1YAUO

Structure of archeabacterial 20s proteasome- pa26 complex
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
228
structure length
218
Chain Sequence
KRAALIQNLRDSYTETSSFAVIEEWAAGTLQEIEGIAKAAAEAHGVIRNSTYGRAQAEKSPEQLLGVLQRYQDLCHNVYCQAETIRTVIAIRIPEHKEEDNLGVAVQHAVLKIIDELEIKTLGSGEKSGSGGAPTPIGMYALREYLSARSTVEDKLLGGGSQSPSLLLELRQIDADFMLKVELATTHLSTMVRAVINAYLLNWKKLIQPRTGSDHMVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proteasome alpha subunit
publication title The 1.9 A structure of a proteasome-11S activator complex and implications for proteasome-PAN/PA700 interactions.
pubmed doi rcsb
source organism Thermoplasma acidophilum
molecule tags Hydrolase/hydrolase activator
total genus 82
structure length 218
sequence length 228
chains with identical sequence P, Q, R, S, T, U
ec nomenclature
pdb deposition date 2004-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF02252 PA28_beta Proteasome activator pa28 beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.180 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Proteasome activator pa28, C-terminal domain 1yauO01
1YAUO 3JRMO 1AVOB 1Z7Qc 3IPMO 1FNTc 1YA7O 3JTLO 3JSEO 1YARO
chains in the Genus database with same CATH superfamily
1PCXA 2Y3GA 1TWCA 4BG0A 2L7AA 1T9KA 2EPKX 4LDQA 4X0RA 4CJGA 3DE9A 3QZCA 5KYYB 4J32B 4CSAC 4IWBA 5AC5A 3RIPA 2XXAB 5L3QA 4B6IA 2KK1A 4C7OA 3H2UA 3FDQA 4YWQA 3B9QA 3HNKA 1JR8A 4DRIB 3IPMO 5L0IA 5JUAA 1FNTc 3O10A 4BJ5C 3SZRA 4DXWA 2ZXOA 3GEHA 3ZVRA 2HMZA 2A68F 3F46A 5EGYA 3FAJA 5KYWA 1MMDA 2YLDA 1TQGA 3GWNA 3I5PA 3U9MA 1MNDA 1CGOA 4J7YA 3NKEA 4LDKA 5DVWA 4ER9A 4JTCB 1GS9A 4RDAA 5A6BA 2OG2A 1M2VA 1Z23A 2PFDA 4JTDB 3ABMC 4PJJA 2VB6A 1VB5A 2WB7A 4IB4A 5CI8A 3UGPA 2QLAA 2M64A 3HKKA 3M4BA 4CSAA 2B0JA 2W45A 3HNLA 3ZSUA 5DQTA 3C63A 5A6BD 2LSEA 4JIOA 4N6HA 2AWCA 3IQCA 3U5SA 3GM2A 5DS4A 4OIRF 4CDAA 3QVZA 4FESA 4BJ5A 1EQ1A 1OXBA 4OIOF 1GGQA 4CIPA 3EZIA 4GQHA 1D1BA 3C8ZA 2Q9AA 3TULA 5EK0A 3LNRA 2ZPAA 1DOVA 4IAQA 4JE9A 4NCQA 2ZXWC 3C8GA 3FAPB 1ZHZA 3KKBA 3QTHA 1VYKA 1K05A 4OD4A 2Q3TA 4P9TA 2DB4A 5KYUB 4U5CE 3U0CA 5D91A 3EGXB 4H4KC 4Q4ZF 2HJMA 1XZPA 2HKVA 3ZC4A 3KH2A 1K04A 3C8GD 3JYYA 4XWJA 3ITFA 4XPXA 2QE9A 2YEVA 4AL1A 2KGOA 4JVSA 2KJGA 2R7OA 2A1DD 4JEAA 4XPYA 2XXAA 3U2MA 3EGDB 3U8PA 2XL6A 4MTFA 3RF3A 3EH2A 3AQBA 5JP7A 2V26A 1HY5A 3RFYA 2XL4A 3CAXA 5KYNA 4G7OF 1G4US 3U9JA 2DGJA 3ZWIA 1OCRC 2AVKA 1JAFA 3C62A 1H9GA 3JTLO 4MTOA 1NZEA 2G3VA 1ZW3A 1YZCA 