5JVEA

L16i mutant of cytochrome c prime from alcaligenes xylosoxidans: ferrous state
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
125
structure length
125
Chain Sequence
EFAKPEDAVKYRQSAITLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Electron transport
molecule keywords Cytochrome c'
publication title Engineering proximal vs. distal heme-NO coordination via dinitrosyl dynamics: implications for NO sensor design.
pubmed doi rcsb
source organism Alcaligenes xylosoxydans xylosoxydans
total genus 49
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2016-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 5jveA00
1E85A 1E86A 4CX9A 3ZTZA 2J9BA 2YKZA 1YYJA 1QQ3A 3IQ5A 3ZWIA 4ULVA 4U9DA 3HNKA 3NMIA 5AGFA 4JEBA 1CGNA 4WGYA 4CJOA 3IQ6A 2QLAA 1EKYA 2XLEA 1BBHA 4IB4A 1S05A 1E83A 2YLIA 3ZQYA 4IARA 3L1MA 5JP7A 1RCPA 1LM3B 2XLWA 3TOLA 4U9EA 2CCYA 2XL6A 5JS5A 5JVEA 3M15A 1YZAA 2YLDA 4CIPA 2J8WA 1CGOA 1QPUA 3M79A 3QW1A 5JUAA 2YLGA 4JE9A 4IAQA 3DE9A 3HNIA 2XLVA 2YL0A 4L6RA 4ER9A 4EIYA 1MQVA 3NMKA 3QW0A 2XLMA 4N4WA 1NBBA 1A7VA 1JAFA 2XM4A 1CPQA 2XLDA 5JT4A 4WGZA 2XLHA 3C63A 256BA 3QVZA 2XLOA 3ZTMA 3HNLA 3C62A 1E84A 5JSLA 3HNJA 3DE8A 4JKVA 2XM0A 4N6HA 3M4BA 5JLIA 2XL8A 5B3IA 2YL1A 4D4NA 3VRCA 1YYXA 2YL7A 3NMJA 3ZQVA 2BC5A 4JEAA 4NC3A 3TOMA 1M6TA 4CDAA 3U8PA 5JRAA 2YL3A 4CDVA 3FOPA 1CPRA 3FOOA 4D4XA 1GQAA 4CDYA 3QVYA 3M4CA 4CJGA 1APCA 1YZCA
chains in the Genus database with same CATH superfamily
1E85A 4BJTA 4Q7CA 2NSGA 2DYRC 3ITFA 1VB5A 3V7OA 2AP3A 1MMAA 2J9BA 2Y39A 1F1MA 3EGXA 3LS0A 1YLMA 1YYJA 4K1OA 2J46A 2KC3A 3IQ5A 3MYFA 4KC9A 2HJMA 1HMOA 2H7BA 3EFOB 3H2VA 4MS2A 2NUTA 1LIHA 2O9XA 4ULVA 1C02A 4DRJB 2HFIA 1PCXA 2G62A 2HZ8A 2R02A 2VASA 4IJJA 4LDKA 4DVYP 3MBGA 4DBQA 5COMA 1D0ZA 3RYLA 5AGFA 1ZZPA 3OA1A 4PACA 3SP1A 4WGYA 3CEXA 4U5CE 3Q7LA 2LIGA 3FDQA 2VCAA 1OCOC 1MMDA 1MNEA 1FAPB 1A41A 3QZCA 2HJ3A 4XLPF 2XLEA 1EKYA 2X0CA 1FMWA 3L0IA 1T6QA 3GEEA 4IB4A 3JRMO 5L0CA 1ZHTA 2OG2A 3C8ZA 2BE5F 4JRZA 4JVSA 3W4YA 4UDVA 4IARA 2XS8A 2W4BA 4G7HF 1FFTC 5F28E 2ZD9A 1LM3B 2EIKC 2XLWA 1EI7A 2WL8A 3LESA 3NYMA 4KNWA 4U9EA 1AUEA 3SNHA 3SXZA 1RKEA 2V3CC 5CIVA 3POVA 3M15A 4BG0A 4E17A 2J9UA 3GORA 4XPYA 3GANA 3JZ0A 5T3TA 1C03A 4C7OB 4YL0A 2R7QA 2WZLA 3M79A 4U5EE 3TK0A 3OWTA 1V4AA 2YHSA 3HNIA 3EH1A 3NKDA 4WJ0A 1T6IA 2EIJC 4OIRF 1YDIA 1Z7Qc 1VYIA 1ZVZA 3SZRA 1OCZC 4IAOA 4CSAC 2PBEA 2PNOA 4XTKA 4YJWA 4EWCA 4F4BA 1H9TA 4EIYA 4JTCB 2KQ9A 3PDMP 3V5ZA 4DOZA 3KKBA 4C3BA 4JURI 1Q0GA 2VC9A 1ZHXA 1SZIA 5DS4A 3C7JA 2I8BA 2LSEA 2OCCC 3BEHA 3N0TA 3QW0A 1NBBA 4N4WA 4CBEA 1HMDA 2H8AA 2YRFA 4CS9A 1XWJA 4AE4A 3K1IA 2XS1A 2AWYA 1JAFA 2A0UA 2XM4A 1CPQA 3IPMO 4FESA 4JCHA 1N1CA 1JPJA 3WHNA 1YAUO 3GEIA 3C8GD 4PJJA 4FAPB 1OKKA 1IW7F 1ZW2A 2PX0A 1FMVA 2OEXA 2XLOA 3LLIA 3HNLA 3K66A 2OQMA 3HJCA 3ABKC 1U6HA 1VMAA 1FFHA 