5JVEA

L16i mutant of cytochrome c prime from alcaligenes xylosoxidans: ferrous state
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
125
structure length
125
Chain Sequence
b'EFAKPEDAVKYRQSAITLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cytochrome c'
molecule tags Electron transport
source organism Alcaligenes xylosoxydans xylosoxydans
publication title Engineering proximal vs. distal heme-NO coordination via dinitrosyl dynamics: implications for NO sensor design.
pubmed doi rcsb
total genus 49
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2016-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 5jveA00
3IQ5A 1CPQA 2XLOA 4CDAA 3M4BA 1JAFA 1CPRA 2YLIA 1NBBA 5JT4A 1E84A 3FOOA 1LM3B 1E85A 3C63A 3ZTMA 2YL3A 4U9DA 4IB4A 3U8PA 5JRAA 4U9EA 4ER9A 4N4WA 2XL6A 3C62A 4N6HA 4JKVA 1QPUA 5B3IA 4D4NA 1YZAA 4CDVA 4IARA 1CGOA 3M4CA 5JS5A 4WGYA 1APCA 1A7VA 4CIPA 3HNIA 5JSLA 3TOMA 2XL8A 4CJOA 1YYJA 4WGZA 4D4XA 4CJGA 4CDYA 1MQVA 1E86A 4CX9A 3ZQYA 5JUAA 2YL1A 3NMKA 1GQAA 3TOLA 2CCYA 3QVYA 3QW0A 2XM4A 2QLAA 1YYXA 2XLVA 4ULVA 2YL7A 3NMIA 4JEAA 5AGFA 1BBHA 2XLMA 2XM0A 4IAQA 1YZCA 3VRCA 2XLDA 1EKYA 3FOPA 2BC5A 2YL0A 4JEBA 2J8WA 1QQ3A 3HNLA 3ZWIA 3DE9A 4L6RA 1RCPA 2XLEA 3ZTZA 3HNKA 3QW1A 5JP7A 1M6TA 3IQ6A 3HNJA 3NMJA 5JLIA 4EIYA 3QVZA 2XLWA 2YLGA 3DE8A 3ZQVA 2J9BA 4JE9A 3L1MA 256BA 2YLDA 3M79A 4NC3A 1E83A 2XLHA 1S05A 3M15A 5JVEA 2YKZA 1CGNA
chains in the Genus database with same CATH superfamily
1NFNA 4WJ0A 3EH1A 3PHF2 2NG1A 2R02A 2LIGA 1T5OA 3H2UA 3UMHA 5FCLA 3M4BA 1HMOA 1OW7A 3GEEA 3KPHA 4K0DA 1F1MA 1ORJA 1NBBA 2BE5F 2YVKA 4EWCA 1ZYRF 4N06A 1OCOC 1RKCA 4ZLCA 1E84A 3CQZA 4MVUA 2CNWA 4MVZA 2G62A 5BQGA 1E85A 2R7RA 5L0GA 3Q7GA 4BEMJ 2HMZA 3U8PA 3AG4C 5B1BC 4X0RA 2AP3A 2O9XA 4JURI 1PV3A 1S7ZA 2CGEA 1H6GA 2GAQA 2OQMA 2PX3A 3HTKC 4U9EA 3U9JA 3W2WA 5A6AA 4JIOA 3C62A 2WVNA 3ECSA 4JKVA 2Q9BA 2IM8A 2WVQA 3RFYA 3F47A 1YZAA 2I15A 3JSZA 1XWJA 1TWCA 4IARA 4ANJA 1K05A 3RW0A 4DVYP 5KYUA 2DI3A 2Y3DA 1W2WA 1WN0A 2I8BA 3ZC4A 5JS5A 1TFKB 4WGYA 4P9FA 1WOLA 1YA9A 1A7VA 1KU2A 2EILC 3SYNA 4CIPA 3JTLO 4LERA 4JVSA 4PJNA 4AE4A 4EBJA 1D0YA 1R4TA 2D5RB 4IJJA 1OQCA 2Y39A 1ZHXA 3EFOA 2WL8A 4MNDA 5L0DA 1YYJA 1C17M 4OD4A 4WGZA 5E3CA 3T4RA 4D4XA 1MMDA 3TJ5A 4XEKA 1SMYF 3ATPA 1MMGA 2YHSA 2WZLA 3K66A 4JTCB 1YARO 3DKAA 5TJ5E 4JCHA 3NMKA 3KL4A 1GQAA 2HMQA 5F28E 1A41A 1MMAA 4NY3A 3UNGC 4CS8A 4DXWA 4KNVA 3DM5A 3TOLA 3Q6MA 4YJWA 3IHUA 2LCHA 4EKWA 3TD7A 4U5CE 4MVSA 3C8ZA 3KH2A 1YYXA 4CSAA 2YL7A 4Q4ZF 2GDCA 5AGFA 1Z23A 3DI5A 4O6NA 1GS9A 2XLMA 1ZHZA 2EIJC 2XM0A 3MLGA 4XPXA 4PACA 2EPOA 2Q00A 4RDAA 5BQHA 4OIRF 4CBEA 5KYYB 3GWNA 4ZLDA 2NUPB 2UUIA 4JJGA 3ZSUA 2ETSA 2PNOA 4DVZA 1ZU4A 2Q9CA 5CIVA 5L0FA 3AOUA 2R7OA 2BC5A 2J7PA 2LK4A 4JEBA 5K0IA 3RQEA 1QQ3A 1O3UA 2KQ9A 2VC9A 5E3AA 4A2NB 3ZWIA 3LNMB 3FXHA 4AK9A 2GA0A 4ONSA 