5L0FA 3DAFA 3MYFA 3OA1A 4J7TA 4N06A 2KSFA 4U5HA 2EPLX 1YDIA 2P61A 4EBBA 3L0IA 4G0HA 4JKVA 1ZHXA 3FHDA 3JCUQ 5B1BC 4C3EA 1Z6AA 3AGUA 4C7OB 2Q7RA 1E86A 4W8KA 3DJNB 3GM1A 4PFOA 2WZFA 2CW0F 2HJ3A 4O6NA 4YJWA 1TWAA 1Z63A 3N0TA 5K0IA 4HFFB 3GODA 3GM3A 2YLGA 3U3FA 3PDMP 1YZAA 2R7WA 5KYWB 1LM3B 4O6MA 1JRAA 4QI2A 4GYTA 2VC9A 4BJ6C 2L81A 1OCOC 1TWGA 1ZU4A 4JURI 1D0YA 2ZXRA 3AG2C 3DJUB 2HV6A 1M2VB 1LPEA 2GA0A 5E33A 3G4XA 2DYRC 3DM9B 3SXZA 5COFA 3ZDLA 4EHPA 4MVOA 3W2WA 4QDLA 1LIHA 4MW8A 2I15A 1FFTC 1NU9C 1L7CA 2Y3BA 2ICWG 3EGXA 2VH3A 4YN0B 3ABKC 1D0ZA 1Z7Qc 4CDYA 3LUTB 1RKEB 3DAGA 3L8IA 3G50A 5IY5C 2HSBA 4HFKB 5HSWA 2KC3A 4N4WA 1PD1A 5BQGA 2HUJA 1LE2A 1ORYA 2MWQA 5JRAA 2HMQA 4JTAB 2JD3A 3QW1A 4MVZA 2B0HA 3IEEA 3AGTA 1QVXA 4CS7A 1LVKA 2HV7A 2JPUA 4JJFA 3K66A 3C8GB 3GEEA 4XQ1A 1FAPB 1ZZPA 4BJ6A 3POVA 1J8MF 2BL2A 2M4EA 4L6RA 3RQFA 2WVOA 4DOZA 4R32A 3BEHA 3M79A 1SR2A 3MFNA 4MQ9F 4XLPF 2EINC 2XLEA 1EA8A 4A2NB 2EIKC 3RH3A 4KNWA 2IOQA 2WZGA 4H54A 5AGFA 4OIPF 1VK5A 4JEBA 1NSGB 1WWPA 2XS8A 4K0DA 1T6QA 4CS8A 3Q6MA 4ULVA 4LLCA 2F22A 2PNOA 2OEXA 2Y39A 3LESA 4F4BA 1U0BB 1RJ9A 4Z9JA 3TK0A 4E7ZA 5FCLA 1ZYRF 5JS5A 3RW0A 3IQ6A 1FFHA 4FX5A 3SXMA 5HV9A 2LP4A 3CEXA 2CGEA 2NUTB 4XPWA 3M1CB 1QKRA 1C02A 3S9OA 3NMKA 1H7IA 2NG1A 2VASA 3A11A 5T3WA 3ASOC 2W4BA 1AVOB 1FTSA 3EQLF 1AUEA 2VCAA 1QQ3A 1C17M 2VCBA 2YL0A 3AJMA 4HEAJ 4NQFA 4U5EE 1A41A 4I1MA 4AE4B 2Q00A 3ZQVA 2RSEB 1SMYF 1U6HA 1RXQA 2EIJC 2AWYA 2HS5A 2J9VA 5B1AC 2UUHA 3AQCA 2EPMX 1AEPA 2WVNA 2YKZA 3T6JA 2OJQA 2XLDA 2OJED 2YL3A 3FOPA 1Z3IX 3UR3C 1HW1A 2YHSA 4CBEA 4K1OA 4MVRA 3TD7A 5L0CA 3KPHA 3NMIA 2P1AA 5A6AA 2YWAA 3RYLA 3LEOA 1RKEA 4U5BE 2XM4A 4D4XA 3G4ZA 5L0HA 2XM0A 4U9EA 1YVIA 4KC9A 3TQOA 2MYSA 3R2PA 1T5OA 1I5NA 1WTYA 2OCCC 3ASNC 3S29A 2Q9CA 2XRHA 2LQGA 3OWTA 1BBHA 2XLVA 5L0DA 4O7GA 3VYWA 1OR3A 2LK4A 3SYNA 1JMWA 2NSFA 1XZQA 4PJMA 2Q4FA 3T9OA 1G8XA 1SZIA 5BQIA 4KNVA 4IGGA 3U8VA 3H2VA 3VM6A 1GM5A 3L1MA 4OD5A 2A0UA 5EHHA 2Y3DA 3L34A 1Q0KA 4XEVA 1OQCA 2GDCA 4MVMA 2BE5F 4YT2A 1E2XA 4AK9A 4M63A 4DBRA 2PP4A 3UNGC 2NUPB 3O39A 5T3TA 1YJGA 2Y69C 4BEJA 2H8AA 5AC4A 5E3AA 1EI7A 3PCVA 2AU5A 4EIYA 1JPJA 1Q0GA 4OINF 1MQVA 1QLEC 4IJJA 4WABA 3R7CA 2R7VA 4XLNF 4O79A 2L6FA 4UDVA 1Y6DA 3JYHA 3DD7A 5COGA 3HLZA 2XLWA 3JRMO 3KMIA 2NPUA 2NUTA 1OW6A 3DZAA 5FZTA 3UMHA 1EKYA 2LFDA 5KYXA 3EHNA 1APCA 2J0WA 1A7VA 1HMDA 1YARO 5CIVA 4YL3A 2WVQA 4AE4A 5BQHA 1OCZC 1E85A 3S28A 3N24A 4Z9IA 1YYJA 3JZ0A 3KYIA 4YL0A 3TOMA 5F5HA 1E84A 