1YAUO

Structure of archeabacterial 20s proteasome- pa26 complex
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
228
structure length
218
Chain Sequence
KRAALIQNLRDSYTETSSFAVIEEWAAGTLQEIEGIAKAAAEAHGVIRNSTYGRAQAEKSPEQLLGVLQRYQDLCHNVYCQAETIRTVIAIRIPEHKEEDNLGVAVQHAVLKIIDELEIKTLGSGEKSGSGGAPTPIGMYALREYLSARSTVEDKLLGGGSQSPSLLLELRQIDADFMLKVELATTHLSTMVRAVINAYLLNWKKLIQPRTGSDHMVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proteasome alpha subunit
publication title The 1.9 A structure of a proteasome-11S activator complex and implications for proteasome-PAN/PA700 interactions.
pubmed doi rcsb
source organism Thermoplasma acidophilum
molecule tags Hydrolase/hydrolase activator
total genus 82
structure length 218
sequence length 228
chains with identical sequence P, Q, R, S, T, U
ec nomenclature
pdb deposition date 2004-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF02252 PA28_beta Proteasome activator pa28 beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.180 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Proteasome activator pa28, C-terminal domain 1yauO01
1FNTc 3JSEO 3JTLO 3JRMO 1AVOB 1YA7O 1YARO 1YAUO 1Z7Qc 3IPMO
chains in the Genus database with same CATH superfamily
2VC9A 3H2VA 2R7SA 4BJ6A 1S05A 1VK5A 2IM8A 1OCZC 2EINC 2KJGA 3FDQA 2L9JA 1RKEB 3QVYA 4BPMA 1ORSC 2AVKA 3U2LA 2WVOA 4KI2A 3B71A 3KPHA 2XL8A 1I4ZA 3EJNA 3SYNA 1G4WR 4MTFA 3ZTZA 4CDAA 4JJGA 2V3CC 3G50A 2R7XA 3E70C 3E9VA 2A0BA 2EPOA 5BQIA 1N1CA 4N06A 4I1OB 1NFNA 1ZYRF 3C8GB 2XXAA 4CBEA 1EKYA 1YLMA 2YLGA 4AK9A 4ER9A 1SYQA 2KNHA 3KKBA 1LE2A 1VMAA 2UUIA 3G4ZA 4JEAA 1CGNA 1IW7F 4IB4A 4DVYP 2R7WA 1B68A 3H65A 1F1MA 5DVWA 1YJGA 2HUJA 5KYWA 4N6HA 2AP3A 2DGJA 2ZD9A 3TOMA 1GS9A 5F5FA 5L0DA 1YA7O 2KSFA 2IXPA 1MMAA 4LDQA 2R7QA 5F5HA 3RFYA 1O5HA 3AG3C 3X1OA 5A6JA 3L34A 4OIQF 1XZPA 3EHMA 5A6KA 4C7OB 3RW0A 1LPEA 2PX3A 2Y3GA 3W8IA 5KYYB 3T6GB 2Q4FA 1BR4A 2YEVA 3M15A 4YL3A 4BJ5A 2HSBA 4FWVA 4EWCA 3QVZA 2KW3C 3VYWA 1Z6AA 256BA 2CNWD 3EPVA 1Q0FA 4PACA 4MQ9F 3M1CB 4NTFA 2R7RA 2NUTB 3HJCA 4ZLCA 1HMOA 4BEMJ 3K1HA 3EGDB 3O39A 1C03A 3GM3A 4E0IA 1EA8A 2LQGA 1YVIA 2Y69C 2VB6A 4W8PA 4PJJA 1E85A 2WZFA 4AX2A 2Q7RA 5DQTA 1Z63A 3H2UA 1HE9A 2AWYA 2HMQA 2J0WA 4OD4A 1QLEC 2VCCA 2W4MA 4ULWA 4JKVA 3U2MA 4O7GA 5L3QA 3LS1A 3B9QA 1D1AA 4CS7A 2PP4A 5KYXA 4JE9A 1QSPA 2X51A 4I3MA 4L6RA 4NC3A 1U0BB 3L1MA 3S0XA 4G7ZF 4AL1A 1R4TA 1V55C 2O9XA 3JCUQ 4JURI 4Q4ZF 4CX9A 2ICWG 3QW1A 4YJWA 