1OQCA

The crystal structure of augmenter of liver regeneration: a mammalian fad dependent sulfhydryl oxidase
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
112
structure length
112
Chain Sequence
EDCPQDREELGRNTWAFLHTLAAYYPDMPTPEQQQDMAQFIHIFSKFYPCEECAEDIRKRIDRSQPDTSTRVSFSQWLCRLHNEVNRKLGKPDFDCSRVDERWRDGWKDGSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords augmenter of liver regeneration
publication title The refined crystal structure of augmenter of liver regeneration
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
total genus 42
structure length 112
sequence length 112
chains with identical sequence B, C, D
ec nomenclature ec 1.8.3.2: Thiol oxidase.
pdb deposition date 2003-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04777 Evr1_Alr Erv1 / Alr family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.310 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) ERV/ALR sulfhydryl oxidase domain 1oqcA00
4E0HA 1JR8A 4E0IA 3R7CA 3U5SA 3U2LA 3LLKA 4LDKA 3GWNA 3GWLA 3TK0A 3LLIA 3MBGA 3U2MA 1OQCA 3W4YA 2HJ3A 3O55A 3TD7A 1JRAA
chains in the Genus database with same CATH superfamily
4J32B 2J0WA 2JD3A 4QI0A 3PHF2 2CDQA 2FGYA 3CEXA 3B0PA 4WABA 3ABMC 3EFOA 2DYRC 4ULWA 4A2NB 1E85A 1EI7A 4U5FE 2P0NA 5BQGA 3BRJA 1LVKA 1Q0GA 2PP4A 3UNGC 3LS1A 2J0XA 2EIKC 2YKZA 2WL8A 4MTOA 1QVXA 2KQ9A 1SR2A 4HEAJ 4YT5A 5DLJA 5FCLA 3G50A 4Q7CA 1ORSC 4JZAA 1XZPA 1RXQA 2L6GA 5AC5A 2YQYA 4M63A 4IAQA 3U2MA 4RD9A 4E18A 4PACA 5A6BD 3IQ5A 3L34A 3AG1C 1G4US 2KYHA 3Q6MA 1RCPA 4U5BE 1VLSA 3RKOF 2KW3C 3DWWA 4WGZA 4XEFA 1ZZPA 1J8YF 5L0IA 3SXKA 1M56C 2WZLA 4U5GA 3U8PA 4Z9IA 1Z6AA 2KGOA 3LAYA 3N2ZB 3QVYA 2FAPB 2GAQA 4H54A 2R05A 4MVZA 1MMDA 1LE4A 1A0BA 4YT2A 4EBKA 1TR2A 1OW8A 1R4TA 3Q7GA 4IWBA 4CJGA 1ZHYA 1M2OA 1T5OA 3QW1A 1LIHA 1YA9A 1HMDA 4DRHB 5A6JA 1GQAA 2LFDA 5FZTA 3JYHA 1MMNA 4XLNF 4BG0A 3SP1A 1UG7A 2XLWA 3KMIA 4NTAA 3ZIBA 1CGME 2Y39A 3GM2A 3S90A 4YJWA 4U5HA 3UGPA 1NFOA 5B1AC 1RMVA 2NUTB 4CS9A 2R7TA 1QLEC 3C62A 4MVQA 3M4CA 3TD7A 2YLGA 4Z9HA 1VB5A 1YVIA 4O6NA 3U9JA 1ORJA 2LIGA 3U3FA 1YYJA 2LCHA 2Y3HA 1U6HA 1WN0A 1JR8A 1YDIA 5DS6A 1HW2A 2VCCA 4J7YA 1IZMA 2YLIA 1S05A 3W8IA 2AP3A 2Y69C 4O6YA 4G0HA 5L0FA 1T6QA 3ZQVA 5AC4A 1G4WR 2ZXWC 2J9WA 5KYWB 4AX2A 5IY5C 1QSPA 1BBHA 3DM5A 3SNHA 1LS1A 1AVOB 1SMYF 1LPEA 4NTBA 3ASNC 3DMDA 4XPXA 5L0GA 3V7OA 4MW8A 2J7PD 3SYNA 2L6FA 2XXAA 3DAFA 3UR3C 2B0HA 3RIPA 2IOQA 2J9UA 4PFPA 4K1OA 4O79A 4LLEA 3LUTB 1V4AA 3LNRA 2XLVA 4JRZA 