1RJ9B 4DJ9A 3S84A 1SF8A 3V5YA 3ZTZA 1OXKA 3GEIA 3K6BA 3RQEA 1H6GA 2R05A 2FGYA 2A6HF 2YZSA 4I44A 4LLEA 4E0IA 3H65A 3FXHA 3Q7GA 5DQZA 3V5ZA 1BR2A 1YA9A 3JRTA 4JW1A 3WG7C 4DVZA 1V4AA 4YL1A 4CIHA 1YLMA 3ATPA 3MBGA 2OEVA 1MMNA 2KQ9A 3N2ZB 4JCHA 4XEKA 3FVYA 2GAQA 3DMDA 3EPVA 2R7RA 1FR0A 1TFOB 1CGNA 3L8JA 5L3VA 5BUOA 1CPQA 4PJNA 4BEMJ 4MS2A 4N6CA 1NFOA 1R4TA 1MNEA 1JOGA 1VMAA 1TWHA 4MVQA 4XEFA 3T6BA 2LFFA 3NYLA 2ASRA 2Q9BA 4IAOA 4EBKA 1M56C 4C3DA 2LCHA 4W8PA 4PFPA 5JVEA 3NMJA 5E3CA 3UMIA 2KNHA 3X1OA 2H7BA 1H9TA 3NG1A 3E70C 2O9XA 2NUPA 4BJ1A 3KL4A 2J9WA 2EILC 1OW8A 3MLGA 1HE1A 4IRUA 3ABLC 2CYDA 1XWJA 1ZHWA 1M57C 3SXKA 1F1MA 3RQGA 2YRFA 4U5FE 2IXMA 2YL7A 3F47A 4PJLA 1M2OA 3W4YA 4C3BA 2HFIA 5F5FA 2L6GA 3DKAA 2PX0A 1E83A 2R7QA 3HJCA 3AOUA 4PACA 2P0NA 3EJNA 3JT1A 1C03A 2R7SA 1DOWA 1NFNA 1ZW2A 3QW0A 4GEHA 5COMA 3T4RA 5A69A 2YQYA 1S05A 1WOLA 2FFHA 1ST6A 2QUPA 3OEOA 4U5DE 4WGYA 4XTKA 3V7OA 1UFBA 1YAUO 2R7UA 1HE9A 2W9YA 3GORA 2XLHA 4K7BA 2QNLA 4I3MA 4JRZA 3HNJA 2E87A 3HNIA 4O6YA 1K40A 2MHRA 1Q0FA 2YLIA 4DBQA 3ZG1A 2DI3A 1MMAA 3AG4C 2GWWA 1V55C 5DS6A 2PBEA 4E18A 4KI2A 2G3KA 1LI5A 1V54C 1A0BA 1N1CA 1LS4A 2R02A 4AX2A 1I4YA 2A69F 5A6KA 5KYXB 3PHF2 5DS5A 1R5ID 4YT5A 3B0UX 1A7DA 3ZQYA 2C03A 3WAQA 2Z15A 1QPUA 1BZ4A 1Z5ZA 2IBFA 3DM5A 3LLKA 4E17A 3PMRA 1ZHTA 3C18A 3TJ6A 3EG9A 2CCYA 3CSKA 1M6TA 4ZLDA 2D4UA 3EFOA 4ZLCA 1BDJB 1VTMP 2VCCA 2BC5A 1KNYA 4G7ZF 1T6UA 1V74B 1FMVA 2J8WA 2A6EF 2J9BA 5DLJA 1OR2A 3DWWA 4U5GA 1J8YF 1ORJA 4NTFA 4ONSA 3V5XA 2J7PA 3X2QC 3J06A 1W2WA 1Y4CA 3LAYA 2JX0A 2ZD9A 3B71A 2PX3A 2EPOA 3SXYA 1YYXA 3LEVA 3US6A 3ZTMA 3QMKA 4LERA 5E2QA 3IQTA 2HZ8A 1OKKA 4QI0A 3Q7LA 1SYQA 2J7PD 1VLSA 3AG3C 4D4NA 1KTMA 1D0XA 3DXJF 3C7JA 1YA7O 3LS1A 2XS1A 2IM8A 1G4WR 3CZ6A 1LE4A 1OKKD 1D1CA 2XSEA 1I4ZA 4BPMA 4CDVA 1RKCA 1WN0A 2KW3C 3W2VA 4MVSA 4EUKB 2IXOA 1T6IA 1WATA 4AL0A 2L9JA 2I8BA 2G62A 5L0GA 1G5ZA 1OCCC 1A7EA 1L3PA 1WGWA 3WODF 3LJBA 4Q7CA 3NYMA 3I5QA 3S0XA 1LI7A 1Q0DA 4YK5A 4DVYP 1TKNA 5A6JA 1U89A 3EHMA 2J46A 4P6IC 5JLIA 3K7DA 3MYIA 5L0JA 2J0XA 3VF0A 4CS8C 2DYSC 2LD6A 1IW7F 3GANA 2W4MA 3HTKC 3NKDA 1ZU5A 3I4UA 1QZXA 3KYJA 4Q5SF 4JZAA 1RMVA 5CI9A 3A9CA 4EBJA 4LACB 2QTVA 3BRJA 2RD9A 3ECSA 3FOOA 3T6GB 3NYJA 1OW7A 4CJOA 3EH1A 2ZXPA 2UUIA 2R7XA 2YVKA 4WGZA 5KYYA 5JSLA 3NDBB 2QY9A 4JJGA 2IXPA 3O55A 4MVUA 3RVZA 3SP1A 4BJTA 2LIGA 3DE8A 4RBNA 4DRJB 5D92A 3K33A 4E0HA 1JPNA 3NRHA 2OU6A 4NTAA 1NU7D 3EZHA 4PK4A 4LDRA 3DI5A 2J9UA 5GPGB 4CX9A 4J30B 4KBLA 