3VM6A 4ZLDA 3LESA 5E3CA 3V5XA 2WZGA 1WN0A 4JTAB 1Q0KA 4MVOA 2EPMX 1SF8A 2M64A 5L0GA 1OW7A 2QE9A 3LLIA 1PD1A 4DRIB 1J8MF 2C03A 5L0IA 1K40A 4WJ0A 4JCZA 1TWGA 3N24A 5IY5C 1H9GA 2YHSA 3RKOF 2KK1A 4CS8C 2A6HF 1WOLA 1C02A 3HNIA 3JSZA 3VF0A 4CSAC 5COGA 1TWHA 2PF4E 4IGGA 5E3AA 1WATA 4NY3A 1D0ZA 3KYIA 1TFOB 3S27A 4HEAJ 4DRHB 3PHF2 3ZTMA 2L6HA 3V5YA 3IHUA 1PD0A 3OA1A 4NCQA 5A6BA 2BC5A 2KGOA 3UMKA 3W8HA 1L3PA 4PK4A 1QVXA 3TOLA 5DS6A 2P61A 4HFKB 2XXAB 1M2VA 1BR2A 1VLSA 4IJJA 2HJMA 4KNWA 4DXWA 4EUKB 4H54A 4Q5SF 1U6HA 1ZHYA 3GEHA 4LLCA 1A0BA 3LEOA 4XLNF 1D0YA 3SNHA 4YWQA 5EGYA 4O6MA 1BDJB 1XZQA 1D1CA 2LFFA 3HNKA 4CDYA 2XLVA 5JLIA 5KYWB 2W4BA 2J0XA 5F28E 3AGUA 3I5PA 2F22A 2Z15A 2GWWA 3DXJF 3RQGA 5JRAA 3EZHA 1TQGA 3ZC4A 3K7DA 2I15A 3K1IA 2Y3HA 1MMDA 2Q3TA 3DJUB 3SP1A 3U9JA 2H7OA 1HW1A 2KYHA 3NYLA 3IQ6A 4Q7CA 1LI7A 3KYJA 1VTMP 2WZLA 2FAPB 1YZCA 1UG7A 2ZPAA 3EH2A 4OINF 3N0TA 3S9OA 4BG0A 4RDAA 1MNDA 2A6EF 5D91A 5BUOA 1Z7Qc 3UGOA 3FOPA 1ZVZA 3A11A 2WVQA 1HE1A 2R7TA 1YDIA 3B0VC 2YL0A 3NMIA 3BEHA 3RQEA 4GQHA 3S84A 1CGME 1ZW2A 3MFNA 3SXYA 2NSFA 3ABKC 5AC5A 5HV9A 2R7VA 2Q9AA 1ZW3A 2XSEA 1H9TA 5B3SC 2QTVA 3LLKA 5T3WA 4XEKA 2G3VA 4YK5A 4AE4A 3TULA 4XLPF 1NZEA 1OCCC 4HE8D 1JRAA 3F47A 2ASRA 3JYYA 3K66A 2W9YA 2XLEA 3PCVA 2HS5A 3O55A 5CIVA 5KYXB 1FTSA 2YWAA 4U5BE 4KC9A 1A7VA 2IXNA 3CAXA 4MNDA 4MW3A 3TD7A 3LJBA 4LDRA 2OOCA 5DLJA 3EFOA 2H7BA 1QQ3A 2G3KA 3V5ZA 1I5NA 3CZ6A 2XS1A 2FGYA 2CNWA 1YAUO 4KNVA 5T3TA 1TFKB 2J9WA 4OD5A 3DAFA 3Q7GA 4D4NA 4E18A 3GODA 1FMWA 1C17M 1LIHA 3I4UA 4YT5A 4MVSA 5TJ5E 3AG1C 3U9MA 4BJ1A 4CJGA 3RVZA 2IYLD 3FMSA 1Y6DA 4HFFB 4U9EA 2QLAA 2HMZA 1D1BA 4WABA 3S28A 1E86A 2E87A 2EPKX 4XPYA 2L81A 2OG2A 3C7JA 3QZCA 3NKDA 2NUPA 2OEXA 5K0IA 2G62A 3QMKA 3U0CA 4EHPA 3AJMA 2GAQA 3BRJA 1Z3IX 3T4RA 4JZAA 4MVZA 1M2VB 4GEHA 4EBJA 2ZXPA 3FAPB 5JUAA 3DKAA 2WB7A 3PMRA 1CPQA 1D0XA 2A0UA 5JP7A 1WWPA 4E7ZA 4CIPA 2YVKA 3DJNB 2QY9A 1Q0MA 2YLDA 4O6YA 2EIKC 2D5RB 1G4US 1MMNA 2MWQA 1MMGA 5FCLA 1RMVA 2ETSA 1ZHTA 3OWTA 4G0HA 2CCYA 1V74B 2L6FA 3HLZA 2QUPA 2ZXWC 3QW0A 1XWJA 2V26A 4JEBA 5A69A 2P0NA 4PJMA 4JVSA 3GWNA 3L8IA 3GEIA 5L3VA 4PFOA 5E2QA 1S7ZA 3IQ5A 4CS9A 1J8YF 1AVOB 5B3IA 2MHRA 3TJ6A 3W4YA 4M63A 3Q7LA 5L0HA 3A9CA 1FMVA 2IBFA 3T9OA 4XEVA 3JRMO 3V7OA 2CGEA 1YARO 2PNOA 3UMIA 2YZSA 3WG7C 4MTOA 1ZHWA 4MS2A 3RYLA 3NDBB 5T1DB 1Z23A 1ZHZA 3LUTB 3O10A 5AC4A 5DS5A 3GANA 3X2QC 3CQZA 2PX0A 4C3DA 2TMVP 3R2PA 3O6XA 4AL0A 3SXMA 4U5EE 4AE4B 5A6AA 4BJTA 2ZXRA 3K1IC 