1YAUO

Structure of archeabacterial 20s proteasome- pa26 complex
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
228
structure length
218
Chain Sequence
KRAALIQNLRDSYTETSSFAVIEEWAAGTLQEIEGIAKAAAEAHGVIRNSTYGRAQAEKSPEQLLGVLQRYQDLCHNVYCQAETIRTVIAIRIPEHKEEDNLGVAVQHAVLKIIDELEIKTLGSGEKSGSGGAPTPIGMYALREYLSARSTVEDKLLGGGSQSPSLLLELRQIDADFMLKVELATTHLSTMVRAVINAYLLNWKKLIQPRTGSDHMVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The 1.9 A structure of a proteasome-11S activator complex and implications for proteasome-PAN/PA700 interactions.
pubmed doi rcsb
source organism Thermoplasma acidophilum
molecule tags Hydrolase/hydrolase activator
molecule keywords Proteasome alpha subunit
total genus 82
structure length 218
sequence length 228
chains with identical sequence P, Q, R, S, T, U
ec nomenclature
pdb deposition date 2004-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF02252 PA28_beta Proteasome activator pa28 beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.180 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Proteasome activator pa28, C-terminal domain 1yauO01
1FNTc 1AVOB 1Z7Qc 1YARO 3JSEO 1YA7O 3JRMO 1YAUO 3IPMO 3JTLO
chains in the Genus database with same CATH superfamily
2WVOA 5B3IA 1JPJA 5BQGA 1YJGA 1OW8A 1O5HA 1ZVZA 4FESA 4MW3A 1ZU4A 5BQHA 1WOLA 4XPXA 1F1MA 2HSBA 4W8KA 2R02A 4YT5A 4DXWA 3MLGA 4H4KC 1OKKD 2L9JA 4JTCB 3FOPA 5E33A 4F4BA 3WG7C 1T01A 3SXZA 3JRTA 3AQCA 1C02A 3JSEO 1YA7O 3ZQYA 2W4MA 2HMQA 4G0HA 1ZHZA 4A2NB 4YL3A 2J7PA 5COGA 4DRIB 5JRAA 1WGWA 4JRZA 4ULVA 1M56C 3IEEA 3HNKA 3KKBA 2QTVA 3FAPB 2GWWA 2TMVP 3DE9A 2A6EF 4C3EA 2B0JA 1YDIA 2PBEA 3TD7A 3EH1A 4JIOA 4XEFA 1DOVA 3TK0A 2XS8A 5A6BD 1CPQA 3L1MA 1ORYA 3ZTZA 5KYWA 5GPGB 2CGEA 1I4YA 4IAQA 5TJ5E 3L0IA 1A7VA 4OIPF 1J8YF 2OJED 3V5XA 1PD0A 2R7TA 2B0HA 1FNTc 1YZCA 1H6GA 1WN0A 2R7RA 3HTKC 3Q7LA 5JS5A 4MTFA 3VF0A 4J30B 1JRAA 1OR2A 3UNGC 3EHNA 2ZXRA 1T6QA 4QI0A 4PJNA 3WODF 3QW0A 1ORSC 2Q9AA 2XM0A 4H54A 3EH2A 3FVYA 3B9QA 3N2ZB 2YVKA 3DWWA 2D5RB 2L6HA 4Q7CA 1KU2A 2AWCA 4DRJB 4E7ZA 2QY9A 2AVKA 4I1MA 3L8JA 5EGYA 1TR2A 2J45A 2KJGA 2GA0A 1LI5A 2LCHA 4NY3A 4IWBA 5CI9A 1SR2A 2A68F 5L0GA 2XL8A 2NUPB 3C8GA 1GQAA 3MX3A 2A69F 1ZYRF 2H7BA 2XL6A 3OEOA 4PJMA 5KYUA 3RW0A 2MYSA 2KGOA 1OR3A 3M79A 3GEHA 2NUTA 3B0UX 4JKVA 2G3KA 3LS1A 1E2XA 5BUOA 1TFKB 4NC3A 1OCOC 1MMAA 3IQ5A 3UMKA 4UDVA 3N0TA 3G4ZA 5JT4A 3DXJF 3QTHA 2XLEA 3SEOA 1ZHWA 5COFA 4EBKA 2XLMA 2ZPAA 2AWYA 1VB5A 