1RJ9B 1LS1A 1JMWA 2P61A 3HLZA 4L6RA 4XPWA 4XLNF 4P6IC 2ZXRA 3EGDA 3S29A 4YT8A 3B71A 3QZCA 2HSBA 3DMDA 2W4BA 2R7WA 3ABKC 4OIPF 1JOGA 1V54C 5T1DB 3CAXA 2XS8A 2ASRA 4IGGA 1YA7O 3H65A 1N1CA 1V55C 2HZ8A 2PP4A 3M1CB 5CI9A 4G0HA 1D0ZA 5A6JA 1Q0GA 2R7QA 1VB5A 4AL1A 1RKEA 256BA 2NUPA 2VCCA 4BJ6C 4HFFB 2KGOA 2MHRA 4J7YA 2D4UA 1TKNA 2QE9A 4IWBA 1Z6AA 3JSEO 4C3EA 1JRAA 4JC7A 4YK5A 4CIHA 3LS0A 1PD0A 3M15A 2W9YA 5KYYA 3T6GB 4EHPA 1OCCC 2OJQA 4DOZA 3LS1A 1FFHA 3IQ5A 3QMKA 2VCAA 2KW3C 4K7BA 1T9KA 1T6QA 2LD6A 4CDAA 2DB4A 2PFDA 1VK5A 4O6YA 4B6IA 1A0BA 1JAFA 4YWQA 4YL1A 3K6BA 4OINF 4FESA 5F5HA 3U5SA 3LEOA 1H9TA 5JT4A 4BJ6A 4XLPF 5KYWA 3GODA 2GFHA 1LM3B 1NU9C 1D1BA 1FFTC 3AQBA 1WWPA 3C8GD 4H4KC 3T6JA 3UGPA 4E0HA 4CS9A 4NTAA 2YL3A 4JZAA 4Q5SF 4E18A 2P0NA 4IB4A 3DWWA 1G8XA 3CZ6A 1VYKA 2B0HA 2MYSA 1HW1A 2L6GA 5JRAA 4ER9A 1OXKA 2IXMA 2CNWD 2HV6A 2QUPA 2RD9A 3A11A 1MMNA 1ZHYA 4BJTA 4N6HA 3I5PA 4E0IA 2MWQA 3GEIA 2Y3HA 5BQIA 1FR0A 2J9WA 2L6HA 4QI0A 1OW6A 3T9OA 1Z3IX 3RQGA 4AL0A 2R05A 4NTFA 4U5HA 3DXJF 2OKUA 1Z7Qc 3W8IA 2V3CC 4XQ1A 1CGME 5JSLA 3PDMP 1Y4CA 1SYQA 2XL8A 4MTFA 4E7SA 2F22A 2HUJA 4MVQA 4G7OF 4CJGA 3ZIBA 1GGQA 2WVOA 2R7UA 3J06A 4XEFA 3MBGA 1FMWA 2C03A 3C18A 4EUKB 5B3SC 2YEVA 4DBQA 1ZW3A 2YL1A 4W8PA 4J7TA 1LI5A 3VYWA 4FWVA 3G4ZA 3NDBB 2R7XA 3HKKA 1FNTc 2QTVA 4YT5A 1LVKA 1VLTA 2OCCC 5L0IA 1Y6DA 2CCYA 3EGDB 3QVYA 1WTYA 3QW0A 1OW8A 2XL4A 3X2QC 4C3BA 4M63A 3NMIA 3R2PA 1YLMA 4JEAA 1BBHA 2AU5A 5EGYA 2J7PD 3EH2A 4IAQA 1ORYA 5COGA 2ZXPA 1C03A 2EIMC 4O6MA 3ZDLA 1NZEA 4BJ5A 5AC4A 3VRCA 5DS4A 3U0CA 3EFOB 3RKOF 1B68A 3V5YA 1NG1A 4DBRA 2P6VA 1HE1A 3FVYA 3EQLF 1BR1A 4JCZA 1QLEC 2NPUA 1Q0FA 4LLEA 4RBNA 1EKYA 3B29A 5DS5A 1H7IA 2P1AA 2Q3TA 1D1AA 3O10A 1NSGB 3ABMC 3RVYA 2L7AA 3KYIA 4NCQA 4F4BA 1AVOB 3LLIA 4H54A 3AGUA 1NFOA 3S90A 2XLEA 3EG9B 1I5NA 2R25A 4QI2A 1M2VA 2YZSA 3LUTB 4MVRA 3S27A 5L0HA 4I1MA 4IRUA 3OA1A 3DJUB 3ZVRA 3IQ6A 3Q6NA 1DOVA 2FAPB 1M57C 3FMSA 3NMJA 3WG7C 5JLIA 1Z5ZA 2YWAA 1LE4A 4E7ZA 1QZXA 4DJ9A 1D0XA 4MW8A 4JJFA 1AEPA 3FAJA 2KYHA 4MS2A 4MVMA 3DD7A 1TQGA 3L8IA 3NG1A 3SEOA 4CS7A 1SZIA 2J9BA 4JE9A 2OEVA 3HJCA 2G3VA 2XSEA 1O5HA 2PBEA 3FAPB 3G4XA 2DYRC 2A6EF 3M79A 2L6FA 2XRHA 4JRZA 4NC3A 4W8KA 4YN0B 1I4ZA 3O55A 3ASOC 3SZRA 1H9GA 3AG3C 3KYJA 3C8GB 1AUEA 3JRTA 1U6HA 2XLHA 3NYMA 3NYLA 5JVEA 2YKZA 1MNEA 2HKVA 2IXOA 5KYWB 2GWWA 2W45A 3NKDA 4FX5A 4XEVA 4OIQF 2LFFA 1TWHA 1JR8A 1UG7A 2XLOA 1M2VB 2HJMA 3SXYA 3ABLC 1LPEA 2PF4E 1CPRA 1M56C 2YLIA 3NRHA 1ORSC 1OKKD 1UFBA 3OWTA 2XXAB 5A6KA 2A1DD 2NUTA 1DOWA 1G4US 2H8AA 5EHHA 2Y3BA 4PJLA 3FOOA 2Q7RA 4BEJA 4DRHB 1NU7D 2IYLD 1T6UA 4LDQA 3K33A 3AG2C 1U89A 2R7VA 3C63A 2OG2A 4OIOF 1WASA 3O39A 4U5DE 4U9DA 2A0UA 1ZZPA 4NTBA 2VASA 4J32B 4Z9HA 2HFIA 2XL6A 3DZAA 3LEVA 1QPUA 1J8MF 5B3IA 3E70C 3CEXA 3K1IC 1L7CA 2WZGA 3S9OA 3QTHA 4MW3A 1O87A 1OKKA 1Q0DA 1V74B 1CGOA 3G50A 