4P9TA 3U0CA 5E3CA 1KU2A 3WAQA 1ZU4A 2KK1A 3JRMO 3T4RA 3PDMP 4Q5SF 3N24A 1JMWA 4MVOA 3ZWIA 1M2VB 1HW1A 2OQMA 5A69A 3EG9A 1K40A 3G4XA 3MX3A 1BR1A 1OXBA 2OJQA 2YL3A 3MYFA 1Q0KA 3NG1A 3O10A 4YT8A 3LEOA 3TK0A 2NG1A 1NZEA 1OR2A 4KBLA 5JP7A 4MNDA 4CS7A 1ZHZA 2YLDA 3V5XA 4DRJB 5JVEA 1D1CA 1E84A 4PK4A 4O6MA 2YWAA 3ZVRA 1T01A 1MMGA 1YAUO 2J8WA 3O55A 4HE8D 3AG2C 2GFHA 5JSLA 1EA8A 1TFKB 1G8XA 1KNYA 4C3BA 1LKXA 1ZW2A 4NQFA 1D0ZA 2A6EF 2Y3GA 3QMKA 2VASA 4WGYA 1DOWA 1TQGA 1SYQA 1I4ZA 3R7CA 1VK5A 3ATPA 4BEMJ 2CGEA 2J45A 5DVWA 3U2LA 3F47A 3NYMA 2G62A 5COFA 2BE5F 3AQCA 2KJGA 3DKAA 3ZTZA 2YL7A 3CSKA 4XTKA 3EZHA 3TQOA 1FFTC 3HNLA 5L0CA 2XRHA 4QDLA 2TMVP 3OA1A 3WODF 2A68F 4N6HA 3DE8A 4DBQA 4OD4A 3W2VA 2NSFA 2LSEA 4IRUA 1NU9C 1E86A 3VM6A 3EFOB 1FMWA 3K7DA 3FOOA 4XWJA 3V5YA 5T1DB 2ZXOA 1TWAA 3T6JA 1L7CA 2VCBA 4YWQA 1ZHWA 4G7ZF 4DXWA 4BJ6C 2WB7A 3US6A 2ETSA 3S9OA 3C8GA 2R7WA 1M57C 3H2UA 5BQIA 3VAYA 2OU6A 2VH3A 1OKKA 3FDQA 2X51A 1A7EA 2HUJA 3DXJF 4G7OF 4F4BA 2R25A 3EZIA 4P9FA 4X0RA 3IHUA 3NKDA 4MS2A 4MQ9F 1TWHA 2MWQA 3LLIA 3U3BA 4CS9C 1FNTc 2F22A 3TJ6A 5BUOA 3KL4A 3KH2A 1AUEA 2D5RB 1FFHA 2LFFA 2Y3BA 3ABLC 3IQTA 4J30B 4W8PA 3S28A 4A4AA 3POVA 1H6GA 5HSWA 1BDJB 4XEKA 4I1MA 2WZGA 4YN0B 4JE9A 2X0CA 2EIMC 5E33A 2PX0A 3R2PA 4K0DA 1D1BA 3DD7A 1U0BB 1T9KA 5KYYA 4NY3A 3EHMA 1FMVA 3NRHA 3QVZA 1MNEA 3B29A 4U5EE 4U9DA 4IAOA 2XL8A 3K1IA 3EH2A 3AGUA 2YEVA 5L0JA 3MYIA 1V55C 4LERA 4DBRA 4BJ6A 3SEOA 3UMIA 3JYYA 2HSQA 3JTLO 3OEOA 2QE9A 3EGXA 4L6RA 4N4WA 3K66A 2XLOA 1YZCA 3GODA 1A7DA 4R32A 3TOLA 2V26A 1GS9A 1CGNA 1JPNA 1LM3B 2GWWA 2UUIA 3FHDA 3VYWA 3LEVA 3U9MA 1NBBA 2HMQA 1T6UA 1YZAA 2YRFA 5E2QA 4KI2A 1VLTA 1ZW3A 2L6HA 3ABKC 4IB4A 2KC3A 4OIRF 4AK9A 2PNOA 2BL2A 4CBEA 1VTMP 1Y4CA 2AVKA 3HJCA 2GDCA 3CQZA 1A41A 2DB4A 4DRIB 1O5HA 2BC5A 1RJ9A 1LS4A 1ZVZA 2IXOA 2XL6A 3AOUA 1R5ID 2EPNA 4LDRA 4E0IA 4XPYA 1H9GA 3C63A 3K33A 5CI8A 5B3IA 2CW0F 3AG3C 2WZFA 1UFBA 3AGTA 4XQ1A 5D91A 1AEPA 3IQ6A 2A0UA 4LDKA 3H65A 4PJLA 3WG7C 4CIPA 2XXAB 2HMZA 2W45A 1I5NA 2HKVA 1C17M 1VYKA 5A6BA 3DM9B 1ZHTA 1YLMA 2H8AA 5HV9A 1VOMA 1U89A 4E17A 3AQBA 2WVNA 3OWTA 4EKWA 3RH3A 3HNKA 2XLMA 5DQTA 3DJUB 4O7GA 4C3DA 4JEAA 1I4YA 1JRAA 2NUPA 3EG9B 4XEVA 4ANJA 2HFIA 4MVMA 3RF3A 2JX0A 4H4KC 4ER9A 4CJOA 5CIVA 3GM1A 2P61A 3QTHA 2LD6A 4I44A 3WHNA 4AE4A 2EPOA 2YHSA 3FAPB 2HSBA 2P7VA 3HTKC 3MLGA 1O3UA 3ASOC 4XPWA 1OR3A 2DYSC 1N1CA 1RKEA 4IJJA 1OW7A 4JCHA 3HNIA 2QNLA 3KKBA 3A9CA 1S7ZA 4JIOA 5L0HA 3IQCA 3S29A 1B68A 4JTAB 3Q7LA 2YL0A 