1M2VA 3W2WA 4ANJA 1ORYA 2A0BA 2JX0A 3DAGA 3WG7C 5L0JA 1QSPA 1QVXA 2IXMA 1M2OA 3ZVRA 3ASOC 5KYXB 3U9MA 3O10A 2EPOA 1T9KA 2J9VA 2G3VA 2XM0A 4MTOA 1ST6A 5A6AA 3N2ZB 5JLIA 2XL8A 3KYIA 2HS5A 5E2QA 3F47A 4J30B 3EHNA 4MVSA 2R9RB 4OD5A 1DOVA 4P9TA 1ZHZA 3AGUA 1JOGA 3RVYA 2LFDA 3ASNC 4MVRA 4AX2A 4XPXA 4EBJA 4CIPA 2R7UA 1BR4A 1OR2A 3JYHA 4BJ1A 5KYWB 5DQTA 5KYNA 2BC5A 1V74B 2L6HA 2H7OA 4NC3A 3GWLA 2OEVA 4MVUA 1GM5A 3JT1A 1UG7A 1VLTA 3EZHA 3RH3A 3RIPA 3TD7A 4CDVA 1NLXA 2NUTB 1MMGA 4Z9HA 2VCCA 5A6KA 1TR2A 1CGME 5T3WA 5BUOA 3QVYA 3GM2A 2AU5A 3MLGA 4CJGA 4G7ZF 1OW8A 2OKUA 1E86A 2FFHA 3L8JA 2RD9A 2YZSA 1VK5A 5D92A 5K0IA 4CIHA 1TWAA 1QQ3A 2A6EF 2HKVA 2DB4A 3DJUB 4CS8C 4CSAA 1ZU5A 2GAQA 3KYJA 3FHDA 4MVOA 1GGQA 1SR2A 3HNKA 3T6GB 2WZFA 1G4WR 2HMQA 1Z63A 3AG3C 1EQ1A 1RKEB 1W2WA 1CGNA 1NG1A 5A6BD 4MW3A 3IQ6A 4XEVA 4Z9IA 1Y4CA 1LE2A 1I5NA 2QLAA 3UR3C 1D0XA 1OKKD 3EJNA 1BBHA 1LE4A 2QY9A 3GM3A 1SYQA 4QDLA 5KYYA 3I5QA 4IGGA 2X51A 3AOUA 3FAPB 4XEFA 3KMIA 5L0HA 1E83A 1WASA 3AGTA 3UMIA 3PMRA 4ZLCA 3C18A 1OR3A 1HW2A 1LS4A 1RCPA 2CNWD 2HUJA 4ULWA 2DGJA 2R7XA 2CCYA 2XL6A 3EG9A 2JD3A 2UUHA 2P7VA 4JIOA 4W8PA 3U2MA 2YLDA 3BRJA 3L34A 5JS5A 3T4RA 4AL0A 2NUPA 3VAYA 3IQTA 3B0PA 4JW1A 1RMVA 3DWWA 1CGOA 1QPUA 2Q9BA 5E3CA 3VM6A 4AE4B 5JUAA 1A7EA 2L7AA 3CAXA 2W9YA 4IAQA 2Q7RA 2XLVA 4L6RA 2ZXOA 4ER9A 4IRUA 3RF3A 3E9VA 3JSEO 4O6NA 3RW0A 4U5FE 4MTGA 1QKRA 1M2VB 1A7DA 3S29A 1AVOB 1VYKA 1NSGB 5DQZA 2J0XA 4YT8A 2C04A 1J8MF 2Q00A 4GEHA 1PD0A 3U2LA 4A4AA 3OEOA 2XL4A 4HE8D 4RBNA 5A69A 2WZGA 2XLHA 4JTDB 3C63A 4YK5A 5B1BC 4MTFA 4MVQA 3AQCA 2YWAA 4E7ZA 5GPGB 5DS5A 3LUTB 3K33A 4E0IA 2XXAA 2CGEA 1ORJA 2VB6A 1E84A 5JSLA 1PV3A 4JCZA 4XPWA 1UFBA 2Q9AA 2VH3A 1Q0DA 1JR8A 1RJ9A 1YVIA 2B0HA 4ZLDA 3K6BA 4JKVA 5F5FA 1TWHA 5DVWA 4CS8A 4N6HA 4O6MA 5DS6A 2NPUA 3DI5A 2OJQA 2YL1A 4J32B 4D4NA 3I5PA 4KBLA 3WODF 4EBBA 1V54C 3KH2A 3RFYA 5AC5A 4LLCA 1O3UA 1NZEA 1S7ZA 5KYUA 5A6BA 3TJ6A 2R05A 3B71A 2YVKA 2QUPA 3U5SA 1H7IA 3EQLF 1OW7A 3AG2C 1M6TA 3ABLC 3TOMA 4CDAA 4R32A 2EILC 1A0BA 1HW1A 1JMWA 2AWCA 1ZHWA 4YL3A 1H9GA 1WGWA 3U0CA 4J7YA 1ZW3A 3LNMB 3W8IA 5B3SC 1OXBA 4JZAA 4NQFA 4WABA 2Y3BA 3FOOA 1D0YA 2OU6A 4XEKA 4D4XA 3VYWA 1LPEA 1NFNA 2CNWA 2MYSA 2D4UA 2PP4A 2EPMX 2P0NA 3RQEA 4C3DA 1APCA 5HSWA 5L0IA 2M4EA 1YZCA 3LJBA 5TJ5E 1M56C 2A68F 3SXMA 2R03A 3DD7A 3AG1C 3T9OA 3ZTZA 5BQIA 1SF8A 2YKZA 5KYYB 3CSKA 1WWPA 2PFDA 3FMSA 4I3MA 2GA0A 3LEVA 2UUIA 1J8YF 2HSBA 2Q9CA 3EZIA 1OQCA 2GFHA 4MVZA 3X1OA 5AC4A 2WVQA 3C8GB 1OCCC 2A69F 3C8GA 3W2VA 1Z3IX 3FVYA 2Q4FA 3R2PA 3EG9B 3EGXB 4JEBA 2HSQA 3S0XA 2ASRA 1LI7A 3A9CA 1TKNA 3F46A 4JC7A 4AK9A 4E0HA 3DAFA 2NUPB 2R7TA 1TWCA 4K7BA 1Z5ZA 3I4UA 2KGOA 1KNYA 2LQGA 4NTFA 4KI2A 3FAJA 4OIOF 3DKAA 2EPLX 3U8VA 2A1DD 3GM1A 1D1CA 1S05A 4NCQA 2KK1A 3SXYA 2R7RA 4BJ6C 1VOMA 3NYJA 2V26A 2E87A 4YT2A 4P6IC 3NRHA 2WVNA 5L0GA 5EGYA 1YA9A 