1OQCA

The crystal structure of augmenter of liver regeneration: a mammalian fad dependent sulfhydryl oxidase
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
112
structure length
112
Chain Sequence
b'EDCPQDREELGRNTWAFLHTLAAYYPDMPTPEQQQDMAQFIHIFSKFYPCEECAEDIRKRIDRSQPDTSTRVSFSQWLCRLHNEVNRKLGKPDFDCSRVDERWRDGWKDGSC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords augmenter of liver regeneration
publication title The refined crystal structure of augmenter of liver regeneration
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
total genus 42
structure length 112
sequence length 112
chains with identical sequence B, C, D
ec nomenclature ec 1.8.3.2: Thiol oxidase.
pdb deposition date 2003-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04777 Evr1_Alr Erv1 / Alr family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.310 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) ERV/ALR sulfhydryl oxidase domain 1oqcA00
3GWNA 3U5SA 3LLKA 3U2LA 4E0IA 3O55A 1OQCA 3W4YA 4E0HA 2HJ3A 3TK0A 3GWLA 4LDKA 1JRAA 3MBGA 3LLIA 3R7CA 1JR8A 3TD7A 3U2MA
chains in the Genus database with same CATH superfamily
2M4EA 1BR1A 2RSEB 256BA 1O87A 2ZPAA 1QLEC 3DZAA 3ABKC 4NC3A 3FOPA 2KC3A 2A69F 4KNVA 3VYWA 2R7UA 5BQIA 3SXMA 3DKAA 1R4TA 4XEFA 3ZIBA 4G78A 3SXYA 2A0BA 3VAYA 4DRHB 2DB4A 2L7AA 3ZQVA 1OXBA 4KNWA 1H9GA 3G4XA 4G7HF 4U9DA 3DXJF 5B1BC 3T4RA 3RQFA 3DI5A 2EPKX 3OWTA 3JRMO 2YQYA 2L6HA 2VCCA 3UNGC 4PFPA 3ZG1A 2O9XA 4JJGA 1MNEA 3S90A 3B0PA 2C04A 2Q9BA 2J8WA 2W4BA 2OEVA 3CZ6A 3DM5A 4ONSA 1M2VA 3ZSUA 4JCHA 2HUJA 1ZYRF 2XS1A 2LFDA 4XWJA 4OIPF 1HE1A 3NYMA 4E7SA 1ZHWA 2V3CC 2UUHA 4MVMA 3LNMB 2Z15A 2C03A 4CS9C 3NYLA 2LCHA 1AVOB 1H6GA 4U5GA 5FCLA 4G7OF 3SXZA 3JYYA 3UGPA 3W4YA 2KW3C 2YL7A 3MLGA 1OXKA 2PBEA 1D0ZA 2F22A 5COGA 2LFFA 1GM5A 1WGWA 2HS5A 4GYTA 4NTFA 4DXWA 2XLMA 5BUOA 3N0TA 1WWPA 3EFOB 3L1MA 1ZW2A 3DE8A 3PDMP 4M63A 3SEOA 1EKYA 2XL8A 5AGFA 3U3BA 2NG1A 1SYQA 4YN0B 4IWBA 2J45A 4Z9IA 3FHDA 4J32B 2Q9CA 3EFOA 2I15A 3V7OA 4FAPB 1HY5A 1NFOA 2H7BA 4IGGA 2XLOA 4AE4B 4CIHA 3K66A 3DE9A 1T5OA 3JSZA 3O10A 2B0JA 2J9VA 1S7ZA 5JSLA 3AJMA 1SZIA 4MVRA 1OW8A 3FMSA 1Q0KA 2L6GA 5K0IA 1V54C 1OQCA 1HMDA 1NSGB 2VC9A 3X1OA 1BR2A 1ZHTA 2IOQA 4E18A 1LI5A 3M4BA 2XXAB 4PR9A 4NCQA 4MVUA 4BJ5A 5A6JA 1F1MA 4G7ZF 4K7BA 1OR3A 2H7OA 3TOMA 4NTBA 1PCXA 1RCPA 2ASRA 4ER9A 4ZLCA 3BEHA 2D4UA 3R7CA 1A7VA 3EG9B 2XXAA 3LAYA 3PHF2 3GM1A 3KKBA 3U2MA 5AC4A 3RF3A 4I3MA 1AUEA 2ZXRA 4O6NA 1WN0A 