5F5HA 4XTKA 3SP1A 3EQLF 1M2VA 1BDJB 1U89A 4IRUA 3DI5A 1I5NA 2YLIA 1RKEB 4XLPF 1RJ9B 3X2QC 1HE9A 1QLEC 1Q0DA 3TJ5A 1BBHA 3MFNA 4IB4A 3JCUQ 5DQZA 1VOMA 2CCYA 2V26A 3DM5A 2R7UA 3MBGA 1ZW3A 4NTBA 3ZDLA 2V3CC 1YAUO 2LQGA 3U2MA 2H8AA 4LDQA 3E9VA 4CDAA 2WZGA 3UMIA 2LIGA 2W45A 2NSGA 4ER9A 3FMSA 2GAQA 3AJMA 3K7DA 5F28E 1IW7F 2LD6A 5E3CA 4J7YA 4CS8A 1RCPA 3WHNA 4DRHB 3EGDB 5A6KA 5HSWA 2R7XA 3ATPA 4BJ6A 2QLAA 2LFFA 1HW2A 3PCVA 1WWPA 4CS8C 2R7SA 4DVYP 3M4CA 3ABKC 5JLIA 3KYIA 1QZXA 1ZW2A 1SMYF 5EK0A 1V74B 1VTMP 4YT8A 1QKRA 3EJNA 4YL1A 2Q00A 3S90A 2R7WA 2J0WA 3TOLA 2VC9A 1PCXA 3EHMA 3UGPA 1EA8A 4WABA 1K04A 2I15A 2P1AA 3K1IC 3NG1A 4U5FE 1TFOB 2M64A 2NSFA 2CYDA 2KW3C 2A6HF 2DB4A 2WVQA 4GEHA 4LACB 4OIRF 4EBBA 4CSAC 2KC3A 4MVSA 1A41A 3C8GB 3K1IA 1G8XA 2EIJC 1MMDA 5L0CA 4G7ZF 3K33A 4GQHA 3VYWA 4NTAA 4EBJA 2J9UA 4O79A 2CDQA 3IHUA 4BJ5A 1LS4A 3SZRA 2GDCA 1A7DA 3FOOA 2LK4A 1Q0MA 3EZHA 4RD9A 2XLDA 1RJ9A 5EHHA 2ZXWC 2PX0A 4MTGA 1WATA 3VM6A 2NPUA 1SZIA 1WTYA 1MMNA 2I8BA 4O6YA 5DVWA 3U9JA 5KYXB 4PFPA 5K0IA 2J0XA 5L0JA 5L0FA 3JZ0A 3LLKA 1R4TA 2C03A 3IQ6A 1YARO 1OW7A 4G78A 4LDRA 4IAOA 2LSEA 2YL0A 4N4WA 3VRCA 3LNRA 3QZCA 2ZD9A 4KC9A 4P9TA 5L0IA 1H9GA 2DI3A 3ZVRA 1GS9A 5D91A 2H7VC 4BJ6C 4MTOA 3W4YA 4A4AA 3POVA 3VAYA 1E86A 4LDKA 1AEPA 1OCCC 1I4ZA 2EPNA 1O87A 4NQFA 3NKEA 1VLTA 3U3FA 4C3BA 3AG4C 2ASRA 4EHPA 3DMDA 1JMWA 5T1DB 2OCCC 3DM9B 3K1HA 1CGOA 4BPMA 4DBQA 4I3MA 2PF4E 4KNVA 4ONSA 2EIKC 2EINC 3M1CB 4JC7A 4OD5A 4YJWA 4AE4A 1Z23A 3LLIA 3KL4A 1PD1A 1QQ3A 4ZLCA 5DS6A 3B29A 2G3VA 2J9BA 4O7GA 4MVUA 2R05A 3QW1A 2PX3A 2JX0A 2OJQA 2XLOA 4K0DA 3EFOB 2XL4A 5T3WA 4I1OB 2IXNA 1Q0KA 3I4UA 3N24A 4WJ0A 1E83A 1M6TA 1GGQA 3BRJA 3RKOF 3FHDA 2EIMC 4YN0B 4P9FA 2HV7A 2P61A 3CEXA 3PDMP 4CSAA 3K6BA 3RVZA 3TJ6A 4CS9C 1APCA 2WL8A 4YT2A 3O39A 3RQFA 1BR2A 1Z7Qc 4DBRA 3B0PA 2Y3DA 1TKNA 2XM4A 1AUEA 3R2PA 2ZXOA 4WGZA 2LFDA 4BJ5C 3L8IA 1DOWA 3O6XA 1OCZC 2YL1A 3DKAA 1D0YA 4CIHA 1D0XA 4DOZA 4K7BA 4XWJA 4AK9A 1LE2A 4XEVA 4D4NA 4MQ9F 2L6GA 1NU7D 2XLHA 4IARA 4JTAB 5E2QA 5KYNA 1VYIA 2CNWA 1G4WR 3ITFA 1AVOB 2E87A 3U0CA 1EQ1A 3PMRA 2OKUA 3EGXA 3JRMO 2YL7A 1NBBA 3QVYA 4U5HA 2VB6A 4JCZA 1HMOA 1RMVA 4CDYA 1Y6DA 3G50A 2EPMX 1M2OA 1H7IA 2ICWG 3AGUA 3EZIA 4JEAA 3RQGA 4OIOF 2EILC 2UUIA 1TQGA 1YA9A 2A1DD 1N1CA 3LEOA 3C8GD 4FX5A 1NSGB 2YLDA 2R7QA 1T5OA 1MNEA 4U5GA 4PK4A 2HFIA 2HMZA 1ZU5A 4KNWA 4G7OF 2Y3BA 3GEEA 3S84A 2KNHA 4JVSA 2X51A 4LERA 1JR8A 4JW1A 1CPRA 4KI2A 3IQCA 5COMA 3AQBA 5CIVA 4J7TA 