA 1E85A 1D0ZA 3CAXA 2J8WA 2XS1A 1PV3A 2Q00A 1BBHA 3L8JA 2TMVP 1WOLA 3EG9A 4JCHA 4DBRA 5K0IA 2R7UA 2YLIA 3C63A 3C7JA 2DYSC 3UGPA 3U0CA 1LE4A 3AJMA 1VLSA 2OQMA 3GANA 3POVA 5A6BD 4DOZA 1DOVA 4G7HF 2HUJA 4JIOA 1VB5A 3ZSUA 3S9OA 3QW0A 3Q6MA 2R7RA 4MVZA 3ZC4A 2Y39A 5DS6A 3LUTB 3K1IA 1OR2A 3IHUA 4U5DE 5E2QA 1TWCA 4YN0B 5EHHA 1EQ1A 2KQ9A 2Q4FA 4KBLA 4YL3A 2B0HA 3NMKA 2BE5F 1YZCA 2KJGA 2ETSA 4MVOA 2WVQA 3EHNA 5A69A 1APCA 3HLZA 4MVSA 5A6AA 2AU5A 2XLOA 2MHRA 4MVUA 3VRCA 1F1MA 2DYRC 1TFKB 2YZSA 4DRHB 2L7AA 4JURI 4D4NA 4I1MA 1I5NA 2HV6A 4D4XA 1VK5A 2XS8A 4K1OA 2CCYA 3SNHA 3T4RA 3ASOC 4MNDA 3ZIBA 4DRIB 4DVZA 2LIGA 1C03A 1GS9A 3H2VA 4PJNA 5IY5C 3C8GD 3DAFA 1C02A 1BR4A 3LNRA 3OEOA 1OKKA 1U0BB 2Q3TA 1RXQA 3BRJA 2H7BA 4IRUA 4DVYP 5L0DA 1J8MF 3M4CA 4CS9A 4EUKB 4CIPA 2ZXPA 4QI0A 5E3CA 4JCZA 4O6NA 2HJ3A 1WGWA 2IBFA 2Y3HA 4ER9A 1SF8A 5L3VA 3W2WA 1MQVA 1Q0GA 3KPHA 2R7WA 2P6VA 3S28A 3DXJF 1VTMP 1ZU5A 2GA0A 3DAGA 3JSZA 1VOMA 2HV7A 4W8KA 3J06A 1HY5A 3U2LA 2KNHA 1FFHA 4I1OB 2HJMA 1MMDA 1VYIA 5BQGA 3ABMC 1T6QA 2LD6A 3RYLA 5FZTA 2CNWD 2G3VA 4U5CE 3R7CA 2LFDA 3LS0A 2CYDA 2L6HA 2YEVA 2OOCA 1HMDA 4Z9HA 3ZTMA 1PD1A 2L6FA 3AQBA 3SXMA 3W4YA 1RJ9A 3S29A 2VC9A 1OXKA 4XLNF 5KYYB 1FAPB 5JVEA 2EPKX 2A68F 2YL0A 2XXAB 1NBBA 5A6JA 2R25A 2P1AA 1C17M 3ASNC 4JRZA 1TWAA 2EIJC 1T5OA 4PACA 1M2VA 3F47A 5COGA 3OWTA 5JP7A 1NU9C 4C3EA 2ZPAA 3DE8A 1NFOA 2XLEA 5KYYA 1UG7A 2KSFA 4I44A 4BEJA 2OCCC 2XL4A 4Q4ZF 1Q0DA 1ORSC 2C03A 3I4UA
chains in the Genus database with same CATH topology
3IPMO 1YA7O 1FNTc 1YARO 3JSEO 1Z7Qc 3JRMO 1AVOB 3JTLO 1YAUO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IPM O;  1YA7 O;  1FNT c;  1YAR O;  3JSE O;  1Z7Q c;  3JRM O;  1AVO B;  3JTL O;  1YAU O; 
#chains in the Genus database with same CATH topology
 1LS4 A;  3M15 A;  4RD9 A;  3U2M A;  4G7O F;  2I8B A;  5CIV A;  3FXH A;  4LDR A;  4CJG A;  3L8I A;  2JX0 A;  1RCP A;  4EBK A;  3JYH A;  4OIP F;  5T3T A;  2KYH A;  4N6H A;  1TWG A;  4ZLD A;  3GEH A;  2LK4 A;  3AGU A;  1EKY A;  2QY9 A;  1I4Y A;  4J7Y A;  2NUT B;  3ZDL A;  1NFN A;  2HS5 A;  3ZG1 A;  2X0C A;  3IQT A;  4OD5 A;  