4O79A 4PK4A 5JVEA 1LI5A 1YZAA 2W45A 1H6GA 4I44A 2CW0F 3MX3A 2I15A 2MHRA 4U5DE 5B1AC 4PR9A 3IQCA 4X0RA 3U3BA 3B0UX 1MNDA 5DLJA 2EPKX 2ETSA 3QW1A 2YLGA 5HV9A 3NG1A 3W8HA 3DM5A 2CYDA 2F22A 2LFFA 1WTYA 2YL0A 1NFOA 3V5YA 4YL1A 2BL2A 2OOCA 4B6IA 4U5BE 3S90A 4PJNA 5A6JA 1QLEC 2W4MA 3EPVA 2P61A 4OIPF 3LNRA 3QMKA 1MQVA 1K04A 4IWBA 4M63A 3NMKA 3RVZA 3HKKA 2Q3TA 4DRIB 1BR1A 3V5XA 4MNDA 2CDQA 1G4US 1WATA 3O6XA 4JTAB 3JRTA 4DBRA 1BR2A 3JCUQ 3NKEA 4BEMJ 4CS7A 2LP4A 2XLDA 1Q0FA 2M64A 3UGOA 256BA 2P6VA 3DJNB 4LDRA 2WB7A 3H65A 3LEOA 5L0FA 3HLZA 4MQ9F 2R7WA 3C62A 2FAPB 4RD9A 5CI8A 4DVZA 1LKXA 4BPMA 3T6BA 2IYLD 1RKCA 3DE8A 1R4TA 2L9JA 2KW3C 4XQ1A 4LACB 3UNGC 3O55A 4A2NB 1K40A 3ABMC 2DYSC 1OCRC 2Y3DA 3ZDLA 2R7OA 3UMHA 1YYXA 1HE9A 3RQFA 1D1BA 3NDBB 3JSZA 1K05A 3ZQVA 4YT5A 3VF0A 1XZPA 2QE9A 3H2UA 4FWVA 1PD1A 4JEAA 4N06A 3EGDA 3R7CA 2IXPA 2KSFA 3B0VC 4LERA 5L3QA 3Q6MA 1Z6AA 5EHHA 4BJ6A 2LK4A 2OJED 3IHUA 1FR0A 1GS9A 1BZ4A 1U89A 2L6GA 3G50A 3GODA 4W8KA 1WOLA 1JPNA 1R5ID 1GQAA 2ZPAA 1V55C 1T6UA 1E2XA 4CDYA 4EUKB 4OIQF 3M4CA 4ONSA 1YARO 3EH2A 5F5HA 4OINF 2FGYA 3KL4A 1FTSA 2L81A 1Z23A 2WVOA 1YJGA 3GEHA 5CI9A 4HFKB 3AQBA 3HTKC 4MVMA 1NU9C 4AL1A 3IEEA 4CX9A 4I1MA 2KYHA 3G4XA 1O87A 2J7PD 3PCVA 3M1CB 1ZYRF 2HV7A 5T1DB 3ZWIA 4EHPA 4YWQA 3X2QC 3TULA 4QI2A 1BDJB 1RXQA 3Q6NA 2QTVA 4U9DA 1KU2A 2L6FA 3K7DA 4O6YA 4PFOA 4KNVA 1TQGA 3LS1A 2HMZA 2VCBA 3SEOA 3NMIA 3ZC4A 3SYNA 4C3EA 2KJGA 4EBKA 4K0DA 1I4ZA 1NU7D 4MW8A 1VLSA 2ICWG 2NG1A 2PX3A 4CJOA 3B9QA 1LVKA 2DI3A 4QI0A 2G3KA 1TFOB 2PF4E 1SMYF 4EKWA 2TMVP 3EFOA 2A6HF 2YLIA 4RDAA 3ZQYA 2R7VA 3DMDA 1KTMA 1HE1A 3GWNA 4G78A 4NY3A 3L1MA 5JP7A 2EIMC 4XLNF 2C03A 2RSEB 2QNLA 3WAQA 4E7SA 5FCLA 3TOLA 2R7SA 3TJ5A 2H7VC 4BJ5C 3CZ6A 2IXOA 4BEJA 3ZG1A 4O7GA 1I4YA 1WN0A 3SXKA 4JJFA 4N6CA 2ZXWC 4DXWA 2J8WA 3B29A 4JJGA 1VTMP 3A11A 2ZXPA 2IM8A 2Z15A 3EHMA 1U0BB 3UMKA 1DOWA 5EK0A 1T5OA 4JE9A 5E33A 3DE9A 1MMNA 2P1AA 4PJMA 3G4ZA 3FXHA 4FX5A 2XSEA 2MWQA 1L7CA 4GYTA 1D1AA 1EA8A 1JRAA 4J7TA 1ZU4A 4U5GA 3J06A 1OXKA 2KNHA 2XLMA 1YA7O 3JTLO 4DJ9A 1G5ZA 2IBFA 4YT4A 4OD4A 1FNTc 3ECSA 2J45A 2Y3HA 3S9OA 4C7OA 3L8IA 1Q0MA 4HEAJ 4NTBA 1A7VA 1T01A 3U3FA 3AG4C 3DZAA 3ZIBA 5L3VA 4Q4ZF 3AJMA 3LAYA 1L3PA 3Q7GA 5JT4A 2YEVA 2IOQA 1HY5A 3K1HA 4WGZA 4U5HA 3RQGA 3UGPA 5BQGA 1LS1A 3QVZA 5IY5C 5COGA 4Q5SF 2J0WA 2Y69C 3ZTMA 2HV6A 5BQHA 1O5HA 3S27A 4PJLA 4H54A 5D91A 1Q0KA 2JPUA 1OW6A 1G8XA 2IXNA 4G7OF 2GWWA 3HNJA 3EGDB 4E18A 2YQYA 1XZQA 2EINC 2J7PA 3MYIA 3O39A 1Y6DA 5E3AA 5FZTA 2D5RB 1TWGA 3M4BA 2XRHA 4HFFB 3T6JA 3DM9B 5B3IA 4DRHB 1B68A 2XXAB 2LCHA 3JYYA 4H4KC 1C17M 3U9JA 3VRCA 1ZHYA 3PHF2 1RJ9B 2YL7A 3NYLA 4PFPA 3NMJA 2AVKA 3MFNA 1M57C 3US6A 2ZXRA 3S84A 4NTAA 4GQHA 2J9WA 1IZMA 5L0DA 1AEPA 5KYXA 2LD6A 3U8PA 4Z9JA 5JRAA 4I1OB 2YL3A 4YN0B 4CS9C 1ORSC 2GDCA 3K1IC 3ATPA 4LDQA 5KYUB 2R25A 5COFA 3FOPA 3KPHA 3QTHA 1CPRA 3DXJF 4G0HA 4P9FA 2Y3GA 4LLEA 4BJ5A 3LLKA 3TQOA 3RKOF 3N24A 4XWJA 3ZSUA 2NSFA 5KYWA 1TFKB 1QZXA 2B0JA 3CQZA 3E70C 3S28A 2EPNA