1YYJA 1NSGB 2GDCA 4YT2A 2WVNA 3FXHA 5HSWA 5BQGA 3GM1A 2DI3A 2R03A 3NG1A 1NU9C 2LD6A 1APCA 5KYUA 1VYKA 3L8JA 3IEEA 3AG2C 3L0IA 3EFOB 2XL4A 4FESA 5AGFA 1L7CA 2RSEB 3AOUA 3FAJA 1AUEA 3ZIBA 4EIYA 3TJ5A 3EH1A 1E2XA 1CPRA 1QKRA 1K05A 3LEVA 2XLOA 1V4AA 4ANJA 2J7PA 2PFDA 2VASA 2GA0A 2M4EA 3FOOA 2C04A 4U5DE 4BJ6C 4EBKA 3MBGA 5DS4A 3C18A 5CI9A 3TQOA 1T5OA 3IQTA 3RIPA 3DE9A 1G8XA 1RJ9A 5COFA 5D92A 1OR3A 2NSGA 2R7OA 2XLMA 3MYFA 1NG1A 1OKKD 2NUPB 1EQ1A 2Y3BA 4C7OA 1O87A 4P9FA 3I5QA 3ZQYA 3C8ZA 5L0FA 3DM9B 2HZ8A 1UFBA 3PDMP 3DI5A 2D4UA 2LP4A 2XRHA 2Y39A 3FHDA 1OR2A 4KBLA 5EHHA 3S90A 1VOMA 4UDVA 2LIGA 3J06A 1WGWA 4G78A 4XEFA 1ZZPA 2LK4A 3C8GD 2UUHA 4K0DA 3AQCA 4E7SA 3CSKA 4PJNA 2EPLX 4R32A 4JIOA 1KNYA 2YL7A 3U3FA 1SZIA 3JTLO 4C3BA 3U8PA 4D4XA 1A41A 4NTAA 1RKCA 2CW0F 4P9TA 2A1DD 2JD3A 2KC3A 2JX0A 3UMHA 1OW8A 1PCXA 4CDVA 2HFIA 1NFOA 4DRJB 4I1MA 4LLEA 4B6IA 4J30B 1LS4A 3R7CA 3RF3A 1AEPA 3ZQVA 5JSLA 2IXOA 1I4YA 4H4KC 4CS8A 1LE4A 2XM0A 4CSAA 1LKXA 2HV6A 2Q9CA 2EILC 1FFTC 1SMYF 2YQYA 5KYNA 4BJ5C 1O3UA 4DVZA 1M6TA 1DOVA 2R02A 4JJFA 3DMDA 3B29A 1OXKA 2DYRC 4FAPB 4O6NA 2XLHA 3JRTA 2RD9A 4OIRF 3SZRA 4GYTA 1JMWA 4P6IC 2H7VC 2NG1A 3ECSA 4WGZA 4G7OF 1JAFA 2B0JA 4IRUA 1E83A 2GFHA 2P6VA 2BL2A 1ORYA 1E84A 2OU6A 2HKVA 3EG9A 3UGPA 1JPNA 3QTHA 1NLXA 3WODF 1JPJA 4W8KA 3GM2A 2R25A 4MW8A 2IOQA 5BQHA 2DYSC 4CS9C 1TWAA 1RCPA 3HTKC 2HV7A 3ASOC 2ZXOA 3ASNC 3EGXA 1BBHA 2BE5F 4J7YA 5JS5A 5KYUB 3ABMC 3EHNA 1YYXA 1EI7A 4XPWA 4WGYA 1TR2A 4CJOA 3N2ZB 5DQZA 2A69F 1RXQA 3AG4C 3B0PA 1TKNA 3K33A 3NRHA 4U5GA 1A7DA 1FNTc 2R9RB 2YLIA 3JSEO 3RVYA 5JVEA 4PJLA 2J46A 1MNEA 3U3BA 4E0HA 2R7UA 3FVYA 3T6BA 3DE8A 3JYHA 4G7HF 4I44A 5JT4A 1GM5A 4MVUA 2VCBA 2YL1A 1RJ9B 4MVMA 2LSEA 3EZIA 3WAQA 1KTMA 3ZWIA 3ITFA 4XTKA 4MTGA 4NQFA 3IQCA 1NBBA 3G4XA 3IPMO 4JCHA 3C63A 1ZU5A 2FFHA 4FX5A 2VH3A 1JR8A 1R5ID 4ONSA 1V54C 2L6GA 2J9VA 1PV3A 4A4AA 2OJQA 1OCRC 1GQAA 3AGTA 3F46A 3LNMB 3M4BA 3NMJA 2OKUA 3HNLA 4Z9JA 2X0CA 2CYDA 3KMIA 4OIOF 3SEOA 1MQVA 3NMKA 4IWBA 4NTBA 3M79A 1T6UA 3ATPA 3KH2A 1T6QA 1VB5A 3T6JA 2AU5A 3TK0A 2OEVA 1OCOC 4C3EA 4QI2A 3ZDLA 2CDQA 1CGOA 1Q0GA 2J45A 2A68F 3DWWA 2J9BA 3Q6MA 2HJ3A 3UR3C 3SXZA 1GGQA 4BEJA 3LAYA 5EK0A 2JPUA 1OKKA 3KL4A 4O79A 1RKEA 1W2WA 4RD9A 2PBEA 3LS0A 3MX3A 3VRCA 4CIHA 4K7BA 3M4CA 2EPNA 4YN0B 4JTCB 4YL1A 2P1AA 4QI0A 4ULVA 2YKZA 4DBRA 3NYMA 3JT1A 4YT4A 2NPUA 2XS8A 3ZVRA 1WTYA 1T9KA 4PFPA 2EIMC 3C8GA 3CEXA 5B1AC 4DJ9A 2YRFA 4J32B 4DOZA 1LM3B 3RQFA 3EG9B 1FFHA 