2HMZA 3GM2A 4W8KA 2BC5A 1TWHA 2LIGA 3EG9A 2FAPB 2X0CA 4FWVA 3V5ZA 4KI2A 4IB4A 1I4YA 2YKZA 3HLZA 4YJWA 2ZXPA 3ITFA 5F5HA 2A68F 2WL8A 2RD9A 3NRHA 1A7DA 5L0DA 2NSFA 3ZDLA 2Q9AA 2R25A 4WGYA 5BQGA 3X2QC 2XS8A 3L34A 2D5RB 2HSBA 2LQGA 4CBEA 4N6CA 4E17A 4DBQA 4UDVA 1ORYA 3US6A 2OG2A 3IPMO 4CS8A 4DJ9A 3GWLA 3LS0A 2YEVA 3W2VA 2EPOA 5A6BD 2WVNA 2QLAA 1M2OA 5KYXA 4X0RA 2AWYA 1WASA 1JR8A 1LKXA 1ZHZA 4W8PA 1FNTc 2PNOA 4JRZA 3VM6A 3DJUB 3KPHA 3TJ5A 3ABMC 1E85A 1T9KA 1Z6AA 2Q3TA 3SYNA 3Q7GA 3U3FA 1BR4A 3DAGA 3WAQA 1Q0GA 3EJNA 3ZWIA 2IXPA 4CSAC 4MVSA 3RW0A 3G4ZA 3U2LA 2MYSA 4Z9JA 2R9RB 1A0BA 1VLSA 3ASNC 4IARA 1RKEB 3AQBA 2OQMA 3F47A 1IZMA 4PJMA 4JTDB 1GS9A 3AGTA 5KYYA 3NYJA 1C03A 4J7YA 1M57C 4BJ6A 1VLTA 1ZU5A 1RKEA 1T6UA 3EGXB 3TULA 3IQCA 3G50A 3QTHA 1E84A 3NMJA 2ETSA 5DS5A 1AEPA 1TFOB 1TQGA 3EGXA 3U0CA 2IYLD 2A6HF 3QZCA 5A6BA 1QPUA 3EHMA 5A69A 2VCBA 1TKNA 2J0WA 3O55A 1OW6A 1A7EA 3A11A 2KNHA 4XEVA 2R7QA 4XPYA 4BG0A 1L3PA 2L9JA 3GEIA 1CGME 2XL6A 1YARO 1N1CA 3SP1A 4BJ1A 3FAPB 2WZLA 4F4BA 1KTMA 1GQAA 2YZSA 1XZQA 4J30B 3LEVA 4E7ZA 1YVIA 3JSEO 1YJGA 3GANA 4P6IC 2R03A 4XEKA 3ATPA 4OIOF 2ZD9A 2IM8A 2HFIA 2AU5A 2AVKA 2QTVA 2BE5F 1W2WA 1ZU4A 4HFFB 2DYRC 4A2NB 1GGQA 3POVA 5JUAA 4JTAB 2PX3A 1NU9C 2HV7A 4ANJA 2AP3A 4XLNF 1G8XA 2KK1A 2V26A 5T3WA 3T9OA 3IQ6A 2J9WA 2CNWA 4Q7CA 5JLIA 5DS6A 1TFKB 1J8YF 5JT4A 2P1AA 3EPVA 3JRTA 3QVYA 3U9JA 2VCAA 2NUTB 1T6IA 4O79A 5A6KA 2H7VC 5COMA 3C62A 4O7GA 1O3UA 4GQHA 5BQHA 3CAXA 2W4MA 4I1MA 4JJFA 1OR2A 2R7TA 3JYHA 3IQTA 5F5FA 1YYJA 1FTSA 2HJMA 1TWAA 5COFA 4O6YA 1Y4CA 1UG7A 3K6BA 1JPJA 3RFYA 2UUIA 2HMQA 4U5FE 3FDQA 2YVKA 1CGOA 3EZHA 1FFHA 4O6MA 3K1IA 3VF0A 3WODF 5JS5A 1H7IA 1LVKA 2HZ8A 3GEHA 1TWGA 2VASA 4C3BA 4JKVA 4PJLA 1Z23A 5T1DB 3C8GB 2R7XA 3RVZA 3QW1A 4NQFA 1NFNA 2CNWD 3AG4C 3H2UA 3JCUQ 4MW8A 4AE4A 2HJ3A 1TR2A 4EBKA 3NDBB 3T6BA 3N24A 1HW2A 1LM3B 2P61A 2EIMC 3C8GA 2YLGA 3HTKC 3V5XA 2WZFA 3AG2C 2XLDA 3EGDB 2CCYA 2J46A 2JD3A 2LP4A 2OJED 3MBGA 4MVOA 2NPUA 4LDRA 3TQOA 3QVZA 3NMKA 4WGZA 3U8VA 3ZTMA 5IY5C 2FGYA 5DVWA 3TD7A 1FFTC 5D92A 3LESA 2XLWA 1T6QA 2L6FA 4WJ0A 4YT5A 3DWWA 3PCVA 2KSFA 3F46A 3NKEA 3W2WA 4YL0A 4E0IA 3S28A 3UMIA 1FR0A 3Q7LA 1A41A 2HV6A 3U9MA 1DOWA 2J9BA 2WB7A 1NG1A 3FVYA 2CYDA 1K04A 3HNIA 1MMDA 5B1AC 3JTLO 1YDIA 3PMRA 4JEBA 3AGUA 1KU2A 1FMWA 2DYSC 2EIKC 4I1OB 1JAFA 4ULWA 4C3EA 2R7RA 1JMWA 3M15A 4Q4ZF 3IHUA 1RJ9B 2A0UA 3C8GD 4JTCB 2YHSA 2P6VA 3K33A 4QI0A 2NUPB 3W8HA 1D1CA 1O5HA 1I5NA 1K40A 3RYLA 4DVYP 2MWQA 2IXNA 1SMYF 