4Q4ZF 1NFNA 2L6FA 3SYNA 3W2VA 4N06A 2NG1A 2AU5A 2XS1A 4JCHA 2EPOA 1OXKA 2YHSA 3HJCA 2QUPA 2XSEA 2AP3A 3SXKA 2VASA 3GM2A 3U9MA 3RIPA 4G7HF 1NU9C 1BR1A 3S28A 1MQVA 2X0CA 4U9DA 3ZIBA 4CIPA 2JPUA 3I5PA 5A6JA 4IJJA 2CW0F 3HKKA 1Z3IX 3M4BA 3Q6NA 3GM1A 2XLVA 3AG2C 4M63A 3HLZA 3SXMA 5DS4A 1MMGA 1Z63A 2OEVA 1LI7A 3EFOA 4CS9A 2FAPB 4D4XA 3FXHA 1TWCA 1NG1A 1ZZPA 3ABLC 3KH2A 1UG7A 3GWLA 3SXYA 5DQTA 5DS5A 3EGXB 1H9TA 2O9XA 1FR0A 4JURI 3LNMB 1PV3A 3J06A 2Q9BA 5KYXA 2Q9CA 2YQYA 4XEKA 4QDLA 2J7PD 2P0NA 2YKZA 2EPLX 1WASA 3EGDA 3ZG1A 3B71A 3T6BA 2BE5F 3F47A 2HUJA 4MVZA 2MHRA 4JE9A 4JTDB 1HE1A 4RDAA 1HY5A 1C03A 2RD9A 2KK1A 5L3QA 1ZHTA 2OEXA 1A7EA 3LJBA 4OIQF 4K1OA 1D1CA 5AC5A 2PP4A 4PJLA 4U5DE 3DD7A 3GM3A 4YK5A 2G62A 3A11A 3JYHA 3O10A 4O6NA 1LPEA 5CI8A 3SNHA 1XZPA 2Z15A 3ZC4A 4YT4A 5KYYA 1QSPA 1Z5ZA 4R32A 1M57C 2LP4A 4RBNA 1V54C 2Q7RA 2YEVA 2IOQA 4HFKB 1CGNA 1U0BB 4ULWA 3EG9A 1TWGA 2HSQA 1JAFA 1QVXA 2KYHA 3L34A 4DJ9A 3TOMA 1BR4A 4E18A 1RXQA 1FFTC 2OG2A 4E7SA 3R7CA 1T6IA 1Y4CA 1OW6A 2OU6A 2OQMA 3U2LA 4MVRA 2KQ9A 4CJGA 4DVZA 5A6BA 2PFDA 3NYMA 3S27A 3LESA 3MYIA 1TWHA 2J46A 1LKXA 4U5CE 4E0IA 2IYLD 3NKDA 4KBLA 3RQEA 5B1BC 3C62A 5KYUB 4O6MA 5JVEA 1Q0FA 2Q3TA 3LUTB 3V5YA 1XWJA 2XLWA 1SF8A 1KTMA 2P7VA 3HNLA 2D4UA 3BEHA 3W8HA 1OXBA 4J32B 3DE8A 2KSFA 4NTFA 1UFBA 5E3AA 3NYJA 1D0ZA 1MNDA 3T9OA 2MWQA 3I5QA 3GORA 4XPYA 3C63A 5B1AC 3IQTA 4U9EA 1HMDA 2Y3HA 4JJFA 4WGYA 1K05A 2A0BA 3B0VC 1RKEA 4C3DA 3Q7GA 2R7VA 1BZ4A 3M15A 3QMKA 2VCAA 3UR3C 1R5ID 4CDVA 2YL3A 4ZLDA 1LE4A 2OOCA 2RSEB 1W2WA 2CNWD 2HJMA 2DGJA 2C04A 2EPKX 2QNLA 1TWAA 1B68A 3FAJA 3IPMO 4LLCA 4MNDA 1OKKA 4NCQA 3QVZA 4E17A 1FAPB 1XZQA 1VK5A 2FFHA 4PR9A 2NUPA 4BJTA 5KYYB 3OWTA 1FMWA 4XQ1A 4P6IC 1S05A 3X1OA 2UUHA 1LIHA 2IXOA 3A9CA 3H65A 4W8PA 4B6IA 5A6AA 4LLEA 4XPWA 2J8WA 5T3TA 4BG0A 1LVKA 4CS7A 2HV6A 3E70C 3ZWIA 1K40A 1JOGA 2R25A 2YLGA 1T6UA 3H2VA 1U6HA 4GYTA 3T6GB 3KMIA 4FWVA 4EKWA 2J9VA 5JP7A 1D1AA 3ASNC 4C7OA 4Q5SF 3CQZA 3GANA 3V7OA 4PACA 3F46A 3PHF2 4OD4A 5AC4A 3NMIA 3G4XA 4X0RA 1D1BA 5FZTA 4EUKB 3ECSA 1QPUA 3NYLA 3HNIA 1JPNA 2PNOA 2R03A 3AG3C 4L6RA 3Q6MA 3JTLO 4BEMJ 2HS5A 5D92A 1NLXA 1NFOA 2R7OA 3K66A 4QI2A 3RFYA 2Q4FA 3W2WA 3TQOA 4HFFB 256BA 5JUAA 2DYRC 4XLNF 1E84A 2BL2A 1YZAA 3H2UA 2YZSA 2NUTB 3EG9B 4PJJA 1ZHXA 4ANJA 3NRHA 3JSZA 4Z9IA 3RVYA 5B3SC 4BJ1A 5DLJA 2L81A 2W9YA 1G4US 1FTSA 2HZ8A 4HE8D 2IXPA 2H7OA 1L7CA 2Y39A 4CBEA 5L0DA 3NMKA 3OA1A 4C7OB 1NZEA 3FDQA 1V4AA 4MS2A 1VYKA 3ZSUA 2WZLA 