3DM5A 1QZXA 2Q9BA 1JOGA 2AWCA 3US6A 5CI8A 3GWLA 1OW6A 4JW1A 1TWCA 3WHNA 1G5ZA 5L0JA 2XM4A 1YZAA 1ZU4A 4DBQA 2P7VA 3EGXB 5COMA 4EKWA 1Z5ZA 2Y3DA 4LACB 4Z9HA 4A2NB 2Q00A 4YT8A 5L0CA 1HW2A 2OCCC 5B1BC 4OIPF 3B0UX 1ST6A 3MLGA 3HNJA 4Z9IA 1LVKA 4F4BA 2H8AA 2DB4A 3POVA 1U89A 1FR0A 1M56C 4E17A 5KYYA 3DZAA 1H7IA 1DOWA 4MVQA 1ZHXA 2EIJC 1BZ4A 3SXKA 4J7TA 1Q0DA 1SR2A 1QPUA 1T01A 3C62A 3DAGA 4IAQA 1HMDA 1YA9A 3Q6NA 4XQ1A 4XPXA 3VAYA 2NUTA 2LFDA 2WL8A 1M2OA 2J9UA 3EGDA 1OQCA 3JZ0A 3K6BA 4U5FE 1LI5A 2B0HA 4LERA 4YL0A 2OQMA 2XL6A 2W45A 4U5HA 3U5SA 3ZSUA 4X0RA 3DD7A 3EQLF 4U9DA 2QNLA 3LNRA 4JRZA 1HY5A 1A7EA 3OEOA 4N4WA 1ORJA 3W2VA 1VYIA 2IXMA 1NU7D 2KQ9A 3HKKA 4IARA 5E33A 2L7AA 1VLTA 3UNGC 5A6BD 4JTDB 3ABLC 1BR1A 2J8WA 3AQBA 3RH3A 3W2WA 1OXBA 1H6GA 2HSQA 3NYJA 1IZMA 4JC7A 4MVRA 2YL3A 5FZTA 4EBBA 1M57C 1WASA 5GPGB 2OJED 3S29A 1T6IA 2R05A 4K1OA 4N6CA 4RBNA 4IAOA 3NKEA 3U8VA 3GEEA 2J7PD 4U5CE 2VCAA 1FAPB 1K04A 1LS1A 2I8BA 4PR9A 4XWJA 3ZG1A 3GORA 2LCHA 4QDLA 2MYSA 4LDKA 3MYIA 1KU2A 2XLDA 1Y4CA 2XLWA
chains in the Genus database with same CATH topology
1FNTc 3JSEO 3JTLO 3JRMO 1AVOB 1YA7O 1YARO 1YAUO 1Z7Qc 3IPMO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FNT c;  3JSE O;  3JTL O;  3JRM O;  1AVO B;  1YA7 O;  1YAR O;  1YAU O;  1Z7Q c;  3IPM O; 
#chains in the Genus database with same CATH topology
 2VC9 A;  3H2V A;  2R7S A;  4BJ6 A;  1S05 A;  1VK5 A;  2IM8 A;  1OCZ C;  2EIN C;  2KJG A;  3FDQ A;  2L9J A;  1RKE B;  3QVY A;  4BPM A;  1ORS C;  2AVK A;  3U2L A;  2WVO A;  4KI2 A;  3B71 A;  3KPH A;  2XL8 A;  1I4Z A;  3EJN A;  3SYN A;  1G4W R;  4MTF A;  3ZTZ A;  4CDA A;  4JJG A;  2V3C C;  3G50 A;  2R7X A;  3E70 C;  3E9V A;  2A0B A;  2EPO A;  5BQI A;  1N1C A;  4N06 A;  4I1O B;  1NFN A;  1ZYR F;  3C8G B;  2XXA A;  4CBE A;  1EKY A;  1YLM A;  2YLG A;  4AK9 A;  4ER9 A;  1SYQ A;  2KNH A;  3KKB A;  1LE2 A;  1VMA A;  2UUI A;  3G4Z A;  4JEA A;  1CGN A;  1IW7 F;  4IB4 A;  4DVY P;  2R7W A;  1B68 A;  3H65 A;  1F1M A;  5DVW A;  1YJG A;  2HUJ A;  5KYW A;  4N6H A;  2AP3 A;  2DGJ A;  2ZD9 A;  3TOM A;  1GS9 A;  5F5F A;  5L0D A;  1YA7 O;  2KSF A;  2IXP A;  1MMA A;  4LDQ A;  2R7Q A;  5F5H A;  3RFY A;  1O5H A;  3AG3 C;  3X1O A;  5A6J A;  3L34 A;  4OIQ F;  1XZP A;  3EHM A;  5A6K A;  4C7O B;  3RW0 A;  1LPE A;  2PX3 A;  2Y3G A;  3W8I A;  5KYY B;  3T6G B;  2Q4F A;  1BR4 A;  2YEV A;  3M15 A;  4YL3 A;  4BJ5 A;  2HSB A;  4FWV A;  4EWC A;  3QVZ A;  2KW3 C;  3VYW A;  