4EBBA 1BZ4A 1ORJA 1LPEA 1T01A 2QE9A 4I44A 5A6AA 4WABA 4JIOA 4MVZA 3I5QA 4IAQA 2Y3BA 3UMKA 4U9EA 2NUPA 4DRJB 4JURI 4XTKA 3U8PA 3K7DA 4BJTA 4MW3A 1YZAA 2W45A 4AL1A 4JC7A 4D4NA 4YL1A 1OW7A 4YT4A 1VYKA 2R7SA 5L0IA 4P9FA 2A6EF 4U5EE 4C7OB 2EIJC 2EPNA 1L7CA 1MMGA 2M64A 2OOCA 1Z3IX 4KBLA 4LERA 4MQ9F 4YK5A 4CIPA 4ZLDA 4XLPF 3NMIA 4HFKB 3E9VA 2R7WA 2Y3HA 1RMVA 5EK0A 4C7OA 5AC5A 2Y3GA 4BEMJ 2VB6A 1CPQA 4IAOA 3KMIA 2XLHA 3C63A 3MYIA 5T3TA 5L0GA 1G4WR 2PF4E 1PD1A 3L0IA 3KYJA 2KGOA 1E83A 4DVZA 3AQCA 2KYHA 4DOZA 1SR2A 3N2ZB 2IXOA 3T6JA 1YYXA 4CJOA 4OIRF 5D91A 2ZXOA 3FXHA 1VB5A 1E86A 4N06A 3EQLF 3U5SA 4L6RA 3QMKA 4YL3A 4QDLA 3BRJA 3RKOF 1XWJA 1MMNA 3CSKA 1WOLA 5HSWA 1U0BB 4OD5A 1OKKA 1V74B 3M1CB 1NU7D 2I8BA 4LACB 2JX0A 4MNDA 3AG3C 4AK9A 3UGOA 2CW0F 1HE9A 2CGEA 3FAJA 2NSGA 5L3VA 2GA0A 3H2VA 3ZTZA 1LIHA 1KNYA 3K1HA 5KYNA 5E3AA 3GODA 3UR3C 4EHPA 4D4XA 1ZHYA 2J9UA 4JVSA 3SXKA 1APCA 3S0XA 2WVOA 4OD4A 3GWNA 1PV3A 2W9YA 2XL4A 3DAFA 3EZIA 2G3KA 3FOOA 4IJJA 3J06A 2Y69C 4BJ5C 2R05A 3TJ6A 1LI7A 3LLKA 4G0HA 4NTAA 5CIVA 1VOMA 2BL2A 1QVXA 1D1AA 4B6IA 4CDYA 1SF8A 1ZVZA 5GPGB 4H4KC 4CSAA 3IQ5A 1U89A 2EPMX 2OEXA 2OJQA 1OKKD 1Z7Qc 3B0UX 3TOLA 4H54A 3SZRA 3A9CA 1M2VB 2E87A 2QY9A 3I5PA 1HMOA 4PJJA 2Q00A 2XSEA 1EI7A 4C3DA 5DQTA 4CDVA 4BEJA 2OCCC 1LS4A 3E70C 4K1OA 4KC9A 3C7JA 4IRUA 2NUTA 4BPMA 1ST6A 1U6HA 4HE8D 1ZW3A 1YA9A 2LD6A 3C8ZA 4JZAA 1JPNA 3I4UA 2DGJA 1IW7F 1BBHA 3GM3A 3B71A 1QSPA 4YWQA 1NLXA 4CS8C 3NG1A 3M79A 3ABLC 4FX5A 1HW1A 1QKRA 3AOUA 5TJ5E 2HSQA 2Y39A 2XLVA 3T6GB 4LLCA 5KYUB 3HKKA 2PX0A 3L8JA 2GAQA 4MTOA 1G4US 3S84A 1K05A 1RKCA 4U5BE 3LS1A 3TK0A 1C02A 1Q0DA 5L0CA 1CGNA 4MTGA 3RVYA 1JRAA 3EH2A 2OU6A 3LNRA 4NY3A 5EHHA 4MTFA 4Q5SF 5KYUA 1DOVA 1XZPA 4CDAA 2G3VA 2R7OA 1WTYA 1H9TA 3KL4A 4ULVA 5DS4A 3M4CA 3Q6MA 1YZCA 4MVQA 3SNHA 2XM0A 2IXMA 3EGDA 3GEEA 1LE2A 2HKVA 3MX3A 3ZQYA 2J7PA 5JP7A 1M6TA 4LDQA 1MMAA 3HNLA 1YLMA 4BJ6C 3UMHA 2WZGA 1D0XA 1FAPB 4N6HA 2A1DD 3B9QA 4DRIB 2ZXWC 3S27A 2PP4A 1V4AA 1B68A 2FFHA 2R02A 3EH1A 2WVQA 4R32A 2EILC 5E3CA 1Y6DA 4OINF 2DI3A 3W8IA 4AL0A 5EGYA 2LSEA 2YL3A 4PK4A 5L3QA 2ICWG 3ECSA 4CS9A 4EUKB 4EWCA 1WATA 2GWWA 2Q4FA 3HJCA 1LS1A 3LEOA 3LJBA 3LLIA 1EQ1A 3IEEA 3OEOA 1OCRC 2CDQA 4EKWA 2KJGA 1Z5ZA 3H65A 3HNJA 2GFHA 4GEHA 4Z9HA 1R5ID 1YA7O 1PD0A 5JRAA 3LUTB 4RD9A 1VK5A 3JT1A 1Q0MA 1MNDA 3ASOC 1TWCA 2XM4A 1RJ9A 4PJNA 1E2XA 3DM9B 4U5CE 4CJGA 1D0YA 3JZ0A 4PFOA 3B29A 4U5DE 1OCZC 4CX9A 2MHRA 4JCZA 3RQGA 4JEAA 2AWCA 2B0HA 2YLDA 3B0VC 1G5ZA 4PACA 4XPWA 