4PFO A;  3I5P A;  3ECS A;  4CDV A;  3SEO A;  2C04 A;  3C18 A;  2GWW A;  2WZG A;  1L7C A;  3WAQ A;  2QUP A;  2H7O A;  1YAU O;  2WVO A;  2AP3 A;  3CQZ A;  4JEA A;  4OD4 A;  4U5H A;  1IZM A;  4ZLC A;  5E3A A;  4MS2 A;  4EBB A;  2GFH A;  1I4Z A;  3UR3 C;  2NUT A;  2Y3G A;  2HSB A;  2W4M A;  4E0I A;  3M79 A;  2Q7R A;  3E70 C;  3ZQV A;  3LLK A;  2I15 A;  4JJG A;  1BZ4 A;  3ABK C;  3RKO F;  3WHN A;  3EJN A;  3K7D A;  1CPQ A;  2HFI A;  2HMQ A;  3HNI A;  4U5F E;  5B1B C;  1TR2 A;  2X51 A;  2MWQ A;  3VAY A;  1SZI A;  2WZF A;  3FVY A;  4HFF B;  4U5B E;  1ZHW A;  4U9E A;  1JRA A;  1NLX A;  2P0N A;  1OR3 A;  3EQL F;  1K04 A;  2YL3 A;  2LCH A;  2Z15 A;  3NMJ A;  4P9F A;  4N4W A;  2EPM X;  1B68 A;  3T6B A;  1CPR A;  3B0P A;  2PP4 A;  2ZXR A;  3X1O A;  1G5Z A;  3TOM A;  3MYI A;  1D1A A;  3U3B A;  1T01 A;  1Z7Q c;  4C7O B;  3LNM B;  3AGT A;  4NCQ A;  2PX3 A;  4PJM A;  4NQF A;  1RKC A;  1A41 A;  5T3W A;  2XLD A;  2WB7 A;  4WGZ A;  5JLI A;  1LPE A;  2XLV A;  1YYX A;  2PF4 E;  3R2P A;  4NC3 A;  1MMN A;  2J9U A;  2EIL C;  4CS8 A;  3QVZ A;  3U8V A;  2WL8 A;  3Q7G A;  4E0H A;  1FTS A;  3EH1 A;  4XLP F;  3V5Z A;  1SMY F;  3U9J A;  4C7O A;  1LVK A;  1GGQ A;  1N1C A;  3IQ5 A;  2G3K A;  4XQ1 A;  5D91 A;  1R4T A;  3FAJ A;  2XLM A;  4ULW A;  4IAR A;  1WAT A;  3DWW A;  3GWN A;  5F5F A;  3UMH A;  4OIO F;  4PK4 A;  4JTA B;  4BJ6 C;  1V74 B;  5EGY A;  5T1D B;  4YWQ A;  1HMO A;  3EZI A;  3U3F A;  3TUL A;  2EIM C;  1U6H A;  4YJW A;  5KYN A;  3KH2 A;  3OA1 A;  3SP1 A;  1A7V A;  1OCR C;  2WZL A;  3NYM A;  1YYJ A;  1FMW A;  4RDA A;  4AL1 A;  4C3B A;  1Z5Z A;  3US6 A;  3V7O A;  1NSG B;  1YVI A;  3L1M A;  1V4A A;  3GWL A;  1D1C A;  2VCB A;  4IGG A;  5L3Q A;  3QZC A;  3U8P A;  5DS4 A;  1JR8 A;  3VYW A;  2CDQ A;  4HFK B;  2GDC A;  2AWY A;  3KYJ A;  4ANJ A;  1QVX A;  1LE2 A;  1Q0M A;  1WAS A;  2KW3 C;  1EA8 A;  5B3I A;  1OCO C;  3I5Q A;  3VM6 A;  3DMD A;  4R32 A;  4XEV A;  2VCC A;  1FMV A;  1M56 C;  3QTH A;  3CZ6 A;  4JZA A;  4NTB A;  2OG2 A;  2R7X A;  1YZA A;  1M57 C;  3HNK A;  3NMI A;  3TD7 A;  2BC5 A;  1QPU A;  4K7B A;  3NYJ A;  3EH2 A;  