5JVEA

L16i mutant of cytochrome c prime from alcaligenes xylosoxidans: ferrous state
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
125
structure length
125
Chain Sequence
EFAKPEDAVKYRQSAITLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cytochrome c'
publication title Engineering proximal vs. distal heme-NO coordination via dinitrosyl dynamics: implications for NO sensor design.
pubmed doi rcsb
source organism Alcaligenes xylosoxydans xylosoxydans
molecule tags Electron transport
total genus 49
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2016-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 5jveA00
5JSLA 1CPRA 3HNLA 2BC5A 2CCYA 2XL6A 5B3IA 2QLAA 1YYXA 3ZWIA 3M4CA 3QW0A 3TOMA 4U9DA 3QVYA 2YL7A 1CPQA 4N4WA 2YLDA 1MQVA 1E86A 5JS5A 1E84A 3C62A 3HNJA 1QQ3A 5JT4A 2J9BA 4IAQA 1EKYA 3DE8A 1LM3B 2J8WA 3C63A 1APCA 1E85A 2YLIA 5JRAA 2YL0A 4IARA 4JE9A 3M79A 1E83A 2YKZA 4L6RA 2XLHA 2XLVA 4ULVA 5JUAA 4CDVA 1RCPA 3VRCA 4WGZA 2XL8A 3QVZA 4IB4A 3FOPA 3FOOA 3DE9A 1BBHA 2XLEA 4U9EA 4NC3A 2YLGA 3ZTZA 4D4NA 256BA 1S05A 2XM0A 4ER9A 2XLMA 3HNIA 3ZQYA 1NBBA 4CJOA 5JLIA 4EIYA 2XLOA 3NMIA 5JP7A 4D4XA 4N6HA 5JVEA 1GQAA 1YZCA 1CGOA 4CX9A 4JKVA 4JEBA 1A7VA 2YL1A 3IQ6A 1YYJA 3TOLA 3ZTMA 3M15A 4CDYA 4CDAA 3NMKA 3M4BA 3QW1A 4JEAA 3U8PA 3L1MA 4WGYA 1QPUA 4CIPA 1CGNA 2YL3A 3ZQVA 5AGFA 3HNKA 4CJGA 1M6TA 2XLDA 1JAFA 2XLWA 1YZAA 3IQ5A 2XM4A 3NMJA
chains in the Genus database with same CATH superfamily
3KH2A 5L3VA 4EBBA 4JTAB 4DXWA 1BR2A 2OKUA 1OW6A 2CCYA 3H65A 2XL6A 1E2XA 1NFOA 4JCHA 1U0BB 1I5NA 1LI7A 1YYXA 2AVKA 3ZWIA 2A6HF 1NG1A 4ONSA 2G3VA 3VF0A 3LLKA 4GYTA 3QVYA 3RKOF 1ORSC 4EHPA 2PF4E 4IAOA 4MVUA 4PACA 2OCCC 1WGWA 2R7SA 2OEVA 1B68A 2LIGA 4XEVA 5E3AA 2Q7RA 5L0FA 2XXAB 4Z9IA 1BDJB 1OR3A 3MBGA 2HJ3A 4KI2A 2R7WA 1E86A 1ZYRF 1WTYA 2I15A 1DOWA 1YARO 3AG2C 3C62A 4PJLA 4AX2A 4BJ6A 4CSAC 1O87A 5FCLA 1EKYA 2KNHA 4XPWA 3S0XA 1HW1A 3DE8A 1RMVA 2VCCA 5AC4A 5CIVA 2LD6A 1SF8A 4U5BE 1JMWA 4UDVA 4IGGA 2YLIA 2PP4A 2EILC 2R03A 3K6BA 3U2LA 2R7VA 2L6HA 3LLIA 4MS2A 5CI9A 2LSEA 2X0CA 3U3FA 1OCRC 1F1MA 1VYIA 3CEXA 4E17A 2KK1A 1LE4A 1RJ9B 3B29A 4NCQA 1HW2A 3AGTA 1LS4A 2ZD9A 2XXAA 1CGME 4XEFA 2R7XA 1W2WA 5L0DA 2AP3A 2B0HA 2J45A 4YK5A 1KTMA 1E83A 4JIOA 3X2QC 5EGYA 2EPMX 4L6RA 3TK0A 1WATA 3AGUA 4AK9A 1OQCA 2G62A 2EPNA 3NYJA 4ULVA 3UR3C 3DD7A 4EKWA 4CDVA 4DBRA 5KYYB 2TMVP 3I4UA 1OXBA 1Y6DA 1QKRA 1L3PA 3DMDA 3VRCA 4FX5A 4IB4A 4Q4ZF 2Q4FA 1RJ9A 2Q9CA 3DJUB 4P6IC 256BA 2EPOA 2Q9AA 2XM0A 4JCZA 2ETSA 1NFNA 4ER9A 4AL0A 2R25A 2R7TA 5DQTA 4NQFA 3JZ0A 3ABMC 2HMQA 3FXHA 3LS0A 4G78A 3ZQYA 2WVQA 5L0CA 1RKEB 3QTHA 2J9WA 2J9VA 4J32B 5AC5A 2MWQA 5KYYA 3DM9B 3I5PA 3ASNC 2DB4A 3EHNA 2FGYA 3QMKA 3JTLO 1GGQA 4PFPA 2KJGA 3CAXA 3LEOA 1Q0MA 3V5YA 2R7UA 1PD0A 1CGOA 4CX9A 3Q7LA 2L7AA 2Q9BA 1TWGA 4CIHA 1A7VA 2UUIA 2ZXWC 2WVOA 