2P7VA 1WASA 3IQ5A 2R7TA 4WJ0A 1VLTA 2XLMA 4G78A 1BR4A 3UGOA 3EG9B 2CDQA 2H7OA 1BR1A 3K1HA 3EFOB 3U3BA 4PR9A 3CQZA 3U2LA 1KU2A 3S90A 1UG7A 1S7ZA 2KYHA 3Q6NA 1PV3A 2TMVP 3TJ5A 2D5RB 2OQMA 4I1OB 4JC7A 4JCZA 3FMSA 4OIQF 4FAPB 1CPRA 4HE8D 2L6HA 1LKXA 2HSQA 1B68A 1VYIA 3RKOF 1RCPA 4NY3A 4P9FA 2H7VC 2IXNA 1O3UA 3ZIBA 4G7HF 1IZMA 2WL8A 3B29A 2OOCA 2OKUA 5T1DB 4DRHB 3E9VA 4CS9C 4MW3A 3K1IC 3LLIA 2PF4E 5B3SC 1CGME 3TOLA 2V3CC 3LS0A 3QVYA 256BA 1ORSC 3GWLA 1PD0A 3UMKA 1LS1A 1HW2A 2NSGA 2AP3A 2P6VA 5KYUA 4RD9A 2XL8A 2XLOA 4Z9HA 3B0VC 4E7SA 1NG1A 5B3IA 3M4CA 2IYLD 2X0CA 3RVYA 1VOMA 1TFKB 4EKWA 1ZHYA 5JT4A 1QSPA 1NLXA 1MMGA 1T01A 2WZLA 4FWVA 2X51A 3W8IA 2FAPB 3MX3A 3SNHA 2A0BA 4YT4A 1O5HA 1NBBA 4IARA 5F28E 3EGDA 2EPNA 2R03A 4MNDA 3S27A 3SEOA 1ZVZA 2ETSA 2CNWA 1FMWA 1HMOA 1O87A 2C04A 3JSZA 3AG1C 3IHUA 2EIMC 3VAYA 3O6XA 1TR2A 4NC3A 3JSEO 5TJ5E 3K1IA 3WHNA 4CS9A 2J45A 4ULWA 3B0PA 2Y3HA 1GQAA 4MTGA 2R25A 3M15A 4EWCA 1Q0MA 4A4AA 2YL1A 3VRCA 4U9DA 3LNMB 1D1AA 2CNWD 4ANJA 2R9RB 4YT8A 3W8HA 4NTBA 2GFHA
chains in the Genus database with same CATH topology
1YAUO 3JRMO 1AVOB 1Z7Qc 3IPMO 1FNTc 1YA7O 3JTLO 3JSEO 1YARO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YAU O;  3JRM O;  1AVO B;  1Z7Q c;  3IPM O;  1FNT c;  1YA7 O;  3JTL O;  3JSE O;  1YAR O; 
#chains in the Genus database with same CATH topology
 1PCX A;  2Y3G A;  1TWC A;  4BG0 A;  2L7A A;  1T9K A;  2EPK X;  4LDQ A;  4X0R A;  4CJG A;  3DE9 A;  3QZC A;  5KYY B;  4J32 B;  4CSA C;  4IWB A;  5AC5 A;  3RIP A;  2XXA B;  5L3Q A;  4B6I A;  2KK1 A;  4C7O A;  3H2U A;  3FDQ A;  4YWQ A;  3B9Q A;  3HNK A;  1JR8 A;  4DRI B;  3IPM O;  5L0I A;  5JUA A;  1FNT c;  3O10 A;  4BJ5 C;  3SZR A;  4DXW A;  2ZXO A;  3GEH A;  3ZVR A;  2HMZ A;  2A68 F;  3F46 A;  5EGY A;  3FAJ A;  5KYW A;  1MMD A;  2YLD A;  1TQG A;  3GWN A;  3I5P A;  3U9M A;  1MND A;  1CGO A;  4J7Y A;  3NKE A;  4LDK A;  5DVW A;  4ER9 A;  4JTC B;  1GS9 A;  4RDA A;  5A6B A;  2OG2 A;  1M2V A;  1Z23 A;  2PFD A;  4JTD B;  3ABM C;  4PJJ A;  2VB6 A;  1VB5 A;  2WB7 A;  4IB4 A;  5CI8 A;  3UGP A;  2QLA A;  2M64 A;  3HKK A;  3M4B A;  4CSA A;  2B0J A;  2W45 A;  3HNL A;  3ZSU A;  5DQT A;  3C63 A;  5A6B D;  2LSE A;  4JIO A;  4N6H A;  2AWC A;  3IQC A;  3U5S A;  3GM2 A;  5DS4 A;  4OIR F;  4CDA A;  3QVZ A;  4FES A;  4BJ5 A;  1EQ1 A;  1OXB A;  4OIO F;  1GGQ A;  4CIP A;  3EZI A;  4GQH A;  1D1B A;  3C8Z A;  2Q9A A;  3TUL A;  5EK0 A;  3LNR A;  2ZPA A;  1DOV A;  