4JTDB 3W4YA 2AWCA 2IXPA 1ORYA 1GGQA 1C03A 1LE2A 1Z3IX 2A0BA 2FFHA 4IARA 3QW0A 4EIYA 3JRTA 1TWGA 1IW7F 2DI3A 4AL0A 4MTGA 2CNWD 4KNWA 4EUKB 1RKCA 2I8BA 3C8ZA 3H2VA 2EILC 3SZRA 3QZCA 2J46A 2Q4FA 1BR2A 3GORA 2AU5A 3UGOA 1V74B 2CCYA 1WASA 3FXHA 2R7RA 3HNJA 3DZAA 5KYNA 3M79A 4BPMA 1JOGA 4PR9A 2P1AA 1O87A 1D1AA 4EWCA 2M4EA 4CDVA 5JRAA 3HLZA 2O9XA 4YL1A 2OEXA 2XLDA 3E9VA 5KYXA 2QY9A 1Q0MA 2XSEA 2B0JA 2QLAA 4K7BA 3GWLA 4NTFA 3ZC4A 5BQHA 4CIHA 2R7VA 2XM4A 1CGOA 2AWYA 2G3KA 2KSFA 4MW3A 2R7SA 1E83A 4CSAA 2J7PA 1ST6A 4C7OA 1GM5A 1OCRC 1DOVA 3K1HA 4XLPF 2M64A 1NSGB 2HJ3A 3C8GB 5KYUA 4DVYP 2W4MA 3B0UX 1QZXA 4AL1A 2KNHA 2J9VA 2XL4A 4JURI 1SF8A 2VCAA 3K1IC 1LI7A 3JT1A 1BZ4A 2MHRA 4JW1A 4QI2A 2D4UA 2R03A 3FMSA 5AGFA 2MYSA 3L8IA 2A69F 4KC9A 1TKNA 2Q7RA 5K0IA 2QTVA 2OCCC 4DVZA 4PJJA 4UDVA 3U5SA 1XZQA 3W8HA 3ZDLA 2OOCA 4N06A 4W8KA 3NDBB 2G3VA 1L3PA 4GEHA 3DE9A 4J7TA 4BJ5C 3L0IA 1Z63A 1SZIA 4PJNA 2EPKX 1E2XA 2ZXPA 1OW6A 4U9EA 3GEIA 4CS8C 1MMAA 4Q4ZF 2L7AA 2CNWA 2VB6A 4U5DE 1CPRA 1OQCA 2YZSA 4CDAA 4EBBA 5KYYB 4JJFA 3RW0A 2H7OA 3NMIA 3CAXA 3KYIA 2Z15A 3EHNA 1WWPA 3JCUQ 4OIQF 4JVSA 2HS5A 3VRCA 4OD5A 1ZHXA 1XWJA 3KPHA 3S84A 1CPQA 1QKRA 1W2WA 3LS0A 1TWCA 2IYLD 1KTMA 1EKYA 4E7SA 2QUPA 3EGXB 3NKEA 5DS5A 2NPUA 2L81A 4LACB 3TOMA 4ZLDA 2JPUA 3DI5A 2J9BA 2GA0A 1QQ3A 2HV6A 2PF4E 2Q3TA 4FX5A 3TJ5A 5JT4A 3B9QA 2H7VC 4HFFB 2RD9A 3E70C 2YVKA 2ZPAA 3GEEA 4IGGA 1JAFA 1G5ZA 1D0XA 3SXMA 2Y3DA 4NCQA 3FAJA 1RJ9B 1ZYRF 4B6IA 4BJ5A 5EK0A 3J06A 4OIPF 2R7UA 1NU7D 4CX9A 3X2QC 2LQGA 3MFNA 4CS8A 3I5QA 1VMAA 4JC7A 3X1OA 3UMHA 5JS5A 4JKVA 5T3TA 5L3VA 1YJGA 5COGA 1APCA 3DAGA 3L1MA 3DJNB 3V5ZA 2ASRA 3B71A 4GYTA 4MTFA 3NYJA 4MVRA 4YK5A 5L3QA 2EPLX 1C02A 3RYLA 5GPGB 2I15A 1NG1A 2WVOA 4BEJA 1LI5A 5F5HA 5B3SC 4WJ0A 4BJTA 1WGWA 3AJMA 3T6BA 1HE9A 1NLXA 3SXYA 2NUPB 2DGJA 1VYIA 3F46A 3JSEO 2R7OA 2OKUA 3GM3A 4FESA 4OIOF 2IXNA 4GQHA 5A6AA 4AE4B 3IPMO 5B1BC 2OJED 4I3MA 1H7IA 1Y6DA 1WOLA 3JSZA 3N0TA 1OCZC 1Q0DA 4FWVA 3I4UA 1D0YA 4YL0A 4JCZA 3KYJA 3T9OA 2YL1A 2HZ8A 2HJMA 1RKEB 1EQ1A 2W9YA 1Z5ZA 1PD1A 3PMRA 4U5CE 5CI9A 4D4NA 4EHPA 3HKKA 4LDQA 3I5PA 4DJ9A 4RBNA 2NUTA 3PCVA 3M1CB 2R7XA 3M15A 2Q9AA 4PJMA 4YL3A 2ZXRA 1JPJA 1T6IA 1WTYA 1MQVA 4I1OB 2R02A 2Q9BA 4LLCA 4FAPB 3ITFA 1Z23A 1HMOA 4C3EA 2PFDA 4NC3A 4CSAC 4ULVA 3RVZA 1MNDA 2WVQA 5JUAA 1YARO 3LJBA 3RFYA 2EIJC 3G4ZA 4RDAA 3LESA 4MVUA 2H7BA 2V3CC 3GANA 3BEHA 2A6HF 5KYWA 1BR4A 1A7VA 2R9RB 1H9TA 2Q9CA 3UMKA 4DOZA 2XM0A 3T6GB 1HE1A 4JTCB 3SXZA 5KYXB 5L0DA 