4JTD B;  3GM1 A;  2EIN C;  3K1I C;  1YA9 A;  4L6R A;  3TJ6 A;  1RKE B;  3V5Y A;  2J9B A;  5AC4 A;  2ZD9 A;  5L0J A;  3S0X A;  3RIP A;  2J0X A;  1A7E A;  4CDA A;  1HW2 A;  1HE9 A;  3T6J A;  4CDY A;  3N2Z B;  3QVY A;  4IB4 A;  5BQH A;  1LI5 A;  2J46 A;  2Q9B A;  2R7Q A;  3ATP A;  5F5H A;  3MBG A;  1LIH A;  3DJU B;  1NG1 A;  2OEV A;  3JCU Q;  4JE9 A;  4XPY A;  2DB4 A;  1ZVZ A;  1QZX A;  2JD3 A;  5COF A;  1YLM A;  3RH3 A;  5COM A;  2EIK C;  1YDI A;  1BR1 A;  3EFO B;  4JJF A;  4MVR A;  3RFY A;  1E86 A;  4OIR F;  4BPM A;  3NYL A;  1CGM E;  1RKE A;  1GM5 A;  2A69 F;  1G4W R;  2YHS A;  3MYF A;  3FAP B;  2YL7 A;  4CBE A;  1MMA A;  2A0U A;  2QE9 A;  5B1A C;  5B3S C;  2M4E A;  1KU2 A;  1QSP A;  2RD9 A;  1CGN A;  2ZXW C;  3NKE A;  4RBN A;  2IM8 A;  4MTG A;  3TK0 A;  3ZTZ A;  3N0T A;  4OIQ F;  1AEP A;  3X2Q C;  3LEV A;  3EFO A;  1AVO B;  2OU6 A;  4ONS A;  4YT5 A;  1S05 A;  2H7V C;  2KGO A;  3TQO A;  2YQY A;  3BEH A;  2NPU A;  1E84 A;  1OKK D;  5EK0 A;  2QTV A;  2CGE A;  5CI8 A;  3RVZ A;  2XXA A;  4C3D A;  1BR2 A;  2L6G A;  3S84 A;  3S90 A;  3H2U A;  5GPG B;  4DJ9 A;  3U9M A;  4MW3 A;  3AG1 C;  4JTC B;  4MTF A;  4YK5 A;  4MVQ A;  1Y4C A;  1VYK A;  1D0Y A;  3W8I A;  1FR0 A;  2NSF A;  4LDQ A;  2HKV A;  2JPU A;  4BJ5 C;  4DXW A;  4AE4 B;  4JKV A;  2ZXO A;  2B0J A;  2J0W A;  3QW1 A;  1FFT C;  1YA7 O;  4GYT A;  4J7T A;  5TJ5 E;  2QNL A;  4I3M A;  2J9V A;  1HW1 A;  2YRF A;  3DD7 A;  3EGX B;  4IAQ A;  2AWC A;  2NG1 A;  4KC9 A;  4CS7 A;  1O5H A;  2AVK A;  3EHM A;  1OCZ C;  5D92 A;  4U5E E;  3DZA A;  4Q7C A;  4XWJ A;  4AE4 A;  1Z63 A;  4QI2 A;  2W45 A;  2OJQ A;  1DOW A;  4HE8 D;  1ZHX A;  4M63 A;  5AC5 A;  3KL4 A;  4J30 B;  2J7P D;  2NSG A;  4CSA C;  4YT2 A;  4F4B A;  4EBJ A;  2KK1 A;  4NTF A;  5KYW B;  4FWV A;  1O3U A;  2XM0 A;  1W2W A;  3A9C A;  2IYL D;  2DI3 A;  4Z9I A;  2Y3D A;  2WVN A;  1QKR A;  4WGY A;  3T6G B;  2J9W A;  2HZ8 A;  5A6B A;  3JZ0 A;  1EI7 A;  5L0I A;  1TWH A;  2Y69 C;  1JOG A;  3GOR A;  4JC7 A;  4Z9J A;  3WG7 C;  1MMG A;  3Q7L A;  4U9D A;  5DVW A;  2IOQ A;  5JSL A;  2BL2 A;  5HSW A;  5L0G A;  3SXY A;  