1OQCA

The crystal structure of augmenter of liver regeneration: a mammalian fad dependent sulfhydryl oxidase
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
112
structure length
112
Chain Sequence
EDCPQDREELGRNTWAFLHTLAAYYPDMPTPEQQQDMAQFIHIFSKFYPCEECAEDIRKRIDRSQPDTSTRVSFSQWLCRLHNEVNRKLGKPDFDCSRVDERWRDGWKDGSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords augmenter of liver regeneration
publication title The refined crystal structure of augmenter of liver regeneration
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
total genus 42
structure length 112
sequence length 112
chains with identical sequence B, C, D
ec nomenclature ec 1.8.3.2: Thiol oxidase.
pdb deposition date 2003-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04777 Evr1_Alr Erv1 / Alr family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.310 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) ERV/ALR sulfhydryl oxidase domain 1oqcA00
3R7CA 3O55A 3LLIA 4LDKA 2HJ3A 3MBGA 1JRAA 3W4YA 1OQCA 1JR8A 3TK0A 3LLKA 3U2MA 3U2LA 3TD7A 3U5SA 4E0HA 3GWLA 4E0IA 3GWNA
chains in the Genus database with same CATH superfamily
2D4UA 1V4AA 2J45A 4OD5A 4RDAA 4CX9A 1WTYA 5K0IA 5DS5A 3DE9A 1EQ1A 4BJ1A 1VB5A 4AL1A 1JPNA 2Q3TA 2KGOA 4JCZA 1PCXA 3IHUA 3ZWIA 2HV6A 5KYXB 3LJBA 4CJOA 5A69A 5JVEA 1Q0DA 2EILC 1ZHZA 1OKKD 2XLDA 3LESA 3W2VA 4FX5A 2EPNA 2XLHA 1TR2A 1HW2A 3G4ZA 1PV3A 1YDIA 4IARA 1RJ9B 4MTFA 3ZDLA 3LNMB 4BEJA 5BQIA 4OIQF 3HJCA 5A6KA 3S0XA 4N6CA 3J06A 3SXKA 1YZAA 5L3VA 2X51A 4FESA 5DS4A 3N0TA 1C17M 3M15A 3M79A 3OEOA 1TFKB 3A11A 4C3DA 5KYWA 4PJNA 1QSPA 2D5RB 5JLIA 5COMA 2GFHA 2DB4A 2NG1A 3C8GA 3NMJA 4HE8D 1LVKA 3VRCA 3ZIBA 3WHNA 5DQZA 2LQGA 2G3VA 2HJ3A 4CBEA 3AOUA 1BBHA 1VOMA 4ANJA 1GM5A 3WODF 4I1MA 2XL8A 1OCRC 1HW1A 4JJFA 2VCBA 4K1OA 3W2WA 2ICWG 2QNLA 2I8BA 4IAQA 3RQGA 2KK1A 3TOLA 4DRIB 1E85A 3EG9A 1CGOA 4XTKA 3K1HA 4OIRF 2NUPB 3JRMO 1RKEB 4XLNF 4CS9C 5GPGB 4ER9A 2GAQA 3T6BA 3QTHA 5JUAA 5CI8A 5L0HA 3QW1A 4O7GA 1OW7A 4CS8C 3AG4C 2OEVA 4WJ0A 1WOLA 1I4YA 2PFDA 1H9GA 3PHF2 3U3BA 2XS1A 1Y4CA 3T6GB 3NYLA 2A68F 3BEHA 1BZ4A 