chains in the Genus database with same CATH topology
1E85A 1E86A 4CX9A 3ZTZA 2J9BA 2YKZA 1YYJA 1QQ3A 3IQ5A 3ZWIA 4ULVA 4U9DA 3HNKA 3NMIA 5AGFA 4JEBA 1CGNA 4WGYA 4CJOA 3IQ6A 2QLAA 1EKYA 2XLEA 1BBHA 4IB4A 1S05A 1E83A 2YLIA 3ZQYA 4IARA 3L1MA 5JP7A 1RCPA 1LM3B 2XLWA 3TOLA 4U9EA 2CCYA 2XL6A 5JS5A 5JVEA 3M15A 1YZAA 2YLDA 4CIPA 2J8WA 1CGOA 1QPUA 3M79A 3QW1A 5JUAA 2YLGA 4JE9A 4IAQA 3DE9A 3HNIA 2XLVA 2YL0A 4L6RA 4ER9A 4EIYA 1MQVA 3NMKA 3QW0A 2XLMA 4N4WA 1NBBA 1A7VA 1JAFA 2XM4A 1CPQA 2XLDA 5JT4A 4WGZA 2XLHA 3C63A 256BA 3QVZA 2XLOA 3ZTMA 3HNLA 3C62A 1E84A 5JSLA 3HNJA 3DE8A 4JKVA 2XM0A 4N6HA 3M4BA 5JLIA 2XL8A 5B3IA 2YL1A 4D4NA 3VRCA 1YYXA 2YL7A 3NMJA 3ZQVA 2BC5A 4JEAA 4NC3A 3TOMA 1M6TA 4CDAA 3U8PA 5JRAA 2YL3A 4CDVA 3FOPA 1CPRA 3FOOA 4D4XA 1GQAA 4CDYA 3QVYA 3M4CA 4CJGA 1APCA 1YZCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E85 A;  1E86 A;  4CX9 A;  3ZTZ A;  2J9B A;  2YKZ A;  1YYJ A;  1QQ3 A;  3IQ5 A;  3ZWI A;  4ULV A;  4U9D A;  3HNK A;  3NMI A;  5AGF A;  4JEB A;  1CGN A;  4WGY A;  4CJO A;  3IQ6 A;  2QLA A;  1EKY A;  2XLE A;  1BBH A;  4IB4 A;  1S05 A;  1E83 A;  2YLI A;  3ZQY A;  4IAR A;  3L1M A;  5JP7 A;  1RCP A;  1LM3 B;  2XLW A;  3TOL A;  4U9E A;  2CCY A;  2XL6 A;  5JS5 A;  5JVE A;  3M15 A;  1YZA A;  2YLD A;  4CIP A;  2J8W A;  1CGO A;  1QPU A;  3M79 A;  3QW1 A;  5JUA A;  2YLG A;  4JE9 A;  4IAQ A;  3DE9 A;  3HNI A;  2XLV A;  2YL0 A;  4L6R A;  4ER9 A;  4EIY A;  1MQV A;  3NMK A;  3QW0 A;  2XLM A;  4N4W A;  1NBB A;  1A7V A;  1JAF A;  2XM4 A;  1CPQ A;  2XLD A;  5JT4 A;  4WGZ A;  2XLH A;  3C63 A;  256B A;  3QVZ A;  2XLO A;  3ZTM A;  3HNL A;  3C62 A;  1E84 A;  5JSL A;  3HNJ A;  3DE8 A;  4JKV A;  2XM0 A;  4N6H A;  3M4B A;  5JLI A;  2XL8 A;  5B3I A;  2YL1 A;  4D4N A;  3VRC A;  1YYX A;  2YL7 A;  3NMJ A;  3ZQV A;  2BC5 A;  4JEA A;  4NC3 A;  3TOM A;  1M6T A;  4CDA A;  3U8P A;  5JRA A;  2YL3 A;  4CDV A;  3FOP A;  1CPR A;  3FOO A;  4D4X A;  1GQA A;  4CDY A;  3QVY A;  3M4C A;  4CJG A;  1APC A;  1YZC A; 
#chains in the Genus database with same CATH topology
 1E85 A;  4BJT A;  4Q7C A;  2NSG A;  2DYR C;  3ITF A;  1VB5 A;  3V7O A;  2AP3 A;  1MMA A;  2J9B A;  2Y39 A;  1F1M A;  3EGX A;  3LS0 A;  1YLM A;  1YYJ A;  4K1O A;  2J46 A;  2KC3 A;  3IQ5 A;  3MYF A;  4KC9 A;  2HJM A;  1HMO A;  2H7B A;  3EFO B;  3H2V A;  4MS2 A;  2NUT A;  1LIH A;  2O9X A;  4ULV A;  1C02 A;  4DRJ B;  2HFI A;  1PCX A;  2G62 A;  2HZ8 A;  2R02 A;  2VAS A;  4IJJ A;  4LDK A;  4DVY P;  3MBG A;  4DBQ A;  5COM A;  1D0Z A;  3RYL A;  5AGF A;  1ZZP A;  3OA1 A;  4PAC A;  3SP1 A;  4WGY A;  3CEX A;  4U5C E;  3Q7L A;  2LIG A;  3FDQ A;  2VCA A;  1OCO C;  1MMD A;  1MNE A;  1FAP B;  1A41 A;  3QZC A;  2HJ3 A;  4XLP