4IAQ A;  4JE9 A;  4NCQ A;  2ZXW C;  3C8G A;  3FAP B;  1ZHZ A;  3KKB A;  3QTH A;  1VYK A;  1K05 A;  4OD4 A;  2Q3T A;  4P9T A;  2DB4 A;  5KYU B;  4U5C E;  3U0C A;  5D91 A;  3EGX B;  4H4K C;  4Q4Z F;  2HJM A;  1XZP A;  2HKV A;  3ZC4 A;  3KH2 A;  1K04 A;  3C8G D;  3JYY A;  4XWJ A;  3ITF A;  4XPX A;  2QE9 A;  2YEV A;  4AL1 A;  2KGO A;  4JVS A;  2KJG A;  2R7O A;  2A1D D;  4JEA A;  4XPY A;  2XXA A;  3U2M A;  3EGD B;  3U8P A;  2XL6 A;  4MTF A;  3RF3 A;  3EH2 A;  3AQB A;  5JP7 A;  2V26 A;  1HY5 A;  3RFY A;  2XL4 A;  3CAX A;  5KYN A;  4G7O F;  1G4U S;  3U9J A;  2DGJ A;  3ZWI A;  1OCR C;  2AVK A;  1JAF A;  3C62 A;  1H9G A;  3JTL O;  4MTO A;  1NZE A;  2G3V A;  1ZW3 A;  1YZC A;  5L0F A;  3DAF A;  3MYF A;  3OA1 A;  4J7T A;  4N06 A;  2KSF A;  4U5H A;  2EPL X;  1YDI A;  2P61 A;  4EBB A;  3L0I A;  4G0H A;  4JKV A;  1ZHX A;  3FHD A;  3JCU Q;  5B1B C;  4C3E A;  1Z6A A;  3AGU A;  4C7O B;  2Q7R A;  1E86 A;  4W8K A;  3DJN B;  3GM1 A;  4PFO A;  2WZF A;  2CW0 F;  2HJ3 A;  4O6N A;  4YJW A;  1TWA A;  1Z63 A;  3N0T A;  5K0I A;  4HFF B;  3GOD A;  3GM3 A;  2YLG A;  3U3F A;  3PDM P;  1YZA A;  2R7W A;  5KYW B;  1LM3 B;  4O6M A;  1JRA A;  4QI2 A;  4GYT A;  2VC9 A;  4BJ6 C;  2L81 A;  1OCO C;  1TWG A;  1ZU4 A;  4JUR I;  1D0Y A;  2ZXR A;  3AG2 C;  3DJU B;  2HV6 A;  1M2V B;  1LPE A;  2GA0 A;  5E33 A;  3G4X A;  2DYR C;  3DM9 B;  3SXZ A;  5COF A;  3ZDL A;  4EHP A;  4MVO A;  3W2W A;  4QDL A;  1LIH A;  4MW8 A;  2I15 A;  1FFT C;  1NU9 C;  1L7C A;  2Y3B A;  2ICW G;  3EGX A;  2VH3 A;  4YN0 B;  3ABK C;  1D0Z A;  1Z7Q c;  4CDY A;  3LUT B;  1RKE B;  3DAG A;  3L8I A;  3G50 A;  5IY5 C;  2HSB A;  4HFK B;  5HSW A;  2KC3 A;  4N4W A;  1PD1 A;  5BQG A;  2HUJ A;  1LE2 A;  1ORY A;  2MWQ A;  5JRA A;  2HMQ A;  4JTA B;  2JD3 A;  3QW1 A;  4MVZ A;  2B0H A;  3IEE A;  3AGT A;  1QVX A;  4CS7 A;  1LVK A;  2HV7 A;  2JPU A;  4JJF A;  3K66 A;  3C8G B;  3GEE A;  4XQ1 A;  1FAP B;  1ZZP A;  4BJ6 A;  3POV A;  1J8M F;  2BL2 A;  2M4E A;  4L6R A;  3RQF A;  2WVO A;  4DOZ A;  4R32 A;  3BEH A;  3M79 A;  1SR2 A;  3MFN A;  4MQ9 F;  4XLP F;  2EIN C;  2XLE A;  1EA8 A;  4A2N B;  2EIK C;  3RH3 A;  4KNW A;  2IOQ A;  2WZG A;  4H54 A;  5AGF A;  4OIP F;  1VK5 A;  4JEB A;  1NSG B;  1WWP A;  2XS8 A;  4K0D A;  1T6Q A;  4CS8 A;  3Q6M A;  4ULV A;  4LLC A;  2F22 A;  2PNO A;  2OEX A;  2Y39 A;  3LES A;  4F4B A;  1U0B B;  1RJ9 A;  4Z9J A;  3TK0 A;  4E7Z A;  5FCL A;  1ZYR F;  5JS5 A;  3RW0 A;  3IQ6 A;  1FFH A;  4FX5 