1Z6A A;  256B A;  2CNW D;  3EPV A;  1Q0F A;  4PAC A;  4MQ9 F;  3M1C B;  4NTF A;  2R7R A;  2NUT B;  3HJC A;  4ZLC A;  1HMO A;  4BEM J;  3K1H A;  3EGD B;  3O39 A;  1C03 A;  3GM3 A;  4E0I A;  1EA8 A;  2LQG A;  1YVI A;  2Y69 C;  2VB6 A;  4W8P A;  4PJJ A;  1E85 A;  2WZF A;  4AX2 A;  2Q7R A;  5DQT A;  1Z63 A;  3H2U A;  1HE9 A;  2AWY A;  2HMQ A;  2J0W A;  4OD4 A;  1QLE C;  2VCC A;  2W4M A;  4ULW A;  4JKV A;  3U2M A;  4O7G A;  5L3Q A;  3LS1 A;  3B9Q A;  1D1A A;  4CS7 A;  2PP4 A;  5KYX A;  4JE9 A;  1QSP A;  2X51 A;  4I3M A;  4L6R A;  4NC3 A;  1U0B B;  3L1M A;  3S0X A;  4G7Z F;  4AL1 A;  1R4T A;  1V55 C;  2O9X A;  3JCU Q;  4JUR I;  4Q4Z F;  4CX9 A;  2ICW G;  3QW1 A;  4YJW A;  3VM6 A;  4ZLD A;  3LES A;  5E3C A;  3V5X A;  2WZG A;  1WN0 A;  4JTA B;  1Q0K A;  4MVO A;  2EPM X;  1SF8 A;  2M64 A;  5L0G A;  1OW7 A;  2QE9 A;  3LLI A;  1PD1 A;  4DRI B;  1J8M F;  2C03 A;  5L0I A;  1K40 A;  4WJ0 A;  4JCZ A;  1TWG A;  3N24 A;  5IY5 C;  1H9G A;  2YHS A;  3RKO F;  2KK1 A;  4CS8 C;  2A6H F;  1WOL A;  1C02 A;  3HNI A;  3JSZ A;  3VF0 A;  4CSA C;  5COG A;  1TWH A;  2PF4 E;  4IGG A;  5E3A A;  1WAT A;  4NY3 A;  1D0Z A;  3KYI A;  1TFO B;  3S27 A;  4HEA J;  4DRH B;  3PHF 2;  3ZTM A;  2L6H A;  3V5Y A;  3IHU A;  1PD0 A;  3OA1 A;  4NCQ A;  5A6B A;  2BC5 A;  2KGO A;  3UMK A;  3W8H A;  1L3P A;  4PK4 A;  1QVX A;  3TOL A;  5DS6 A;  2P61 A;  4HFK B;  2XXA B;  1M2V A;  1BR2 A;  1VLS A;  4IJJ A;  2HJM A;  4KNW A;  4DXW A;  4EUK B;  4H54 A;  4Q5S F;  1U6H A;  1ZHY A;  3GEH A;  4LLC A;  1A0B A;  3LEO A;  4XLN F;  1D0Y A;  3SNH A;  4YWQ A;  5EGY A;  4O6M A;  1BDJ B;  1XZQ A;  1D1C A;  2LFF A;  3HNK A;  4CDY A;  2XLV A;  5JLI A;  5KYW B;  2W4B A;  2J0X A;  5F28 E;  3AGU A;  3I5P A;  2F22 A;  2Z15 A;  2GWW A;  3DXJ F;  3RQG A;  5JRA A;  3EZH A;  1TQG A;  3ZC4 A;  3K7D A;  2I15 A;  3K1I A;  2Y3H A;  1MMD A;  2Q3T A;  3DJU B;  3SP1 A;  3U9J A;  2H7O A;  1HW1 A;  2KYH A;  3NYL A;  3IQ6 A;  4Q7C A;  1LI7 A;  3KYJ A;  1VTM P;  2WZL A;  2FAP B;  1YZC A;  1UG7 A;  2ZPA A;  3EH2 A;  4OIN F;  3N0T A;  3S9O A;  4BG0 A;  4RDA A;  1MND A;  2A6E F;  5D91 A;  5BUO A;  1Z7Q c;  3UGO A;  3FOP A;  1ZVZ A;  3A11 A;  2WVQ A;  1HE1 A;  2R7T A;  1YDI A;  3B0V C;  2YL0 A;  3NMI A;  3BEH A;  3RQE A;  4GQH A;  3S84 A;  1CGM E;  1ZW2 A;  3MFN A;  3SXY A;  2NSF A;  3ABK C;  5AC5 A;  5HV9 A;  2R7V A;  2Q9A A;  1ZW3 A;  2XSE A;  1H9T A;  5B3S C;  2QTV A;  3LLK A;  5T3W A;  4XEK A;  2G3V A;  4YK5 