F;  2XLE A;  1EKY A;  2X0C A;  1FMW A;  3L0I A;  1T6Q A;  3GEE A;  4IB4 A;  3JRM O;  5L0C A;  1ZHT A;  2OG2 A;  3C8Z A;  2BE5 F;  4JRZ A;  4JVS A;  3W4Y A;  4UDV A;  4IAR A;  2XS8 A;  2W4B A;  4G7H F;  1FFT C;  5F28 E;  2ZD9 A;  1LM3 B;  2EIK C;  2XLW A;  1EI7 A;  2WL8 A;  3LES A;  3NYM A;  4KNW A;  4U9E A;  1AUE A;  3SNH A;  3SXZ A;  1RKE A;  2V3C C;  5CIV A;  3POV A;  3M15 A;  4BG0 A;  4E17 A;  2J9U A;  3GOR A;  4XPY A;  3GAN A;  3JZ0 A;  5T3T A;  1C03 A;  4C7O B;  4YL0 A;  2R7Q A;  2WZL A;  3M79 A;  4U5E E;  3TK0 A;  3OWT A;  1V4A A;  2YHS A;  3HNI A;  3EH1 A;  3NKD A;  4WJ0 A;  1T6I A;  2EIJ C;  4OIR F;  1YDI A;  1Z7Q c;  1VYI A;  1ZVZ A;  3SZR A;  1OCZ C;  4IAO A;  4CSA C;  2PBE A;  2PNO A;  4XTK A;  4YJW A;  4EWC A;  4F4B A;  1H9T A;  4EIY A;  4JTC B;  2KQ9 A;  3PDM P;  3V5Z A;  4DOZ A;  3KKB A;  4C3B A;  4JUR I;  1Q0G A;  2VC9 A;  1ZHX A;  1SZI A;  5DS4 A;  3C7J A;  2I8B A;  2LSE A;  2OCC C;  3BEH A;  3N0T A;  3QW0 A;  1NBB A;  4N4W A;  4CBE A;  1HMD A;  2H8A A;  2YRF A;  4CS9 A;  1XWJ A;  4AE4 A;  3K1I A;  2XS1 A;  2AWY A;  1JAF A;  2A0U A;  2XM4 A;  1CPQ A;  3IPM O;  4FES A;  4JCH A;  1N1C A;  1JPJ A;  3WHN A;  1YAU O;  3GEI A;  3C8G D;  4PJJ A;  4FAP B;  1OKK A;  1IW7 F;  1ZW2 A;  2PX0 A;  1FMV A;  2OEX A;  2XLO A;  3LLI A;  3HNL A;  3K66 A;  2OQM A;  3HJC A;  3ABK C;  1U6H A;  1VMA A;  1FFH A;  1M2V A;  3W2W A;  4ANJ A;  1ORY A;  2A0B A;  2JX0 A;  3DAG A;  3WG7 C;  5L0J A;  1QSP A;  1QVX A;  2IXM A;  1M2O A;  3ZVR A;  3ASO C;  5KYX B;  3U9M A;  3O10 A;  2EPO A;  1T9K A;  2J9V A;  2G3V A;  2XM0 A;  4MTO A;  1ST6 A;  5A6A A;  3N2Z B;  5JLI A;  2XL8 A;  3KYI A;  2HS5 A;  5E2Q A;  3F47 A;  4J30 B;  3EHN A;  4MVS A;  2R9R B;  4OD5 A;  1DOV A;  4P9T A;  1ZHZ A;  3AGU A;  1JOG A;  3RVY A;  2LFD A;  3ASN C;  4MVR A;  4AX2 A;  4XPX A;  4EBJ A;  4CIP A;  2R7U A;  1BR4 A;  1OR2 A;  3JYH A;  4BJ1 A;  5KYW B;  5DQT A;  5KYN A;  2BC5 A;  1V74 B;  2L6H A;  2H7O A;  4NC3 A;  3GWL A;  2OEV A;  4MVU A;  1GM5 A;  3JT1 A;  1UG7 A;  1VLT A;  3EZH A;  3RH3 A;  3RIP A;  3TD7 A;  4CDV A;  1NLX A;  2NUT B;  1MMG A;  4Z9H A;  2VCC A;  5A6K A;  1TR2 A;  1CGM E;  5T3W A;  5BUO A;  3QVY A;  3GM2 A;  2AU5 A;  3MLG A;  4CJG A;  4G7Z F;  1OW8 A;  2OKU A;  1E86 A;  2FFH A;  3L8J A;  2RD9 A;  2YZS A;  1VK5 A;  5D92 A;  5K0I A;  4CIH A;  1TWA A;  1QQ3 A;  2A6E F;  2HKV A;  2DB4 A;  3DJU B;  4CS8 C;  4CSA A;  1ZU5 A;  2GAQ A;  3KYJ A;  3FHD A;  4MVO A;  1GGQ A;  1SR2 A;  3HNK A;  3T6G B;  2WZF A;  1G4W R;  2HMQ A;  1Z63 A;  3AG3 C;  1EQ1 A;  1RKE B;  1W2W A;  1CGN A;  1NG1 A;  5A6B D;  4MW3 A;  3IQ6 A;  4XEV A;  4Z9I A;  1Y4C A;  1LE2 A;  1I5N A;  2QLA A;  3UR3 C;  1D0X A;  1OKK D;  3EJN A;  1BBH A;  1LE4 A;  2QY9 A;  3GM3 A;  1SYQ A;  4QDL A;  5KYY A;  3I5Q A;  4IGG A;  2X51 A;  3AOU A;  3FAP