2YVKA 3M15A 3LNMB 2VC9A 4FESA 1VYKA 4CS8A 3H2VA 4YWQA 3MYFA 3NMKA 1SZIA 3N24A 2A0UA 3TJ6A 3TJ5A 5A6AA 1TFOB 4JEAA 2Q3TA 3E70C 2ZXRA 2EIKC 1RKEA 4OIOF 3NYMA 4I44A 1CGNA 3IEEA 4YT4A 3UNGC 4N6CA 4KNVA 2FFHA 3FVYA 1LIHA 5AGFA 5B1BC 4EBKA 1C17M 1EI7A 4PJNA 1IW7F 2EIJC 3IQTA 1ZHTA 3T6BA 1G4WR 4BJ1A 3M1CB 5F28E 4DVYP 3S84A 3FDQA 3BEHA 1LI5A 1Q0KA 1M57C 4X0RA 1MMDA 5BQIA 3OWTA 3HNLA 4HE8D 1ORYA 2AWYA 5B3IA 1MNEA 4U5HA 2QLAA 4R32A 1ZVZA 3EH2A 2WL8A 4JC7A 3QW0A 3B0PA 5K0IA 2A6EF 1EA8A 1TQGA 2YL7A 1LPEA 2H7BA 5HV9A 3G4XA 3WAQA 1LKXA 3V5XA 1I4YA 4WJ0A 3AQBA 3G4ZA 3EZIA 1T6IA 3QZCA 3AG1C 2J0WA 2OJED 4MQ9F 1MQVA 4BJ6C 1SYQA 2IOQA 3T6JA 5CI8A 5JS5A 3RH3A 1QQ3A 3DKAA 5T3WA 3VAYA 4C3EA 1OKKD 1ZHYA 3VYWA 1R5ID 2IYLD 4IRUA 5D91A 3JCUQ 1V55C 3C63A 2C03A 2A68F 1PV3A 3JRMO 3KYIA 3SEOA 2ZPAA 3GEIA 3RW0A 3Q6MA 1FMVA 5DS5A 1IZMA 3I5QA 2YEVA 2LFFA 2YL0A 3C8ZA 2C04A 3S29A 1ZW2A 4IARA 3FAJA 3GANA 1TWAA 1FAPB 4DRJB 3F46A 2A1DD 2HZ8A 1D1BA 1YA7O 2BL2A 2H7OA 2QNLA 4EWCA 2YHSA 2LCHA 4GEHA 2P7VA 1L7CA 4U5EE 2A69F 3RQEA 1H9GA 1YVIA 1UFBA 2R9RB 4JW1A 1HY5A 3UMKA 5L0JA 1ORJA 3JSZA 4RBNA 4NTFA 4YN0B 3U0CA 2NG1A 2QTVA 2A0BA 2GA0A 4WGZA 4IWBA 4P9FA 3RQFA 1JRAA 4XWJA 5GPGB 3RYLA 3AOUA 3GODA 1AUEA 3DE9A 1BBHA 4U9EA 1OCOC 2LFDA 2OU6A 3C18A 5BUOA 3ZTZA 3TULA 1D0XA 5COFA 3HTKC 4D4NA 1RKCA 2WZFA 1MMAA 1T6UA 4NTBA 4G0HA 5EHHA 1H9TA 3MLGA 3ZIBA 4CS9A 2W4BA 1D1AA 1Q0DA 2R7OA 2XLMA 2YQYA 3ZVRA 3CQZA 3KMIA 4JTCB 4RD9A 1FTSA 2XLOA 5JP7A 3EG9B 3RVZA 4B6IA 4OIQF 1UG7A 1ZHZA 1MNDA 2NPUA 4DBQA 3UMIA 1V4AA 4LDKA 3R7CA 2P0NA 1BZ4A 3EPVA 3LUTB 3MFNA 2YWAA 4K0DA 3SZRA 4BEMJ 1YZCA 1Z6AA 2PFDA 4CBEA 2QE9A 4IJJA 4LDQA 3OA1A 1FFTC 3GWLA 1WN0A 2AU5A 3SP1A 4CS8C 1OXKA 2YL1A 2HMZA 2KW3C 3IQ6A 4MW8A 1K04A 1S7ZA 4O6NA 3TOLA 2KYHA 4LLEA 4MTGA 4YT2A 1FFHA 4ZLCA 2KSFA 1J8MF 3PHF2 3HJCA 3FHDA 1YA9A 3RVYA 4FWVA 1VLSA 2AWCA 3JRTA 1QPUA 2VASA 2XS1A 3L1MA 5KYXB 2WZLA 3X1OA 4W8PA 3W8HA 1HMOA 2M4EA 3EG9A 2YL3A 2V26A 2IXPA 3O39A 4EUKB 2GDCA 2D5RB 4K1OA 3HNKA 2IBFA 4YJWA 4OIRF 4MTFA 3N0TA 4XEKA 5DVWA 3RFYA 2JD3A 1JAFA 3U9JA 1QZXA 1YZAA 3EGXB 4DVZA 3NMJA 3FAPB 2GAQA 1Z3IX 2HSBA 2NUPB 3EHMA 4J7TA 5JSLA 5A6KA 3AJMA 2L6GA 2BC5A 4JJFA 3DAFA 4NY3A 5IY5C 4MVOA 1DOVA 2XS8A 1WWPA 3TOMA 4U9DA 3JYYA 3O10A 4O79A 3JYHA 2HS5A 5A6BD 1Y4CA 1TWHA 1NLXA 5L0IA 5KYXA 1D0ZA 3B0UX 3SXZA 3SXMA 1C02A 1OCCC 4N4WA 5BQGA 1WASA 2M64A 5COMA 1ZU5A 4XTKA 4OIPF 3U2MA 5T3TA 5DS4A 2P1AA 2Y3BA 4QDLA 2J9BA 4E0HA 4XLNF 3EGXA 5E2QA 3W2VA 2JPUA 1FMWA 1FR0A 2G3KA 2NUPA 3K66A 3RQGA 2XL4A 2J8WA 3S28A 3U3BA 1APCA 1E85A 1OR2A 4CS7A 3H2UA 1Z7Qc 1OW7A 1RXQA 4HFKB 3SNHA 5A6JA 4G7ZF 1JR8A 2HV7A 4DRIB 3GEEA 2DYSC 1LS1A 4I1OB 5JRAA 2O9XA 3HKKA 4YL1A 4JTDB 1C03A 2YZSA 3ZTMA 4JRZA 2HFIA 4PR9A 4YT8A 4JE9A 4K7BA 2DYRC 2L81A 2J0XA 2R7RA 3PCVA 2JX0A 4FAPB 3O55A 3L8IA 1HMDA 2W9YA 4LDRA 2YKZA 1WOLA 3ZDLA 