2YRFA 3CAXA 1Z6AA 4EWCA 3DAFA 2Y69C 3ZTMA 1C17M 2HJ3A 4U5EE 1J8MF 1VLSA 2FGYA 3EPVA 2VCCA 1M2VB 2VCBA 4N6HA 3RH3A 1OQCA 1EKYA 2ETSA 3U8PA 1VMAA 4U5BE 4N6CA 3T4RA 3WAQA 3LAYA 2XXAA 5F5FA 2IM8A 1GM5A 3MYFA 2Y3GA 1LS1A 3AG1C 4OINF 4PFOA 3S29A 2DYSC 1YLMA 2WZFA 1YYJA 3GWNA 3NMJA 3US6A 4AE4B 5A69A 5BQIA 2YWAA 3AGTA 1LM3B 2R9RB 4MVQA 3JYYA 1SYQA 1Q0GA 2WVNA 4YL0A 3S0XA 3CZ6A 3DZAA 2A0UA 4JEBA 3RF3A 4JJGA 3C18A 5JSLA 4JZAA 3KPHA 4EIYA 1CGME 5FCLA 3DJNB 2JD3A 3ABMC 1FFHA 4BEJA 3V5ZA 3GODA 3KYJA 1A0BA 4AL0A 2J9WA 2VH3A 3C7JA 4Z9JA 2GFHA 3UMHA 4CX9A 3LS0A 3AOUA 2ZXPA 5HV9A 5L0HA 3T6JA 1ST6A 3DJUB 4E0HA 3HNJA 4I44A 5AGFA 1S7ZA 2XXAB 2F22A 5L3VA 5IY5C 1E85A 2XRHA 1ORJA 2M4EA 3U3BA 1G5ZA 2L7AA 3DAGA 1IZMA 4CJOA 2HKVA 2WB7A 3GEIA 1RKCA 1OCRC 1YYXA 2QE9A 1T9KA 1V55C 2P6VA 4AL1A 4AX2A 4MW8A 4YWQA 1KNYA 3RYLA 3S9OA 3NDBB 4MVOA 3ZQVA 4FAPB 1O3UA 5KYWB 4Z9HA 2IXMA 1HW1A 3ASOC 3C8ZA 3CSKA 3O55A 1YVIA 2W4BA 3TULA 3LEVA 4MVMA 3U5SA 1L3PA 3W8IA 1ZHYA 2BC5A 1FMVA 3UGOA 3JT1A 4IGGA 1EI7A 2IBFA 4HEAJ 3U8VA
chains in the Genus database with same CATH topology
1FNTc 1AVOB 1Z7Qc 1YARO 3JSEO 1YA7O 3JRMO 1YAUO 3IPMO 3JTLO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FNT c;  1AVO B;  1Z7Q c;  1YAR O;  3JSE O;  1YA7 O;  3JRM O;  1YAU O;  3IPM O;  3JTL O; 
#chains in the Genus database with same CATH topology
 2WVO A;  5B3I A;  1JPJ A;  5BQG A;  1YJG A;  1OW8 A;  1O5H A;  1ZVZ A;  4FES A;  4MW3 A;  1ZU4 A;  5BQH A;  1WOL A;  4XPX A;  1F1M A;  2HSB A;  4W8K A;  2R02 A;  4YT5 A;  4DXW A;  3MLG A;  4H4K C;  1OKK D;  2L9J A;  4JTC B;  3FOP A;  5E33 A;  4F4B A;  3WG7 C;  1T01 A;  3SXZ A;  3JRT A;  3AQC A;  1C02 A;  3JSE O;  1YA7 O;  3ZQY A;  2W4M A;  2HMQ A;  4G0H A;  1ZHZ A;  4A2N B;  4YL3 A;  2J7P A;  5COG A;  4DRI B;  5JRA A;  1WGW A;  4JRZ A;  4ULV A;  1M56 C;  3IEE A;  3HNK A;  3KKB A;  2QTV A;  3FAP B;  2GWW A;  2TMV P;  3DE9 A;  2A6E F;  4C3E A;  2B0J A;  1YDI A;  2PBE A;  3TD7 A;  3EH1 A;  4JIO A;  4XEF A;  1DOV A;  3TK0 A;  2XS8 A;  5A6B D;  1CPQ A;  3L1M A;  1ORY A;  3ZTZ A;  5KYW A;  5GPG B;  2CGE A;  1I4Y A;  4IAQ A;  5TJ5 E;  3L0I A;  1A7V A;  4OIP F;  1J8Y F;  2OJE D;  3V5X A;  1PD0 A;  2R7T A;  2B0H A;  1FNT c;  1YZC A;  1H6G A;  1WN0 A;  2R7R A;  3HTK C;  3Q7L A;  5JS5 A;  4MTF A;  3VF0 A;  4J30 B;  1JRA A;  1OR2 A;  3UNG C;  3EHN A;  2ZXR A;  1T6Q A;  4QI0 A;  4PJN A;  3WOD F;  3QW0 A;  1ORS C;  2Q9A A;  2XM0 A;  4H54 A;  3EH2 A;  