B;  4XEF A;  3KMI A;  5L0H A;  1E83 A;  1WAS A;  3AGT A;  3UMI A;  3PMR A;  4ZLC A;  3C18 A;  1OR3 A;  1HW2 A;  1LS4 A;  1RCP A;  2CNW D;  2HUJ A;  4ULW A;  2DGJ A;  2R7X A;  2CCY A;  2XL6 A;  3EG9 A;  2JD3 A;  2UUH A;  2P7V A;  4JIO A;  4W8P A;  3U2M A;  2YLD A;  3BRJ A;  3L34 A;  5JS5 A;  3T4R A;  4AL0 A;  2NUP A;  3VAY A;  3IQT A;  3B0P A;  4JW1 A;  1RMV A;  3DWW A;  1CGO A;  1QPU A;  2Q9B A;  5E3C A;  3VM6 A;  4AE4 B;  5JUA A;  1A7E A;  2L7A A;  3CAX A;  2W9Y A;  4IAQ A;  2Q7R A;  2XLV A;  4L6R A;  2ZXO A;  4ER9 A;  4IRU A;  3RF3 A;  3E9V A;  3JSE O;  4O6N A;  3RW0 A;  4U5F E;  4MTG A;  1QKR A;  1M2V B;  1A7D A;  3S29 A;  1AVO B;  1VYK A;  1NSG B;  5DQZ A;  2J0X A;  4YT8 A;  2C04 A;  1J8M F;  2Q00 A;  4GEH A;  1PD0 A;  3U2L A;  4A4A A;  3OEO A;  2XL4 A;  4HE8 D;  4RBN A;  5A69 A;  2WZG A;  2XLH A;  4JTD B;  3C63 A;  4YK5 A;  5B1B C;  4MTF A;  4MVQ A;  3AQC A;  2YWA A;  4E7Z A;  5GPG B;  5DS5 A;  3LUT B;  3K33 A;  4E0I A;  2XXA A;  2CGE A;  1ORJ A;  2VB6 A;  1E84 A;  5JSL A;  1PV3 A;  4JCZ A;  4XPW A;  1UFB A;  2Q9A A;  2VH3 A;  1Q0D A;  1JR8 A;  1RJ9 A;  1YVI A;  2B0H A;  4ZLD A;  3K6B A;  4JKV A;  5F5F A;  1TWH A;  5DVW A;  4CS8 A;  4N6H A;  4O6M A;  5DS6 A;  2NPU A;  3DI5 A;  2OJQ A;  2YL1 A;  4J32 B;  4D4N A;  3I5P A;  4KBL A;  3WOD F;  4EBB A;  1V54 C;  3KH2 A;  3RFY A;  5AC5 A;  4LLC A;  1O3U A;  1NZE A;  1S7Z A;  5KYU A;  5A6B A;  3TJ6 A;  2R05 A;  3B71 A;  2YVK A;  2QUP A;  3U5S A;  1H7I A;  3EQL F;  1OW7 A;  3AG2 C;  1M6T A;  3ABL C;  3TOM A;  4CDA A;  4R32 A;  2EIL C;  1A0B A;  1HW1 A;  1JMW A;  2AWC A;  1ZHW A;  4YL3 A;  1H9G A;  1WGW A;  3U0C A;  4J7Y A;  1ZW3 A;  3LNM B;  3W8I A;  5B3S C;  1OXB A;  4JZA A;  4NQF A;  4WAB A;  2Y3B A;  3FOO A;  1D0Y A;  2OU6 A;  4XEK A;  4D4X A;  3VYW A;  1LPE A;  1NFN A;  2CNW A;  2MYS A;  2D4U A;  2PP4 A;  2EPM X;  2P0N A;  3RQE A;  4C3D A;  1APC A;  5HSW A;  5L0I A;  2M4E A;  1YZC A;  3LJB A;  5TJ5 E;  1M56 C;  2A68 F;  3SXM A;  2R03 A;  3DD7 A;  3AG1 C;  3T9O A;  3ZTZ A;  5BQI A;  1SF8 A;  2YKZ A;  5KYY B;  3CSK A;  1WWP A;  2PFD A;  3FMS A;  4I3M A;  2GA0 A;  3LEV A;  2UUI A;  1J8Y F;  2HSB A;  2Q9C A;  3EZI A;  1OQC A;  2GFH A;  4MVZ A;  3X1O A;  5AC4 A;  2WVQ A;  3C8G B;  1OCC C;  2A69 F;  3C8G A;  3W2V A;  1Z3I X;  3FVY A;  2Q4F A;  3R2P A;  3EG9 B;  3EGX B;  4JEB A;  2HSQ A;  3S0X A;  2ASR A;  1LI7 A;  3A9C A;  1TKN A;  3F46 A;  4JC7 A;  4AK9 A;  4E0H A;  3DAF A;  2NUP B;  2R7T A;  1TWC A;  4K7B A;  1Z5Z A;  3I4U A;  2KGO A;  1KNY A;  2LQG A;  4NTF A;  4KI2 A;  3FAJ A;  4OIO F;  3DKA A;  2EPL X;  3U8V A;  2A1D D;  3GM1 A;  1D1C A;  1S05 A;  4NCQ A;  2KK1 A;  3SXY A;  2R7R A;  4BJ6 C;  1VOM A;  3NYJ A;  2V26 A;  2E87 A;  4YT2 A;  4P6I C;  3NRH A;  2WVN A;  5L0G A;  5EGY A;  1YA9 A;  4O79 A;  4PK4 A;  5JVE A;  1LI5 