5JVEA

L16i mutant of cytochrome c prime from alcaligenes xylosoxidans: ferrous state
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
125
structure length
125
Chain Sequence
EFAKPEDAVKYRQSAITLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Engineering proximal vs. distal heme-NO coordination via dinitrosyl dynamics: implications for NO sensor design.
pubmed doi rcsb
source organism Alcaligenes xylosoxydans xylosoxydans
molecule tags Electron transport
molecule keywords Cytochrome c'
total genus 49
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2016-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 5jveA00
2BC5A 2YL1A 1EKYA 5JVEA 1CPRA 2XLOA 2XL8A 2XLEA 4WGZA 3HNKA 3NMIA 5AGFA 1E85A 2YLGA 3NMJA 3ZWIA 1YZAA 1BBHA 3L1MA 256BA 5JT4A 4U9EA 3ZQVA 2YKZA 4JEBA 4WGYA 1CGOA 4CDAA 2XLHA 4CX9A 4U9DA 3QVYA 1YYXA 3IQ6A 2J8WA 2YL7A 1A7VA 3U8PA 2YLIA 3FOPA 5JS5A 1JAFA 4JE9A 4ULVA 4CDYA 4CJOA 4EIYA 2J9BA 2XLVA 3M4CA 5B3IA 1E86A 5JRAA 3DE9A 3C63A 3ZTZA 1E84A 4ER9A 3ZQYA 1M6TA 3TOMA 1RCPA 3M79A 3HNLA 3M4BA 3FOOA 2XLDA 2CCYA 1E83A 4CDVA 4CIPA 5JLIA 3TOLA 1QQ3A 4IAQA 2YL3A 3C62A 1YYJA 3ZTMA 2XLMA 1QPUA 3QW0A 2YL0A 2XM0A 5JP7A 4D4XA 1GQAA 4N4WA 2XL6A 4NC3A 2QLAA 3IQ5A 3HNJA 4JKVA 4IB4A 2YLDA 3QVZA 5JSLA 5JUAA 1MQVA 3M15A 1CGNA 3DE8A 3HNIA 3VRCA 3NMKA 2XLWA 1YZCA 2XM4A 4N6HA 1CPQA 1S05A 4L6RA 4CJGA 1APCA 4JEAA 3QW1A 4IARA 4D4NA 1LM3B 1NBBA
chains in the Genus database with same CATH superfamily
1VMAA 1W2WA 2KYHA 2OKUA 3KMIA 1JMWA 4I44A 1VYKA 3NYJA 1TFOB 1V54C 5EHHA 1G8XA 3EZIA 3IQCA 1WGWA 3UMKA 1QVXA 4PR9A 3K7DA 3C8GB 3FXHA 4WGZA 3UNGC 3MYFA 3NMIA 2HFIA 1TWHA 2D4UA 4YL3A 1CGME 2NSGA 1QZXA 4JTCB 4OIQF 3IHUA 3N0TA 4MTOA 4RD9A 5KYXA 4E7ZA 1UFBA 2E87A 2LFFA 2YRFA 1LPEA 1FR0A 2QUPA 2JPUA 3K1IA 3RVZA 5F5FA 3LEVA 1WOLA 4O7GA 3WHNA 5F28E 4ZLDA 5KYYA 2L6GA 4MTFA 5A6BD 3ABLC 1NFOA 1V55C 3A9CA 4IAOA 3DZAA 3C8GD 3UGOA 1OR3A 2H7BA 2R7VA 1TKNA 3CSKA 3IQ6A 3N2ZB 3Q7GA 4J7YA 3K66A 4N6CA 3B9QA 4MS2A 2GWWA 4DVYP 3AG1C 3T4RA 2WZGA 3IEEA 3DMDA 4ULVA 3RF3A 3HJCA 2XLVA 1FFTC 4I1MA 5B3IA 1FTSA 4I1OB 3W2VA 5BUOA 4RDAA 3CEXA 4W8PA 3JSEO 1JPNA 3T9OA 4Z9HA 4ER9A 2LQGA 2VB6A 2AVKA 4XPWA 3T6BA 3ZQYA 1ZU5A 3ZC4A 4AE4A 4DRIB 3M79A 3VYWA 3HNLA 2KSFA 2LCHA 2PFDA 1ORJA 2HSBA 1H6GA 2P7VA 4G7OF 2XLDA 4NTBA 3GWNA 4PJLA 2CCYA 4KC9A 2BE5F 4XWJA 3EQLF 3ASOC 1LS4A 2Y69C 4PFPA 1YARO 1C03A 1T01A 2L9JA 1OR2A 1RKEA 2XSEA 4HE8D 4LDQA 4PJMA 4CDVA 4KBLA 2EPOA 1D1AA 3Q6NA 4IRUA 4CIPA 5JLIA 3EPVA 5KYUB 5BQGA 1HW2A 3LS1A 1RKCA 1DOWA 3DAGA 2Q9CA 4GYTA 3VF0A 4IAQA 4P9TA 4EKWA 2YL3A 1T6UA 4C3DA 3K33A 3SXZA 5KYWB 1WATA 3L0IA 2IM8A 1OW6A 3DM9B 5T1DB 3GWLA 1TWCA 3GM1A 3NG1A 4E0HA 2M64A 1H7IA 1PD1A 2FGYA 4LDRA 2NUTA 1M2VA 3U2MA 3QW0A 2LFDA 1NLXA 2XM0A 4JTAB 2LSEA 5COMA 1HW1A 2VCBA 2L81A 1SF8A 4XEVA 3BRJA 3H2VA 2AP3A 2LD6A 4G7ZF 