3VF0A 1V54C 3U8VA 4Z9JA 1OXKA 3A11A 3EQLF 3NMKA 3Q6NA 4KNVA 5COMA 2XLEA 2ZD9A 3ZQYA 2XS8A 5DQZA 1OCOC 4CDYA 4EBJA 2CYDA 3W2WA 3LNMB 2OG2A 3ZG1A 2W4BA 4C7OB 3C8GD 3ECSA 1PV3A 1FAPB 1M6TA 256BA 3LLKA 5TJ5E 3GEHA 5KYUB 3GWNA 1OKKD 2VC9A 3C7JA 3RQFA 4JJGA 3EGDB 2C03A 5A6KA 5DS4A 3O39A 2L9JA 1HY5A 2P6VA 1OCCC 2C04A 1M2VA 2XLHA 1NFNA 3AG4C 3NMJA 4JEBA 2UUHA 3B0VC 2Q00A 3CZ6A 4G78A 2NSGA 1F1MA 4G7HF 5T3WA 1Z7Qc 1WATA 2LK4A 1QPUA 3K6BA 3L8JA 4ONSA 3EGDA 4OINF 4E0HA 2A1DD 1ZU5A 3NYLA 2R7QA 1K05A 2RSEB 3S0XA 1Q0FA 3EPVA 5JLIA 3FOPA 2E87A 2IXMA 1FR0A 5D92A 5EGYA 3FVYA 1PCXA 3RQEA 1FTSA 4HFKB 3EJNA 4MVSA 4N6CA 3ZTMA 5F28E 2PBEA 1PD0A 4YT4A 3MBGA 4ZLCA 3EH1A 5E3AA 2XS1A 2EPMX 3ZSUA 2OEVA 3TULA 5F5FA 5EHHA 2EINC 2HV7A 2LP4A 3M4BA 2ICWG 1YYXA 3RQGA 4P6IC 4D4XA 3S27A 2IM8A 1TFOB 3JZ0A 1K04A 3IEEA 4BJ1A 4E7ZA 4PFOA 2PX3A 2IBFA 3O6XA 3C18A 3RVYA 1YA7O 1J8MF
chains in the Genus database with same CATH topology
4E0HA 1JR8A 4E0IA 3R7CA 3U5SA 3U2LA 3LLKA 4LDKA 3GWNA 3GWLA 3TK0A 3LLIA 3MBGA 3U2MA 1OQCA 3W4YA 2HJ3A 3O55A 3TD7A 1JRAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E0H A;  1JR8 A;  4E0I A;  3R7C A;  3U5S A;  3U2L A;  3LLK A;  4LDK A;  3GWN A;  3GWL A;  3TK0 A;  3LLI A;  3MBG A;  3U2M A;  1OQC A;  3W4Y A;  2HJ3 A;  3O55 A;  3TD7 A;  1JRA A; 
#chains in the Genus database with same CATH topology
 4J32 B;  2J0W A;  2JD3 A;  4QI0 A;  3PHF 2;  2CDQ A;  2FGY A;  3CEX A;  3B0P A;  4WAB A;  3ABM C;  3EFO A;  2DYR C;  4ULW A;  4A2N B;  1E85 A;  1EI7 A;  4U5F E;  2P0N A;  5BQG A;  3BRJ A;  1LVK A;  1Q0G A;  2PP4 A;  3UNG C;  3LS1 A;  2J0X A;  2EIK C;  2YKZ A;  2WL8 A;  4MTO A;  1QVX A;  2KQ9 A;  1SR2 A;  4HEA J;  4YT5 A;  5DLJ A;  5FCL A;  3G50 A;  4Q7C A;  1ORS C;  4JZA A;  1XZP A;  1RXQ A;  2L6G A;  5AC5 A;  2YQY A;  4M63 A;  4IAQ A;  3U2M A;  4RD9 A;  4E18 A;  4PAC A;  5A6B D;  3IQ5 A;  3L34 A;  3AG1 C;  1G4U S;  2KYH A;  3Q6M A;  1RCP A;  4U5B E;  1VLS A;  3RKO F;  2KW3 C;  3DWW A;  4WGZ A;  4XEF A;  1ZZP A;  1J8Y F;  5L0I A;  3SXK A;  1M56 C;  2WZL A;  4U5G A;  3U8P A;  4Z9I A;  1Z6A A;  2KGO A;  3LAY A;  3N2Z B;  3QVY A;  2FAP B;  2GAQ A;  4H54 A;  2R05 A;  4MVZ A;  1MMD A;  1LE4 A;  1A0B A;  4YT2 A;  4EBK A;  1TR2 A;  1OW8 A;  1R4T A;  3Q7G A;  4IWB A;  4CJG A;  1ZHY A;  1M2O A;  1T5O A;  3QW1 A;  1LIH A;  1YA9 A;  1HMD A;  4DRH B;  5A6J A;  1GQA A;  2LFD A;  5FZT A;  3JYH A;  1MMN A;  4XLN F;  4BG0 A;  3SP1 A;  1UG7 A;  2XLW A;  3KMI A;  4NTA A;  