A;  3SXM A;  5HV9 A;  2LP4 A;  3CEX A;  2CGE A;  2NUT B;  4XPW A;  3M1C B;  1QKR A;  1C02 A;  3S9O A;  3NMK A;  1H7I A;  2NG1 A;  2VAS A;  3A11 A;  5T3W A;  3ASO C;  2W4B A;  1AVO B;  1FTS A;  3EQL F;  1AUE A;  2VCA A;  1QQ3 A;  1C17 M;  2VCB A;  2YL0 A;  3AJM A;  4HEA J;  4NQF A;  4U5E E;  1A41 A;  4I1M A;  4AE4 B;  2Q00 A;  3ZQV A;  2RSE B;  1SMY F;  1U6H A;  1RXQ A;  2EIJ C;  2AWY A;  2HS5 A;  2J9V A;  5B1A C;  2UUH A;  3AQC A;  2EPM X;  1AEP A;  2WVN A;  2YKZ A;  3T6J A;  2OJQ A;  2XLD A;  2OJE D;  2YL3 A;  3FOP A;  1Z3I X;  3UR3 C;  1HW1 A;  2YHS A;  4CBE A;  4K1O A;  4MVR A;  3TD7 A;  5L0C A;  3KPH A;  3NMI A;  2P1A A;  5A6A A;  2YWA A;  3RYL A;  3LEO A;  1RKE A;  4U5B E;  2XM4 A;  4D4X A;  3G4Z A;  5L0H A;  2XM0 A;  4U9E A;  1YVI A;  4KC9 A;  3TQO A;  2MYS A;  3R2P A;  1T5O A;  1I5N A;  1WTY A;  2OCC C;  3ASN C;  3S29 A;  2Q9C A;  2XRH A;  2LQG A;  3OWT A;  1BBH A;  2XLV A;  5L0D A;  4O7G A;  3VYW A;  1OR3 A;  2LK4 A;  3SYN A;  1JMW A;  2NSF A;  1XZQ A;  4PJM A;  2Q4F A;  3T9O A;  1G8X A;  1SZI A;  5BQI A;  4KNV A;  4IGG A;  3U8V A;  3H2V A;  3VM6 A;  1GM5 A;  3L1M A;  4OD5 A;  2A0U A;  5EHH A;  2Y3D A;  3L34 A;  1Q0K A;  4XEV A;  1OQC A;  2GDC A;  4MVM A;  2BE5 F;  4YT2 A;  1E2X A;  4AK9 A;  4M63 A;  4DBR A;  2PP4 A;  3UNG C;  2NUP B;  3O39 A;  5T3T A;  1YJG A;  2Y69 C;  4BEJ A;  2H8A A;  5AC4 A;  5E3A A;  1EI7 A;  3PCV A;  2AU5 A;  4EIY A;  1JPJ A;  1Q0G A;  4OIN F;  1MQV A;  1QLE C;  4IJJ A;  4WAB A;  3R7C A;  2R7V A;  4XLN F;  4O79 A;  2L6F A;  4UDV A;  1Y6D A;  3JYH A;  3DD7 A;  5COG A;  3HLZ A;  2XLW A;  3JRM O;  3KMI A;  2NPU A;  2NUT A;  1OW6 A;  3DZA A;  5FZT A;  3UMH A;  1EKY A;  2LFD A;  5KYX A;  3EHN A;  1APC A;  2J0W A;  1A7V A;  1HMD A;  1YAR O;  5CIV A;  4YL3 A;  2WVQ A;  4AE4 A;  5BQH A;  1OCZ C;  1E85 A;  3S28 A;  3N24 A;  4Z9I A;  1YYJ A;  3JZ0 A;  3KYI A;  4YL0 A;  3TOM A;  5F5H A;  1E84 A;  1RJ9 B;  4DJ9 A;  3S84 A;  1SF8 A;  3V5Y A;  3ZTZ A;  1OXK A;  3GEI A;  3K6B A;  3RQE A;  1H6G A;  2R05 A;  2FGY A;  2A6H F;  2YZS A;  4I44 A;  4LLE A;  4E0I A;  3H65 A;  3FXH A;  3Q7G A;  5DQZ A;  3V5Z A;  1BR2 A;  1YA9 A;  3JRT A;  4JW1 A;  3WG7 C;  4DVZ A;  1V4A A;  4YL1 A;  4CIH A;  1YLM A;  3ATP A;  3MBG A;  2OEV A;  1MMN A;  2KQ9 A;  3N2Z B;  4JCH A;  4XEK A;  3FVY A;  2GAQ A;  3DMD A;  3EPV A;  2R7R A;  1FR0 A;  1TFO B;  1CGN A;  3L8J A;  5L3V A;  5BUO A;  1CPQ A;  4PJN A;  4BEM J;  4MS2 A;  4N6C