2XLHA 4NTAA 2Y3GA 3LS1A 2IXMA 2XLVA 5JUAA 1QVXA 2YRFA 2HUJA 1O3UA 3GM1A 1XZQA 3DI5A 2CW0F 3ABLC 5A6BA 1JPJA 4AE4B 1JPNA 1BR1A 1Q0GA 3FOPA 3FOOA 2WZGA 1NU9C 1VB5A 2RD9A 4MVSA 1SR2A 1T01A 1TWCA 2H7VC 4NC3A 2YLGA 2HSQA 4Q7CA 3NDBB 2I8BA 4CS9C 3FMSA 2EPLX 3U9MA 4N06A 5BQHA 2WVNA 3PMRA 4E18A 3ECSA 2L9JA 2OEXA 2OJQA 3LNRA 1U89A 1NBBA 5L0GA 1G5ZA 1Q0FA 2IM8A 3KL4A 4U5GA 5JLIA 1TFKB 2CNWD 3U8VA 5F5FA 3NMIA 2OOCA 4N6HA 2X51A 5JVEA 1H6GA 4Q5SF 3N2ZB 1TKNA 3W2WA 4BEJA 3S90A 4Z9HA 1KU2A 1GQAA 1O5HA 2GFHA 2RSEB 3Q7GA 3CSKA 4BJ5A 4J30B 1ZHXA 4U5FE 3EZHA 3W8IA 4AE4A 1JOGA 1OW8A 3DAGA 4LERA 4WABA 3EQLF 5DQZA 5DS6A 3B0VC 3POVA 3RIPA 2IXNA 4BJTA 1Z63A 2F22A 3TQOA 2ICWG 4YT5A 4JEBA 4KBLA 2GWWA 3F47A 4O6YA 4C3BA 4CDYA 2OG2A 2Z15A 4E7ZA 4CDAA 2J9UA 2VB6A 3KPHA 1U6HA 3M4BA 1M56C 3AG4C 1AEPA 1ZW3A 3QW1A 4C3DA 1A7DA 3ZC4A 3EFOB 4WGYA 4DJ9A 5KYUB 4CIPA 2LQGA 3K33A 2L6FA 1LVKA 4I1MA 1H7IA 4PFOA 4P9TA 3NG1A 1OKKA 1YLMA 3L34A 1KNYA 2W45A 3LESA 3AQCA 4E7SA 4CJGA 4H4KC 4A4AA 1M6TA 2BE5F 2XLDA 1LE2A 3PDMP 2NSFA 3ZG1A 3GM2A 3IQ5A 2VH3A 4XQ1A 4RDAA 2KGOA 2MYSA 2DI3A 3K1IA 4KC9A 3JT1A 1CPRA 2UUHA 3KKBA 3VM6A 1K05A 2HJMA 4GQHA 3S27A 2XRHA 3M4CA 3MYIA 2J7PD 2CNWA 2D4UA 3B71A 4LACB 3IQCA 3EFOA 5KYUA 4MVRA 2V3CC 1CPQA 1AVOB 1QSPA 1XZPA 4MW3A 3TD7A 3WODF 5HSWA 4J7YA 5KYNA 1PD1A 4Z9JA 1R4TA 4XPYA 3K1HA 2E87A 1G4US 1K40A 1QLEC 2Y39A 4MTOA 4YL3A 5E33A 3WG7C 4ANJA 4DOZA 3ATPA 3NRHA 4OD4A 2YLDA 4F4BA 2B0JA 2PNOA 1TR2A 1T9KA 3T9OA 3T4RA 1E84A 4MVMA 4A2NB 5DLJA 3HNJA 2P61A 2OQMA 5F5HA 4IAQA 1VMAA 5JT4A 5B1AC 2PX0A 4MVQA 4MVZA 4G7OF 2ASRA 4CSAA 1YJGA 1LM3B 4QI0A 3GEHA 4EBJA 5L3QA 3O6XA 3LEVA 2ZXPA 4M63A 4U5CE 1PCXA 1NZEA 3SXYA 4ZLDA 2NUTB 1J8YF 4PK4A 2R7QA 1SMYF 1D1CA 1T5OA 3AG3C 1A7EA 3J06A 1D0YA 2J46A 5T1DB 1ZHWA 2DGJA 3A9CA 3KYJA 4JVSA 3U5SA 4KNWA 2XSEA 3L8JA 3GORA 5FZTA 2PX3A 3DM5A 3OEOA 2KC3A 2MHRA 3M79A 4O6MA 4W8KA 3RF3A 4XLPF 3A11A 1GM5A 5TJ5E 3W4YA 1FNTc 2P6VA 3C8GD 3GM3A 2EPKX 4JURI 3ASOC 5E3CA 3LAYA 4E0IA 3MX3A 4C7OB 2H8AA 1M2OA 2Q00A 4JJGA 1YAUO 1VTMP 5D92A 3L0IA 3GWNA 4O7GA 1RCPA 1M2VB 1ZZPA 5EK0A 2J7PA 1A0BA 2NUTA 2Y3HA 1N1CA 2VCAA 1GS9A 2KQ9A 5KYWB 4YL0A 3DXJF 1EQ1A 2XL8A 2ZXOA 3QVZA 1ST6A 1MMGA 1BR4A 2XLEA 2R02A 2W4MA 3UGOA 3LJBA 3R2PA 2CYDA 1A41A 2HKVA 3S9OA 3E9VA 3EGDB 3C7JA 1S05A 1G8XA 3C8GB 2HV6A 4PJJA 5B3SC 3HNIA 3UGPA 3BRJA 3ZSUA 3UMHA 4G7HF 4CJOA 1ZU4A 4HEAJ 4LLCA 2VCBA 4MNDA 3V7OA 4D4XA 4DRHB 4EIYA 4C7OA 3NYLA 1V74B 1Z5ZA 2CDQA 4BJ5C 1NU7D 3US6A 1XWJA 1MMNA 4QI2A 2EINC 4HFFB 1M2VA 2FAPB 3G50A 2R05A 3DJNB 5KYWA 3CZ6A 2LP4A 4OD5A 3K7DA 3Q6NA 4OINF 2LK4A 2QUPA 1HE1A 1Z23A 4JKVA 5COGA 3WHNA 4JZAA 3SXKA 1YYJA 1VK5A 3DWWA 3EGDA 2IXOA 2NSGA 3C8GA 3EJNA 4ULWA 3HLZA 1I4ZA 3B9QA 3JSEO 4PJMA 3U8PA 4XPXA 1NSGB 2CGEA 3ABKC 4I3MA 4U5DE 3ITFA 4H54A 1HE9A 2QY9A 5A69A 1OCZC 2EIMC 2PBEA 1VOMA 3V5ZA 3NKDA 4AL1A 4BPMA 3ZQVA 3NKEA 3DZAA 3EH1A 2Y69C 3IHUA 4BG0A 1VLTA 3IPMO 1V54C 3K1IC 3T6GB 2Y3DA 2XLWA 1YDIA 3SYNA 5L0HA 1T6QA 2WB7A 2XM4A