3M4BA 1CPQA 2A0UA 3VF0A 1M2VA 3LLIA 4YK5A 3Q6NA 4MVMA 1HMOA 4CS9A 2L7AA 2XM0A 2L81A 3QZCA 1NLXA 2ETSA 4YT4A 4CS8A 4I44A 1K04A 1YLMA 3B29A 2HUJA 4QI0A 3ZG1A 2X0CA 2Q9CA 2P7VA 1E83A 2W4BA 1Z3IX 3ABLC 2A6HF 4BJ6A 1ZW3A 2EINC 2H7VC 1VLTA 1HE1A 2MHRA 4ULVA 1D0ZA 2JX0A 3HKKA 2V3CC 2HKVA 3EJNA 2YLDA 4MVQA 3TD7A 2VASA 1O3UA 1S05A 3VAYA 3CEXA 4JTAB 1XZQA 4YT5A 2AWYA 3FAJA 1LS4A 3ASNC 3K1IC 4Z9JA 3ZSUA 2HV7A 1YA9A 5F5HA 2Y3BA 2OKUA 4KNVA 1Q0MA 3UGPA 2YL7A 3CSKA 3C18A 3NDBB 1YJGA 3S29A 2UUIA 4OINF 3ZQVA 1LPEA 3ITFA 1NG1A 1V55C 4U5EE 2YRFA 3GEIA 2W9YA 3JCUQ 1D0XA 1M56C 3WAQA 1SF8A 3W4YA 3V5ZA 1EI7A 2BL2A 4JW1A 4DRJB 5IY5C 2LCHA 3L34A 3B71A 3PMRA 2WZGA 4GEHA 5CI9A 3ZC4A 1OW6A 3ZQYA 3RKOF 4DVZA 1QKRA 1S7ZA 3V7OA 3IPMO 1LI5A 3DE8A 4EWCA 2CDQA 3F47A 1XWJA 2TMVP 4AK9A 4OD4A 2QLAA 1A7EA 2ZD9A 3HNKA 1B68A 1MMDA 2R7VA 1FFHA 1LE2A 3H65A 3SXYA 2AP3A 2YLIA 2YL3A 2UUHA 4GYTA 4YL1A 3JRTA 4BJTA 2PNOA 3M4CA 4M63A 1GS9A 3AQBA 4DOZA 2EIMC 5EK0A 3PDMP 2R7WA 1J8YF 1VMAA 2AVKA 1G8XA 3DMDA 5DLJA 3MBGA 2IXMA 4PJMA 3T6JA 2Q9BA 2C03A 1H6GA 4IAOA 4QI2A 3L8IA 4B6IA 3LEVA 4E7ZA 3JSZA 3FOPA 1EKYA 3U8PA 1ZU4A 2XL6A 2Y3HA 4N4WA 1U6HA 3F46A 4R32A 4AE4B 4YL0A 5KYNA 2Z15A 3ZVRA 4KC9A 2WB7A 3EH1A 3Q7LA 3NMKA 4CDYA 2R7RA 3NYMA 2BE5F 3RVZA 4XEVA 3QVYA 4IB4A 4NTAA 4MQ9F 4JRZA 1D1CA 2DYRC 3GODA 2IBFA 4MVSA 3UMIA 4AL0A 4LDKA 4ZLCA 4O6MA 1VTMP 2RSEB 1RMVA 4UDVA 1M2OA 3EFOB 4WGZA 5T1DB 1IW7F 1J8MF 4Z9HA 1OCOC 1Z7Qc 1OQCA 3VYWA 1LS1A 2Q9AA 2VB6A 5T3TA 2YL1A 2IYLD 3T4RA 4D4XA 4XEFA 3L1MA 5L3QA 1APCA 5E33A 3W8HA 3S84A 2WZFA 3WG7C 1ORYA 1BDJB 2LP4A 2QTVA 3US6A 4JIOA 4E7SA 5KYUB 4NY3A 4YN0B 1I5NA 1F1MA 2R7OA 3DD7A 1G4US 3DXJF 3A9CA 3HNJA 4NTFA 5B1BC 5KYYA 4BPMA 2W45A 3RW0A 3G50A 2NUTB 2OU6A 1YARO 4WGYA 2OEXA 3EGXA 2PP4A 4C3EA 1TWGA 4MNDA 4U5BE 1OXKA 1O5HA 3UGOA 3KYJA 4IJJA 2NUPA 3MYIA 4LDRA 4PJLA 3IQ6A 4FAPB 3SNHA 3EGDA 2Y3DA 2L6FA 4HEAJ 2XSEA 4LACB 4PFOA 2IOQA 2P6VA 1OW8A 3DJUB 4MTGA 4DJ9A 256BA 1D1BA 2PX3A 2XXAA 4CDVA 1JPJA 2ZPAA 1E2XA 3OWTA 4J32B 3U2MA 1OKKA 3X1OA 2AWCA 2KSFA 1ZU5A 4JVSA 3KKBA 3HTKC 1SYQA 3I4UA 3LUTB 1CGNA 2GWWA 3MLGA 3UMHA 1ZW2A 