5B3IA 1VTMP 2J7PD 3OA1A 1M56C 2J0XA 1I4ZA 4FESA 1LE4A 3O6XA 4P9TA 5HV9A 2YRFA 3WG7C 4CS7A 5KYXB 3RH3A 1C17M 1RXQA 5DLJA 3RIPA 5JVEA 1ZZPA 3S9OA 1ORSC 4HEAJ 5CI8A 1BDJB 3KYIA 1QZXA 4YT2A 3CEXA 2L81A 3HNKA 5F28E 1MQVA 1NZEA 1Q0FA 1ZHXA 2EPLX 1OCCC 4JE9A 4XPXA 4DBRA 1Z63A 2QNLA 2TMVP 4A4AA 3KH2A 4K0DA 4MS2A 3C18A 2P7VA 1OCOC 5E2QA 1QQ3A 4N4WA 1VMAA 1EA8A 2H8AA 2GDCA 1S05A 5KYWB 2G62A 2EINC 4JW1A 2VH3A 3AG1C 4RBNA 2KQ9A 4EIYA 4YT8A 5L0FA 4OIQF 5FZTA 3QW0A 3Q6NA 3EHNA 2JPUA 4XQ1A 5KYYB 4RDAA 3V5YA 4LLEA 2PFDA 1NBBA 2YLIA 2LK4A 3MYFA 4AX2A 5KYWA 3VRCA 3RQEA 2QUPA 3S29A 2YWAA 4E0HA 3CQZA 1YAUO 1FMVA 3ZVRA 1JOGA 3ZC4A 2YL1A 2IBFA 2R7VA 3DD7A 3MFNA 2XRHA 5B3SC 4U5HA 4QI2A 4LDKA 1D1BA 1VYIA 4J7TA 4EBJA 5E33A 2XLEA 3O39A 1CPRA 3DJNB 3K1IC 3L8IA 1J8MF 2YL0A 5DQZA 2Q7RA 3GORA 3DMDA 5L0JA 1V55C 3NKDA 1UFBA 5L0HA 3R2PA 2OKUA 2Y3DA 2X51A 3WHNA 2P0NA 5CI9A
chains in the Genus database with same CATH topology
3GWNA 3U5SA 3LLKA 3U2LA 4E0IA 3O55A 1OQCA 3W4YA 4E0HA 2HJ3A 3TK0A 3GWLA 4LDKA 1JRAA 3MBGA 3LLIA 3R7CA 1JR8A 3TD7A 3U2MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GWN A;  3U5S A;  3LLK A;  3U2L A;  4E0I A;  3O55 A;  1OQC A;  3W4Y A;  4E0H A;  2HJ3 A;  3TK0 A;  3GWL A;  4LDK A;  1JRA A;  3MBG A;  3LLI A;  3R7C A;  1JR8 A;  3TD7 A;  3U2M A; 
#chains in the Genus database with same CATH topology
 2M4E A;  1BR1 A;  2RSE B;  256B A;  1O87 A;  2ZPA A;  1QLE C;  3DZA A;  3ABK C;  4NC3 A;  3FOP A;  2KC3 A;  2A69 F;  4KNV A;  3VYW A;  2R7U A;  5BQI A;  3SXM A;  3DKA A;  1R4T A;  4XEF A;  3ZIB A;  4G78 A;  3SXY A;  2A0B A;  3VAY A;  4DRH B;  2DB4 A;  2L7A A;  3ZQV A;  1OXB A;  4KNW A;  1H9G A;  3G4X A;  4G7H F;  4U9D A;  3DXJ F;  5B1B C;  3T4R A;  3RQF A;  3DI5 A;  2EPK X;  3OWT A;  3JRM O;  2YQY A;  2L6H A;  2VCC A;  3UNG C;  4PFP A;  3ZG1 A;  2O9X A;  4JJG A;  1MNE A;  3S90 A;  3B0P A;  2C04 A;  2Q9B A;  2J8W A;  2W4B A;  2OEV A;  3CZ6 A;  3DM5 A;  4ONS A;  1M2V A;  3ZSU A;  4JCH A;  2HUJ A;  1ZYR F;  2XS1 A;  2LFD A;  4XWJ A;  4OIP F;  1HE1 A;  3NYM A;  4E7S A;  1ZHW A;  2V3C C;  2UUH A;  4MVM A;  3LNM B;  2Z15 A;  2C03 A;  4CS9 C;  3NYL A;  2LCH A;  1AVO B;  1H6G A;  4U5G A;  5FCL A;  4G7O F;  3SXZ A;  3JYY A;  3UGP A;  3W4Y A;  2KW3 C;  2YL7 A;  3MLG A;  1OXK A;  2PBE A;  1D0Z A;  2F22 A;  5COG A;  2LFF A;  1GM5 A;  1WGW A;  2HS5 A;  4GYT A;  4NTF A;  4DXW A;  2XLM A;  5BUO A;  3N0T A;  1WWP A;  3EFO B;  3L1M A;  1ZW2 A;  3DE8 A;  3PDM P;  4M63 