A;  1YZA A;  2W45 A;  1H6G A;  4I44 A;  2CW0 F;  3MX3 A;  2I15 A;  2MHR A;  4U5D E;  5B1A C;  4PR9 A;  3IQC A;  4X0R A;  3U3B A;  3B0U X;  1MND A;  5DLJ A;  2EPK X;  2ETS A;  3QW1 A;  2YLG A;  5HV9 A;  3NG1 A;  3W8H A;  3DM5 A;  2CYD A;  2F22 A;  2LFF A;  1WTY A;  2YL0 A;  1NFO A;  3V5Y A;  4YL1 A;  2BL2 A;  2OOC A;  4B6I A;  4U5B E;  3S90 A;  4PJN A;  5A6J A;  1QLE C;  2W4M A;  3EPV A;  2P61 A;  4OIP F;  3LNR A;  3QMK A;  1MQV A;  1K04 A;  4IWB A;  4M63 A;  3NMK A;  3RVZ A;  3HKK A;  2Q3T A;  4DRI B;  1BR1 A;  3V5X A;  4MND A;  2CDQ A;  1G4U S;  1WAT A;  3O6X A;  4JTA B;  3JRT A;  4DBR A;  1BR2 A;  3JCU Q;  3NKE A;  4BEM J;  4CS7 A;  2LP4 A;  2XLD A;  1Q0F A;  2M64 A;  3UGO A;  256B A;  2P6V A;  3DJN B;  4LDR A;  2WB7 A;  3H65 A;  3LEO A;  5L0F A;  3HLZ A;  4MQ9 F;  2R7W A;  3C62 A;  2FAP B;  4RD9 A;  5CI8 A;  4DVZ A;  1LKX A;  4BPM A;  3T6B A;  2IYL D;  1RKC A;  3DE8 A;  1R4T A;  2L9J A;  2KW3 C;  4XQ1 A;  4LAC B;  3UNG C;  3O55 A;  4A2N B;  1K40 A;  3ABM C;  2DYS C;  1OCR C;  2Y3D A;  3ZDL A;  2R7O A;  3UMH A;  1YYX A;  1HE9 A;  3RQF A;  1D1B A;  3NDB B;  3JSZ A;  1K05 A;  3ZQV A;  4YT5 A;  3VF0 A;  1XZP A;  2QE9 A;  3H2U A;  4FWV A;  1PD1 A;  4JEA A;  4N06 A;  3EGD A;  3R7C A;  2IXP A;  2KSF A;  3B0V C;  4LER A;  5L3Q A;  3Q6M A;  1Z6A A;  5EHH A;  4BJ6 A;  2LK4 A;  2OJE D;  3IHU A;  1FR0 A;  1GS9 A;  1BZ4 A;  1U89 A;  2L6G A;  3G50 A;  3GOD A;  4W8K A;  1WOL A;  1JPN A;  1R5I D;  1GQA A;  2ZPA A;  1V55 C;  1T6U A;  1E2X A;  4CDY A;  4EUK B;  4OIQ F;  3M4C A;  4ONS A;  1YAR O;  3EH2 A;  5F5H A;  4OIN F;  2FGY A;  3KL4 A;  1FTS A;  2L81 A;  1Z23 A;  2WVO A;  1YJG A;  3GEH A;  5CI9 A;  4HFK B;  3AQB A;  3HTK C;  4MVM A;  1NU9 C;  4AL1 A;  3IEE A;  4CX9 A;  4I1M A;  2KYH A;  3G4X A;  1O87 A;  2J7P D;  3PCV A;  3M1C B;  1ZYR F;  2HV7 A;  5T1D B;  3ZWI A;  4EHP A;  4YWQ A;  3X2Q C;  3TUL A;  4QI2 A;  1BDJ B;  1RXQ A;  3Q6N A;  2QTV A;  4U9D A;  1KU2 A;  2L6F A;  3K7D A;  4O6Y A;  4PFO A;  4KNV A;  1TQG A;  3LS1 A;  2HMZ A;  2VCB A;  3SEO A;  3NMI A;  3ZC4 A;  3SYN A;  4C3E A;  2KJG A;  4EBK A;  4K0D A;  1I4Z A;  1NU7 D;  4MW8 A;  1VLS A;  2ICW G;  2NG1 A;  2PX3 A;  4CJO A;  3B9Q A;  1LVK A;  2DI3 A;  4QI0 A;  2G3K A;  1TFO B;  2PF4 E;  1SMY F;  4EKW A;  2TMV P;  3EFO A;  2A6H F;  2YLI A;  4RDA A;  3ZQY A;  2R7V A;  3DMD A;  1KTM A;  1HE1 A;  3GWN A;  4G78 A;  4NY3 A;  3L1M A;  5JP7 A;  2EIM C;  4XLN F;  2C03 A;  2RSE B;  2QNL A;  3WAQ A;  4E7S A;  5FCL A;  3TOL A;  2R7S A;  3TJ5 A;  2H7V C;  4BJ5 C;  3CZ6 A;  2IXO A;  4BEJ A;  3ZG1 A;  4O7G A;  1I4Y A;  1WN0 A;  3SXK A;  4JJF A;  4N6C A;  2ZXW C;  4DXW A;  2J8W A;  3B29 A;  4JJG A;  1VTM P;  3A11 A;  2ZXP A;  2IM8 A;  2Z15 A;  3EHM A;  1U0B B;  3UMK A;  1DOW A;  5EK0 A;  1T5O A;  4JE9 A;  5E33 A;  3DE9 A;  1MMN A;  2P1A