2B0HA 4KNWA 1GQAA 3SXYA 5L0DA 2V3CC 3G4ZA 5CIVA 5L0CA 4JVSA 4NC3A 5T3WA 4JC7A 2QLAA 4XEFA 5BQIA 1I5NA 2YLDA 3ZTMA 1PD0A 5A6AA 2DGJA 3M15A 4MVSA 1QKRA 4U5HA 1CGNA 1L3PA 3DE8A 5FZTA 3V5YA 4ZLCA 4CS8C 3DXJF 3JRTA 4PK4A 2XL4A 3HLZA 1RJ9A 3L8JA 2XLWA 3U3BA 1YAUO 3B29A 3EH1A 1TWAA 2NUTB 4Q5SF 3O10A 2I8BA 3DAFA 3GEHA 2WZFA 4JEAA 2NUPB 2B0JA 3QW1A 2R7TA 1VLSA 2XRHA 2XS8A 4D4NA 2NUPA 5HSWA 4Q4ZF 3T6GB 2BC5A 2A68F 4C3EA 2JD3A 4YT4A 1NG1A 2R7UA 3SXKA 4MQ9F 3ZVRA 2DYRC 2MHRA 3JZ0A 2XL8A 4A2NB 1ORYA 1JRAA 4CIHA 3ECSA 1V74B 4WJ0A 4ONSA 3UMHA 4UDVA 1LKXA 1ZHTA 4NQFA 1BZ4A 4BEMJ 3POVA 1JR8A 1XZPA 3RQEA 4A4AA 5B1AC 2CW0F 1KNYA 2WL8A 1K40A 5L0IA 3JRMO 3NYLA 2Y39A 3SP1A 1U89A 3GODA 1FNTc 2H7OA 2VH3A 4CBEA 4EWCA 1PV3A 1T5OA 4DRJB 2OEVA 1CGOA 1MNDA 2A0UA 4CDAA 3B0VC 3QVYA 3I5PA 4EUKB 2J8WA 1D0YA 3LAYA 2J9UA 4K7BA 4BPMA 1GS9A 4IWBA 3AOUA 5DQTA 4MVMA 1M2VB 4FWVA 4LACB 1JAFA 1AVOB 1Z3IX 4YN0B 3EGXA 1TQGA 4CDYA 3KH2A 2J9BA 3EGDA 3KYJA 3M4CA 3EJNA 3SEOA 4EBKA 3DE9A 5KYWA 1J8MF 3K1HA 1ZHXA 4DJ9A 2J7PD 4JURI 3Q7LA 3TQOA 4G78A 1F1MA 1M6TA 2Y3GA 5KYYB 2R7SA 1Q0GA 4JJFA 1U0BB 1NSGB 1HE9A 1GGQA 1Y4CA 3FOOA 3GM3A 2M4EA 2V26A 1KU2A 1T6QA 3HTKC 3PHF2 4OD5A 3X1OA 2R7XA 4HFFB 2D5RB 2WVNA 3U5SA 2ZPAA 2WVQA 2Y3DA 1J8YF 3B71A 1Z63A 4MTGA 2YHSA 4J7TA 3WODF 5DVWA 1ZYRF 2EPMX 2HUJA 1OXBA 4AE4B 4BJTA 1WTYA 3PDMP 4XTKA 1QQ3A 5DS6A 1ZHZA 4PACA 1HMOA 1PCXA 3C8ZA 1UG7A 3ABMC 2QY9A 3C62A 2Q3TA 3DI5A 5DQZA 1N1CA 3HKKA 1Y6DA 1Z6AA 4JW1A 4LDKA 4QI0A 5COGA 2X0CA 3VM6A 4YJWA 1JOGA 2OG2A 1QPUA 2EINC 3M1CB 2YL0A 3QZCA 1FMVA 4Q7CA 1MMDA 3CZ6A 1TFKB 2ZXWC 2GA0A 3AG4C 3PCVA 4JZAA 3TK0A 2IOQA 5JP7A 4J30B 4O6NA 2EPKX 3ASNC 5TJ5E 2L7AA 4N4WA 4BJ6C 1VYIA 1V4AA 1WASA 2PF4E 4LLCA 1MMNA 2NPUA 4JCZA 4NY3A 4IB4A 3QVZA 4H4KC 2R02A 4EBJA 1OCOC 2A6HF 5JSLA 3W8IA 5DS4A 5KYXB 1MQVA 2GAQA 1D1CA 3EHNA 4XQ1A 2A1DD 4U5BE 1OCZC 1GM5A 4KI2A 2EIKC 3NMKA 1OCCC 2CNWA 3U9JA 3TJ6A 2OCCC 1M56C 1ZW2A 3E70C 4LLEA 4AX2A 1SZIA 4N6HA 1OKKA 4K0DA 2JX0A 1A41A 2MYSA 3WAQA 1ST6A 4MVRA 1ZZPA 1LM3B 4AL1A 1NBBA 4EHPA 1M2OA 1SMYF 1EKYA 5JVEA 1CPRA 3S84A 1O5HA 2LK4A 2IXOA 3DJNB 3OEOA 5E3AA 3EGDB 4RBNA 4JRZA 3EGXB 3HNKA 2A6EF 4MW8A 3ZWIA 3NMJA 2HV7A 2Q9BA 2NSFA 1QLEC 3O39A 4DXWA 2HS5A 3EG9B 3FMSA 3L1MA 1T9KA 1ZU4A 1BR1A 2I15A 2KC3A 3LEOA 4XPXA 1D0ZA 4IGGA 4U9EA 3RW0A 1G4WR 2CYDA 4U5EE 3I5QA 2YKZA 3BEHA 4MVZA 4O6YA 4ULWA 3LJBA 4CS8A 1BR2A 2BL2A 1LI7A 2QE9A 2KW3C 4HEAJ 2UUHA 4Z9IA 2FFHA 4U9DA 4CS7A 4E7SA 3U9MA 5AC4A 2R25A 1YYXA 3S0XA 1WN0A 1Q0FA 5DLJA 4DBQA 1VK5A 3F46A 2O9XA 3KYIA 3SNHA 2R7WA 3JT1A 4N06A 1D1BA 2YLIA 3AQCA 4IJJA 1Q0KA 1QSPA 2W9YA 3KPHA 3C7JA 5GPGB 3S9OA 4JE9A 2ICWG 2F22A 3KL4A 5JS5A 5L0GA 2TMVP 4CJOA 3GORA 2Q9AA 5JRAA 2R05A 3C63A 3ZTZA 1SYQA 2WB7A 2VCCA 1A0BA 5E2QA 1K04A 1G5ZA 4JJGA 1YDIA 2EIJC 1IW7F 1ZVZA 2R03A 1IZMA 1Z7Qc 3G50A 3QMKA 2J0WA 1C17M 1HE1A 