chains in the Genus database with same CATH topology
5JSLA 1CPRA 3HNLA 2BC5A 2CCYA 2XL6A 5B3IA 2QLAA 1YYXA 3ZWIA 3M4CA 3QW0A 3TOMA 4U9DA 3QVYA 2YL7A 1CPQA 4N4WA 2YLDA 1MQVA 1E86A 5JS5A 1E84A 3C62A 3HNJA 1QQ3A 5JT4A 2J9BA 4IAQA 1EKYA 3DE8A 1LM3B 2J8WA 3C63A 1APCA 1E85A 2YLIA 5JRAA 2YL0A 4IARA 4JE9A 3M79A 1E83A 2YKZA 4L6RA 2XLHA 2XLVA 4ULVA 5JUAA 4CDVA 1RCPA 3VRCA 4WGZA 2XL8A 3QVZA 4IB4A 3FOPA 3FOOA 3DE9A 1BBHA 2XLEA 4U9EA 4NC3A 2YLGA 3ZTZA 4D4NA 256BA 1S05A 2XM0A 4ER9A 2XLMA 3HNIA 3ZQYA 1NBBA 4CJOA 5JLIA 4EIYA 2XLOA 3NMIA 5JP7A 4D4XA 4N6HA 5JVEA 1GQAA 1YZCA 1CGOA 4CX9A 4JKVA 4JEBA 1A7VA 2YL1A 3IQ6A 1YYJA 3TOLA 3ZTMA 3M15A 4CDYA 4CDAA 3NMKA 3M4BA 3QW1A 4JEAA 3U8PA 3L1MA 4WGYA 1QPUA 4CIPA 1CGNA 2YL3A 3ZQVA 5AGFA 3HNKA 4CJGA 1M6TA 2XLDA 1JAFA 2XLWA 1YZAA 3IQ5A 2XM4A 3NMJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JSL A;  1CPR A;  3HNL A;  2BC5 A;  2CCY A;  2XL6 A;  5B3I A;  2QLA A;  1YYX A;  3ZWI A;  3M4C A;  3QW0 A;  3TOM A;  4U9D A;  3QVY A;  2YL7 A;  1CPQ A;  4N4W A;  2YLD A;  1MQV A;  1E86 A;  5JS5 A;  1E84 A;  3C62 A;  3HNJ A;  1QQ3 A;  5JT4 A;  2J9B A;  4IAQ A;  1EKY A;  3DE8 A;  1LM3 B;  2J8W A;  3C63 A;  1APC A;  1E85 A;  2YLI A;  5JRA A;  2YL0 A;  4IAR A;  4JE9 A;  3M79 A;  1E83 A;  2YKZ A;  4L6R A;  2XLH A;  2XLV A;  4ULV A;  5JUA A;  4CDV A;  1RCP A;  3VRC A;  4WGZ A;  2XL8 A;  3QVZ A;  4IB4 A;  3FOP A;  3FOO A;  3DE9 A;  1BBH A;  2XLE A;  4U9E A;  4NC3 A;  2YLG A;  3ZTZ A;  4D4N A;  256B A;  1S05 A;  2XM0 A;  4ER9 A;  2XLM A;  3HNI A;  3ZQY A;  1NBB A;  4CJO A;  5JLI A;  4EIY A;  2XLO A;  3NMI A;  5JP7 A;  4D4X A;  4N6H A;  5JVE A;  1GQA A;  1YZC A;  1CGO A;  4CX9 A;  4JKV A;  4JEB A;  1A7V A;  2YL1 A;  3IQ6 A;  1YYJ A;  3TOL A;  3ZTM A;  3M15 A;  4CDY A;  4CDA A;  3NMK A;  3M4B A;  3QW1 A;  4JEA A;  3U8P A;  3L1M A;  4WGY A;  1QPU A;  4CIP A;  1CGN A;  2YL3 A;  3ZQV A;  5AGF A;  3HNK A;  4CJG A;  1M6T A;  2XLD A;  1JAF A;  2XLW A;  1YZA A;  3IQ5 A;  2XM4 A;  3NMJ A; 
#chains in the Genus database with same CATH topology
 3KH2 A;  5L3V A;  4EBB A;  4JTA B;  4DXW A;  1BR2 A;  2OKU A;  1OW6 A;  2CCY A;  3H65 A;  2XL6 A;  1E2X A;  1NFO A;  4JCH A;  1U0B B;  1I5N A;  1LI7 A;  1YYX A;  2AVK A;  3ZWI A;  2A6H F;  1NG1 A;  4ONS A;  2G3V A;  3VF0 A;  3LLK A;  4GYT A;  3QVY A;  3RKO F;  1ORS C;  4EHP A;  2PF4 E;  4IAO A;  4MVU A;  4PAC A;  2OCC C;  1WGW A;  2R7S A;  2OEV A;  1B68 A;  2LIG A;  4XEV A;  5E3A A;  2Q7R A;  5L0F A;  2XXA B;  4Z9I A;  1BDJ B;  1OR3 A;  3MBG A;  2HJ3 A;  4KI2 A;  2R7W A;  1E86 A;  1ZYR F;  1WTY A;  2I15 A;  1DOW A;  1YAR O;  3AG2 C;  3C62 A;  4PJL A;  4AX2 A;  4BJ6 A;  4CSA C;  1O87 A;  5FCL A;  1EKY A;  2KNH