3V5ZA 5KYNA 2M64A 2C04A 3E9VA 1E2XA 1GM5A 4WABA 5F5FA 3GM3A 3CSKA 4PR9A 3B0PA 5EK0A 1HMDA 2NSGA 2B0JA 3HNIA 3MX3A 3B9QA 3K1IA 4LDKA 1TFOB 2EIKC 3PMRA 3V5XA 1MNDA 4LACB 2J0XA 4XTKA 2R7TA 4CDVA 3EGXA 5D92A 2R9RB 3PCVA 1E86A 1MQVA 4IAOA 2A6HF 3DAFA 3SXZA 4CX9A 1JPJA 3N2ZB 3AQCA 5JUAA 4G7ZF 3RYLA 5A6BA 2OEXA 3UMKA 4OD5A 5GPGB 3UMIA 5A6BD 1OCRC 1TWAA 4G78A 4U5BE 4N6CA 4I1OB 2TMVP 1LI7A 2H7BA 2L9JA 4LLCA 1I4YA 1TWGA 4HFKB 2XM4A 2QLAA 4ULVA 3T6BA 4JW1A 3K7DA 3MYIA 3US6A 5AC5A 4AE4B 1KTMA 2IBFA 1R5ID 2FGYA 3BRJA 1XZQA 3SP1A 1Q0MA 3IPMO 3SXKA 2KC3A 3TQOA 2OU6A 5KYXA 3FDQA 1BR4A 2DGJA 2R03A 4BG0A 4FAPB 3KMIA 5KYUB 1Q0KA 1D1CA 2G3KA 1RKEB 4O7GA 1LS4A 2CDQA 4Q7CA 3FOPA 5FZTA 3U3BA 4PFPA 2YL0A 1OR3A 2CYDA 3AGTA 4MVOA 1FAPB 3RQFA 3B0VC 3K1HA 3OEOA 2Q9AA 1T01A 4C3DA 4MQ9F 1K40A 3DE9A 1LKXA 4DRIB 1RCPA 1YVIA 3ZTZA 2Q4FA 2Y69C 5BUOA 3B0UX 3WODF 2R7SA 1M6TA 3MFNA 4R32A 1SF8A 2NSFA 1IZMA 1QSPA 2QY9A 4I44A 3C7JA 3VM6A 4AX2A 2EPLX 3QVZA 3MYFA 2XLWA 1QKRA 3N0TA 1ZVZA 1EA8A 2LFDA 2A69F 1VTMP 4MTGA 3O6XA 4HE8D 2AVKA 2ZXWC 3ZG1A 4KC9A 5DQZA 1VMAA 4A4AA 2IOQA 1J8YF 2YLDA 4PFOA 4RD9A 1YDIA 2Z15A 3V7OA 5DQTA 2KK1A 1G4WR 1EI7A 2KNHA 3JRMO 2VCBA 2HS5A 3U2MA 3U3FA 1HW2A 3H2VA 3C8GA 1S05A 2JX0A 1WGWA 1BDJB 2H7OA 2ZPAA 1CGNA 1WATA 3IQTA 3LJBA 4HEAJ 4NQFA 4D4NA 2KSFA 4JTAB 5DVWA 4Z9IA 5HV9A 1SR2A 1CPQA 3SXMA 2EPNA 4QDLA 2J9VA 3IEEA 5DLJA 4EBBA 1FMVA 4KBLA 1RJ9A 2J9UA 3AJMA 1XZPA 3RVZA 1QVXA 4G7HF 3JT1A 4YT2A 3A9CA 2EINC 2KJGA 3EG9A 3UR3C 3ZTMA 2A68F 1V4AA 5L0JA 2VB6A 2AWCA 2DYSC 1VYIA 3DM9B 3NYJA 2BL2A 4I3MA 3Q7LA 3GORA 3L0IA 3U9MA 4N4WA 1OXBA 1T6IA 2CW0F 3S0XA 1PCXA 3DJNB 3EHNA 3IQCA 5L3QA 3N24A 5KYXB 2E87A 4UDVA 2H7VC 2ICWG 1HY5A 2J46A 1YJGA 4EBKA 2LSEA 3DAGA 5L3VA 3M4CA 2HJ3A 2YQYA 5A69A 2YRFA 3R7CA 4KI2A 1APCA 4YT4A 2ZD9A 4CS8C 1L3PA 2PX0A 4XWJA 5DS6A 1RMVA 3X1OA 2LQGA 4YL0A 4GEHA 1PD1A 4ULWA 3GWLA 3FHDA 4DRJB 2ZXOA 3TOMA 2VH3A 3UGOA 4CJOA 4PJMA 5IY5C 1YAUO 3VAYA 3AG1C 3I5QA 3W2VA 3VF0A 4CDYA 2L81A 3SNHA 2Y3GA 3ZQYA 5B1AC 3ASNC 2P7VA 3W4YA 1K04A 3BEHA 3S84A 2FFHA 2OOCA 4PK4A 2JPUA 1VLSA 4MTOA 5COMA 2XXAA 2OJED 4PJJA 2IXNA 5CI8A 5D91A 3POVA 3RIPA 4XPYA 3RF3A 4Z9JA 3TJ6A 1ST6A 2J45A 1A7EA 3TK0A 4BJ1A 4E17A 2XLVA 4U5EE 1Z63A 4JTDB 1FTSA 1C02A 1ZU5A 4J30B 4K1OA 2IXPA 2LP4A 3LESA 1HE9A 1VOMA 1EQ1A 4O79A 3JYHA 4P9TA 4U5GA 1YZCA 3GM2A 5E2QA 1ZW2A 4GYTA 5HSWA 3I4UA 2XLDA 2JD3A 5T3TA 4KNWA 2XS1A 3EZIA 3LLKA 3KKBA 3ITFA 2J8WA 2EPKX 3GANA 4C7OB 3HNLA 3JCUQ 1IW7F 1TR2A 2AWYA 2NUTB 3EJNA 1LIHA 3EZHA 5E33A 3WHNA 2EPMX 2RSEB 4CSAC 2HSQA 4YL3A 1JPNA 3LAYA 3NKEA 2WZFA 3GEHA 3HNKA 3QW1A 1ZHWA 2J0WA 1LE2A 1OR2A 5JP7A 3U2LA 3W8HA 1U0BB 3GM1A 1BR2A 3HNJA 3RH3A 1ZHTA 4EIYA 3EPVA 3L8JA 3F46A 3JZ0A 1A7DA 1OCZC 2YLGA 1M2OA 2W4MA 3S28A 1KNYA 2UUHA 2HV7A 3EHMA 3DE8A 3EGXB 4LDRA 3ZQVA 4GQHA 2X0CA 2WB7A 3L34A 3L1MA 4BPMA 3LNRA 2M4EA 1RXQA 1BZ4A 2A0BA 4U5FE 3JYYA 3U8VA 4CS9C 1E83A 1NLXA 4BJ5C 5L0CA 3TULA 1G5ZA 5T3WA 4C7OA 5COFA 3WAQA 2V26A 2X51A 2QNLA