2ETSA 4R32A 3RIPA 1U6HA 2HZ8A 1EQ1A 1LE4A 3M4BA 4P9FA 4W8KA 3O6XA 4M63A 4BG0A 4OIRF 1RXQA 2X51A 3X2QC 1RMVA 4JTDB 4BJ6A 1O87A 4C7OB 1S7ZA 2KGOA 2NG1A 4MW3A 1E83A 5BQHA 1Q0MA 3MYIA 1MMGA 2PP4A 4PFOA 2HSQA 2WVOA 2DI3A 4LERA 2PBEA 2EIMC 4BJ5C 2VC9A 1AEPA 4O6MA 3TOLA 3LS0A 1Q0DA 3H65A 3ITFA 4G0HA 4YT5A 3RH3A 4MVOA 1NU7D 2ZXOA 3AG3C 3G4XA 3CQZA 3GANA 4I3MA 4YT8A 3JSZA 5A6KA 4FAPB 1VB5A 3L8IA 4NTAA 1OXKA 2CDQA 2OQMA 4O79A 1OW8A 2WZLA 4E17A 2Q4FA 2LIGA 2HKVA 1LE2A 4KNVA 3GEEA 3ZDLA 3R2PA 5L0FA 2OJED 1SR2A 3DD7A 3W8HA 2ZXPA 4OINF 3OWTA 4MVUA 2J9VA 2GDCA 4ANJA 1JPJA 1OW7A 3IPMO 3SYNA 3W4YA 3LNRA 2XL6A 3RVYA 2OEXA 2C03A 2RSEB 1LIHA 3SZRA 3FDQA 2ASRA 3W2WA 4U5GA 3HNJA 2HMZA 3Q6MA 4NCQA 1BDJB 2Y3HA 4JKVA 2DB4A 4PJJA 2Z15A 3K1IC 4AK9A 5KYUA 3MX3A 3TJ5A 5A6JA 5JUAA 4YL1A 2H7VC 2P1AA 1LI5A 1RJ9B 3VRCA 1RKEB 2EPLX 2H8AA 4DRHB 4FX5A 3RKOF 3EFOA 1OQCA 2EILC 3L34A 5FCLA 3GM2A 1ZHYA 1CPQA 4XLNF 2W4BA 3FHDA 3NKDA 2OJQA 1APCA 3DM5A 4L6RA 4XPYA 5CI9A 3OA1A 5COFA 4DOZA 1T6IA 3LNMB 2A69F 2Q00A 4CS9C 1E2XA 2QTVA 3ZIBA 1FFHA 3V5ZA 1R5ID 3JCUQ 2YL1A 4HFKB 3UMIA 3A11A 3FAJA 3NRHA 2J7PA 2XLOA 2DYSC 3LUTB 3RQGA 5A69A 2LP4A 2XLEA 3EFOB 2VCAA 4CSAA 3I4UA 5AGFA 1E85A 4P6IC 3AG2C 2OU6A 4BJ5A 2AWYA 2J0XA 2YLGA 3S28A 4EBBA 1YZAA 4OIOF 4C7OA 3K6BA 1BBHA 2EPNA 4B6IA 1NU9C 3SXMA 5AC5A 3JTLO 4JIOA 5EGYA 4C3BA 256BA 3LLKA 2YVKA 4U5CE 5E3CA 4GEHA 3R7CA 3NYMA 1YLMA 4FESA 1Z23A 3C18A 5IY5C 5JT4A 2KK1A 1LVKA 3ZQVA 2RD9A 2R7RA 4YWQA 4WGYA 4JEBA 1VOMA 1MNEA 3ZSUA 1FMWA 2XLHA 1KTMA 3JYYA 1TWGA 3FVYA 2P6VA 1Z5ZA 1OKKD 3NKEA 4CX9A 5EK0A 2YQYA 3EZHA 1BR4A 1NZEA 5B1BC 2YZSA 1H9TA 2YL7A 1A7VA 2AU5A 3DWWA 3U8PA 2FAPB 2HV6A 1ORSC 3FOPA 3KKBA 1DOVA 2G3VA 1WWPA 2UUIA 2KQ9A 3PMRA 4CSAC 1O3UA 3CAXA 2IXMA 3C8GA 2HJMA 3LLIA 1D0XA 4OD4A 2Q7RA 4EIYA 1EI7A 3ZG1A 1E86A 2XS1A 1VTMP 4BJ1A 1YVIA 3DJUB 2P61A 1MMAA 3AGUA 4QDLA 2L6HA 1E84A 3U0CA 4X0RA 2R7OA 2C04A 3B0UX 3TD7A 2IXPA 3U2LA 5L3VA 4BEJA 4QI2A 1EA8A 4DBRA 3TOMA 1RCPA 3RFYA 5L0HA 1I4ZA 1R4TA 1XWJA 2PX3A 3B0PA 2G3KA 4YL0A 4YT2A 2PNOA 5DS5A 2AWCA 3T6JA 3ABKC 3F47A 1L7CA 2ZXRA 3JYHA 2MWQA 1TR2A 4CS9A 1YJGA 2XXAA 3NDBB 3S27A 3MFNA 3AJMA 4J32B 1G4US 2G62A 1HY5A 3V5XA 1K05A 2CNWD 2R7QA 3LESA 3VAYA 4XLPF 2IXNA 1YA9A 5D91A 1C02A 4MNDA 3V7OA 3S29A 3U8VA 1FAPB 2L6FA 4YK5A 5L3QA 3E9VA 1YYJA 2OOCA 3AQBA 3QTHA 4U5DE 4WABA 5CI8A 2XLMA 1H9GA 2IYLD 3RQFA 3IQTA 3EHMA 5A6BA 3ATPA 5K0IA 5L0JA 3MLGA 4H54A 2A0BA 5F5HA 4F4BA 3MBGA 2R9RB 5KYNA 3UR3C 2QNLA 2ZD9A 3S90A 1M57C 1YA7O 2YWAA 3J06A 4OIPF 1B68A 4D4XA 5B3SC 4MVQA 2W4MA 4DVZA 3H2UA 3AGTA 3WG7C 3IQ5A 4PJNA 1ZW3A 2J9WA 1OCRC 2PX0A 3FAPB 2CGEA 2YEVA 2KNHA 1LS1A 3EG9A 5E33A 2J45A 4E18A 2Y3BA 3DKAA 3U3FA 3O55A 4G7HF 1NFNA 1ZHWA 1A7EA 2P0NA 2IBFA 3EH2A 1AUEA 1A7DA 2W45A 3HNIA 4NTFA 4U5FE 5D92A 3US6A 4XEKA 2XXAB 1I4YA 5T3TA 2HJ3A 1YZCA 2HMQA 2XM4A 2GFHA 1VLTA 4E0IA 2J46A 5HV9A 4GQHA 1S05A 4AL0A 3GEIA 1XZQA 4CJGA 4K1OA 3RYLA 3N24A 4IARA 4JCHA 2KJGA 4Z9JA 3TULA 1HMDA 2VASA 3UGPA