A;  3SEO A;  1EKY A;  2XL8 A;  5AGF A;  3U3B A;  2NG1 A;  1SYQ A;  4YN0 B;  4IWB A;  2J45 A;  4Z9I A;  3FHD A;  4J32 B;  2Q9C A;  3EFO A;  2I15 A;  3V7O A;  4FAP B;  1HY5 A;  1NFO A;  2H7B A;  4IGG A;  2XLO A;  4AE4 B;  4CIH A;  3K66 A;  3DE9 A;  1T5O A;  3JSZ A;  3O10 A;  2B0J A;  2J9V A;  1S7Z A;  5JSL A;  3AJM A;  1SZI A;  4MVR A;  1OW8 A;  3FMS A;  1Q0K A;  2L6G A;  5K0I A;  1V54 C;  1OQC A;  1HMD A;  1NSG B;  2VC9 A;  3X1O A;  1BR2 A;  1ZHT A;  2IOQ A;  4E18 A;  1LI5 A;  3M4B A;  2XXA B;  4PR9 A;  4NCQ A;  4MVU A;  4BJ5 A;  5A6J A;  1F1M A;  4G7Z F;  4K7B A;  1OR3 A;  2H7O A;  3TOM A;  4NTB A;  1PCX A;  1RCP A;  2ASR A;  4ER9 A;  4ZLC A;  3BEH A;  2D4U A;  3R7C A;  1A7V A;  3EG9 B;  2XXA A;  3LAY A;  3PHF 2;  3GM1 A;  3KKB A;  3U2M A;  5AC4 A;  3RF3 A;  4I3M A;  1AUE A;  2ZXR A;  4O6N A;  1WN0 A;  2HMZ A;  3GM2 A;  4W8K A;  2BC5 A;  1TWH A;  2LIG A;  3EG9 A;  2FAP B;  2X0C A;  4FWV A;  3V5Z A;  4KI2 A;  4IB4 A;  1I4Y A;  2YKZ A;  3HLZ A;  4YJW A;  2ZXP A;  3ITF A;  5F5H A;  2A68 F;  2WL8 A;  2RD9 A;  3NRH A;  1A7D A;  5L0D A;  2NSF A;  3ZDL A;  2Q9A A;  2R25 A;  4WGY A;  5BQG A;  3X2Q C;  2XS8 A;  3L34 A;  2D5R B;  2HSB A;  2LQG A;  4CBE A;  4N6C A;  4E17 A;  4DBQ A;  4UDV A;  1ORY A;  3US6 A;  2OG2 A;  3IPM O;  4CS8 A;  4DJ9 A;  3GWL A;  3LS0 A;  2YEV A;  3W2V A;  2EPO A;  5A6B D;  2WVN A;  2QLA A;  1M2O A;  5KYX A;  4X0R A;  2AWY A;  1WAS A;  1JR8 A;  1LKX A;  1ZHZ A;  4W8P A;  1FNT c;  2PNO A;  4JRZ A;  3VM6 A;  3DJU B;  3KPH A;  3TJ5 A;  3ABM C;  1E85 A;  1T9K A;  1Z6A A;  2Q3T A;  3SYN A;  3Q7G A;  3U3F A;  1BR4 A;  3DAG A;  3WAQ A;  1Q0G A;  3EJN A;  3ZWI A;  2IXP A;  4CSA C;  4MVS A;  3RW0 A;  3G4Z A;  3U2L A;  2MYS A;  4Z9J A;  2R9R B;  1A0B A;  1VLS A;  3ASN C;  4IAR A;  1RKE B;  3AQB A;  2OQM A;  3F47 A;  1IZM A;  4PJM A;  4JTD B;  1GS9 A;  3AGT A;  5KYY A;  3NYJ A;  1C03 A;  4J7Y A;  1M57 C;  4BJ6 A;  1VLT A;  1ZU5 A;  1RKE A;  1T6U A;  3EGX B;  3TUL A;  3IQC A;  3G50 A;  3QTH A;  1E84 A;  3NMJ A;  2ETS A;  5DS5 A;  1AEP A;  1TFO B;  1TQG A;  3EGX A;  3U0C A;  2IYL D;  2A6H F;  3QZC A;  5A6B A;  1QPU A;  3EHM A;  5A69 A;  2VCB A;  1TKN A;  2J0W A;  3O55 A;  1OW6 A;  1A7E A;  3A11 A;  2KNH A;  4XEV A;  2R7Q A;  4XPY A;  4BG0 A;  1L3P A;  2L9J A;  3GEI A;  1CGM E;  2XL6 A;  1YAR O;  1N1C A;  3SP1 A;  4BJ1 A;  3FAP B;  2WZL A;  4F4B A;  1KTM A;  1GQA A;  2YZS A;  1XZQ A;  4J30 B;  3LEV A;  4E7Z A;  1YVI A;  3JSE O;  1YJG A;  