chains in the Genus database with same CATH topology
3IQ5A 1CPQA 2XLOA 4CDAA 3M4BA 1JAFA 1CPRA 2YLIA 1NBBA 5JT4A 1E84A 3FOOA 1LM3B 1E85A 3C63A 3ZTMA 2YL3A 4U9DA 4IB4A 3U8PA 5JRAA 4U9EA 4ER9A 4N4WA 2XL6A 3C62A 4N6HA 4JKVA 1QPUA 5B3IA 4D4NA 1YZAA 4CDVA 4IARA 1CGOA 3M4CA 5JS5A 4WGYA 1APCA 1A7VA 4CIPA 3HNIA 5JSLA 3TOMA 2XL8A 4CJOA 1YYJA 4WGZA 4D4XA 4CJGA 4CDYA 1MQVA 1E86A 4CX9A 3ZQYA 5JUAA 2YL1A 3NMKA 1GQAA 3TOLA 2CCYA 3QVYA 3QW0A 2XM4A 2QLAA 1YYXA 2XLVA 4ULVA 2YL7A 3NMIA 4JEAA 5AGFA 1BBHA 2XLMA 2XM0A 4IAQA 1YZCA 3VRCA 2XLDA 1EKYA 3FOPA 2BC5A 2YL0A 4JEBA 2J8WA 1QQ3A 3HNLA 3ZWIA 3DE9A 4L6RA 1RCPA 2XLEA 3ZTZA 3HNKA 3QW1A 5JP7A 1M6TA 3IQ6A 3HNJA 3NMJA 5JLIA 4EIYA 3QVZA 2XLWA 2YLGA 3DE8A 3ZQVA 2J9BA 4JE9A 3L1MA 256BA 2YLDA 3M79A 4NC3A 1E83A 2XLHA 1S05A 3M15A 5JVEA 2YKZA 1CGNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IQ5 A;  1CPQ A;  2XLO A;  4CDA A;  3M4B A;  1JAF A;  1CPR A;  2YLI A;  1NBB A;  5JT4 A;  1E84 A;  3FOO A;  1LM3 B;  1E85 A;  3C63 A;  3ZTM A;  2YL3 A;  4U9D A;  4IB4 A;  3U8P A;  5JRA A;  4U9E A;  4ER9 A;  4N4W A;  2XL6 A;  3C62 A;  4N6H A;  4JKV A;  1QPU A;  5B3I A;  4D4N A;  1YZA A;  4CDV A;  4IAR A;  1CGO A;  3M4C A;  5JS5 A;  4WGY A;  1APC A;  1A7V A;  4CIP A;  3HNI A;  5JSL A;  3TOM A;  2XL8 A;  4CJO A;  1YYJ A;  4WGZ A;  4D4X A;  4CJG A;  4CDY A;  1MQV A;  1E86 A;  4CX9 A;  3ZQY A;  5JUA A;  2YL1 A;  3NMK A;  1GQA A;  3TOL A;  2CCY A;  3QVY A;  3QW0 A;  2XM4 A;  2QLA A;  1YYX A;  2XLV A;  4ULV A;  2YL7 A;  3NMI A;  4JEA A;  5AGF A;  1BBH A;  2XLM A;  2XM0 A;  4IAQ A;  1YZC A;  3VRC A;  2XLD A;  1EKY A;  3FOP A;  2BC5 A;  2YL0 A;  4JEB A;  2J8W A;  1QQ3 A;  3HNL A;  3ZWI A;  3DE9 A;  4L6R A;  1RCP A;  2XLE A;  3ZTZ A;  3HNK A;  3QW1 A;  5JP7 A;  1M6T A;  3IQ6 A;  3HNJ A;  3NMJ A;  5JLI A;  4EIY A;  3QVZ A;  2XLW A;  2YLG A;  3DE8 A;  3ZQV A;  2J9B A;  4JE9 A;  3L1M A;  256B A;  2YLD A;  3M79 A;  4NC3 A;  1E83 A;  2XLH A;  1S05 A;  3M15 A;  5JVE A;  2YKZ A;  1CGN A; 
#chains in the Genus database with same CATH topology
 1NFN A;  4WJ0 A;  3EH1 A;  3PHF 2;  2NG1 A;  2R02 A;  2LIG A;  1T5O A;  3H2U A;  3UMH A;  5FCL A;  3M4B A;  1HMO A;  1OW7 A;  3GEE A;  3KPH A;  4K0D A;  1F1M A;  1ORJ A;  1NBB A;  2BE5 F;  2YVK A;  4EWC A;  1ZYR F;  4N06 A;  1OCO C;  1RKC A;  4ZLC A;  1E84 A;  3CQZ A;  4MVU A;  2CNW A;  4MVZ A;  2G62 A;  5BQG A;  1E85 A;  2R7R A;  5L0G A;  3Q7G A;  4BEM J;  2HMZ A;  3U8P A;  3AG4 C;  5B1B C;  4X0R A;  2AP3 A;  2O9X A;  4JUR I;  1PV3 A;  1S7Z A;  2CGE A;  1H6G A;  2GAQ A;  2OQM A;  2PX3 A;  3HTK C;  4U9E A;  3U9J A;  3W2W A;  5A6A A;  4JIO A;  3C62 A;  2WVN A;  3ECS A;  4JKV A;  2Q9B A;  2IM8 A;  2WVQ A;  3RFY