chains in the Genus database with same CATH topology
2BC5A 2YL1A 1EKYA 5JVEA 1CPRA 2XLOA 2XL8A 2XLEA 4WGZA 3HNKA 3NMIA 5AGFA 1E85A 2YLGA 3NMJA 3ZWIA 1YZAA 1BBHA 3L1MA 256BA 5JT4A 4U9EA 3ZQVA 2YKZA 4JEBA 4WGYA 1CGOA 4CDAA 2XLHA 4CX9A 4U9DA 3QVYA 1YYXA 3IQ6A 2J8WA 2YL7A 1A7VA 3U8PA 2YLIA 3FOPA 5JS5A 1JAFA 4JE9A 4ULVA 4CDYA 4CJOA 4EIYA 2J9BA 2XLVA 3M4CA 5B3IA 1E86A 5JRAA 3DE9A 3C63A 3ZTZA 1E84A 4ER9A 3ZQYA 1M6TA 3TOMA 1RCPA 3M79A 3HNLA 3M4BA 3FOOA 2XLDA 2CCYA 1E83A 4CDVA 4CIPA 5JLIA 3TOLA 1QQ3A 4IAQA 2YL3A 3C62A 1YYJA 3ZTMA 2XLMA 1QPUA 3QW0A 2YL0A 2XM0A 5JP7A 4D4XA 1GQAA 4N4WA 2XL6A 4NC3A 2QLAA 3IQ5A 3HNJA 4JKVA 4IB4A 2YLDA 3QVZA 5JSLA 5JUAA 1MQVA 3M15A 1CGNA 3DE8A 3HNIA 3VRCA 3NMKA 2XLWA 1YZCA 2XM4A 4N6HA 1CPQA 1S05A 4L6RA 4CJGA 1APCA 4JEAA 3QW1A 4IARA 4D4NA 1LM3B 1NBBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BC5 A;  2YL1 A;  1EKY A;  5JVE A;  1CPR A;  2XLO A;  2XL8 A;  2XLE A;  4WGZ A;  3HNK A;  3NMI A;  5AGF A;  1E85 A;  2YLG A;  3NMJ A;  3ZWI A;  1YZA A;  1BBH A;  3L1M A;  256B A;  5JT4 A;  4U9E A;  3ZQV A;  2YKZ A;  4JEB A;  4WGY A;  1CGO A;  4CDA A;  2XLH A;  4CX9 A;  4U9D A;  3QVY A;  1YYX A;  3IQ6 A;  2J8W A;  2YL7 A;  1A7V A;  3U8P A;  2YLI A;  3FOP A;  5JS5 A;  1JAF A;  4JE9 A;  4ULV A;  4CDY A;  4CJO A;  4EIY A;  2J9B A;  2XLV A;  3M4C A;  5B3I A;  1E86 A;  5JRA A;  3DE9 A;  3C63 A;  3ZTZ A;  1E84 A;  4ER9 A;  3ZQY A;  1M6T A;  3TOM A;  1RCP A;  3M79 A;  3HNL A;  3M4B A;  3FOO A;  2XLD A;  2CCY A;  1E83 A;  4CDV A;  4CIP A;  5JLI A;  3TOL A;  1QQ3 A;  4IAQ A;  2YL3 A;  3C62 A;  1YYJ A;  3ZTM A;  2XLM A;  1QPU A;  3QW0 A;  2YL0 A;  2XM0 A;  5JP7 A;  4D4X A;  1GQA A;  4N4W A;  2XL6 A;  4NC3 A;  2QLA A;  3IQ5 A;  3HNJ A;  4JKV A;  4IB4 A;  2YLD A;  3QVZ A;  5JSL A;  5JUA A;  1MQV A;  3M15 A;  1CGN A;  3DE8 A;  3HNI A;  3VRC A;  3NMK A;  2XLW A;  1YZC A;  2XM4 A;  4N6H A;  1CPQ A;  1S05 A;  4L6R A;  4CJG A;  1APC A;  4JEA A;  3QW1 A;  4IAR A;  4D4N A;  1LM3 B;  1NBB A; 
#chains in the Genus database with same CATH topology
 1VMA A;  1W2W A;  2KYH A;  2OKU A;  3KMI A;  1JMW A;  4I44 A;  1VYK A;  3NYJ A;  1TFO B;  1V54 C;  5EHH A;  1G8X A;  3EZI A;  3IQC A;  1WGW A;  3UMK A;  1QVX A;  4PR9 A;  3K7D A;  3C8G B;  3FXH A;  4WGZ A;  3UNG C;  3MYF A;  3NMI A;  2HFI A;  1TWH A;  2D4U A;  4YL3 A;  1CGM E;  2NSG A;  1QZX A;  4JTC B;  4OIQ F;  3IHU A;  3N0T A;  4MTO A;  4RD9 A;  5KYX A;  4E7Z A;  1UFB A;  2E87 A;  2LFF A;  2YRF A;  1LPE A;  1FR0 A;  2QUP A;  2JPU A;  3K1I A;  3RVZ A;  5F5F A;  3LEV A;  1WOL A;  4O7G A;  3WHN A;  5F28 E;  4ZLD A;  5KYY A;  2L6G A;  4MTF A;  5A6B D;  3ABL C;  1NFO A;  1V55 C;  3A9C A;  4IAO A;  3DZA A;  3C8G