A;  4AE4 A;  3TUL A;  4XLP F;  1NZE A;  1OCC C;  4HE8 D;  1JRA A;  3F47 A;  2ASR A;  3JYY A;  3K66 A;  2W9Y A;  2XLE A;  3PCV A;  2HS5 A;  3O55 A;  5CIV A;  5KYX B;  1FTS A;  2YWA A;  4U5B E;  4KC9 A;  1A7V A;  2IXN A;  3CAX A;  4MND A;  4MW3 A;  3TD7 A;  3LJB A;  4LDR A;  2OOC A;  5DLJ A;  3EFO A;  2H7B A;  1QQ3 A;  2G3K A;  3V5Z A;  1I5N A;  3CZ6 A;  2XS1 A;  2FGY A;  2CNW A;  1YAU O;  4KNV A;  5T3T A;  1TFK B;  2J9W A;  4OD5 A;  3DAF A;  3Q7G A;  4D4N A;  4E18 A;  3GOD A;  1FMW A;  1C17 M;  1LIH A;  3I4U A;  4YT5 A;  4MVS A;  5TJ5 E;  3AG1 C;  3U9M A;  4BJ1 A;  4CJG A;  3RVZ A;  2IYL D;  3FMS A;  1Y6D A;  4HFF B;  4U9E A;  2QLA A;  2HMZ A;  1D1B A;  4WAB A;  3S28 A;  1E86 A;  2E87 A;  2EPK X;  4XPY A;  2L81 A;  2OG2 A;  3C7J A;  3QZC A;  3NKD A;  2NUP A;  2OEX A;  5K0I A;  2G62 A;  3QMK A;  3U0C A;  4EHP A;  3AJM A;  2GAQ A;  3BRJ A;  1Z3I X;  3T4R A;  4JZA A;  4MVZ A;  1M2V B;  4GEH A;  4EBJ A;  2ZXP A;  3FAP B;  5JUA A;  3DKA A;  2WB7 A;  3PMR A;  1CPQ A;  1D0X A;  2A0U A;  5JP7 A;  1WWP A;  4E7Z A;  4CIP A;  2YVK A;  3DJN B;  2QY9 A;  1Q0M A;  2YLD A;  4O6Y A;  2EIK C;  2D5R B;  1G4U S;  1MMN A;  2MWQ A;  1MMG A;  5FCL A;  1RMV A;  2ETS A;  1ZHT A;  3OWT A;  4G0H A;  2CCY A;  1V74 B;  2L6F A;  3HLZ A;  2QUP A;  2ZXW C;  3QW0 A;  1XWJ A;  2V26 A;  4JEB A;  5A69 A;  2P0N A;  4PJM A;  4JVS A;  3GWN A;  3L8I A;  3GEI A;  5L3V A;  4PFO A;  5E2Q A;  1S7Z A;  3IQ5 A;  4CS9 A;  1J8Y F;  1AVO B;  5B3I A;  2MHR A;  3TJ6 A;  3W4Y A;  4M63 A;  3Q7L A;  5L0H A;  3A9C A;  1FMV A;  2IBF A;  3T9O A;  4XEV A;  3JRM O;  3V7O A;  2CGE A;  1YAR O;  2PNO A;  3UMI A;  2YZS A;  3WG7 C;  4MTO A;  1ZHW A;  4MS2 A;  3RYL A;  3NDB B;  5T1D B;  1Z23 A;  1ZHZ A;  3LUT B;  3O10 A;  5AC4 A;  5DS5 A;  3GAN A;  3X2Q C;  3CQZ A;  2PX0 A;  4C3D A;  2TMV P;  3R2P A;  3O6X A;  4AL0 A;  3SXM A;  4U5E E;  4AE4 B;  5A6A A;  4BJT A;  2ZXR A;  3K1I C;  1YYJ A;  1NSG B;  2GDC A;  4YT2 A;  2WVN A;  3FXH A;  5HSW A;  5BQG A;  3GM1 A;  2DI3 A;  2R03 A;  3NG1 A;  1NU9 C;  2LD6 A;  1APC A;  5KYU A;  1VYK A;  3L8J A;  3IEE A;  3AG2 C;  3L0I A;  3EFO B;  2XL4 A;  4FES A;  5AGF A;  1L7C A;  2RSE B;  3AOU A;  3FAJ A;  1AUE A;  3ZIB A;  4EIY A;  3TJ5 A;  3EH1 A;  1E2X A;  1CPR A;  1QKR A;  1K05 A;  3LEV A;  2XLO A;  1V4A A;  4ANJ A;  2J7P A;  2PFD A;  2VAS A;  2GA0 A;  2M4E A;  3FOO A;  2C04 A;  4U5D E;  4BJ6 C;  4EBK A;  3MBG A;  5DS4 A;  3C18 A;  5CI9 A;  3TQO