A;  3F47 A;  1YZA A;  2I15 A;  3JSZ A;  1XWJ A;  1TWC A;  4IAR A;  4ANJ A;  1K05 A;  3RW0 A;  4DVY P;  5KYU A;  2DI3 A;  2Y3D A;  1W2W A;  1WN0 A;  2I8B A;  3ZC4 A;  5JS5 A;  1TFK B;  4WGY A;  4P9F A;  1WOL A;  1YA9 A;  1A7V A;  1KU2 A;  2EIL C;  3SYN A;  4CIP A;  3JTL O;  4LER A;  4JVS A;  4PJN A;  4AE4 A;  4EBJ A;  1D0Y A;  1R4T A;  2D5R B;  4IJJ A;  1OQC A;  2Y39 A;  1ZHX A;  3EFO A;  2WL8 A;  4MND A;  5L0D A;  1YYJ A;  1C17 M;  4OD4 A;  4WGZ A;  5E3C A;  3T4R A;  4D4X A;  1MMD A;  3TJ5 A;  4XEK A;  1SMY F;  3ATP A;  1MMG A;  2YHS A;  2WZL A;  3K66 A;  4JTC B;  1YAR O;  3DKA A;  5TJ5 E;  4JCH A;  3NMK A;  3KL4 A;  1GQA A;  2HMQ A;  5F28 E;  1A41 A;  1MMA A;  4NY3 A;  3UNG C;  4CS8 A;  4DXW A;  4KNV A;  3DM5 A;  3TOL A;  3Q6M A;  4YJW A;  3IHU A;  2LCH A;  4EKW A;  3TD7 A;  4U5C E;  4MVS A;  3C8Z A;  3KH2 A;  1YYX A;  4CSA A;  2YL7 A;  4Q4Z F;  2GDC A;  5AGF A;  1Z23 A;  3DI5 A;  4O6N A;  1GS9 A;  2XLM A;  1ZHZ A;  2EIJ C;  2XM0 A;  3MLG A;  4XPX A;  4PAC A;  2EPO A;  2Q00 A;  4RDA A;  5BQH A;  4OIR F;  4CBE A;  5KYY B;  3GWN A;  4ZLD A;  2NUP B;  2UUI A;  4JJG A;  3ZSU A;  2ETS A;  2PNO A;  4DVZ A;  1ZU4 A;  2Q9C A;  5CIV A;  5L0F A;  3AOU A;  2R7O A;  2BC5 A;  2J7P A;  2LK4 A;  4JEB A;  5K0I A;  3RQE A;  1QQ3 A;  1O3U A;  2KQ9 A;  2VC9 A;  5E3A A;  4A2N B;  3ZWI A;  3LNM B;  3FXH A;  4AK9 A;  2GA0 A;  4ONS A;  1RJ9 B;  1LS1 A;  1JMW A;  2P61 A;  3HLZ A;  4L6R A;  4XPW A;  4XLN F;  4P6I C;  2ZXR A;  3EGD A;  3S29 A;  4YT8 A;  3B71 A;  3QZC A;  2HSB A;  3DMD A;  2W4B A;  2R7W A;  3ABK C;  4OIP F;  1JOG A;  1V54 C;  5T1D B;  3CAX A;  2XS8 A;  2ASR A;  4IGG A;  1YA7 O;  3H65 A;  1N1C A;  1V55 C;  2HZ8 A;  2PP4 A;  3M1C B;  5CI9 A;  4G0H A;  1D0Z A;  5A6J A;  1Q0G A;  2R7Q A;  1VB5 A;  4AL1 A;  1RKE A;  256B A;  2NUP A;  2VCC A;  4BJ6 C;  4HFF B;  2KGO A;  2MHR A;  4J7Y A;  2D4U A;  1TKN A;  2QE9 A;  4IWB A;  1Z6A A;  3JSE O;  4C3E A;  1JRA A;  4JC7 A;  4YK5 A;  4CIH A;  3LS0 A;  1PD0 A;  3M15 A;  2W9Y A;  5KYY A;  3T6G B;  4EHP A;  1OCC C;  2OJQ A;  4DOZ A;  3LS1 A;  1FFH A;  3IQ5 A;  3QMK A;  2VCA A;  2KW3 C;  4K7B A;  1T9K A;  1T6Q A;  2LD6 A;  4CDA A;  2DB4 A;  2PFD A;  1VK5 A;  4O6Y A;  4B6I A;  1A0B A;  1JAF A;  4YWQ A;  4YL1 A;  3K6B A;  4OIN F;  4FES A;  5F5H A;  3U5S A;  3LEO A;  1H9T A;  5JT4 A;  4BJ6 A;  4XLP F;  5KYW A;  3GOD A;  2GFH A;  1LM3 B;  1NU9 C;  1D1B A;  1FFT C;  3AQB A;  1WWP A;  3C8G D;  4H4K C;  3T6J A;  3UGP A;  4E0H A;  4CS9 A;  4NTA A;  2YL3 A;  4JZA A;  4Q5S F;  4E18 A;  2P0N A;  4IB4 A;  3DWW A;  1G8X A;  3CZ6 A;  1VYK A;  2B0H A;  2MYS A;  1HW1 A;  2L6G A;  5JRA A;  4ER9 A;  1OXK A;  2IXM A;  2CNW D;  2HV6 A;  2QUP A;  2RD9 A;  3A11 A;  1MMN A;  1ZHY A;  4BJT A;  4N6H A;  3I5P A;  4E0I A;  2MWQ A;  3GEI A;  2Y3H A;  5BQI A;  1FR0 A;  2J9W