D;  3UGO A;  1OR3 A;  2H7B A;  2R7V A;  1TKN A;  3CSK A;  3IQ6 A;  3N2Z B;  3Q7G A;  4J7Y A;  3K66 A;  4N6C A;  3B9Q A;  4MS2 A;  2GWW A;  4DVY P;  3AG1 C;  3T4R A;  2WZG A;  3IEE A;  3DMD A;  4ULV A;  3RF3 A;  3HJC A;  2XLV A;  1FFT C;  4I1M A;  5B3I A;  1FTS A;  4I1O B;  3W2V A;  5BUO A;  4RDA A;  3CEX A;  4W8P A;  3JSE O;  1JPN A;  3T9O A;  4Z9H A;  4ER9 A;  2LQG A;  2VB6 A;  2AVK A;  4XPW A;  3T6B A;  3ZQY A;  1ZU5 A;  3ZC4 A;  4AE4 A;  4DRI B;  3M79 A;  3VYW A;  3HNL A;  2KSF A;  2LCH A;  2PFD A;  1ORJ A;  2HSB A;  1H6G A;  2P7V A;  4G7O F;  2XLD A;  4NTB A;  3GWN A;  4PJL A;  2CCY A;  4KC9 A;  2BE5 F;  4XWJ A;  3EQL F;  3ASO C;  1LS4 A;  2Y69 C;  4PFP A;  1YAR O;  1C03 A;  1T01 A;  2L9J A;  1OR2 A;  1RKE A;  2XSE A;  4HE8 D;  4LDQ A;  4PJM A;  4CDV A;  4KBL A;  2EPO A;  1D1A A;  3Q6N A;  4IRU A;  4CIP A;  5JLI A;  3EPV A;  5KYU B;  5BQG A;  1HW2 A;  3LS1 A;  1RKC A;  1DOW A;  3DAG A;  2Q9C A;  4GYT A;  3VF0 A;  4IAQ A;  4P9T A;  4EKW A;  2YL3 A;  1T6U A;  4C3D A;  3K33 A;  3SXZ A;  5KYW B;  1WAT A;  3L0I A;  2IM8 A;  1OW6 A;  3DM9 B;  5T1D B;  3GWL A;  1TWC A;  3GM1 A;  3NG1 A;  4E0H A;  2M64 A;  1H7I A;  1PD1 A;  2FGY A;  4LDR A;  2NUT A;  1M2V A;  3U2M A;  3QW0 A;  2LFD A;  1NLX A;  2XM0 A;  4JTA B;  2LSE A;  5COM A;  1HW1 A;  2VCB A;  2L81 A;  1SF8 A;  4XEV A;  3BRJ A;  3H2V A;  2AP3 A;  2LD6 A;  4G7Z F;  2B0H A;  4KNW A;  1GQA A;  3SXY A;  5L0D A;  2V3C C;  3G4Z A;  5CIV A;  5L0C A;  4JVS A;  4NC3 A;  5T3W A;  4JC7 A;  2QLA A;  4XEF A;  5BQI A;  1I5N A;  2YLD A;  3ZTM A;  1PD0 A;  5A6A A;  2DGJ A;  3M15 A;  4MVS A;  1QKR A;  4U5H A;  1CGN A;  1L3P A;  3DE8 A;  5FZT A;  3V5Y A;  4ZLC A;  4CS8 C;  3DXJ F;  3JRT A;  4PK4 A;  2XL4 A;  3HLZ A;  1RJ9 A;  3L8J A;  2XLW A;  3U3B A;  1YAU O;  3B29 A;  3EH1 A;  1TWA A;  2NUT B;  4Q5S F;  3O10 A;  2I8B A;  3DAF A;  3GEH A;  2WZF A;  4JEA A;  2NUP B;  2B0J A;  3QW1 A;  2R7T A;  1VLS A;  2XRH A;  2XS8 A;  4D4N A;  2NUP A;  5HSW A;  4Q4Z F;  3T6G B;  2BC5 A;  2A68 F;  4C3E A;  2JD3 A;  4YT4 A;  1NG1 A;  2R7U A;  3SXK A;  4MQ9 F;  3ZVR A;  2DYR C;  2MHR A;  3JZ0 A;  2XL8 A;  4A2N B;  1ORY A;  1JRA A;  4CIH A;  3ECS A;  1V74 B;  4WJ0 A;  4ONS A;  3UMH A;  4UDV A;  1LKX A;  1ZHT A;  4NQF A;  1BZ4 A;  4BEM J;  3POV A;  1JR8 A;  1XZP A;  3RQE A;  4A4A A;  5B1A C;  2CW0 F;  1KNY A;  2WL8 A;  1K40 A;  5L0I A;  3JRM O;  3NYL A;  2Y39 A;  3SP1 A;  1U89 A;  3GOD A;  1FNT c;  2H7O A;  2VH3 A;  4CBE A;  4EWC A;  1PV3 A;  1T5O A;  4DRJ B;  2OEV A;  1CGO A;  1MND A;  2A0U A;  4CDA A;  3B0V C;  3QVY A;  3I5P A;  4EUK B;  2J8W A;  1D0Y A;  3LAY A;  2J9U A;  4K7B A;  4BPM A;  1GS9 A;  4IWB A;  3AOU A;  5DQT A;  4MVM A;  1M2V B;  4FWV A;  4LAC B;  1JAF A;  1AVO B;  1Z3I X;  4YN0 B;  3EGX A;  1TQG A;  4CDY A;  3KH2 A;  2J9B A;  3EGD A;  3KYJ A;  3M4C A;  3EJN A;  3SEO A;  4EBK A;  3DE9 A;  5KYW A;  1J8M F;  3K1H A;  1ZHX A;  4DJ9 A;  2J7P D;  4JUR I;  3Q7L A;  3TQO A;  4G78 A;  1F1M A;  1M6T A;  2Y3G A;  5KYY B;  2R7S A;  1Q0G A;  4JJF A;  1U0B B;  1NSG B;  1HE9 A;  1GGQ A;  1Y4C A;  3FOO A;  3GM3 A;  2M4E A;  2V26 A;  1KU2 A;  1T6Q A;  3HTK C;  3PHF 2;  4OD5 A;  3X1O A;  2R7X A;  4HFF B;  2D5R B;  2WVN A;  3U5S A;  2ZPA A;  2WVQ A;  2Y3D A;  1J8Y F;  3B71 A;  1Z63 A;  4MTG A;  2YHS A;  4J7T A;  3WOD F;  5DVW A;  1ZYR F;  2EPM X;  2HUJ A;  1OXB A;  4AE4 B;  4BJT A;  1WTY A;  3PDM P;  4XTK A;  1QQ3 A;  5DS6 A;  1ZHZ A;  4PAC A;  1HMO A;  1PCX A;  3C8Z A;  1UG7 A;  3ABM C;  2QY9 A;  3C62 A;  2Q3T A;  3DI5 A;  5DQZ A;  1N1C A;  3HKK A;  1Y6D A;  1Z6A A;  4JW1 A;  4LDK A;  4QI0 A;  5COG A;  2X0C A;  3VM6 A;  4YJW A;  1JOG A;  2OG2 A;  1QPU A;  2EIN C;  3M1C B;  2YL0 A;  3QZC A;  1FMV A;  4Q7C A;  1MMD A;  3CZ6 A;  1TFK B;  2ZXW C;  2GA0 A;  3AG4 C;  3PCV A;  4JZA A;  3TK0 A;  2IOQ A;  5JP7 A;  4J30 B;  4O6N A;  2EPK X;  3ASN C;  5TJ5 E;  2L7A A;  4N4W A;  4BJ6 C;  1VYI A;  1V4A A;  1WAS A;  2PF4 E;  4LLC A;  1MMN A;  2NPU A;  4JCZ A;  4NY3 A;  4IB4 A;  3QVZ A;  4H4K C;  2R02 A;  4EBJ A;  1OCO C;  2A6H F;  5JSL A;  3W8I A;  5DS4 A;  5KYX B;  1MQV A;  2GAQ A;  1D1C A;  3EHN A;  4XQ1 A;  2A1D D;  4U5B E;  1OCZ C;  1GM5 A;  4KI2 A;  2EIK C;  3NMK A;  1OCC C;  2CNW A;  3U9J A;  3TJ6 A;  2OCC C;  1M56 C;  1ZW2 A;  3E70 C;  4LLE A;  4AX2 A;  1SZI A;  4N6H A;  1OKK A;  4K0D A;  2JX0 A;  1A41 A;  2MYS A;  3WAQ A;  1ST6 A;  4MVR A;  1ZZP A;  1LM3 B;  4AL1 A;  1NBB A;  4EHP A;  1M2O A;  1SMY F;  1EKY A;  5JVE A;  1CPR A;  3S84 A;  1O5H A;  2LK4 A;  2IXO A;  3DJN B;  3OEO A;  5E3A A;  3EGD B;  4RBN A;  4JRZ A;  3EGX B;  3HNK A;  2A6E F;  4MW8 A;  3ZWI A;  3NMJ A;  2HV7 A;  2Q9B A;  2NSF A;  1QLE C;  3O39 A;  4DXW A;  2HS5 A;  3EG9 B;  3FMS A;  3L1M A;  1T9K A;  1ZU4 A;  1BR1 A;  2I15 A;  2KC3 A;  3LEO A;  4XPX A;  1D0Z A;  4IGG A;  4U9E A;  3RW0 A;  1G4W R;  2CYD A;  4U5E E;  3I5Q A;  2YKZ A;  3BEH A;  4MVZ A;  4O6Y A;  4ULW A;  3LJB A;  4CS8 A;  1BR2 A;  2BL2 A;  1LI7 A;  2QE9 A;  2KW3 C;  4HEA J;  2UUH A;  4Z9I A;  2FFH A;  4U9D A;  4CS7 A;  4E7S A;  3U9M A;  5AC4 A;  2R25 A;  1YYX A;  3S0X A;  1WN0 A;  1Q0F A;  5DLJ A;  4DBQ A;  1VK5 A;  3F46 A;  2O9X A;  3KYI A;  3SNH A;  2R7W A;  3JT1 A;  4N06 A;  1D1B A;  2YLI A;  3AQC A;  4IJJ A;  1Q0K A;  1QSP A;  2W9Y A;  3KPH A;  3C7J A;  5GPG B;  3S9O A;  4JE9 A;  2ICW G;  2F22 A;  3KL4 A;  5JS5 A;  5L0G A;  2TMV P;  4CJO A;  3GOR A;  2Q9A A;  5JRA A;  2R05 A;  3C63 A;  3ZTZ A;  1SYQ A;  2WB7 A;  2VCC A;  1A0B A;  5E2Q A;  1K04 A;  1G5Z A;  4JJG A;  1YDI A;  2EIJ C;  1IW7 F;  1ZVZ A;  2R03 A;  1IZM A;  1Z7Q c;  3G50 A;  3QMK A;  2J0W A;  1C17 M;  1HE1 A;  2ETS A;  4R32 A;  3RIP