3GAN A;  4P6I C;  2R03 A;  4XEK A;  3ATP A;  4OIO F;  2ZD9 A;  2IM8 A;  2HFI A;  2AU5 A;  2AVK A;  2QTV A;  2BE5 F;  1W2W A;  1ZU4 A;  4HFF B;  2DYR C;  4A2N B;  1GGQ A;  3POV A;  5JUA A;  4JTA B;  2PX3 A;  1NU9 C;  2HV7 A;  4ANJ A;  2AP3 A;  4XLN F;  1G8X A;  2KK1 A;  2V26 A;  5T3W A;  3T9O A;  3IQ6 A;  2J9W A;  2CNW A;  4Q7C A;  5JLI A;  5DS6 A;  1TFK B;  1J8Y F;  5JT4 A;  2P1A A;  3EPV A;  3JRT A;  3QVY A;  3U9J A;  2VCA A;  2NUT B;  1T6I A;  4O79 A;  5A6K A;  2H7V C;  5COM A;  3C62 A;  4O7G A;  1O3U A;  4GQH A;  5BQH A;  3CAX A;  2W4M A;  4I1M A;  4JJF A;  1OR2 A;  2R7T A;  3JYH A;  3IQT A;  5F5F A;  1YYJ A;  1FTS A;  2HJM A;  1TWA A;  5COF A;  4O6Y A;  1Y4C A;  1UG7 A;  3K6B A;  1JPJ A;  3RFY A;  2UUI A;  2HMQ A;  4U5F E;  3FDQ A;  2YVK A;  1CGO A;  3EZH A;  1FFH A;  4O6M A;  3K1I A;  3VF0 A;  3WOD F;  5JS5 A;  1H7I A;  1LVK A;  2HZ8 A;  3GEH A;  1TWG A;  2VAS A;  4C3B A;  4JKV A;  4PJL A;  1Z23 A;  5T1D B;  3C8G B;  2R7X A;  3RVZ A;  3QW1 A;  4NQF A;  1NFN A;  2CNW D;  3AG4 C;  3H2U A;  3JCU Q;  4MW8 A;  4AE4 A;  2HJ3 A;  1TR2 A;  4EBK A;  3NDB B;  3T6B A;  3N24 A;  1HW2 A;  1LM3 B;  2P61 A;  2EIM C;  3C8G A;  2YLG A;  3HTK C;  3V5X A;  2WZF A;  3AG2 C;  2XLD A;  3EGD B;  2CCY A;  2J46 A;  2JD3 A;  2LP4 A;  2OJE D;  3MBG A;  4MVO A;  2NPU A;  4LDR A;  3TQO A;  3QVZ A;  3NMK A;  4WGZ A;  3U8V A;  3ZTM A;  5IY5 C;  2FGY A;  5DVW A;  3TD7 A;  1FFT C;  5D92 A;  3LES A;  2XLW A;  1T6Q A;  2L6F A;  4WJ0 A;  4YT5 A;  3DWW A;  3PCV A;  2KSF A;  3F46 A;  3NKE A;  3W2W A;  4YL0 A;  4E0I A;  3S28 A;  3UMI A;  1FR0 A;  3Q7L A;  1A41 A;  2HV6 A;  3U9M A;  1DOW A;  2J9B A;  2WB7 A;  1NG1 A;  3FVY A;  2CYD A;  1K04 A;  3HNI A;  1MMD A;  5B1A C;  3JTL O;  1YDI A;  3PMR A;  4JEB A;  3AGU A;  1KU2 A;  1FMW A;  2DYS C;  2EIK C;  4I1O B;  1JAF A;  4ULW A;  4C3E A;  2R7R A;  1JMW A;  3M15 A;  4Q4Z F;  3IHU A;  1RJ9 B;  2A0U A;  3C8G D;  4JTC B;  2YHS A;  2P6V A;  3K33 A;  4QI0 A;  2NUP B;  3W8H A;  1D1C A;  1O5H A;  1I5N A;  1K40 A;  3RYL A;  4DVY P;  2MWQ A;  2IXN A;  1SMY F;  4EBB A;  1BZ4 A;  1ORJ A;  1LPE A;  1T01 A;  2QE9 A;  4I44 A;  5A6A A;  4WAB A;  4JIO A;  4MVZ A;  3I5Q A;  4IAQ A;  2Y3B A;  3UMK A;  4U9E A;  2NUP A;  4DRJ B;  4JUR I;  4XTK A;  3U8P A;  3K7D A;  4BJT A;  4MW3 A;  1YZA A;  2W45 A;  4AL1 A;  4JC7 A;  4D4N A;  4YL1 A;  1OW7 A;  4YT4 A;  1VYK A;  2R7S A;  5L0I A;  4P9F A;  2A6E F;  4U5E E;  4C7O B;  2EIJ C;  2EPN A;  1L7C A;  