A;  2L6H A;  4QI0 A;  1OW6 A;  3T9O A;  1Z3I X;  3RQG A;  4AL0 A;  2R05 A;  4NTF A;  4U5H A;  3DXJ F;  2OKU A;  1Z7Q c;  3W8I A;  2V3C C;  4XQ1 A;  1CGM E;  5JSL A;  3PDM P;  1Y4C A;  1SYQ A;  2XL8 A;  4MTF A;  4E7S A;  2F22 A;  2HUJ A;  4MVQ A;  4G7O F;  4CJG A;  3ZIB A;  1GGQ A;  2WVO A;  2R7U A;  3J06 A;  4XEF A;  3MBG A;  1FMW A;  2C03 A;  3C18 A;  4EUK B;  5B3S C;  2YEV A;  4DBQ A;  1ZW3 A;  2YL1 A;  4W8P A;  4J7T A;  1LI5 A;  3VYW A;  4FWV A;  3G4Z A;  3NDB B;  2R7X A;  3HKK A;  1FNT c;  2QTV A;  4YT5 A;  1LVK A;  1VLT A;  2OCC C;  5L0I A;  1Y6D A;  2CCY A;  3EGD B;  3QVY A;  1WTY A;  3QW0 A;  1OW8 A;  2XL4 A;  3X2Q C;  4C3B A;  4M63 A;  3NMI A;  3R2P A;  1YLM A;  4JEA A;  1BBH A;  2AU5 A;  5EGY A;  2J7P D;  3EH2 A;  4IAQ A;  1ORY A;  5COG A;  2ZXP A;  1C03 A;  2EIM C;  4O6M A;  3ZDL A;  1NZE A;  4BJ5 A;  5AC4 A;  3VRC A;  5DS4 A;  3U0C A;  3EFO B;  3RKO F;  1B68 A;  3V5Y A;  1NG1 A;  4DBR A;  2P6V A;  1HE1 A;  3FVY A;  3EQL F;  1BR1 A;  4JCZ A;  1QLE C;  2NPU A;  1Q0F A;  4LLE A;  4RBN A;  1EKY A;  3B29 A;  5DS5 A;  1H7I A;  2P1A A;  2Q3T A;  1D1A A;  3O10 A;  1NSG B;  3ABM C;  3RVY A;  2L7A A;  3KYI A;  4NCQ A;  4F4B A;  1AVO B;  3LLI A;  4H54 A;  3AGU A;  1NFO A;  3S90 A;  2XLE A;  3EG9 B;  1I5N A;  2R25 A;  4QI2 A;  1M2V A;  2YZS A;  3LUT B;  4MVR A;  3S27 A;  5L0H A;  4I1M A;  4IRU A;  3OA1 A;  3DJU B;  3ZVR A;  3IQ6 A;  3Q6N A;  1DOV A;  2FAP B;  1M57 C;  3FMS A;  3NMJ A;  3WG7 C;  5JLI A;  1Z5Z A;  2YWA A;  1LE4 A;  4E7Z A;  1QZX A;  4DJ9 A;  1D0X A;  4MW8 A;  4JJF A;  1AEP A;  3FAJ A;  2KYH A;  4MS2 A;  4MVM A;  3DD7 A;  1TQG A;  3L8I A;  3NG1 A;  3SEO A;  4CS7 A;  1SZI A;  2J9B A;  4JE9 A;  2OEV A;  3HJC A;  2G3V A;  2XSE A;  1O5H A;  2PBE A;  3FAP B;  3G4X A;  2DYR C;  2A6E F;  3M79 A;  2L6F A;  2XRH A;  4JRZ A;  4NC3 A;  4W8K A;  4YN0 B;  1I4Z A;  3O55 A;  3ASO C;  3SZR A;  1H9G A;  3AG3 C;  3KYJ A;  3C8G B;  1AUE A;  3JRT A;  1U6H A;  2XLH A;  3NYM A;  3NYL A;  5JVE A;  2YKZ A;  1MNE A;  2HKV A;  2IXO A;  5KYW B;  2GWW A;  2W45 A;  3NKD A;  4FX5 A;  4XEV A;  4OIQ F;  2LFF A;  1TWH A;  1JR8 A;  1UG7 A;  2XLO A;  1M2V B;  2HJM A;  3SXY A;  3ABL C;  1LPE A;  2PF4 E;  1CPR A;  1M56 C;  2YLI A;  3NRH A;  1ORS C;  1OKK D;  1UFB A;  3OWT A;  2XXA B;  5A6K A;  2A1D D;  2NUT A;  1DOW A;  1G4U S;  2H8A A;  5EHH A;  2Y3B A;  4PJL A;  3FOO A;  2Q7R A;  4BEJ A;  4DRH B;  1NU7 D;  2IYL D;  1T6U A;  4LDQ A;  3K33 A;  3AG2 C;  1U89 A;  2R7V A;  3C63 A;  2OG2 A;  4OIO F;  1WAS A;  3O39 A;  4U5D E;  4U9D A;  2A0U A;  1ZZP A;  4NTB A;  2VAS A;  4J32 B;  4Z9H A;  2HFI A;  2XL6 A;  3DZA A;  3LEV A;  1QPU A;  1J8M F;  5B3I A;  3E70 C;  3CEX A;  3K1I C;  1L7C A;  2WZG A;  3S9O A;  3QTH A;  4MW3 A;  1O87 A;  1OKK A;  1Q0D A;  1V74 B;  1CGO A;  3G50 A;  3V5Z A;  5KYN A;  2M64 