A;  1U6H A;  2HZ8 A;  1EQ1 A;  1LE4 A;  3M4B A;  4P9F A;  4W8K A;  3O6X A;  4M63 A;  4BG0 A;  4OIR F;  1RXQ A;  2X51 A;  3X2Q C;  1RMV A;  4JTD B;  4BJ6 A;  1O87 A;  4C7O B;  1S7Z A;  2KGO A;  2NG1 A;  4MW3 A;  1E83 A;  5BQH A;  1Q0M A;  3MYI A;  1MMG A;  2PP4 A;  4PFO A;  2HSQ A;  2WVO A;  2DI3 A;  4LER A;  2PBE A;  2EIM C;  4BJ5 C;  2VC9 A;  1AEP A;  4O6M A;  3TOL A;  3LS0 A;  1Q0D A;  3H65 A;  3ITF A;  4G0H A;  4YT5 A;  3RH3 A;  4MVO A;  1NU7 D;  2ZXO A;  3AG3 C;  3G4X A;  3CQZ A;  3GAN A;  4I3M A;  4YT8 A;  3JSZ A;  5A6K A;  4FAP B;  1VB5 A;  3L8I A;  4NTA A;  1OXK A;  2CDQ A;  2OQM A;  4O79 A;  1OW8 A;  2WZL A;  4E17 A;  2Q4F A;  2LIG A;  2HKV A;  1LE2 A;  4KNV A;  3GEE A;  3ZDL A;  3R2P A;  5L0F A;  2OJE D;  1SR2 A;  3DD7 A;  3W8H A;  2ZXP A;  4OIN F;  3OWT A;  4MVU A;  2J9V A;  2GDC A;  4ANJ A;  1JPJ A;  1OW7 A;  3IPM O;  3SYN A;  3W4Y A;  3LNR A;  2XL6 A;  3RVY A;  2OEX A;  2C03 A;  2RSE B;  1LIH A;  3SZR A;  3FDQ A;  2ASR A;  3W2W A;  4U5G A;  3HNJ A;  2HMZ A;  3Q6M A;  4NCQ A;  1BDJ B;  2Y3H A;  4JKV A;  2DB4 A;  4PJJ A;  2Z15 A;  3K1I C;  4AK9 A;  5KYU A;  3MX3 A;  3TJ5 A;  5A6J A;  5JUA A;  4YL1 A;  2H7V C;  2P1A A;  1LI5 A;  1RJ9 B;  3VRC A;  1RKE B;  2EPL X;  2H8A A;  4DRH B;  4FX5 A;  3RKO F;  3EFO A;  1OQC A;  2EIL C;  3L34 A;  5FCL A;  3GM2 A;  1ZHY A;  1CPQ A;  4XLN F;  2W4B A;  3FHD A;  3NKD A;  2OJQ A;  1APC A;  3DM5 A;  4L6R A;  4XPY A;  5CI9 A;  3OA1 A;  5COF A;  4DOZ A;  1T6I A;  3LNM B;  2A69 F;  2Q00 A;  4CS9 C;  1E2X A;  2QTV A;  3ZIB A;  1FFH A;  3V5Z A;  1R5I D;  3JCU Q;  2YL1 A;  4HFK B;  3UMI A;  3A11 A;  3FAJ A;  3NRH A;  2J7P A;  2XLO A;  2DYS C;  3LUT B;  3RQG A;  5A69 A;  2LP4 A;  2XLE A;  3EFO B;  2VCA A;  4CSA A;  3I4U A;  5AGF A;  1E85 A;  4P6I C;  3AG2 C;  2OU6 A;  4BJ5 A;  2AWY A;  2J0X A;  2YLG A;  3S28 A;  4EBB A;  1YZA A;  4OIO F;  4C7O A;  3K6B A;  1BBH A;  2EPN A;  4B6I A;  1NU9 C;  3SXM A;  5AC5 A;  3JTL O;  4JIO A;  5EGY A;  4C3B A;  256B A;  3LLK A;  2YVK A;  4U5C E;  5E3C A;  4GEH A;  3R7C A;  3NYM A;  1YLM A;  4FES A;  1Z23 A;  3C18 A;  5IY5 C;  5JT4 A;  2KK1 A;  1LVK A;  3ZQV A;  2RD9 A;  2R7R A;  4YWQ A;  4WGY A;  4JEB A;  1VOM A;  1MNE A;  3ZSU A;  1FMW A;  2XLH A;  1KTM A;  3JYY A;  1TWG A;  3FVY A;  2P6V A;  1Z5Z A;  1OKK D;  3NKE A;  4CX9 A;  5EK0 A;  2YQY A;  3EZH A;  1BR4 A;  1NZE A;  5B1B C;  2YZS A;  1H9T A;  2YL7 A;  1A7V A;  2AU5 A;  3DWW A;  3U8P A;  2FAP B;  2HV6 A;  1ORS C;  3FOP A;  3KKB A;  1DOV A;  2G3V A;  1WWP A;  2UUI A;  2KQ9 A;  3PMR A;  4CSA C;  1O3U A;  3CAX A;  2IXM A;  3C8G A;  2HJM A;  3LLI A;  1D0X A;  4OD4 A;  2Q7R A;  4EIY A;  1EI7 A;  3ZG1 A;  1E86 A;  2XS1 A;  1VTM P;  4BJ1 A;  1YVI A;  3DJU B;  2P61 A;  1MMA A;  3AGU A;  4QDL A;  2L6H A;  1E84 A;  3U0C A;  4X0R A;  2R7O A;  2C04 A;  3B0U