A;  1T5O A;  3IQT A;  3RIP A;  3DE9 A;  1G8X A;  1RJ9 A;  5COF A;  5D92 A;  1OR3 A;  2NSG A;  2R7O A;  2XLM A;  3MYF A;  1NG1 A;  1OKK D;  2NUP B;  1EQ1 A;  2Y3B A;  4C7O A;  1O87 A;  4P9F A;  3I5Q A;  3ZQY A;  3C8Z A;  5L0F A;  3DM9 B;  2HZ8 A;  1UFB A;  3PDM P;  3DI5 A;  2D4U A;  2LP4 A;  2XRH A;  2Y39 A;  3FHD A;  1OR2 A;  4KBL A;  5EHH A;  3S90 A;  1VOM A;  4UDV A;  2LIG A;  3J06 A;  1WGW A;  4G78 A;  4XEF A;  1ZZP A;  2LK4 A;  3C8G D;  2UUH A;  4K0D A;  3AQC A;  4E7S A;  3CSK A;  4PJN A;  2EPL X;  4R32 A;  4JIO A;  1KNY A;  2YL7 A;  3U3F A;  1SZI A;  3JTL O;  4C3B A;  3U8P A;  4D4X A;  1A41 A;  4NTA A;  1RKC A;  2CW0 F;  4P9T A;  2A1D D;  2JD3 A;  2KC3 A;  2JX0 A;  3UMH A;  1OW8 A;  1PCX A;  4CDV A;  2HFI A;  1NFO A;  4DRJ B;  4I1M A;  4LLE A;  4B6I A;  4J30 B;  1LS4 A;  3R7C A;  3RF3 A;  1AEP A;  3ZQV A;  5JSL A;  2IXO A;  1I4Y A;  4H4K C;  4CS8 A;  1LE4 A;  2XM0 A;  4CSA A;  1LKX A;  2HV6 A;  2Q9C A;  2EIL C;  1FFT C;  1SMY F;  2YQY A;  5KYN A;  4BJ5 C;  1O3U A;  4DVZ A;  1M6T A;  1DOV A;  2R02 A;  4JJF A;  3DMD A;  3B29 A;  1OXK A;  2DYR C;  4FAP B;  4O6N A;  2XLH A;  3JRT A;  2RD9 A;  4OIR F;  3SZR A;  4GYT A;  1JMW A;  4P6I C;  2H7V C;  2NG1 A;  3ECS A;  4WGZ A;  4G7O F;  1JAF A;  2B0J A;  4IRU A;  1E83 A;  2GFH A;  2P6V A;  2BL2 A;  1ORY A;  1E84 A;  2OU6 A;  2HKV A;  3EG9 A;  3UGP A;  1JPN A;  3QTH A;  1NLX A;  3WOD F;  1JPJ A;  4W8K A;  3GM2 A;  2R25 A;  4MW8 A;  2IOQ A;  5BQH A;  2DYS C;  4CS9 C;  1TWA A;  1RCP A;  3HTK C;  2HV7 A;  3ASO C;  2ZXO A;  3ASN C;  3EGX A;  1BBH A;  2BE5 F;  4J7Y A;  5JS5 A;  5KYU B;  3ABM C;  3EHN A;  1YYX A;  1EI7 A;  4XPW A;  4WGY A;  1TR2 A;  4CJO A;  3N2Z B;  5DQZ A;  2A69 F;  1RXQ A;  3AG4 C;  3B0P A;  1TKN A;  3K33 A;  3NRH A;  4U5G A;  1A7D A;  1FNT c;  2R9R B;  2YLI A;  3JSE O;  3RVY A;  5JVE A;  4PJL A;  2J46 A;  1MNE A;  3U3B A;  4E0H A;  2R7U A;  3FVY A;  3T6B A;  3DE8 A;  3JYH A;  4G7H F;  4I44 A;  5JT4 A;  1GM5 A;  4MVU A;  2VCB A;  2YL1 A;  1RJ9 B;  4MVM A;  2LSE A;  3EZI A;  3WAQ A;  1KTM A;  3ZWI A;  3ITF A;  4XTK A;  4MTG A;  4NQF A;  3IQC A;  1NBB A;  3G4X A;  3IPM O;  4JCH A;  3C63 A;  1ZU5 A;  2FFH A;  4FX5 A;  2VH3 A;  1JR8 A;  1R5I D;  4ONS A;  1V54 C;  2L6G A;  2J9V A;  1PV3 A;  4A4A A;  2OJQ A;  1OCR C;  1GQA A;  3AGT A;  3F46 A;  3LNM B;  3M4B A;  3NMJ A;  2OKU A;  3HNL A;  4Z9J A;  2X0C A;  2CYD A;  3KMI A;  4OIO F;  3SEO A;  1MQV A;  3NMK A;  4IWB A;  