1MMG A;  2M64 A;  2OOC A;  1Z3I X;  4KBL A;  4LER A;  4MQ9 F;  4YK5 A;  4CIP A;  4ZLD A;  4XLP F;  3NMI A;  4HFK B;  3E9V A;  2R7W A;  2Y3H A;  1RMV A;  5EK0 A;  4C7O A;  5AC5 A;  2Y3G A;  4BEM J;  2VB6 A;  1CPQ A;  4IAO A;  3KMI A;  2XLH A;  3C63 A;  3MYI A;  5T3T A;  5L0G A;  1G4W R;  2PF4 E;  1PD1 A;  3L0I A;  3KYJ A;  2KGO A;  1E83 A;  4DVZ A;  3AQC A;  2KYH A;  4DOZ A;  1SR2 A;  3N2Z B;  2IXO A;  3T6J A;  1YYX A;  4CJO A;  4OIR F;  5D91 A;  2ZXO A;  3FXH A;  1VB5 A;  1E86 A;  4N06 A;  3EQL F;  3U5S A;  4L6R A;  3QMK A;  4YL3 A;  4QDL A;  3BRJ A;  3RKO F;  1XWJ A;  1MMN A;  3CSK A;  1WOL A;  5HSW A;  1U0B B;  4OD5 A;  1OKK A;  1V74 B;  3M1C B;  1NU7 D;  2I8B A;  4LAC B;  2JX0 A;  4MND A;  3AG3 C;  4AK9 A;  3UGO A;  2CW0 F;  1HE9 A;  2CGE A;  3FAJ A;  2NSG A;  5L3V A;  2GA0 A;  3H2V A;  3ZTZ A;  1LIH A;  1KNY A;  3K1H A;  5KYN A;  5E3A A;  3GOD A;  3UR3 C;  4EHP A;  4D4X A;  1ZHY A;  2J9U A;  4JVS A;  3SXK A;  1APC A;  3S0X A;  2WVO A;  4OD4 A;  3GWN A;  1PV3 A;  2W9Y A;  2XL4 A;  3DAF A;  3EZI A;  2G3K A;  3FOO A;  4IJJ A;  3J06 A;  2Y69 C;  4BJ5 C;  2R05 A;  3TJ6 A;  1LI7 A;  3LLK A;  4G0H A;  4NTA A;  5CIV A;  1VOM A;  2BL2 A;  1QVX A;  1D1A A;  4B6I A;  4CDY A;  1SF8 A;  1ZVZ A;  5GPG B;  4H4K C;  4CSA A;  3IQ5 A;  1U89 A;  2EPM X;  2OEX A;  2OJQ A;  1OKK D;  1Z7Q c;  3B0U X;  3TOL A;  4H54 A;  3SZR A;  3A9C A;  1M2V B;  2E87 A;  2QY9 A;  3I5P A;  1HMO A;  4PJJ A;  2Q00 A;  2XSE A;  1EI7 A;  4C3D A;  5DQT A;  4CDV A;  4BEJ A;  2OCC C;  1LS4 A;  3E70 C;  4K1O A;  4KC9 A;  3C7J A;  4IRU A;  2NUT A;  4BPM A;  1ST6 A;  1U6H A;  4HE8 D;  1ZW3 A;  1YA9 A;  2LD6 A;  3C8Z A;  4JZA A;  1JPN A;  3I4U A;  2DGJ A;  1IW7 F;  1BBH A;  3GM3 A;  3B71 A;  1QSP A;  4YWQ A;  1NLX A;  4CS8 C;  3NG1 A;  3M79 A;  3ABL C;  4FX5 A;  1HW1 A;  1QKR A;  3AOU A;  5TJ5 E;  2HSQ A;  2Y39 A;  2XLV A;  3T6G B;  4LLC A;  5KYU B;  3HKK A;  2PX0 A;  3L8J A;  2GAQ A;  4MTO A;  1G4U S;  3S84 A;  1K05 A;  1RKC A;  4U5B E;  3LS1 A;  3TK0 A;  1C02 A;  1Q0D A;  5L0C A;  1CGN A;  4MTG A;  3RVY A;  1JRA A;  3EH2 A;  2OU6 A;  3LNR A;  4NY3 A;  5EHH A;  4MTF A;  4Q5S F;  5KYU A;  1DOV A;  1XZP A;  4CDA A;  2G3V A;  2R7O A;  1WTY A;  1H9T A;  3KL4 A;  4ULV A;  5DS4 A;  3M4C A;  3Q6M A;  1YZC A;  4MVQ A;  3SNH A;  2XM0 A;  2IXM A;  3EGD A;  3GEE A;  1LE2 A;  2HKV A;  3MX3 A;  3ZQY A;  2J7P A;  5JP7 A;  1M6T A;  4LDQ A;  1MMA A;  3HNL A;  1YLM A;  4BJ6 C;  3UMH A;  2WZG A;  1D0X