A;  4XPW A;  3S0X A;  1HW1 A;  3DE8 A;  1RMV A;  2VCC A;  5AC4 A;  5CIV A;  2LD6 A;  1SF8 A;  4U5B E;  1JMW A;  4UDV A;  4IGG A;  2YLI A;  2PP4 A;  2EIL C;  2R03 A;  3K6B A;  3U2L A;  2R7V A;  2L6H A;  3LLI A;  4MS2 A;  5CI9 A;  2LSE A;  2X0C A;  3U3F A;  1OCR C;  1F1M A;  1VYI A;  3CEX A;  4E17 A;  2KK1 A;  1LE4 A;  1RJ9 B;  3B29 A;  4NCQ A;  1HW2 A;  3AGT A;  1LS4 A;  2ZD9 A;  2XXA A;  1CGM E;  4XEF A;  2R7X A;  1W2W A;  5L0D A;  2AP3 A;  2B0H A;  2J45 A;  4YK5 A;  1KTM A;  1E83 A;  4JIO A;  3X2Q C;  5EGY A;  2EPM X;  4L6R A;  3TK0 A;  1WAT A;  3AGU A;  4AK9 A;  1OQC A;  2G62 A;  2EPN A;  3NYJ A;  4ULV A;  3UR3 C;  3DD7 A;  4EKW A;  4CDV A;  4DBR A;  5KYY B;  2TMV P;  3I4U A;  1OXB A;  1Y6D A;  1QKR A;  1L3P A;  3DMD A;  3VRC A;  4FX5 A;  4IB4 A;  4Q4Z F;  2Q4F A;  1RJ9 A;  2Q9C A;  3DJU B;  4P6I C;  256B A;  2EPO A;  2Q9A A;  2XM0 A;  4JCZ A;  2ETS A;  1NFN A;  4ER9 A;  4AL0 A;  2R25 A;  2R7T A;  5DQT A;  4NQF A;  3JZ0 A;  3ABM C;  2HMQ A;  3FXH A;  3LS0 A;  4G78 A;  3ZQY A;  2WVQ A;  5L0C A;  1RKE B;  3QTH A;  2J9W A;  2J9V A;  4J32 B;  5AC5 A;  2MWQ A;  5KYY A;  3DM9 B;  3I5P A;  3ASN C;  2DB4 A;  3EHN A;  2FGY A;  3QMK A;  3JTL O;  1GGQ A;  4PFP A;  2KJG A;  3CAX A;  3LEO A;  1Q0M A;  3V5Y A;  2R7U A;  1PD0 A;  1CGO A;  4CX9 A;  3Q7L A;  2L7A A;  2Q9B A;  1TWG A;  4CIH A;  1A7V A;  2UUI A;  2ZXW C;  2WVO A;  2YVK A;  3M15 A;  3LNM B;  2VC9 A;  4FES A;  1VYK A;  4CS8 A;  3H2V A;  4YWQ A;  3MYF A;  3NMK A;  1SZI A;  3N24 A;  2A0U A;  3TJ6 A;  3TJ5 A;  5A6A A;  1TFO B;  4JEA A;  2Q3T A;  3E70 C;  2ZXR A;  2EIK C;  1RKE A;  4OIO F;  3NYM A;  4I44 A;  1CGN A;  3IEE A;  4YT4 A;  3UNG C;  4N6C A;  4KNV A;  2FFH A;  3FVY A;  1LIH A;  5AGF A;  5B1B C;  4EBK A;  1C17 M;  1EI7 A;  4PJN A;  1IW7 F;  2EIJ C;  3IQT A;  1ZHT A;  3T6B A;  1G4W R;  4BJ1 A;  3M1C B;  5F28 E;  4DVY P;  3S84 A;  3FDQ A;  3BEH A;  1LI5 A;  1Q0K A;  1M57 C;  4X0R A;  1MMD A;  5BQI A;  3OWT A;  3HNL A;  4HE8 D;  1ORY A;  2AWY A;  5B3I A;  1MNE A;  4U5H A;  2QLA A;  4R32 A;  1ZVZ A;  3EH2 A;  2WL8 A;  4JC7 A;  3QW0 A;  3B0P A;  5K0I A;  2A6E F;  1EA8 A;  1TQG A;  2YL7 A;  1LPE A;  2H7B A;  5HV9 A;  3G4X A;  3WAQ A;  1LKX A;  3V5X A;  1I4Y A;  4WJ0 A;  3AQB A;  3G4Z A;  3EZI A;  1T6I A;  3QZC A;  3AG1 C;  2J0W A;  2OJE D;  4MQ9 F;  1MQV A;  4BJ6 C;  1SYQ A;  2IOQ A;  3T6J A;  5CI8 A;  5JS5 A;  3RH3 A;  1QQ3 A;  3DKA A;  5T3W A;  3VAY A;  4C3E A;  1OKK D;  1ZHY A;  3VYW A;  1R5I D;  2IYL D;  4IRU A;  5D91 A;  3JCU Q;  1V55 C;  3C63 A;  2C03 A;  2A68 F;  1PV3 A;  3JRM O;  3KYI A;  3SEO A;  2ZPA A;  3GEI A;  3RW0 A;  3Q6M A;  1FMV A;  5DS5 A;  1IZM A;  3I5Q A;  2YEV A;  2LFF A;  2YL0 A;  3C8Z A;  2C04 A;  3S29 A;  1ZW2 A;  4IAR A;  3FAJ A;  3GAN A;  1TWA A;  1FAP B;  4DRJ B;  3F46 A;  2A1D D;  2HZ8 A;  1D1B