4NTB A;  3M79 A;  1T6U A;  3ATP A;  3KH2 A;  1T6Q A;  1VB5 A;  3T6J A;  2AU5 A;  3TK0 A;  2OEV A;  1OCO C;  4C3E A;  4QI2 A;  3ZDL A;  2CDQ A;  1CGO A;  1Q0G A;  2J45 A;  2A68 F;  3DWW A;  2J9B A;  3Q6M A;  2HJ3 A;  3UR3 C;  3SXZ A;  1GGQ A;  4BEJ A;  3LAY A;  5EK0 A;  2JPU A;  1OKK A;  3KL4 A;  4O79 A;  1RKE A;  1W2W A;  4RD9 A;  2PBE A;  3LS0 A;  3MX3 A;  3VRC A;  4CIH A;  4K7B A;  3M4C A;  2EPN A;  4YN0 B;  4JTC B;  4YL1 A;  2P1A A;  4QI0 A;  4ULV A;  2YKZ A;  4DBR A;  3NYM A;  3JT1 A;  4YT4 A;  2NPU A;  2XS8 A;  3ZVR A;  1WTY A;  1T9K A;  4PFP A;  2EIM C;  3C8G A;  3CEX A;  5B1A C;  4DJ9 A;  2YRF A;  4J32 B;  4DOZ A;  1LM3 B;  3RQF A;  3EG9 B;  1FFH A;  3DM5 A;  1QZX A;  2Q9B A;  1JOG A;  2AWC A;  3US6 A;  5CI8 A;  3GWL A;  1OW6 A;  4JW1 A;  1TWC A;  3WHN A;  1G5Z A;  5L0J A;  2XM4 A;  1YZA A;  1ZU4 A;  4DBQ A;  2P7V A;  3EGX B;  5COM A;  4EKW A;  1Z5Z A;  2Y3D A;  4LAC B;  4Z9H A;  4A2N B;  2Q00 A;  4YT8 A;  5L0C A;  1HW2 A;  2OCC C;  5B1B C;  4OIP F;  3B0U X;  1ST6 A;  3MLG A;  3HNJ A;  4Z9I A;  1LVK A;  4F4B A;  2H8A A;  2DB4 A;  3POV A;  1U89 A;  1FR0 A;  1M56 C;  4E17 A;  5KYY A;  3DZA A;  1H7I A;  1DOW A;  4MVQ A;  1ZHX A;  2EIJ C;  1BZ4 A;  3SXK A;  4J7T A;  1Q0D A;  1SR2 A;  1QPU A;  1T01 A;  3C62 A;  3DAG A;  4IAQ A;  1HMD A;  1YA9 A;  3Q6N A;  4XQ1 A;  4XPX A;  3VAY A;  2NUT A;  2LFD A;  2WL8 A;  1M2O A;  2J9U A;  3EGD A;  1OQC A;  3JZ0 A;  3K6B A;  4U5F E;  1LI5 A;  2B0H A;  4LER A;  4YL0 A;  2OQM A;  2XL6 A;  2W45 A;  4U5H A;  3U5S A;  3ZSU A;  4X0R A;  3DD7 A;  3EQL F;  4U9D A;  2QNL A;  3LNR A;  4JRZ A;  1HY5 A;  1A7E A;  3OEO A;  4N4W A;  1ORJ A;  3W2V A;  1VYI A;  2IXM A;  1NU7 D;  2KQ9 A;  3HKK A;  4IAR A;  5E33 A;  2L7A A;  1VLT A;  3UNG C;  5A6B D;  4JTD B;  3ABL C;  1BR1 A;  2J8W A;  3AQB A;  3RH3 A;  3W2W A;  1OXB A;  1H6G A;  2HSQ A;  3NYJ A;  1IZM A;  4JC7 A;  4MVR A;  2YL3 A;  5FZT A;  4EBB A;  1M57 C;  1WAS A;  5GPG B;  2OJE D;  3S29 A;  1T6I A;  2R05 A;  4K1O A;  4N6C A;  4RBN A;  4IAO A;  3NKE A;  3U8V A;  3GEE A;  2J7P D;  4U5C E;  2VCA A;  1FAP B;  1K04 A;  1LS1 A;  2I8B A;  4PR9 A;  4XWJ A;  3ZG1 A;  3GOR A;  2LCH A;  4QDL A;  2MYS A;  4LDK A;  3MYI A;  1KU2 A;  2XLD A;  1Y4C A;  2XLW A; 
#chains in the Genus database with same CATH homology
 1FNT c;  3JSE O;  3JTL O;  3JRM O;  1AVO B;  1YA7 O;  1YAR O;  1YAU O;  1Z7Q c;  3IPM O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...