3FVY A;  3B9Q A;  3N2Z B;  2YVK A;  3DWW A;  2D5R B;  2L6H A;  4Q7C A;  1KU2 A;  2AWC A;  4DRJ B;  4E7Z A;  2QY9 A;  2AVK A;  4I1M A;  3L8J A;  5EGY A;  1TR2 A;  2J45 A;  2KJG A;  2GA0 A;  1LI5 A;  2LCH A;  4NY3 A;  4IWB A;  5CI9 A;  1SR2 A;  2A68 F;  5L0G A;  2XL8 A;  2NUP B;  3C8G A;  1GQA A;  3MX3 A;  2A69 F;  1ZYR F;  2H7B A;  2XL6 A;  3OEO A;  4PJM A;  5KYU A;  3RW0 A;  2MYS A;  2KGO A;  1OR3 A;  3M79 A;  3GEH A;  2NUT A;  3B0U X;  4JKV A;  2G3K A;  3LS1 A;  1E2X A;  5BUO A;  1TFK B;  4NC3 A;  1OCO C;  1MMA A;  3IQ5 A;  3UMK A;  4UDV A;  3N0T A;  3G4Z A;  5JT4 A;  3DXJ F;  3QTH A;  2XLE A;  3SEO A;  1ZHW A;  5COF A;  4EBK A;  2XLM A;  2ZPA A;  2AWY A;  1VB5 A;  5F5H A;  4XTK A;  3SP1 A;  3EQL F;  1M2V A;  1BDJ B;  1U89 A;  4IRU A;  3DI5 A;  1I5N A;  2YLI A;  1RKE B;  4XLP F;  1RJ9 B;  3X2Q C;  1HE9 A;  1QLE C;  1Q0D A;  3TJ5 A;  1BBH A;  3MFN A;  4IB4 A;  3JCU Q;  5DQZ A;  1VOM A;  2CCY A;  2V26 A;  3DM5 A;  2R7U A;  3MBG A;  1ZW3 A;  4NTB A;  3ZDL A;  2V3C C;  1YAU O;  2LQG A;  3U2M A;  2H8A A;  4LDQ A;  3E9V A;  4CDA A;  2WZG A;  3UMI A;  2LIG A;  2W45 A;  2NSG A;  4ER9 A;  3FMS A;  2GAQ A;  3AJM A;  3K7D A;  5F28 E;  1IW7 F;  2LD6 A;  5E3C A;  4J7Y A;  4CS8 A;  1RCP A;  3WHN A;  4DRH B;  3EGD B;  5A6K A;  5HSW A;  2R7X A;  3ATP A;  4BJ6 A;  2QLA A;  2LFF A;  1HW2 A;  3PCV A;  1WWP A;  4CS8 C;  2R7S A;  4DVY P;  3M4C A;  3ABK C;  5JLI A;  3KYI A;  1QZX A;  1ZW2 A;  1SMY F;  5EK0 A;  1V74 B;  1VTM P;  4YT8 A;  1QKR A;  3EJN A;  4YL1 A;  2Q00 A;  3S90 A;  2R7W A;  2J0W A;  3TOL A;  2VC9 A;  1PCX A;  3EHM A;  3UGP A;  1EA8 A;  4WAB A;  1K04 A;  2I15 A;  2P1A A;  3K1I C;  3NG1 A;  4U5F E;  1TFO B;  2M64 A;  2NSF A;  2CYD A;  2KW3 C;  2A6H F;  2DB4 A;  2WVQ A;  4GEH A;  4LAC B;  4OIR F;  4EBB A;  4CSA C;  2KC3 A;  4MVS A;  1A41 A;  3C8G B;  3K1I A;  1G8X A;  2EIJ C;  1MMD A;  5L0C A;  4G7Z F;  3K33 A;  4GQH A;  3VYW A;  4NTA A;  4EBJ A;  2J9U A;  4O79 A;  2CDQ A;  3IHU A;  4BJ5 A;  1LS4 A;  3SZR A;  2GDC A;  1A7D A;  3FOO A;  2LK4 A;  1Q0M A;  3EZH A;  4RD9 A;  2XLD A;  1RJ9 A;  5EHH A;  2ZXW C;  2PX0 A;  4MTG A;  1WAT A;  3VM6 A;  2NPU A;  1SZI A;  1WTY A;  1MMN A;  2I8B A;  4O6Y A;  5DVW A;  3U9J A;  5KYX B;  4PFP A;  5K0I A;  2J0X A;  5L0J A;  5L0F A;  3JZ0 A;  3LLK A;  1R4T A;  2C03 A;  3IQ6 A;  1YAR O;  1OW7 A;  4G78 A;  4LDR A;  4IAO A;  2LSE A;  2YL0 A;  4N4W A;  3VRC A;  3LNR A;  3QZC A;  2ZD9 A;  4KC9 A;  4P9T A;  5L0I A;  1H9G A;  2DI3 A;  3ZVR A;  1GS9 A;  5D91 A;  2H7V C;  4BJ6 C;  4MTO A;  3W4Y A;  4A4A A;  3POV A;  3VAY A;  1E86 A;  4LDK A;  1AEP A;  1OCC C;  1I4Z A;  2EPN A;  1O87 A;  4NQF A;  3NKE A;  1VLT A;  3U3F A;  4C3B A;  3AG4 C;  2ASR A;  4EHP A;  3DMD A;  1JMW A;  5T1D B;  2OCC C;  3DM9 B;  3K1H A;  1CGO A;  4BPM A;  4DBQ A;  4I3M A;  2PF4 E;  4KNV A;  4ONS A;  2EIK C;  2EIN C;  3M1C B;  4JC7 A;  4OD5 A;  4YJW A;  4AE4 A;  1Z23 A;  3LLI A;  3KL4 A;  1PD1 A;  1QQ3 A;  4ZLC A;  5DS6 A;  3B29 A;  2G3V A;  2J9B A;  4O7G A;  4MVU A;  2R05 A;  3QW1 A;  2PX3 A;  2JX0 A;  2OJQ A;  2XLO A;  4K0D A;  3EFO B;  2XL4 A;  5T3W A;  4I1O B;  2IXN A;  1Q0K A;  3I4U A;  3N24 A;  4WJ0 A;  1E83 A;  1M6T A;  1GGQ A;  3BRJ A;  3RKO F;  3FHD A;  2EIM C;  4YN0 B;  4P9F A;  2HV7 A;  2P61 A;  3CEX A;  3PDM P;  4CSA A;  3K6B A;  3RVZ A;  3TJ6 A;  4CS9 C;  1APC A;  2WL8 A;  4YT2 A;  3O39 A;  3RQF A;  1BR2 A;  1Z7Q c;  4DBR A;  3B0P A;  2Y3D A;  1TKN A;  2XM4 A;  1AUE A;  3R2P A;  2ZXO A;  4WGZ A;  2LFD A;  4BJ5 C;  3L8I A;  1DOW A;  3O6X A;  1OCZ C;  2YL1 A;  3DKA A;  1D0Y A;  4CIH A;  1D0X A;  4DOZ A;  4K7B A;  4XWJ A;  4AK9 A;  1LE2 A;  4XEV A;  4D4N A;  4MQ9 F;  2L6G A;  1NU7 D;  2XLH A;  4IAR A;  4JTA B;  5E2Q A;  5KYN A;  1VYI A;  2CNW A;  1G4W R;  3ITF A;  1AVO B;  2E87 A;  3U0C A;  1EQ1 A;  3PMR A;  2OKU A;  3EGX A;  3JRM O;  2YL7 A;  1NBB A;  3QVY A;  4U5H A;  2VB6 A;  4JCZ A;  1HMO A;  1RMV A;  4CDY A;  1Y6D A;  3G50 A;  2EPM X;  1M2O A;  1H7I A;  2ICW G;  3AGU A;  3EZI A;  4JEA A;  3RQG A;  4OIO F;  2EIL C;  2UUI A;  1TQG A;  1YA9 A;  2A1D D;  1N1C A;  3LEO A;  3C8G D;  4FX5 A;  1NSG B;  2YLD A;  2R7Q A;  1T5O A;  1MNE A;  4U5G A;  4PK4 A;  2HFI A;  2HMZ A;  1ZU5 A;  4KNW A;  4G7O F;  2Y3B A;  3GEE A;  3S84 A;  2KNH A;  4JVS A;  2X51 A;  4LER A;  1JR8 A;  4JW1 A;  1CPR A;  4KI2 A;  3IQC A;  5COM A;  3AQB A;  5CIV A;  4J7T A;  4Q4Z F;  1NFN A;  2L6F A;  3SYN A;  3W2V A;  4N06 A;  2NG1 A;  2AU5 A;  2XS1 A;  4JCH A;  2EPO A;  1OXK A;  2YHS A;  3HJC A;  2QUP A;  2XSE A;  2AP3 A;  3SXK A;  2VAS A;  3GM2 A;  3U9M A;  3RIP A;  4G7H F;  1NU9 C;  1BR1 A;  3S28 A;  1MQV A;  2X0C A;  4U9D A;  3ZIB A;  4CIP A;  2JPU A;  3I5P A;  5A6J A;  4IJJ A;  2CW0 F;  3HKK A;  1Z3I X;  3M4B A;  3Q6N A;  3GM1 A;  2XLV A;  3AG2 C;  4M63 A;  3HLZ A;  3SXM A;  5DS4 A;  1MMG A;  1Z63 A;  2OEV A;  1LI7 A;  3EFO A;  4CS9 A;  2FAP B;  4D4X A;  3FXH A;  1TWC