5JT4A 3DJNB 4X0RA 1A0BA 1R5ID 2IXOA 3FXHA 4IGGA 2JPUA 3GM2A 4KNWA 2RD9A 5L0CA 2Y3GA 2ZXOA 3IQ5A 4J7YA 1O87A 2XLWA 1JAFA 3HNLA 1M57C 5EHHA 1NU7D 2DYSC 3FVYA 4E18A 1NSGB 4YT8A 1RCPA 3SXZA 1HMDA 3B9QA 4JEBA 3RH3A 1ZHWA 3DAGA 2CGEA 2EPKX 3X2QC 1LM3B 1T01A 2WVOA 3C8GB 3NRHA 4XLPF 1UFBA 5L0FA 1Z63A 2OJED 4DBRA 2YVKA 1QZXA 2L6HA 3AJMA 1KNYA 4LDQA 2AU5A 2J9WA 3RQEA 3EZIA 1NFOA 1NZEA 3IEEA 3IQTA 1SZIA 4QDLA 2JD3A 3JYHA 5F5FA 1IZMA 3BRJA 5HSWA 2R7TA 2XS8A 1C03A 1TWHA 4I1OB 1GQAA 4YL3A 5T3WA 4D4NA 2C04A 1MQVA 4U5DE 1H9TA 2NSFA 5DQTA 1T9KA 1U89A 3Q6MA 1C02A 2J8WA 1G5ZA 3IQCA 2YKZA 3C62A 4MVUA 3RVYA 4EBJA 4YT2A 2HFIA 3CQZA 1DOWA 5L0IA 2XLVA 4DBQA 1SMYF 2LFFA 2KC3A 1N1CA 2HMZA 3AG1C 3GM3A 3K1IA 3NG1A 1Z5ZA 3T9OA 1BR1A 1Q0KA 4Q4ZF 3SXMA 1Z23A 2EPLX 3M1CB 4K0DA 2E87A 3L8JA 4CIPA 2EPMX 4H4KC 2J46A 2YWAA 5HV9A 4C7OB 5EGYA 1OXBA 4BJ5C 2QUPA 2F22A 3GWLA 3JZ0A 4CDAA 4W8KA 4EHPA 1ZYRF 3MYFA 3KH2A 3AQCA 2IXNA 5B3SC 3DM5A 2YHSA 3G4XA 1TWAA 5FZTA 4XPXA 3FHDA 2KYHA 1K05A 3Q7GA 4JC7A 5AC4A 3ZTMA 4AE4A 4DVYP 1MMNA 2FFHA 3NKDA 3O39A 1WASA 1XZPA 4PJJA 1I4ZA 2J7PD 2KNHA 1ZZPA 4RBNA 1LKXA 4MVRA 5AGFA 3JSEO 2LK4A 2Y39A 3QW0A 4MVOA 3QVZA 5DVWA 1W2WA 2R7XA 1DOVA 1YZCA 4GQHA 1Q0GA 4JJGA 3TJ5A 4E0HA 1NFNA 2VC9A 4RD9A 4DXWA 5CIVA 1PD1A 1ORJA 3S27A 1Z6AA 4AX2A 1A7VA 3AGTA 4LLEA 5KYXA 1VK5A 3NMIA 5L0DA 4JEAA 4BEMJ 2CYDA 3GWNA 1HE9A 1K40A 3EHNA 4FWVA 3SYNA 2WZLA 1MNDA 4LERA 5COFA 1MMGA 3ABMC 3AGUA 1RJ9A 4PK4A 2YQYA 1RXQA 2XLMA 1SR2A 2J9BA 2O9XA 2XLEA 3ASOC 3U3FA 3RYLA 2KW3C 3V5YA 3POVA 2MWQA 2Q00A 4U5FE 2PX0A 3ZTZA 4G0HA 4KBLA 3SZRA 2EIJC 5A6BD 1TQGA 4YWQA 2HSBA 1Y6DA 2HZ8A 1UG7A 2M64A 2OJQA 1WGWA 2B0HA 2ZXPA 4XEKA 1ZHYA 4IRUA 4W8PA 1WATA 3ECSA 2R03A 2BC5A 3C8GD 3TQOA 1ZHTA 4N06A 2ZXRA 2YZSA 5COGA 4G7HF 4I3MA 1WN0A 4EUKB 1OR3A 2Q4FA 3JYYA 1TWCA 3LAYA 3KL4A 5JRAA 1G4WR 4G78A 3MX3A 5JP7A 2J0WA 1WWPA 2LFDA 3EPVA 4E17A 1RKEA 1QVXA 1GGQA 3GM1A 4C3BA 1LIHA 2WVNA 4U5GA 2GDCA 3LEOA 3FMSA 2R25A 2IM8A 2Y69C 3AG2C 1D0YA 3ATPA 2W4MA 1VLSA 3C7JA 2HJMA 4U9DA 3U2LA 5BQHA 5A6BA 5JSLA 2VH3A 5E3CA 3KYIA 3U5SA 2PF4E 5L0GA 1AEPA 1D1AA 1MMAA 2M4EA 