A;  1NFO A;  1R4T A;  1MNE A;  1JOG A;  1VMA A;  1TWH A;  4MVQ A;  4XEF A;  3T6B A;  2LFF A;  3NYL A;  2ASR A;  2Q9B A;  4IAO A;  4EBK A;  1M56 C;  4C3D A;  2LCH A;  4W8P A;  4PFP A;  5JVE A;  3NMJ A;  5E3C A;  3UMI A;  2KNH A;  3X1O A;  2H7B A;  1H9T A;  3NG1 A;  3E70 C;  2O9X A;  2NUP A;  4BJ1 A;  3KL4 A;  2J9W A;  2EIL C;  1OW8 A;  3MLG A;  1HE1 A;  4IRU A;  3ABL C;  2CYD A;  1XWJ A;  1ZHW A;  1M57 C;  3SXK A;  1F1M A;  3RQG A;  2YRF A;  4U5F E;  2IXM A;  2YL7 A;  3F47 A;  4PJL A;  1M2O A;  3W4Y A;  4C3B A;  2HFI A;  5F5F A;  2L6G A;  3DKA A;  2PX0 A;  1E83 A;  2R7Q A;  3HJC A;  3AOU A;  4PAC A;  2P0N A;  3EJN A;  3JT1 A;  1C03 A;  2R7S A;  1DOW A;  1NFN A;  1ZW2 A;  3QW0 A;  4GEH A;  5COM A;  3T4R A;  5A69 A;  2YQY A;  1S05 A;  1WOL A;  2FFH A;  1ST6 A;  2QUP A;  3OEO A;  4U5D E;  4WGY A;  4XTK A;  3V7O A;  1UFB A;  1YAU O;  2R7U A;  1HE9 A;  2W9Y A;  3GOR A;  2XLH A;  4K7B A;  2QNL A;  4I3M A;  4JRZ A;  3HNJ A;  2E87 A;  3HNI A;  4O6Y A;  1K40 A;  2MHR A;  1Q0F A;  2YLI A;  4DBQ A;  3ZG1 A;  2DI3 A;  1MMA A;  3AG4 C;  2GWW A;  1V55 C;  5DS6 A;  2PBE A;  4E18 A;  4KI2 A;  2G3K A;  1LI5 A;  1V54 C;  1A0B A;  1N1C A;  1LS4 A;  2R02 A;  4AX2 A;  1I4Y A;  2A69 F;  5A6K A;  5KYX B;  3PHF 2;  5DS5 A;  1R5I D;  4YT5 A;  3B0U X;  1A7D A;  3ZQY A;  2C03 A;  3WAQ A;  2Z15 A;  1QPU A;  1BZ4 A;  1Z5Z A;  2IBF A;  3DM5 A;  3LLK A;  4E17 A;  3PMR A;  1ZHT A;  3C18 A;  3TJ6 A;  3EG9 A;  2CCY A;  3CSK A;  1M6T A;  4ZLD A;  2D4U A;  3EFO A;  4ZLC A;  1BDJ B;  1VTM P;  2VCC A;  2BC5 A;  1KNY A;  4G7Z F;  1T6U A;  1V74 B;  1FMV A;  2J8W A;  2A6E F;  2J9B A;  5DLJ A;  1OR2 A;  3DWW A;  4U5G A;  1J8Y F;  1ORJ A;  4NTF A;  4ONS A;  3V5X A;  2J7P A;  3X2Q C;  3J06 A;  1W2W A;  1Y4C A;  3LAY A;  2JX0 A;  2ZD9 A;  3B71 A;  2PX3 A;  2EPO A;  3SXY A;  1YYX A;  3LEV A;  3US6 A;  3ZTM A;  3QMK A;  4LER A;  5E2Q A;  3IQT A;  2HZ8 A;  1OKK A;  4QI0 A;  3Q7L A;  1SYQ A;  2J7P D;  1VLS A;  3AG3 C;  4D4N A;  1KTM A;  1D0X A;  3DXJ F;  3C7J A;  1YA7 O;  3LS1 A;  2XS1 A;  2IM8 A;  1G4W R;  3CZ6 A;  1LE4 A;  1OKK D;  1D1C A;  2XSE A;  1I4Z A;  4BPM A;  4CDV A;  1RKC A;  1WN0 A;  2KW3 C;  3W2V A;  4MVS A;  4EUK B;  2IXO A;  1T6I A;  1WAT A;  4AL0 A;  2L9J A;  2I8B A;  2G62 A;  5L0G A;  1G5Z A;  1OCC C;  1A7E A;  1L3P A;  1WGW A;  3WOD F;  3LJB A;  4Q7C A;  3NYM A;  3I5Q A;  3S0X A;  1LI7 A;  1Q0D A;  4YK5 A;  4DVY P;  1TKN A;  5A6J A;  1U89 A;  3EHM A;  