A;  1NG1 A;  1ZZP A;  3ABL C;  3KH2 A;  1UG7 A;  3GWL A;  3SXY A;  5DQT A;  5DS5 A;  3EGX B;  1H9T A;  2O9X A;  1FR0 A;  4JUR I;  3LNM B;  1PV3 A;  3J06 A;  2Q9B A;  5KYX A;  2Q9C A;  2YQY A;  4XEK A;  4QDL A;  2J7P D;  2P0N A;  2YKZ A;  2EPL X;  1WAS A;  3EGD A;  3ZG1 A;  3B71 A;  3T6B A;  2BE5 F;  3F47 A;  2HUJ A;  4MVZ A;  2MHR A;  4JE9 A;  4JTD B;  1HE1 A;  4RDA A;  1HY5 A;  1C03 A;  2RD9 A;  2KK1 A;  5L3Q A;  1ZHT A;  2OEX A;  1A7E A;  3LJB A;  4OIQ F;  4K1O A;  1D1C A;  5AC5 A;  2PP4 A;  4PJL A;  4U5D E;  3DD7 A;  3GM3 A;  4YK5 A;  2G62 A;  3A11 A;  3JYH A;  3O10 A;  4O6N A;  1LPE A;  5CI8 A;  3SNH A;  1XZP A;  2Z15 A;  3ZC4 A;  4YT4 A;  5KYY A;  1QSP A;  1Z5Z A;  4R32 A;  1M57 C;  2LP4 A;  4RBN A;  1V54 C;  2Q7R A;  2YEV A;  2IOQ A;  4HFK B;  1CGN A;  1U0B B;  4ULW A;  3EG9 A;  1TWG A;  2HSQ A;  1JAF A;  1QVX A;  2KYH A;  3L34 A;  4DJ9 A;  3TOM A;  1BR4 A;  4E18 A;  1RXQ A;  1FFT C;  2OG2 A;  4E7S A;  3R7C A;  1T6I A;  1Y4C A;  1OW6 A;  2OU6 A;  2OQM A;  3U2L A;  4MVR A;  2KQ9 A;  4CJG A;  4DVZ A;  5A6B A;  2PFD A;  3NYM A;  3S27 A;  3LES A;  3MYI A;  1TWH A;  2J46 A;  1LKX A;  4U5C E;  4E0I A;  2IYL D;  3NKD A;  4KBL A;  3RQE A;  5B1B C;  3C62 A;  5KYU B;  4O6M A;  5JVE A;  1Q0F A;  2Q3T A;  3LUT B;  3V5Y A;  1XWJ A;  2XLW A;  1SF8 A;  1KTM A;  2P7V A;  3HNL A;  2D4U A;  3BEH A;  3W8H A;  1OXB A;  4J32 B;  3DE8 A;  2KSF A;  4NTF A;  1UFB A;  5E3A A;  3NYJ A;  1D0Z A;  1MND A;  3T9O A;  2MWQ A;  3I5Q A;  3GOR A;  4XPY A;  3C63 A;  5B1A C;  3IQT A;  4U9E A;  1HMD A;  2Y3H A;  4JJF A;  4WGY A;  1K05 A;  2A0B A;  3B0V C;  1RKE A;  4C3D A;  3Q7G A;  2R7V A;  1BZ4 A;  3M15 A;  3QMK A;  2VCA A;  3UR3 C;  1R5I D;  4CDV A;  2YL3 A;  4ZLD A;  1LE4 A;  2OOC A;  2RSE B;  1W2W A;  2CNW D;  2HJM A;  2DGJ A;  2C04 A;  2EPK X;  2QNL A;  1TWA A;  1B68 A;  3FAJ A;  3IPM O;  4LLC A;  4MND A;  1OKK A;  4NCQ A;  3QVZ A;  4E17 A;  1FAP B;  1XZQ A;  1VK5 A;  2FFH A;  4PR9 A;  2NUP A;  4BJT A;  5KYY B;  3OWT A;  1FMW A;  4XQ1 A;  4P6I C;  1S05 A;  3X1O A;  2UUH A;  1LIH A;  2IXO A;  3A9C A;  3H65 A;  4W8P A;  4B6I A;  5A6A A;  4LLE A;  4XPW A;  2J8W A;  5T3T A;  4BG0 A;  1LVK A;  4CS7 A;  2HV6 A;  3E70 C;  3ZWI A;  1K40 A;  1JOG A;  2R25 A;  2YLG A;  1T6U A;  3H2V A;  1U6H A;  4GYT A;  3T6G B;  3KMI A;  4FWV A;  4EKW A;  2J9V A;  5JP7 A;  1D1A A;  3ASN C;  4C7O A;  4Q5S F;  3CQZ A;  3GAN A;  3V7O A;  4PAC A;  3F46 A;  3PHF 2;  4OD4 A;  