3ZIB A;  1CGM E;  2Y39 A;  3GM2 A;  3S90 A;  4YJW A;  4U5H A;  3UGP A;  1NFO A;  5B1A C;  1RMV A;  2NUT B;  4CS9 A;  2R7T A;  1QLE C;  3C62 A;  4MVQ A;  3M4C A;  3TD7 A;  2YLG A;  4Z9H A;  1VB5 A;  1YVI A;  4O6N A;  3U9J A;  1ORJ A;  2LIG A;  3U3F A;  1YYJ A;  2LCH A;  2Y3H A;  1U6H A;  1WN0 A;  1JR8 A;  1YDI A;  5DS6 A;  1HW2 A;  2VCC A;  4J7Y A;  1IZM A;  2YLI A;  1S05 A;  3W8I A;  2AP3 A;  2Y69 C;  4O6Y A;  4G0H A;  5L0F A;  1T6Q A;  3ZQV A;  5AC4 A;  1G4W R;  2ZXW C;  2J9W A;  5KYW B;  4AX2 A;  5IY5 C;  1QSP A;  1BBH A;  3DM5 A;  3SNH A;  1LS1 A;  1AVO B;  1SMY F;  1LPE A;  4NTB A;  3ASN C;  3DMD A;  4XPX A;  5L0G A;  3V7O A;  4MW8 A;  2J7P D;  3SYN A;  2L6F A;  2XXA A;  3DAF A;  3UR3 C;  2B0H A;  3RIP A;  2IOQ A;  2J9U A;  4PFP A;  4K1O A;  4O79 A;  4LLE A;  3LUT B;  1V4A A;  3LNR A;  2XLV A;  4JRZ A;  4P9T A;  3U0C A;  5E3C A;  1KU2 A;  3WAQ A;  1ZU4 A;  2KK1 A;  3JRM O;  3T4R A;  3PDM P;  4Q5S F;  3N24 A;  1JMW A;  4MVO A;  3ZWI A;  1M2V B;  1HW1 A;  2OQM A;  5A69 A;  3EG9 A;  1K40 A;  3G4X A;  3MX3 A;  1BR1 A;  1OXB A;  2OJQ A;  2YL3 A;  3MYF A;  1Q0K A;  3NG1 A;  3O10 A;  4YT8 A;  3LEO A;  3TK0 A;  2NG1 A;  1NZE A;  1OR2 A;  4KBL A;  5JP7 A;  4MND A;  4CS7 A;  1ZHZ A;  2YLD A;  3V5X A;  4DRJ B;  5JVE A;  1D1C A;  1E84 A;  4PK4 A;  4O6M A;  2YWA A;  3ZVR A;  1T01 A;  1MMG A;  1YAU O;  2J8W A;  3O55 A;  4HE8 D;  3AG2 C;  2GFH A;  5JSL A;  1EA8 A;  1TFK B;  1G8X A;  1KNY A;  4C3B A;  1LKX A;  1ZW2 A;  4NQF A;  1D0Z A;  2A6E F;  2Y3G A;  3QMK A;  2VAS A;  4WGY A;  1DOW A;  1TQG A;  1SYQ A;  1I4Z A;  3R7C A;  1VK5 A;  3ATP A;  4BEM J;  2CGE A;  2J45 A;  5DVW A;  3U2L A;  3F47 A;  3NYM A;  2G62 A;  5COF A;  2BE5 F;  3AQC A;  2KJG A;  3DKA A;  3ZTZ A;  2YL7 A;  3CSK A;  4XTK A;  3EZH A;  3TQO A;  1FFT C;  3HNL A;  5L0C A;  2XRH A;  4QDL A;  2TMV P;  3OA1 A;  3WOD F;  2A68 F;  4N6H A;  3DE8 A;  4DBQ A;  4OD4 A;  3W2V A;  2NSF A;  2LSE A;  4IRU A;  1NU9 C;  1E86 A;  3VM6 A;  3EFO B;  1FMW A;  3K7D A;  3FOO A;  4XWJ A;  3V5Y A;  5T1D B;  2ZXO A;  1TWA A;  3T6J A;  1L7C A;  2VCB A;  4YWQ A;  1ZHW A;  4G7Z F;  4DXW A;  4BJ6 C;  2WB7 A;  3US6 A;  2ETS A;  3S9O A;  3C8G A;  2R7W A;  1M57 C;  3H2U A;  5BQI A;  3VAY A;  2OU6 A;  2VH3 A;  1OKK A;  3FDQ A;  2X51 A;  1A7E A;  2HUJ A;  3DXJ F;  4G7O F;  4F4B A;  2R25 A;  3EZI A;  4P9F A;  4X0R A;  3IHU A;  3NKD A;  4MS2 A;  4MQ9 F;  1TWH A;  2MWQ A;  3LLI A;  3U3B A;  4CS9 C;  1FNT c;  2F22 A;  