2J46 A;  4P6I C;  5JLI A;  3K7D A;  3MYI A;  5L0J A;  2J0X A;  3VF0 A;  4CS8 C;  2DYS C;  2LD6 A;  1IW7 F;  3GAN A;  2W4M A;  3HTK C;  3NKD A;  1ZU5 A;  3I4U A;  1QZX A;  3KYJ A;  4Q5S F;  4JZA A;  1RMV A;  5CI9 A;  3A9C A;  4EBJ A;  4LAC B;  2QTV A;  3BRJ A;  2RD9 A;  3ECS A;  3FOO A;  3T6G B;  3NYJ A;  1OW7 A;  4CJO A;  3EH1 A;  2ZXP A;  2UUI A;  2R7X A;  2YVK A;  4WGZ A;  5KYY A;  5JSL A;  3NDB B;  2QY9 A;  4JJG A;  2IXP A;  3O55 A;  4MVU A;  3RVZ A;  3SP1 A;  4BJT A;  2LIG A;  3DE8 A;  4RBN A;  4DRJ B;  5D92 A;  3K33 A;  4E0H A;  1JPN A;  3NRH A;  2OU6 A;  4NTA A;  1NU7 D;  3EZH A;  4PK4 A;  4LDR A;  3DI5 A;  2J9U A;  5GPG B;  4CX9 A;  4J30 B;  4KBL A;  2P7V A;  1WAS A;  3IQ5 A;  2R7T A;  4WJ0 A;  1VLT A;  2XLM A;  4G78 A;  1BR4 A;  3UGO A;  3EG9 B;  2CDQ A;  2H7O A;  1BR1 A;  3K1H A;  3EFO B;  3U3B A;  4PR9 A;  3CQZ A;  3U2L A;  1KU2 A;  3S90 A;  1UG7 A;  1S7Z A;  2KYH A;  3Q6N A;  1PV3 A;  2TMV P;  3TJ5 A;  2D5R B;  2OQM A;  4I1O B;  4JC7 A;  4JCZ A;  3FMS A;  4OIQ F;  4FAP B;  1CPR A;  4HE8 D;  2L6H A;  1LKX A;  2HSQ A;  1B68 A;  1VYI A;  3RKO F;  1RCP A;  4NY3 A;  4P9F A;  2H7V C;  2IXN A;  1O3U A;  3ZIB A;  4G7H F;  1IZM A;  2WL8 A;  3B29 A;  2OOC A;  2OKU A;  5T1D B;  4DRH B;  3E9V A;  4CS9 C;  4MW3 A;  3K1I C;  3LLI A;  2PF4 E;  5B3S C;  1CGM E;  3TOL A;  2V3C C;  3LS0 A;  3QVY A;  256B A;  1ORS C;  3GWL A;  1PD0 A;  3UMK A;  1LS1 A;  1HW2 A;  2NSG A;  2AP3 A;  2P6V A;  5KYU A;  4RD9 A;  2XL8 A;  2XLO A;  4Z9H A;  3B0V C;  4E7S A;  1NG1 A;  5B3I A;  3M4C A;  2IYL D;  2X0C A;  3RVY A;  1VOM A;  1TFK B;  4EKW A;  1ZHY A;  5JT4 A;  1QSP A;  1NLX A;  1MMG A;  1T01 A;  2WZL A;  4FWV A;  2X51 A;  3W8I A;  2FAP B;  3MX3 A;  3SNH A;  2A0B A;  4YT4 A;  1O5H A;  1NBB A;  4IAR A;  5F28 E;  3EGD A;  2EPN A;  2R03 A;  4MND A;  3S27 A;  3SEO A;  1ZVZ A;  2ETS A;  2CNW A;  1FMW A;  1HMO A;  1O87 A;  2C04 A;  3JSZ A;  3AG1 C;  3IHU A;  2EIM C;  3VAY A;  3O6X A;  1TR2 A;  4NC3 A;  3JSE O;  5TJ5 E;  3K1I A;  3WHN A;  4CS9 A;  2J45 A;  4ULW A;  3B0P A;  2Y3H A;  1GQA A;  4MTG A;  2R25 A;  3M15 A;  4EWC A;  1Q0M A;  4A4A A;  2YL1 A;  3VRC A;  4U9D A;  3LNM B;  1D1A A;  2CNW D;  4ANJ A;  2R9R B;  4YT8 A;  3W8H A;  4NTB A;  2GFH A; 
#chains in the Genus database with same CATH homology
 1YAU O;  3JRM O;  1AVO B;  1Z7Q c;  3IPM O;  1FNT c;  1YA7 O;  3JTL O;  3JSE O;  1YAR O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...