3IPM O;  5KYW A;  3DM9 B;  3F46 A;  1NZE A;  2VB6 A;  3AQC A;  1OCC C;  2A0B A;  2GAQ A;  3DJN B;  3E9V A;  4E17 A;  1V55 C;  4YT4 A;  3RF3 A;  1LI7 A;  3V5X A;  4CJO A;  2XRH A;  4FX5 A;  4G0H A;  4LDK A;  3QMK A;  3C8G B;  2ASR A;  3M4B A;  3NG1 A;  3MLG A;  2XM4 A;  1M6T A;  4CX9 A;  1TQG A;  3G4Z A;  2R9R B;  4H54 A;  2EPN A;  4A4A A;  1WTY A;  2Q9A A;  4BJT A;  3JSE O;  3T9O A;  1XZQ A;  4O6Y A;  3NKD A;  2IXN A;  4CIH A;  3L0I A;  4P6I C;  1OW8 A;  4FES A;  5DQZ A;  3C8G A;  2R7V A;  3C62 A;  1H7I A;  3CEX A;  3EPV A;  3O6X A;  3UMI A;  4G78 A;  3ZQY A;  1A7D A;  3FOO A;  2MYS A;  3GEI A;  3MX3 A;  5BUO A;  3B29 A;  3G50 A;  3ZWI A;  4YL1 A;  2QLA A;  2LP4 A;  2A6H F;  2OJE D;  2VH3 A;  4PJJ A;  3O10 A;  3UGO A;  2IXO A;  5KYU B;  1RMV A;  4FAP B;  1T6I A;  2L81 A;  1E2X A;  2R03 A;  3DKA A;  3EGD B;  4PR9 A;  2P7V A;  2OKU A;  4N06 A;  4DRJ B;  1M2O A;  3PCV A;  2G62 A;  2R05 A;  2NUP B;  3N24 A;  3AG3 C;  3DI5 A;  4BEM J;  2D4U A;  4JEB A;  3L34 A;  3B71 A;  2EPO A;  5L0H A;  4KNW A;  3ABL C;  1PCX A;  3AG4 C;  4N6C A;  4DBQ A;  5FCL A;  2CNW A;  3KKB A;  1ZW3 A;  3LS1 A;  4JW1 A;  3S27 A;  5DLJ A;  5JRA A;  1L3P A;  4XTK A;  5KYU A;  3AOU A;  3EGD A;  3NDB B;  1K40 A;  3LLI A;  4XPX A;  1ORJ A;  1PD0 A;  1WWP A;  2NUP A;  1H6G A;  1ZW2 A;  3LES A;  4GEH A;  3SZR A;  3U5S A;  4CS8 C;  1Y6D A;  3RQE A;  5A6K A;  3GOD A;  3KYI A;  3RVY A;  4MQ9 F;  3M1C B;  3KMI A;  2RSE B;  3VF0 A;  4KNV A;  1JPN A;  3LAY A;  4IAO A;  4A2N B;  1GQA A;  3AG2 C;  3GM2 A;  3MFN A;  3A11 A;  3FMS A;  4ULV A;  5JS5 A;  4JVS A;  3TJ5 A;  2PFD A;  3O39 A;  4HEA J;  3EZH A;  1ST6 A;  2W4B A;  1Q0F A;  3PDM P;  1YAR O;  2XSE A;  3W8H A;  2Q9C A;  1A0B A;  3JTL O;  3JYY A;  3O55 A;  5AGF A;  4AX2 A;  2VCA A;  2V26 A;  1K05 A;  4OIN F;  2FGY A;  3HNJ A;  2R7S A;  3FOP A;  1ZYR F;  4O79 A;  1ORY A;  1ZHY A;  1H9T A;  4BJ1 A;  2XLW A;  3RQF A;  2UUH A;  2KC3 A;  1YJG A;  2HMZ A;  3DM5 A;  4PFP A;  4NTA A;  4XEK A;  2XL6 A;  2IXP A;  1IW7 F;  4LAC B;  4BJ5 A;  1G8X A;  1S7Z A;  1RJ9 B;  1MND A;  1CGO A;  3JRT A;  1ZHT A;  1U89 A;  1SYQ A;  3ZVR A;  2OEX A;  1KTM A;  2Y3B A;  4E18 A;  3K66 A;  3RQG A;  3RW0 A;  4CS9 C;  1OQC A;  3G4X A;  4WJ0 A;  2A6E F;  1T6U A;  3B9Q A;  2LFF A;  4IJJ A;  4K0D A;  1NU7 D;  2UUI A;  4KI2 A;  2FAP B;  1TKN A;  5JT4 A;  2P61 A;  3FHD A;  3LJB A;  1BDJ B;  3CSK A;  1M2V B;  1LKX A;  2R02 A;  4E7S A;  1XWJ A;  1G4U S;  4J32 B;  2J7P A;  3HKK A;  3LEO A;  3B0U X;  2YKZ A;  3Q6N A;  3TOL A;  1R5I D;  2LQG A;  3IQC A;  1V54 C;  2IXM A;  2O9X A;  4CSA A;  4EIY A;  4IWB A;  3JRM O;  4LLC A;  4B6I A;  2ICW G;  2XLH A;  1JAF A;  1JMW A;  4W8P A;  4EHP A;  2YLG A;  4BG0 A;  1OW7 A;  2YWA A;  1FNT c;  4MTO A;  3WOD F;  1VLT A;  1AUE A;  5HV9 A;  4O6M A;  3C8Z A;  1ZZP A;  3K6B A;  2V3C C;  2XL8 A;  3IQ6 A;  5JUA A;  4XPW A;  3K33 A;  1OW6 A;  2CW0 F;  1UFB A;  4AK9 A;  3JT1 A;  3EGX A;  3GM3 A;  4NY3 A;  4XEF A;  1LS1 A;  1KNY A;  2YL1 A;  5E33 A;  3SYN A;  3PMR A;  1J8Y F;  2EPL X;  4MVM A;  1SR2 A;  1JPJ A;  4G7Z F;  1XZP A;  4EWC A;  3ITF A;  3SXK A;  3W2V A;  2J45 A;  1WN0 A;  4H4K C;  3B0V C;  2HSQ A;  3UNG C;  4EKW A;  1D1B A;  3UMK A;  3IEE A;  3PHF 2;  2YLD A;  1VMA A;  3HJC A;  2W9Y A;  4P9T A;  4U5G A;  1HE1 A;  3FDQ A;  4Q5S F;  2FFH A;  3NRH A;  4UDV A;  2PBE A;  5BQI A;  5DS5 A;  1T9K A;  4LLE A;  4PJL A;  1Z3I X;  2YVK A;  5KYX B;  4AL0 A;  1ZHZ A;  4BJ6 A;  1LM3 B;  3K1H A;  256B A;  1O87 A;  1D0X A;  2M64 A;  2R7T A;  5DQT A;  3HTK C;  1QLE C;  2VAS A;  2D5R B;  1Z6A A;  2E87 A;  1Z23 A;  5CI9 A;  2R7O A;  4LER A;  2PX0 A;  4QDL A;  2DGJ A;  5L0F A;  1OXB A;  4MW8 A;  1MNE A;  1Q0K A;  2H8A A;  2A1D D;  2PNO A;  3GEE A;  4GQH A;  4YL0 A;  5L0C A;  5KYX A;  2F22 A;  3SXZ A;  1TFO B;  3EG9 B;  2L9J A;  4O7G A;  4E7Z A;  5F28 E;  1E83 A;  3DE9 A;  3H65 A;  1H9G A;  4YT8 A;  1QQ3 A;  4WAB A;  2LSE A;  3HNL A;  1ZU4 A;  4X0R A;  1E85 A;  1D0Z A;  3CAX A;  2J8W A;  2XS1 A;  1PV3 A;  2Q00 A;  1BBH A;  3L8J A;  2TMV P;  1WOL A;  3EG9 A;  4JCH A;  4DBR A;  5K0I A;  2R7U A;  2YLI A;  3C63 A;  3C7J A;  2DYS C;  3UGP A;  3U0C A;  1LE4 A;  3AJM A;  1VLS A;  2OQM A;  3GAN A;  3POV A;  5A6B D;  