A;  2C04 A;  3E9V A;  1E2X A;  1GM5 A;  4WAB A;  5F5F A;  3GM3 A;  3CSK A;  4PR9 A;  3B0P A;  5EK0 A;  1HMD A;  2NSG A;  2B0J A;  3HNI A;  3MX3 A;  3B9Q A;  3K1I A;  4LDK A;  1TFO B;  2EIK C;  3PMR A;  3V5X A;  1MND A;  4LAC B;  2J0X A;  4XTK A;  2R7T A;  4CDV A;  3EGX A;  5D92 A;  2R9R B;  3PCV A;  1E86 A;  1MQV A;  4IAO A;  2A6H F;  3DAF A;  3SXZ A;  4CX9 A;  1JPJ A;  3N2Z B;  3AQC A;  5JUA A;  4G7Z F;  3RYL A;  5A6B A;  2OEX A;  3UMK A;  4OD5 A;  5GPG B;  3UMI A;  5A6B D;  1OCR C;  1TWA A;  4G78 A;  4U5B E;  4N6C A;  4I1O B;  2TMV P;  1LI7 A;  2H7B A;  2L9J A;  4LLC A;  1I4Y A;  1TWG A;  4HFK B;  2XM4 A;  2QLA A;  4ULV A;  3T6B A;  4JW1 A;  3K7D A;  3MYI A;  3US6 A;  5AC5 A;  4AE4 B;  1KTM A;  2IBF A;  1R5I D;  2FGY A;  3BRJ A;  1XZQ A;  3SP1 A;  1Q0M A;  3IPM O;  3SXK A;  2KC3 A;  3TQO A;  2OU6 A;  5KYX A;  3FDQ A;  1BR4 A;  2DGJ A;  2R03 A;  4BG0 A;  4FAP B;  3KMI A;  5KYU B;  1Q0K A;  1D1C A;  2G3K A;  1RKE B;  4O7G A;  1LS4 A;  2CDQ A;  4Q7C A;  3FOP A;  5FZT A;  3U3B A;  4PFP A;  2YL0 A;  1OR3 A;  2CYD A;  3AGT A;  4MVO A;  1FAP B;  3RQF A;  3B0V C;  3K1H A;  3OEO A;  2Q9A A;  1T01 A;  4C3D A;  4MQ9 F;  1K40 A;  3DE9 A;  1LKX A;  4DRI B;  1RCP A;  1YVI A;  3ZTZ A;  2Q4F A;  2Y69 C;  5BUO A;  3B0U X;  3WOD F;  2R7S A;  1M6T A;  3MFN A;  4R32 A;  1SF8 A;  2NSF A;  1IZM A;  1QSP A;  2QY9 A;  4I44 A;  3C7J A;  3VM6 A;  4AX2 A;  2EPL X;  3QVZ A;  3MYF A;  2XLW A;  1QKR A;  3N0T A;  1ZVZ A;  1EA8 A;  2LFD A;  2A69 F;  1VTM P;  4MTG A;  3O6X A;  4HE8 D;  2AVK A;  2ZXW C;  3ZG1 A;  4KC9 A;  5DQZ A;  1VMA A;  4A4A A;  2IOQ A;  1J8Y F;  2YLD A;  4PFO A;  4RD9 A;  1YDI A;  2Z15 A;  3V7O A;  5DQT A;  2KK1 A;  1G4W R;  1EI7 A;  2KNH A;  3JRM O;  2VCB A;  2HS5 A;  3U2M A;  3U3F A;  1HW2 A;  3H2V A;  3C8G A;  1S05 A;  2JX0 A;  1WGW A;  1BDJ B;  2H7O A;  2ZPA A;  1CGN A;  1WAT A;  3IQT A;  3LJB A;  4HEA J;  4NQF A;  4D4N A;  2KSF A;  4JTA B;  5DVW A;  4Z9I A;  5HV9 A;  1SR2 A;  1CPQ A;  3SXM A;  2EPN A;  4QDL A;  2J9V A;  3IEE A;  5DLJ A;  4EBB A;  1FMV A;  4KBL A;  1RJ9 A;  2J9U A;  3AJM A;  1XZP A;  3RVZ A;  1QVX A;  4G7H F;  3JT1 A;  4YT2 A;  3A9C A;  2EIN C;  2KJG A;  3EG9 A;  3UR3 C;  3ZTM A;  2A68 F;  1V4A A;  5L0J A;  2VB6 A;  2AWC A;  2DYS C;  1VYI A;  3DM9 B;  3NYJ A;  2BL2 A;  4I3M A;  3Q7L A;  3GOR A;  3L0I A;  3U9M A;  4N4W A;  1OXB A;  1T6I A;  2CW0 F;  3S0X A;  1PCX A;  3DJN B;  3EHN A;  3IQC A;  5L3Q A;  3N24 A;  5KYX B;  2E87 A;  4UDV A;  2H7V C;  2ICW G;  1HY5 A;  2J46 A;  1YJG A;  4EBK A;  2LSE A;  3DAG A;  5L3V A;  3M4C A;  2HJ3 A;  2YQY A;  5A69 A;  2YRF A;  3R7C A;  4KI2 A;  1APC A;  4YT4 A;  2ZD9 A;  4CS8 C;  1L3P A;  2PX0 A;  4XWJ A;  5DS6 A;  1RMV A;  3X1O A;  2LQG A;  4YL0 A;  4GEH A;  1PD1 A;  4ULW A;  3GWL A;  3FHD A;  4DRJ B;  2ZXO A;  3TOM A;  2VH3 