3TJ6 A;  5BUO A;  3KL4 A;  3KH2 A;  1AUE A;  2D5R B;  1FFH A;  2LFF A;  2Y3B A;  3ABL C;  3IQT A;  4J30 B;  4W8P A;  3S28 A;  4A4A A;  3POV A;  1H6G A;  5HSW A;  1BDJ B;  4XEK A;  4I1M A;  2WZG A;  4YN0 B;  4JE9 A;  2X0C A;  2EIM C;  5E33 A;  2PX0 A;  3R2P A;  4K0D A;  1D1B A;  3DD7 A;  1U0B B;  1T9K A;  5KYY A;  4NY3 A;  3EHM A;  1FMV A;  3NRH A;  3QVZ A;  1MNE A;  3B29 A;  4U5E E;  4U9D A;  4IAO A;  2XL8 A;  3K1I A;  3EH2 A;  3AGU A;  2YEV A;  5L0J A;  3MYI A;  1V55 C;  4LER A;  4DBR A;  4BJ6 A;  3SEO A;  3UMI A;  3JYY A;  2HSQ A;  3JTL O;  3OEO A;  2QE9 A;  3EGX A;  4L6R A;  4N4W A;  3K66 A;  2XLO A;  1YZC A;  3GOD A;  1A7D A;  4R32 A;  3TOL A;  2V26 A;  1GS9 A;  1CGN A;  1JPN A;  1LM3 B;  2GWW A;  2UUI A;  3FHD A;  3VYW A;  3LEV A;  3U9M A;  1NBB A;  2HMQ A;  1T6U A;  1YZA A;  2YRF A;  5E2Q A;  4KI2 A;  1VLT A;  1ZW3 A;  2L6H A;  3ABK C;  4IB4 A;  2KC3 A;  4OIR F;  4AK9 A;  2PNO A;  2BL2 A;  4CBE A;  1VTM P;  1Y4C A;  2AVK A;  3HJC A;  2GDC A;  3CQZ A;  1A41 A;  2DB4 A;  4DRI B;  1O5H A;  2BC5 A;  1RJ9 A;  1LS4 A;  1ZVZ A;  2IXO A;  2XL6 A;  3AOU A;  1R5I D;  2EPN A;  4LDR A;  4E0I A;  4XPY A;  1H9G A;  3C63 A;  3K33 A;  5CI8 A;  5B3I A;  2CW0 F;  3AG3 C;  2WZF A;  1UFB A;  3AGT A;  4XQ1 A;  5D91 A;  1AEP A;  3IQ6 A;  2A0U A;  4LDK A;  3H65 A;  4PJL A;  3WG7 C;  4CIP A;  2XXA B;  2HMZ A;  2W45 A;  1I5N A;  2HKV A;  1C17 M;  1VYK A;  5A6B A;  3DM9 B;  1ZHT A;  1YLM A;  2H8A A;  5HV9 A;  1VOM A;  1U89 A;  4E17 A;  3AQB A;  2WVN A;  3OWT A;  4EKW A;  3RH3 A;  3HNK A;  2XLM A;  5DQT A;  3DJU B;  4O7G A;  4C3D A;  4JEA A;  1I4Y A;  1JRA A;  2NUP A;  3EG9 B;  4XEV A;  4ANJ A;  2HFI A;  4MVM A;  3RF3 A;  2JX0 A;  4H4K C;  4ER9 A;  4CJO A;  5CIV A;  3GM1 A;  2P61 A;  3QTH A;  2LD6 A;  4I44 A;  3WHN A;  4AE4 A;  2EPO A;  2YHS A;  3FAP B;  2HSB A;  2P7V A;  3HTK C;  3MLG A;  1O3U A;  3ASO C;  4XPW A;  1OR3 A;  2DYS C;  1N1C A;  1RKE A;  4IJJ A;  1OW7 A;  4JCH A;  3HNI A;  2QNL A;  3KKB A;  3A9C A;  1S7Z A;  4JIO A;  5L0H A;  3IQC A;  3S29 A;  1B68 A;  4JTA B;  3Q7L A;  2YL0 A;  4JTD B;  3W4Y A;  2AWC A;  2IXP A;  1ORY A;  1GGQ A;  1C03 A;  1LE2 A;  1Z3I X;  2A0B A;  2FFH A;  4IAR A;  3QW0 A;  4EIY A;  3JRT A;  1TWG A;  1IW7 F;  2DI3 A;  4AL0 A;  4MTG A;  2CNW D;  4KNW A;  4EUK B;  1RKC A;  2I8B A;  3C8Z A;  3H2V A;  2EIL C;  3SZR A;  3QZC A;  2J46 A;  2Q4F A;  1BR2 A;  3GOR A;  2AU5 A;  3UGO A;  1V74 B;  2CCY A;  1WAS A;  3FXH A;  2R7R A;  3HNJ A;  3DZA A;  5KYN A;  3M79 A;  4BPM A;  1JOG A;  4PR9 A;  2P1A A;  1O87 A;  1D1A A;  4EWC A;  2M4E A;  4CDV A;  5JRA A;  3HLZ A;  2O9X A;  4YL1 A;  2OEX A;  2XLD A;  3E9V A;  5KYX A;  2QY9 A;  1Q0M A;  2XSE A;  2B0J A;  2QLA A;  4K7B A;  3GWL A;  4NTF A;  3ZC4 A;  5BQH A;  4CIH A;  2R7V A;  2XM4 A;  1CGO A;  2AWY A;  2G3K A;  2KSF A;  4MW3 A;  2R7S A;  1E83 A;  4CSA A;  2J7P A;  1ST6 A;  4C7O A;  1GM5 A;  1OCR C;  1DOV A;  3K1H A;  4XLP F;  2M64 A;  1NSG B;  2HJ3 A;  3C8G B;  5KYU A;  4DVY P;  2W4M A;  3B0U X;  1QZX A;  4AL1 A;  2KNH A;  2J9V A;  2XL4 A;  4JUR I;  1SF8 A;  2VCA A;  3K1I C;  1LI7 A;  3JT1 A;  1BZ4 A;  2MHR A;  4JW1 A;  4QI2 A;  2D4U A;  2R03 A;  3FMS A;  5AGF A;  2MYS A;  3L8I A;  2A69 F;  4KC9 A;  1TKN A;  2Q7R A;  5K0I A;  2QTV A;  2OCC C;  4DVZ A;  4PJJ A;  4UDV A;  3U5S A;  1XZQ A;  3W8H A;  3ZDL A;  2OOC A;  4N06 A;  4W8K A;  3NDB B;  2G3V A;  1L3P A;  4GEH A;  3DE9 A;  4J7T A;  4BJ5 C;  3L0I A;  1Z63 A;  1SZI A;  4PJN A;  2EPK X;  1E2X A;  2ZXP A;  1OW6 A;  4U9E A;  3GEI A;  4CS8 C;  1MMA A;  4Q4Z F;  2L7A A;  2CNW A;  2VB6 A;  4U5D E;  1CPR A;  1OQC A;  2YZS A;  4CDA A;  4EBB A;  5KYY B;  4JJF A;  3RW0 A;  2H7O A;  3NMI A;  3CAX A;  3KYI A;  2Z15 A;  3EHN A;  1WWP A;  3JCU Q;  4OIQ F;  4JVS A;  2HS5 A;  3VRC A;  4OD5 A;  1ZHX A;  1XWJ A;  3KPH A;  3S84 A;  1CPQ A;  1QKR A;  1W2W A;  3LS0 A;  1TWC A;  2IYL D;  1KTM A;  1EKY A;  4E7S A;  2QUP A;  3EGX B;  3NKE A;  5DS5 A;  2NPU A;  2L81 A;  4LAC B;  3TOM A;  4ZLD A;  2JPU A;  3DI5 A;  2J9B A;  2GA0 A;  1QQ3 A;  2HV6 A;  2PF4 E;  2Q3T A;  4FX5 A;  3TJ5 A;  5JT4 A;  3B9Q A;  2H7V C;  4HFF B;  2RD9 A;  3E70 C;  2YVK A;  2ZPA A;  3GEE A;  4IGG A;  1JAF A;  1G5Z A;  1D0X A;  3SXM A;  2Y3D A;  4NCQ A;  3FAJ A;  1RJ9 B;  1ZYR F;  4B6I A;  4BJ5 A;  5EK0 A;  3J06 A;  4OIP F;  2R7U A;  1NU7 D;  4CX9 A;  3X2Q C;  2LQG A;  3MFN A;  4CS8 A;  3I5Q A;  1VMA A;  4JC7 A;  3X1O A;  3UMH A;  5JS5 A;  4JKV A;  5T3T A;  5L3V A;  1YJG A;  5COG A;  1APC A;  3DAG A;  3L1M A;  3DJN B;  3V5Z A;  2ASR A;  3B71 A;  4GYT A;  4MTF A;  3NYJ A;  4MVR A;  4YK5 A;  5L3Q A;  2EPL X;  1C02 A;  3RYL A;  5GPG B;  2I15 A;  1NG1 A;  2WVO A;  4BEJ A;  1LI5 A;  5F5H A;  5B3S C;  4WJ0 A;  4BJT A;  1WGW A;  3AJM A;  3T6B A;  1HE9 A;  1NLX A;  3SXY A;  2NUP B;  2DGJ A;  1VYI A;  3F46 A;  3JSE O;  2R7O A;  2OKU A;  3GM3 A;  4FES A;  4OIO F;  2IXN A;  4GQH A;  5A6A A;  4AE4 B;  3IPM O;  5B1B C;  2OJE D;  4I3M