4DOZ A;  1DOV A;  4G7H F;  2HUJ A;  4JIO A;  1VB5 A;  3ZSU A;  3S9O A;  3QW0 A;  3Q6M A;  2R7R A;  4MVZ A;  3ZC4 A;  2Y39 A;  5DS6 A;  3LUT B;  3K1I A;  1OR2 A;  3IHU A;  4U5D E;  5E2Q A;  1TWC A;  4YN0 B;  5EHH A;  1EQ1 A;  2KQ9 A;  2Q4F A;  4KBL A;  4YL3 A;  2B0H A;  3NMK A;  2BE5 F;  1YZC A;  2KJG A;  2ETS A;  4MVO A;  2WVQ A;  3EHN A;  5A69 A;  1APC A;  3HLZ A;  4MVS A;  5A6A A;  2AU5 A;  2XLO A;  2MHR A;  4MVU A;  3VRC A;  1F1M A;  2DYR C;  1TFK B;  2YZS A;  4DRH B;  2L7A A;  4JUR I;  4D4N A;  4I1M A;  1I5N A;  2HV6 A;  4D4X A;  1VK5 A;  2XS8 A;  4K1O A;  2CCY A;  3SNH A;  3T4R A;  3ASO C;  4MND A;  3ZIB A;  4DRI B;  4DVZ A;  2LIG A;  1C03 A;  1GS9 A;  3H2V A;  4PJN A;  5IY5 C;  3C8G D;  3DAF A;  1C02 A;  1BR4 A;  3LNR A;  3OEO A;  1OKK A;  1U0B B;  2Q3T A;  1RXQ A;  3BRJ A;  2H7B A;  4IRU A;  4DVY P;  5L0D A;  1J8M F;  3M4C A;  4CS9 A;  4EUK B;  4CIP A;  2ZXP A;  4QI0 A;  5E3C A;  4JCZ A;  4O6N A;  2HJ3 A;  1WGW A;  2IBF A;  2Y3H A;  4ER9 A;  1SF8 A;  5L3V A;  3W2W A;  1MQV A;  1Q0G A;  3KPH A;  2R7W A;  2P6V A;  3S28 A;  3DXJ F;  1VTM P;  1ZU5 A;  2GA0 A;  3DAG A;  3JSZ A;  1VOM A;  2HV7 A;  4W8K A;  3J06 A;  1HY5 A;  3U2L A;  2KNH A;  1FFH A;  4I1O B;  2HJM A;  1MMD A;  1VYI A;  5BQG A;  3ABM C;  1T6Q A;  2LD6 A;  3RYL A;  5FZT A;  2CNW D;  2G3V A;  4U5C E;  3R7C A;  2LFD A;  3LS0 A;  2CYD A;  2L6H A;  2YEV A;  2OOC A;  1HMD A;  4Z9H A;  3ZTM A;  1PD1 A;  2L6F A;  3AQB A;  3SXM A;  3W4Y A;  1RJ9 A;  3S29 A;  2VC9 A;  1OXK A;  4XLN F;  5KYY B;  1FAP B;  5JVE A;  2EPK X;  2A68 F;  2YL0 A;  2XXA B;  1NBB A;  5A6J A;  2R25 A;  2P1A A;  1C17 M;  3ASN C;  4JRZ A;  1TWA A;  2EIJ C;  1T5O A;  4PAC A;  1M2V A;  3F47 A;  5COG A;  3OWT A;  5JP7 A;  1NU9 C;  4C3E A;  2ZPA A;  3DE8 A;  1NFO A;  2XLE A;  5KYY A;  1UG7 A;  2KSF A;  4I44 A;  4BEJ A;  2OCC C;  2XL4 A;  4Q4Z F;  1Q0D A;  1ORS C;  2C03 A;  3I4U A; 
#chains in the Genus database with same CATH homology
 3IPM O;  1YA7 O;  1FNT c;  1YAR O;  3JSE O;  1Z7Q c;  3JRM O;  1AVO B;  3JTL O;  1YAU O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...