A;  3UGO A;  4CJO A;  4PJM A;  5IY5 C;  1YAU O;  3VAY A;  3AG1 C;  3I5Q A;  3W2V A;  3VF0 A;  4CDY A;  2L81 A;  3SNH A;  2Y3G A;  3ZQY A;  5B1A C;  3ASN C;  2P7V A;  3W4Y A;  1K04 A;  3BEH A;  3S84 A;  2FFH A;  2OOC A;  4PK4 A;  2JPU A;  1VLS A;  4MTO A;  5COM A;  2XXA A;  2OJE D;  4PJJ A;  2IXN A;  5CI8 A;  5D91 A;  3POV A;  3RIP A;  4XPY A;  3RF3 A;  4Z9J A;  3TJ6 A;  1ST6 A;  2J45 A;  1A7E A;  3TK0 A;  4BJ1 A;  4E17 A;  2XLV A;  4U5E E;  1Z63 A;  4JTD B;  1FTS A;  1C02 A;  1ZU5 A;  4J30 B;  4K1O A;  2IXP A;  2LP4 A;  3LES A;  1HE9 A;  1VOM A;  1EQ1 A;  4O79 A;  3JYH A;  4P9T A;  4U5G A;  1YZC A;  3GM2 A;  5E2Q A;  1ZW2 A;  4GYT A;  5HSW A;  3I4U A;  2XLD A;  2JD3 A;  5T3T A;  4KNW A;  2XS1 A;  3EZI A;  3LLK A;  3KKB A;  3ITF A;  2J8W A;  2EPK X;  3GAN A;  4C7O B;  3HNL A;  3JCU Q;  1IW7 F;  1TR2 A;  2AWY A;  2NUT B;  3EJN A;  1LIH A;  3EZH A;  5E33 A;  3WHN A;  2EPM X;  2RSE B;  4CSA C;  2HSQ A;  4YL3 A;  1JPN A;  3LAY A;  3NKE A;  2WZF A;  3GEH A;  3HNK A;  3QW1 A;  1ZHW A;  2J0W A;  1LE2 A;  1OR2 A;  5JP7 A;  3U2L A;  3W8H A;  1U0B B;  3GM1 A;  1BR2 A;  3HNJ A;  3RH3 A;  1ZHT A;  4EIY A;  3EPV A;  3L8J A;  3F46 A;  3JZ0 A;  1A7D A;  1OCZ C;  2YLG A;  1M2O A;  2W4M A;  3S28 A;  1KNY A;  2UUH A;  2HV7 A;  3EHM A;  3DE8 A;  3EGX B;  4LDR A;  3ZQV A;  4GQH A;  2X0C A;  2WB7 A;  3L34 A;  3L1M A;  4BPM A;  3LNR A;  2M4E A;  1RXQ A;  1BZ4 A;  2A0B A;  4U5F E;  3JYY A;  3U8V A;  4CS9 C;  1E83 A;  1NLX A;  4BJ5 C;  5L0C A;  3TUL A;  1G5Z A;  5T3W A;  4C7O A;  5COF A;  3WAQ A;  2V26 A;  2X51 A;  2QNL A; 
#chains in the Genus database with same CATH homology
 3IQ5 A;  1CPQ A;  2XLO A;  4CDA A;  3M4B A;  1JAF A;  1CPR A;  2YLI A;  1NBB A;  5JT4 A;  1E84 A;  3FOO A;  1LM3 B;  1E85 A;  3C63 A;  3ZTM A;  2YL3 A;  4U9D A;  4IB4 A;  3U8P A;  5JRA A;  4U9E A;  4ER9 A;  4N4W A;  2XL6 A;  3C62 A;  4N6H A;  4JKV A;  1QPU A;  5B3I A;  4D4N A;  1YZA A;  4CDV A;  4IAR A;  1CGO A;  3M4C A;  5JS5 A;  4WGY A;  1APC A;  1A7V A;  4CIP A;  3HNI A;  5JSL A;  3TOM A;  2XL8 A;  4CJO A;  1YYJ A;  4WGZ A;  4D4X A;  4CJG A;  4CDY A;  1MQV A;  1E86 A;  4CX9 A;  3ZQY A;  5JUA A;  2YL1 A;  3NMK A;  1GQA A;  3TOL A;  2CCY A;  3QVY A;  3QW0 A;  2XM4 A;  2QLA A;  1YYX A;  2XLV A;  4ULV A;  2YL7 A;  3NMI A;  4JEA A;  5AGF A;  1BBH A;  2XLM A;  2XM0 A;  4IAQ A;  1YZC A;  3VRC A;  2XLD A;  1EKY A;  3FOP A;  2BC5 A;  2YL0 A;  4JEB A;  2J8W A;  1QQ3 A;  3HNL A;  3ZWI A;  3DE9 A;  4L6R A;  1RCP A;  2XLE A;  3ZTZ A;  3HNK A;  3QW1 A;  5JP7 A;  1M6T A;  3IQ6 A;  3HNJ A;  3NMJ A;  5JLI A;  4EIY A;  3QVZ A;  2XLW A;  2YLG A;  3DE8 A;  3ZQV A;  2J9B A;  4JE9 A;  3L1M A;  256B A;  2YLD A;  3M79 A;  4NC3 A;  1E83 A;  2XLH A;  1S05 A;  3M15 A;  5JVE A;  2YKZ A;  1CGN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...