A;  1FAP B;  4N6H A;  2A1D D;  3B9Q A;  4DRI B;  2ZXW C;  3S27 A;  2PP4 A;  1V4A A;  1B68 A;  2FFH A;  2R02 A;  3EH1 A;  2WVQ A;  4R32 A;  2EIL C;  5E3C A;  1Y6D A;  4OIN F;  2DI3 A;  3W8I A;  4AL0 A;  5EGY A;  2LSE A;  2YL3 A;  4PK4 A;  5L3Q A;  2ICW G;  3ECS A;  4CS9 A;  4EUK B;  4EWC A;  1WAT A;  2GWW A;  2Q4F A;  3HJC A;  1LS1 A;  3LEO A;  3LJB A;  3LLI A;  1EQ1 A;  3IEE A;  3OEO A;  1OCR C;  2CDQ A;  4EKW A;  2KJG A;  1Z5Z A;  3H65 A;  3HNJ A;  2GFH A;  4GEH A;  4Z9H A;  1R5I D;  1YA7 O;  1PD0 A;  5JRA A;  3LUT B;  4RD9 A;  1VK5 A;  3JT1 A;  1Q0M A;  1MND A;  3ASO C;  1TWC A;  2XM4 A;  1RJ9 A;  4PJN A;  1E2X A;  3DM9 B;  4U5C E;  4CJG A;  1D0Y A;  3JZ0 A;  4PFO A;  3B29 A;  4U5D E;  1OCZ C;  4CX9 A;  2MHR A;  4JCZ A;  3RQG A;  4JEA A;  2AWC A;  2B0H A;  2YLD A;  3B0V C;  1G5Z A;  4PAC A;  4XPW A;  5B3I A;  1VTM P;  2J7P D;  3OA1 A;  1M56 C;  2J0X A;  1I4Z A;  4FES A;  1LE4 A;  3O6X A;  4P9T A;  5HV9 A;  2YRF A;  3WG7 C;  4CS7 A;  5KYX B;  3RH3 A;  1C17 M;  1RXQ A;  5DLJ A;  3RIP A;  5JVE A;  1ZZP A;  3S9O A;  1ORS C;  4HEA J;  5CI8 A;  1BDJ B;  3KYI A;  1QZX A;  4YT2 A;  3CEX A;  2L81 A;  3HNK A;  5F28 E;  1MQV A;  1NZE A;  1Q0F A;  1ZHX A;  2EPL X;  1OCC C;  4JE9 A;  4XPX A;  4DBR A;  1Z63 A;  2QNL A;  2TMV P;  4A4A A;  3KH2 A;  4K0D A;  4MS2 A;  3C18 A;  2P7V A;  1OCO C;  5E2Q A;  1QQ3 A;  4N4W A;  1VMA A;  1EA8 A;  2H8A A;  2GDC A;  1S05 A;  5KYW B;  2G62 A;  2EIN C;  4JW1 A;  2VH3 A;  3AG1 C;  4RBN A;  2KQ9 A;  4EIY A;  4YT8 A;  5L0F A;  4OIQ F;  5FZT A;  3QW0 A;  3Q6N A;  3EHN A;  2JPU A;  4XQ1 A;  5KYY B;  4RDA A;  3V5Y A;  4LLE A;  2PFD A;  1NBB A;  2YLI A;  2LK4 A;  3MYF A;  4AX2 A;  5KYW A;  3VRC A;  3RQE A;  2QUP A;  3S29 A;  2YWA A;  4E0H A;  3CQZ A;  1YAU O;  1FMV A;  3ZVR A;  1JOG A;  3ZC4 A;  2YL1 A;  2IBF A;  2R7V A;  3DD7 A;  3MFN A;  2XRH A;  5B3S C;  4U5H A;  4QI2 A;  4LDK A;  1D1B A;  1VYI A;  4J7T A;  4EBJ A;  5E33 A;  2XLE A;  3O39 A;  1CPR A;  3DJN B;  3K1I C;  3L8I A;  1J8M F;  2YL0 A;  5DQZ A;  2Q7R A;  3GOR A;  3DMD A;  5L0J A;  1V55 C;  3NKD A;  1UFB A;  5L0H A;  3R2P A;  2OKU A;  2Y3D A;  2X51 A;  3WHN A;  2P0N A;  5CI9 A; 
#chains in the Genus database with same CATH homology
 3GWN A;  3U5S A;  3LLK A;  3U2L A;  4E0I A;  3O55 A;  1OQC A;  3W4Y A;  4E0H A;  2HJ3 A;  3TK0 A;  3GWL A;  4LDK A;  1JRA A;  3MBG A;  3LLI A;  3R7C A;  1JR8 A;  3TD7 A;  3U2M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...