A;  1YA7 O;  2BL2 A;  2H7O A;  2QNL A;  4EWC A;  2YHS A;  2LCH A;  4GEH A;  2P7V A;  1L7C A;  4U5E E;  2A69 F;  3RQE A;  1H9G A;  1YVI A;  1UFB A;  2R9R B;  4JW1 A;  1HY5 A;  3UMK A;  5L0J A;  1ORJ A;  3JSZ A;  4RBN A;  4NTF A;  4YN0 B;  3U0C A;  2NG1 A;  2QTV A;  2A0B A;  2GA0 A;  4WGZ A;  4IWB A;  4P9F A;  3RQF A;  1JRA A;  4XWJ A;  5GPG B;  3RYL A;  3AOU A;  3GOD A;  1AUE A;  3DE9 A;  1BBH A;  4U9E A;  1OCO C;  2LFD A;  2OU6 A;  3C18 A;  5BUO A;  3ZTZ A;  3TUL A;  1D0X A;  5COF A;  3HTK C;  4D4N A;  1RKC A;  2WZF A;  1MMA A;  1T6U A;  4NTB A;  4G0H A;  5EHH A;  1H9T A;  3MLG A;  3ZIB A;  4CS9 A;  2W4B A;  1D1A A;  1Q0D A;  2R7O A;  2XLM A;  2YQY A;  3ZVR A;  3CQZ A;  3KMI A;  4JTC B;  4RD9 A;  1FTS A;  2XLO A;  5JP7 A;  3EG9 B;  3RVZ A;  4B6I A;  4OIQ F;  1UG7 A;  1ZHZ A;  1MND A;  2NPU A;  4DBQ A;  3UMI A;  1V4A A;  4LDK A;  3R7C A;  2P0N A;  1BZ4 A;  3EPV A;  3LUT B;  3MFN A;  2YWA A;  4K0D A;  3SZR A;  4BEM J;  1YZC A;  1Z6A A;  2PFD A;  4CBE A;  2QE9 A;  4IJJ A;  4LDQ A;  3OA1 A;  1FFT C;  3GWL A;  1WN0 A;  2AU5 A;  3SP1 A;  4CS8 C;  1OXK A;  2YL1 A;  2HMZ A;  2KW3 C;  3IQ6 A;  4MW8 A;  1K04 A;  1S7Z A;  4O6N A;  3TOL A;  2KYH A;  4LLE A;  4MTG A;  4YT2 A;  1FFH A;  4ZLC A;  2KSF A;  1J8M F;  3PHF 2;  3HJC A;  3FHD A;  1YA9 A;  3RVY A;  4FWV A;  1VLS A;  2AWC A;  3JRT A;  1QPU A;  2VAS A;  2XS1 A;  3L1M A;  5KYX B;  2WZL A;  3X1O A;  4W8P A;  3W8H A;  1HMO A;  2M4E A;  3EG9 A;  2YL3 A;  2V26 A;  2IXP A;  3O39 A;  4EUK B;  2GDC A;  2D5R B;  4K1O A;  3HNK A;  2IBF A;  4YJW A;  4OIR F;  4MTF A;  3N0T A;  4XEK A;  5DVW A;  3RFY A;  2JD3 A;  1JAF A;  3U9J A;  1QZX A;  1YZA A;  3EGX B;  4DVZ A;  3NMJ A;  3FAP B;  2GAQ A;  1Z3I X;  2HSB A;  2NUP B;  3EHM A;  4J7T A;  5JSL A;  5A6K A;  3AJM A;  2L6G A;  2BC5 A;  4JJF A;  3DAF A;  4NY3 A;  5IY5 C;  4MVO A;  1DOV A;  2XS8 A;  1WWP A;  3TOM A;  4U9D A;  3JYY A;  3O10 A;  4O79 A;  3JYH A;  2HS5 A;  5A6B D;  1Y4C A;  1TWH A;  1NLX A;  5L0I A;  5KYX A;  1D0Z A;  3B0U X;  3SXZ A;  3SXM A;  1C02 A;  1OCC C;  4N4W A;  5BQG A;  1WAS A;  2M64 A;  5COM A;  1ZU5 A;  4XTK A;  4OIP F;  3U2M A;  5T3T A;  5DS4 A;  2P1A A;  2Y3B A;  4QDL A;  2J9B A;  4E0H A;  4XLN F;  3EGX A;  5E2Q A;  3W2V A;  2JPU A;  1FMW A;  1FR0 A;  2G3K A;  2NUP A;  3K66 A;  3RQG A;  2XL4 A;  2J8W A;  3S28 A;  3U3B A;  1APC A;  1E85 A;  1OR2 A;  4CS7 A;  3H2U A;  1Z7Q c;  1OW7 A;  1RXQ A;  4HFK B;  3SNH A;  5A6J A;  4G7Z F;  1JR8 A;  2HV7 A;  4DRI B;  3GEE A;  2DYS C;  1LS1 A;  4I1O B;  5JRA A;  2O9X A;  3HKK A;  4YL1 A;  4JTD B;  1C03 A;  2YZS A;  3ZTM A;  4JRZ A;  2HFI A;  4PR9 A;  4YT8 A;  4JE9 A;  4K7B A;  2DYR C;  2L81 A;  2J0X A;  2R7R A;  3PCV A;  2JX0 A;  4FAP B;  3O55 A;  3L8I A;  1HMD A;  2W9Y A;  4LDR A;  2YKZ A;  1WOL A;  3ZDL A;  2XLH A;  4NTA A;  2Y3G