X;  3TD7 A;  2IXP A;  3U2L A;  5L3V A;  4BEJ A;  4QI2 A;  1EA8 A;  4DBR A;  3TOM A;  1RCP A;  3RFY A;  5L0H A;  1I4Z A;  1R4T A;  1XWJ A;  2PX3 A;  3B0P A;  2G3K A;  4YL0 A;  4YT2 A;  2PNO A;  5DS5 A;  2AWC A;  3T6J A;  3ABK C;  3F47 A;  1L7C A;  2ZXR A;  3JYH A;  2MWQ A;  1TR2 A;  4CS9 A;  1YJG A;  2XXA A;  3NDB B;  3S27 A;  3MFN A;  3AJM A;  4J32 B;  1G4U S;  2G62 A;  1HY5 A;  3V5X A;  1K05 A;  2CNW D;  2R7Q A;  3LES A;  3VAY A;  4XLP F;  2IXN A;  1YA9 A;  5D91 A;  1C02 A;  4MND A;  3V7O A;  3S29 A;  3U8V A;  1FAP B;  2L6F A;  4YK5 A;  5L3Q A;  3E9V A;  1YYJ A;  2OOC A;  3AQB A;  3QTH A;  4U5D E;  4WAB A;  5CI8 A;  2XLM A;  1H9G A;  2IYL D;  3RQF A;  3IQT A;  3EHM A;  5A6B A;  3ATP A;  5K0I A;  5L0J A;  3MLG A;  4H54 A;  2A0B A;  5F5H A;  4F4B A;  3MBG A;  2R9R B;  5KYN A;  3UR3 C;  2QNL A;  2ZD9 A;  3S90 A;  1M57 C;  1YA7 O;  2YWA A;  3J06 A;  4OIP F;  1B68 A;  4D4X A;  5B3S C;  4MVQ A;  2W4M A;  4DVZ A;  3H2U A;  3AGT A;  3WG7 C;  3IQ5 A;  4PJN A;  1ZW3 A;  2J9W A;  1OCR C;  2PX0 A;  3FAP B;  2CGE A;  2YEV A;  2KNH A;  1LS1 A;  3EG9 A;  5E33 A;  2J45 A;  4E18 A;  2Y3B A;  3DKA A;  3U3F A;  3O55 A;  4G7H F;  1NFN A;  1ZHW A;  1A7E A;  2P0N A;  2IBF A;  3EH2 A;  1AUE A;  1A7D A;  2W45 A;  3HNI A;  4NTF A;  4U5F E;  5D92 A;  3US6 A;  4XEK A;  2XXA B;  1I4Y A;  5T3T A;  2HJ3 A;  1YZC A;  2HMQ A;  2XM4 A;  2GFH A;  1VLT A;  4E0I A;  2J46 A;  5HV9 A;  4GQH A;  1S05 A;  4AL0 A;  3GEI A;  1XZQ A;  4CJG A;  4K1O A;  3RYL A;  3N24 A;  4IAR A;  4JCH A;  2KJG A;  4Z9J A;  3TUL A;  1HMD A;  2VAS A;  3UGP A; 
#chains in the Genus database with same CATH homology
 2BC5 A;  2YL1 A;  1EKY A;  5JVE A;  1CPR A;  2XLO A;  2XL8 A;  2XLE A;  4WGZ A;  3HNK A;  3NMI A;  5AGF A;  1E85 A;  2YLG A;  3NMJ A;  3ZWI A;  1YZA A;  1BBH A;  3L1M A;  256B A;  5JT4 A;  4U9E A;  3ZQV A;  2YKZ A;  4JEB A;  4WGY A;  1CGO A;  4CDA A;  2XLH A;  4CX9 A;  4U9D A;  3QVY A;  1YYX A;  3IQ6 A;  2J8W A;  2YL7 A;  1A7V A;  3U8P A;  2YLI A;  3FOP A;  5JS5 A;  1JAF A;  4JE9 A;  4ULV A;  4CDY A;  4CJO A;  4EIY A;  2J9B A;  2XLV A;  3M4C A;  5B3I A;  1E86 A;  5JRA A;  3DE9 A;  3C63 A;  3ZTZ A;  1E84 A;  4ER9 A;  3ZQY A;  1M6T A;  3TOM A;  1RCP A;  3M79 A;  3HNL A;  3M4B A;  3FOO A;  2XLD A;  2CCY A;  1E83 A;  4CDV A;  4CIP A;  5JLI A;  3TOL A;  1QQ3 A;  4IAQ A;  2YL3 A;  3C62 A;  1YYJ A;  3ZTM A;  2XLM A;  1QPU A;  3QW0 A;  2YL0 A;  2XM0 A;  5JP7 A;  4D4X A;  1GQA A;  4N4W A;  2XL6 A;  4NC3 A;  2QLA A;  3IQ5 A;  3HNJ A;  4JKV A;  4IB4 A;  2YLD A;  3QVZ A;  5JSL A;  5JUA A;  1MQV A;  3M15 A;  1CGN A;  3DE8 A;  3HNI A;  3VRC A;  3NMK A;  2XLW A;  1YZC A;  2XM4 A;  4N6H A;  1CPQ A;  1S05 A;  4L6R A;  4CJG A;  1APC A;  4JEA A;  3QW1 A;  4IAR A;  4D4N A;  1LM3 B;  1NBB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...