A;  4PJM A;  3G4Z A;  3FXH A;  4FX5 A;  2XSE A;  2MWQ A;  1L7C A;  4GYT A;  1D1A A;  1EA8 A;  1JRA A;  4J7T A;  1ZU4 A;  4U5G A;  3J06 A;  1OXK A;  2KNH A;  2XLM A;  1YA7 O;  3JTL O;  4DJ9 A;  1G5Z A;  2IBF A;  4YT4 A;  4OD4 A;  1FNT c;  3ECS A;  2J45 A;  2Y3H A;  3S9O A;  4C7O A;  3L8I A;  1Q0M A;  4HEA J;  4NTB A;  1A7V A;  1T01 A;  3U3F A;  3AG4 C;  3DZA A;  3ZIB A;  5L3V A;  4Q4Z F;  3AJM A;  3LAY A;  1L3P A;  3Q7G A;  5JT4 A;  2YEV A;  2IOQ A;  1HY5 A;  3K1H A;  4WGZ A;  4U5H A;  3RQG A;  3UGP A;  5BQG A;  1LS1 A;  3QVZ A;  5IY5 C;  5COG A;  4Q5S F;  2J0W A;  2Y69 C;  3ZTM A;  2HV6 A;  5BQH A;  1O5H A;  3S27 A;  4PJL A;  4H54 A;  5D91 A;  1Q0K A;  2JPU A;  1OW6 A;  1G8X A;  2IXN A;  4G7O F;  2GWW A;  3HNJ A;  3EGD B;  4E18 A;  2YQY A;  1XZQ A;  2EIN C;  2J7P A;  3MYI A;  3O39 A;  1Y6D A;  5E3A A;  5FZT A;  2D5R B;  1TWG A;  3M4B A;  2XRH A;  4HFF B;  3T6J A;  3DM9 B;  5B3I A;  4DRH B;  1B68 A;  2XXA B;  2LCH A;  3JYY A;  4H4K C;  1C17 M;  3U9J A;  3VRC A;  1ZHY A;  3PHF 2;  1RJ9 B;  2YL7 A;  3NYL A;  4PFP A;  3NMJ A;  2AVK A;  3MFN A;  1M57 C;  3US6 A;  2ZXR A;  3S84 A;  4NTA A;  4GQH A;  2J9W A;  1IZM A;  5L0D A;  1AEP A;  5KYX A;  2LD6 A;  3U8P A;  4Z9J A;  5JRA A;  4I1O B;  2YL3 A;  4YN0 B;  4CS9 C;  1ORS C;  2GDC A;  3K1I C;  3ATP A;  4LDQ A;  5KYU B;  2R25 A;  5COF A;  3FOP A;  3KPH A;  3QTH A;  1CPR A;  3DXJ F;  4G0H A;  4P9F A;  2Y3G A;  4LLE A;  4BJ5 A;  3LLK A;  3TQO A;  3RKO F;  3N24 A;  4XWJ A;  3ZSU A;  2NSF A;  5KYW A;  1TFK B;  1QZX A;  2B0J A;  3CQZ A;  3E70 C;  3S28 A;  2EPN A; 
#chains in the Genus database with same CATH homology
 1E85 A;  1E86 A;  4CX9 A;  3ZTZ A;  2J9B A;  2YKZ A;  1YYJ A;  1QQ3 A;  3IQ5 A;  3ZWI A;  4ULV A;  4U9D A;  3HNK A;  3NMI A;  5AGF A;  4JEB A;  1CGN A;  4WGY A;  4CJO A;  3IQ6 A;  2QLA A;  1EKY A;  2XLE A;  1BBH A;  4IB4 A;  1S05 A;  1E83 A;  2YLI A;  3ZQY A;  4IAR A;  3L1M A;  5JP7 A;  1RCP A;  1LM3 B;  2XLW A;  3TOL A;  4U9E A;  2CCY A;  2XL6 A;  5JS5 A;  5JVE A;  3M15 A;  1YZA A;  2YLD A;  4CIP A;  2J8W A;  1CGO A;  1QPU A;  3M79 A;  3QW1 A;  5JUA A;  2YLG A;  4JE9 A;  4IAQ A;  3DE9 A;  3HNI A;  2XLV A;  2YL0 A;  4L6R A;  4ER9 A;  4EIY A;  1MQV A;  3NMK A;  3QW0 A;  2XLM A;  4N4W A;  1NBB A;  1A7V A;  1JAF A;  2XM4 A;  1CPQ A;  2XLD A;  5JT4 A;  4WGZ A;  2XLH A;  3C63 A;  256B A;  3QVZ A;  2XLO A;  3ZTM A;  3HNL A;  3C62 A;  1E84 A;  5JSL A;  3HNJ A;  3DE8 A;  4JKV A;  2XM0 A;  4N6H A;  3M4B A;  5JLI A;  2XL8 A;  5B3I A;  2YL1 A;  4D4N A;  3VRC A;  1YYX A;  2YL7 A;  3NMJ A;  3ZQV A;  2BC5 A;  4JEA A;  4NC3 A;  3TOM A;  1M6T A;  4CDA A;  3U8P A;  5JRA A;  2YL3 A;  4CDV A;  3FOP A;  1CPR A;  3FOO A;  4D4X A;  1GQA A;  4CDY A;  3QVY A;  3M4C A;  4CJG A;  1APC A;  1YZC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...