A;  1H7I A;  1Y6D A;  1WOL A;  3JSZ A;  3N0T A;  1OCZ C;  1Q0D A;  4FWV A;  3I4U A;  1D0Y A;  4YL0 A;  4JCZ A;  3KYJ A;  3T9O A;  2YL1 A;  2HZ8 A;  2HJM A;  1RKE B;  1EQ1 A;  2W9Y A;  1Z5Z A;  1PD1 A;  3PMR A;  4U5C E;  5CI9 A;  4D4N A;  4EHP A;  3HKK A;  4LDQ A;  3I5P A;  4DJ9 A;  4RBN A;  2NUT A;  3PCV A;  3M1C B;  2R7X A;  3M15 A;  2Q9A A;  4PJM A;  4YL3 A;  2ZXR A;  1JPJ A;  1T6I A;  1WTY A;  1MQV A;  4I1O B;  2R02 A;  2Q9B A;  4LLC A;  4FAP B;  3ITF A;  1Z23 A;  1HMO A;  4C3E A;  2PFD A;  4NC3 A;  4CSA C;  4ULV A;  3RVZ A;  1MND A;  2WVQ A;  5JUA A;  1YAR O;  3LJB A;  3RFY A;  2EIJ C;  3G4Z A;  4RDA A;  3LES A;  4MVU A;  2H7B A;  2V3C C;  3GAN A;  3BEH A;  2A6H F;  5KYW A;  1BR4 A;  1A7V A;  2R9R B;  1H9T A;  2Q9C A;  3UMK A;  4DOZ A;  2XM0 A;  3T6G B;  1HE1 A;  4JTC B;  3SXZ A;  5KYX B;  5L0D A;  3VF0 A;  1V54 C;  3U8V A;  4Z9J A;  1OXK A;  3A11 A;  3EQL F;  3NMK A;  3Q6N A;  4KNV A;  5COM A;  2XLE A;  2ZD9 A;  3ZQY A;  2XS8 A;  5DQZ A;  1OCO C;  4CDY A;  4EBJ A;  2CYD A;  3W2W A;  3LNM B;  2OG2 A;  3ZG1 A;  2W4B A;  4C7O B;  3C8G D;  3ECS A;  1PV3 A;  1FAP B;  1M6T A;  256B A;  3LLK A;  5TJ5 E;  3GEH A;  5KYU B;  3GWN A;  1OKK D;  2VC9 A;  3C7J A;  3RQF A;  4JJG A;  3EGD B;  2C03 A;  5A6K A;  5DS4 A;  3O39 A;  2L9J A;  1HY5 A;  2P6V A;  1OCC C;  2C04 A;  1M2V A;  2XLH A;  1NFN A;  3AG4 C;  3NMJ A;  4JEB A;  2UUH A;  3B0V C;  2Q00 A;  3CZ6 A;  4G78 A;  2NSG A;  1F1M A;  4G7H F;  5T3W A;  1Z7Q c;  1WAT A;  2LK4 A;  1QPU A;  3K6B A;  3L8J A;  4ONS A;  3EGD A;  4OIN F;  4E0H A;  2A1D D;  1ZU5 A;  3NYL A;  2R7Q A;  1K05 A;  2RSE B;  3S0X A;  1Q0F A;  3EPV A;  5JLI A;  3FOP A;  2E87 A;  2IXM A;  1FR0 A;  5D92 A;  5EGY A;  3FVY A;  1PCX A;  3RQE A;  1FTS A;  4HFK B;  3EJN A;  4MVS A;  4N6C A;  3ZTM A;  5F28 E;  2PBE A;  1PD0 A;  4YT4 A;  3MBG A;  4ZLC A;  3EH1 A;  5E3A A;  2XS1 A;  2EPM X;  3ZSU A;  2OEV A;  3TUL A;  5F5F A;  5EHH A;  2EIN C;  2HV7 A;  2LP4 A;  3M4B A;  2ICW G;  1YYX A;  3RQG A;  4P6I C;  4D4X A;  3S27 A;  2IM8 A;  1TFO B;  3JZ0 A;  1K04 A;  3IEE A;  4BJ1 A;  4E7Z A;  4PFO A;  2PX3 A;  2IBF A;  3O6X A;  3C18 A;  3RVY A;  1YA7 O;  1J8M F; 
#chains in the Genus database with same CATH homology
 4E0H A;  1JR8 A;  4E0I A;  3R7C A;  3U5S A;  3U2L A;  3LLK A;  4LDK A;  3GWN A;  3GWL A;  3TK0 A;  3LLI A;  3MBG A;  3U2M A;  1OQC A;  3W4Y A;  2HJ3 A;  3O55 A;  3TD7 A;  1JRA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...