A;  3LS1 A;  2IXM A;  2XLV A;  5JUA A;  1QVX A;  2YRF A;  2HUJ A;  1O3U A;  3GM1 A;  1XZQ A;  3DI5 A;  2CW0 F;  3ABL C;  5A6B A;  1JPJ A;  4AE4 B;  1JPN A;  1BR1 A;  1Q0G A;  3FOP A;  3FOO A;  2WZG A;  1NU9 C;  1VB5 A;  2RD9 A;  4MVS A;  1SR2 A;  1T01 A;  1TWC A;  2H7V C;  4NC3 A;  2YLG A;  2HSQ A;  4Q7C A;  3NDB B;  2I8B A;  4CS9 C;  3FMS A;  2EPL X;  3U9M A;  4N06 A;  5BQH A;  2WVN A;  3PMR A;  4E18 A;  3ECS A;  2L9J A;  2OEX A;  2OJQ A;  3LNR A;  1U89 A;  1NBB A;  5L0G A;  1G5Z A;  1Q0F A;  2IM8 A;  3KL4 A;  4U5G A;  5JLI A;  1TFK B;  2CNW D;  3U8V A;  5F5F A;  3NMI A;  2OOC A;  4N6H A;  2X51 A;  5JVE A;  1H6G A;  4Q5S F;  3N2Z B;  1TKN A;  3W2W A;  4BEJ A;  3S90 A;  4Z9H A;  1KU2 A;  1GQA A;  1O5H A;  2GFH A;  2RSE B;  3Q7G A;  3CSK A;  4BJ5 A;  4J30 B;  1ZHX A;  4U5F E;  3EZH A;  3W8I A;  4AE4 A;  1JOG A;  1OW8 A;  3DAG A;  4LER A;  4WAB A;  3EQL F;  5DQZ A;  5DS6 A;  3B0V C;  3POV A;  3RIP A;  2IXN A;  4BJT A;  1Z63 A;  2F22 A;  3TQO A;  2ICW G;  4YT5 A;  4JEB A;  4KBL A;  2GWW A;  3F47 A;  4O6Y A;  4C3B A;  4CDY A;  2OG2 A;  2Z15 A;  4E7Z A;  4CDA A;  2J9U A;  2VB6 A;  3KPH A;  1U6H A;  3M4B A;  1M56 C;  3AG4 C;  1AEP A;  1ZW3 A;  3QW1 A;  4C3D A;  1A7D A;  3ZC4 A;  3EFO B;  4WGY A;  4DJ9 A;  5KYU B;  4CIP A;  2LQG A;  3K33 A;  2L6F A;  1LVK A;  4I1M A;  1H7I A;  4PFO A;  4P9T A;  3NG1 A;  1OKK A;  1YLM A;  3L34 A;  1KNY A;  2W45 A;  3LES A;  3AQC A;  4E7S A;  4CJG A;  4H4K C;  4A4A A;  1M6T A;  2BE5 F;  2XLD A;  1LE2 A;  3PDM P;  2NSF A;  3ZG1 A;  3GM2 A;  3IQ5 A;  2VH3 A;  4XQ1 A;  4RDA A;  2KGO A;  2MYS A;  2DI3 A;  3K1I A;  4KC9 A;  3JT1 A;  1CPR A;  2UUH A;  3KKB A;  3VM6 A;  1K05 A;  2HJM A;  4GQH A;  3S27 A;  2XRH A;  3M4C A;  3MYI A;  2J7P D;  2CNW A;  2D4U A;  3B71 A;  4LAC B;  3IQC A;  3EFO A;  5KYU A;  4MVR A;  2V3C C;  1CPQ A;  1AVO B;  1QSP A;  1XZP A;  4MW3 A;  3TD7 A;  3WOD F;  5HSW A;  4J7Y A;  5KYN A;  1PD1 A;  4Z9J A;  1R4T A;  4XPY A;  3K1H A;  2E87 A;  1G4U S;  1K40 A;  1QLE C;  2Y39 A;  4MTO A;  4YL3 A;  5E33 A;  3WG7 C;  4ANJ A;  4DOZ A;  3ATP A;  3NRH A;  4OD4 A;  2YLD A;  4F4B A;  2B0J A;  2PNO A;  1TR2 A;  1T9K A;  3T9O A;  3T4R A;  1E84 A;  4MVM A;  4A2N B;  5DLJ A;  3HNJ A;  2P61 A;  2OQM A;  5F5H A;  4IAQ A;  1VMA A;  5JT4 A;  5B1A C;  2PX0 A;  4MVQ A;  4MVZ A;  4G7O F;  2ASR A;  4CSA A;  1YJG A;  1LM3 B;  4QI0 A;  3GEH A;  4EBJ A;  5L3Q A;  3O6X A;  3LEV A;  2ZXP A;  4M63 A;  4U5C E;  1PCX A;  1NZE A;  3SXY A;  4ZLD A;  2NUT B;  1J8Y F;  4PK4 A;  2R7Q A;  1SMY F;  1D1C A;  1T5O A;  3AG3 C;  1A7E A;  3J06 A;  1D0Y A;  2J46 A;  5T1D B;  1ZHW A;  2DGJ A;  3A9C A;  3KYJ A;  4JVS A;  3U5S A;  4KNW A;  2XSE A;  3L8J A;  3GOR A;  5FZT A;  2PX3 A;  3DM5 A;  3OEO A;  2KC3 A;  2MHR A;  3M79 A;  4O6M A;  4W8K A;  3RF3 A;  4XLP F;  3A11 A;  1GM5 