5AC4 A;  3NMI A;  3G4X A;  4X0R A;  1D1B A;  5FZT A;  4EUK B;  3ECS A;  1QPU A;  3NYL A;  3HNI A;  1JPN A;  2PNO A;  2R03 A;  3AG3 C;  4L6R A;  3Q6M A;  3JTL O;  4BEM J;  2HS5 A;  5D92 A;  1NLX A;  1NFO A;  2R7O A;  3K66 A;  4QI2 A;  3RFY A;  2Q4F A;  3W2W A;  3TQO A;  4HFF B;  256B A;  5JUA A;  2DYR C;  4XLN F;  1E84 A;  2BL2 A;  1YZA A;  3H2U A;  2YZS A;  2NUT B;  3EG9 B;  4PJJ A;  1ZHX A;  4ANJ A;  3NRH A;  3JSZ A;  4Z9I A;  3RVY A;  5B3S C;  4BJ1 A;  5DLJ A;  2L81 A;  2W9Y A;  1G4U S;  1FTS A;  2HZ8 A;  4HE8 D;  2IXP A;  2H7O A;  1L7C A;  2Y39 A;  4CBE A;  5L0D A;  3NMK A;  3OA1 A;  4C7O B;  1NZE A;  3FDQ A;  1V4A A;  4MS2 A;  1VYK A;  3ZSU A;  2WZL A;  2YRF A;  3CAX A;  1Z6A A;  4EWC A;  3DAF A;  2Y69 C;  3ZTM A;  1C17 M;  2HJ3 A;  4U5E E;  1J8M F;  1VLS A;  2FGY A;  3EPV A;  2VCC A;  1M2V B;  2VCB A;  4N6H A;  3RH3 A;  1OQC A;  1EKY A;  2ETS A;  3U8P A;  1VMA A;  4U5B E;  4N6C A;  3T4R A;  3WAQ A;  3LAY A;  2XXA A;  5F5F A;  2IM8 A;  1GM5 A;  3MYF A;  2Y3G A;  1LS1 A;  3AG1 C;  4OIN F;  4PFO A;  3S29 A;  2DYS C;  1YLM A;  2WZF A;  1YYJ A;  3GWN A;  3NMJ A;  3US6 A;  4AE4 B;  5A69 A;  5BQI A;  2YWA A;  3AGT A;  1LM3 B;  2R9R B;  4MVQ A;  3JYY A;  1SYQ A;  1Q0G A;  2WVN A;  4YL0 A;  3S0X A;  3CZ6 A;  3DZA A;  2A0U A;  4JEB A;  3RF3 A;  4JJG A;  3C18 A;  5JSL A;  4JZA A;  3KPH A;  4EIY A;  1CGM E;  5FCL A;  3DJN B;  2JD3 A;  3ABM C;  1FFH A;  4BEJ A;  3V5Z A;  3GOD A;  3KYJ A;  1A0B A;  4AL0 A;  2J9W A;  2VH3 A;  3C7J A;  4Z9J A;  2GFH A;  3UMH A;  4CX9 A;  3LS0 A;  3AOU A;  2ZXP A;  5HV9 A;  5L0H A;  3T6J A;  1ST6 A;  3DJU B;  4E0H A;  3HNJ A;  4I44 A;  5AGF A;  1S7Z A;  2XXA B;  2F22 A;  5L3V A;  5IY5 C;  1E85 A;  2XRH A;  1ORJ A;  2M4E A;  3U3B A;  1G5Z A;  2L7A A;  3DAG A;  1IZM A;  4CJO A;  2HKV A;  2WB7 A;  3GEI A;  1RKC A;  1OCR C;  1YYX A;  2QE9 A;  1T9K A;  1V55 C;  2P6V A;  4AL1 A;  4AX2 A;  4MW8 A;  4YWQ A;  1KNY A;  3RYL A;  3S9O A;  3NDB B;  4MVO A;  3ZQV A;  4FAP B;  1O3U A;  5KYW B;  4Z9H A;  2IXM A;  1HW1 A;  3ASO C;  3C8Z A;  3CSK A;  3O55 A;  1YVI A;  2W4B A;  3TUL A;  3LEV A;  4MVM A;  3U5S A;  1L3P A;  3W8I A;  1ZHY A;  2BC5 A;  1FMV A;  3UGO A;  3JT1 A;  4IGG A;  1EI7 A;  2IBF A;  4HEA J;  3U8V A; 
#chains in the Genus database with same CATH homology
 1FNT c;  1AVO B;  1Z7Q c;  1YAR O;  3JSE O;  1YA7 O;  3JRM O;  1YAU O;  3IPM O;  3JTL O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...