A;  5TJ5 E;  3W4Y A;  1FNT c;  2P6V A;  3C8G D;  3GM3 A;  2EPK X;  4JUR I;  3ASO C;  5E3C A;  3LAY A;  4E0I A;  3MX3 A;  4C7O B;  2H8A A;  1M2O A;  2Q00 A;  4JJG A;  1YAU O;  1VTM P;  5D92 A;  3L0I A;  3GWN A;  4O7G A;  1RCP A;  1M2V B;  1ZZP A;  5EK0 A;  2J7P A;  1A0B A;  2NUT A;  2Y3H A;  1N1C A;  2VCA A;  1GS9 A;  2KQ9 A;  5KYW B;  4YL0 A;  3DXJ F;  1EQ1 A;  2XL8 A;  2ZXO A;  3QVZ A;  1ST6 A;  1MMG A;  1BR4 A;  2XLE A;  2R02 A;  2W4M A;  3UGO A;  3LJB A;  3R2P A;  2CYD A;  1A41 A;  2HKV A;  3S9O A;  3E9V A;  3EGD B;  3C7J A;  1S05 A;  1G8X A;  3C8G B;  2HV6 A;  4PJJ A;  5B3S C;  3HNI A;  3UGP A;  3BRJ A;  3ZSU A;  3UMH A;  4G7H F;  4CJO A;  1ZU4 A;  4HEA J;  4LLC A;  2VCB A;  4MND A;  3V7O A;  4D4X A;  4DRH B;  4EIY A;  4C7O A;  3NYL A;  1V74 B;  1Z5Z A;  2CDQ A;  4BJ5 C;  1NU7 D;  3US6 A;  1XWJ A;  1MMN A;  4QI2 A;  2EIN C;  4HFF B;  1M2V A;  2FAP B;  3G50 A;  2R05 A;  3DJN B;  5KYW A;  3CZ6 A;  2LP4 A;  4OD5 A;  3K7D A;  3Q6N A;  4OIN F;  2LK4 A;  2QUP A;  1HE1 A;  1Z23 A;  4JKV A;  5COG A;  3WHN A;  4JZA A;  3SXK A;  1YYJ A;  1VK5 A;  3DWW A;  3EGD A;  2IXO A;  2NSG A;  3C8G A;  3EJN A;  4ULW A;  3HLZ A;  1I4Z A;  3B9Q A;  3JSE O;  4PJM A;  3U8P A;  4XPX A;  1NSG B;  2CGE A;  3ABK C;  4I3M A;  4U5D E;  3ITF A;  4H54 A;  1HE9 A;  2QY9 A;  5A69 A;  1OCZ C;  2EIM C;  2PBE A;  1VOM A;  3V5Z A;  3NKD A;  4AL1 A;  4BPM A;  3ZQV A;  3NKE A;  3DZA A;  3EH1 A;  2Y69 C;  3IHU A;  4BG0 A;  1VLT A;  3IPM O;  1V54 C;  3K1I C;  3T6G B;  2Y3D A;  2XLW A;  1YDI A;  3SYN A;  5L0H A;  1T6Q A;  2WB7 A;  2XM4 A; 
#chains in the Genus database with same CATH homology
 5JSL A;  1CPR A;  3HNL A;  2BC5 A;  2CCY A;  2XL6 A;  5B3I A;  2QLA A;  1YYX A;  3ZWI A;  3M4C A;  3QW0 A;  3TOM A;  4U9D A;  3QVY A;  2YL7 A;  1CPQ A;  4N4W A;  2YLD A;  1MQV A;  1E86 A;  5JS5 A;  1E84 A;  3C62 A;  3HNJ A;  1QQ3 A;  5JT4 A;  2J9B A;  4IAQ A;  1EKY A;  3DE8 A;  1LM3 B;  2J8W A;  3C63 A;  1APC A;  1E85 A;  2YLI A;  5JRA A;  2YL0 A;  4IAR A;  4JE9 A;  3M79 A;  1E83 A;  2YKZ A;  4L6R A;  2XLH A;  2XLV A;  4ULV A;  5JUA A;  4CDV A;  1RCP A;  3VRC A;  4WGZ A;  2XL8 A;  3QVZ A;  4IB4 A;  3FOP A;  3FOO A;  3DE9 A;  1BBH A;  2XLE A;  4U9E A;  4NC3 A;  2YLG A;  3ZTZ A;  4D4N A;  256B A;  1S05 A;  2XM0 A;  4ER9 A;  2XLM A;  3HNI A;  3ZQY A;  1NBB A;  4CJO A;  5JLI A;  4EIY A;  2XLO A;  3NMI A;  5JP7 A;  4D4X A;  4N6H A;  5JVE A;  1GQA A;  1YZC A;  1CGO A;  4CX9 A;  4JKV A;  4JEB A;  1A7V A;  2YL1 A;  3IQ6 A;  1YYJ A;  3TOL A;  3ZTM A;  3M15 A;  4CDY A;  4CDA A;  3NMK A;  3M4B A;  3QW1 A;  4JEA A;  3U8P A;  3L1M A;  4WGY A;  1QPU A;  4CIP A;  1CGN A;  2YL3 A;  3ZQV A;  5AGF A;  3HNK A;  4CJG A;  1M6T A;  2XLD A;  1JAF A;  2XLW A;  1YZA A;  3IQ5 A;  2XM4 A;  3NMJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...