5E2QA 4OIPF 3DM9B 2Q7RA 5TJ5E 1FR0A 1OCCC 1NU9C 2J0XA 3GEHA 2A0BA 1KU2A 3K66A 3QMKA 4EBKA 2QE9A 3CZ6A 2R05A 2OG2A 3HLZA 3I5PA 4NTBA 4Z9IA 3RIPA 2QY9A 1NBBA 1ST6A 4F4BA 5DS6A 1HY5A 4MW3A 5KYYB 1KTMA 5KYWB 2R9RB 5BQGA 5B3IA 5A6AA 2H8AA 2ZXWC 1T6QA 4JE9A 4XPYA 1JMWA 2B0JA 2V26A 4JCHA 1Q0FA 4H54A 2J9VA 2L6GA 3E70C 4P9TA 3EGXB 4G7ZF 5E3AA 2IXPA 3FAPB 3MFNA 1JR8A 5F28E 2A6EF 3TJ6A 1ORSC 3OA1A 2YEVA 2XL4A 3EGDB 1R4TA 3K33A 4PACA 3AG3C 2MYSA 5L0JA 2XXAB 1LI7A 4MS2A 4BG0A 3K7DA 1JOGA 1FFTC 1TFOB 4LLCA 2I15A 3EG9B 4K7BA 4L6RA 4O6YA 1AVOB 4JURI 1L3PA 3NYJA 4BJ6C 1V74B 1FNTc 4EBBA 4MW8A 1E84A 2CNWD 4PR9A 3O55A 2XLOA 3R7CA 2ASRA 4ZLDA 4U5CE 5A6JA 3UNGC 4XWJA 1M6TA 4C7OA 5BUOA 1A41A 4ONSA 3UR3C 2GA0A 4MTOA 1T6UA 1QPUA 3B0PA 3N24A 1ZHXA 1M2VB 4J30B 3SEOA 1FTSA 1LE4A 3EHMA 5B1AC 4EIYA 1QQ3A 1YA7O 2PBEA 3LLKA 1CGME 2R7SA 2NSGA 2KJGA 4XPWA 4BJ5A 1L7CA 3LNRA 4NCQA 4EKWA 1OR2A 4U9EA 3DI5A 4NQFA 1VYIA 2HMQA 2WL8A 3I5QA 3EH2A 1BR4A 1RKCA 4CIHA 2R02A 4HFFB 1YAUO 2KQ9A 1PD0A 4N6HA 3RFYA 3H2VA 2HS5A 1ZVZA 1E86A 1T6IA 3H2UA 2EPOA 1CPRA 2R7QA 1A7DA 2P1AA 3ABKC 4MVZA 2CNWA 3N2ZB 4P6IC 1YYJA 4ULWA 4XQ1A 2OQMA 3LS1A 2CW0F 4JTCB 3UMKA 2L9JA 3L0IA 4OIOF 3E9VA 3GORA 2YL0A 1T5OA 2A69F 2HSQA 4CJGA 3O6XA 4NC3A 5D92A 1FAPB 3EZHA 4Q5SF 2H7BA 3GEEA 3KPHA 2FAPB 1YYXA 1TKNA 2LIGA 2P61A 3PCVA 4U5HA 3U9JA 3FDQA 5AC5A 2OOCA 1OCZC 3TULA 1EA8A 2XRHA 2YLGA 3DWWA 3DAFA 1YVIA 4DRHB 4JTDB 3NKEA 2FGYA 2OCCC 3DKAA 2VCAA 2DI3A 3C63A 3EFOA 4O6NA 3B0VC 4KI2A 4G7OF 4E0IA 4P9FA 2J9UA 2CCYA 2WVQA 4Q7CA 3VM6A 5D91A 1U0BB 4JKVA 2LD6A 3EQLF 1FMVA 1H7IA 3W8IA 4IWBA 2LSEA 2NPUA 3RF3A 2VCCA 4CS7A 3O10A 4A2NB 3JTLO 3JT1A 1JRAA 3LS0A 5KYUA 4A4AA 2P0NA 4HFKB 3RQFA 4J7TA 3HNIA 4CSAC 1VYKA 2R7UA 3DZAA 2J7PA 2XM4A 3GANA 2G62A 4WABA 3TK0A 4PFPA 3KMIA 3S9OA 2A1DD 1FMWA 2EIKC 3R2PA 1V54C 3SP1A 1QLEC 1AUEA 3K6BA 4YJWA 3CAXA 2NUTA 3B0UX 2DGJA 3S90A 3TOMA 2G3KA 1MNEA 4O79A 5FCLA 1BR2A 3FOOA 4JZAA 3S28A 3C8ZA 3U8VA 3V5XA 5JS5A 3U0CA 2H7OA 4CSAA 3U9MA
chains in the Genus database with same CATH topology
3R7CA 3O55A 3LLIA 4LDKA 2HJ3A 3MBGA 1JRAA 3W4YA 1OQCA 1JR8A 3TK0A 3LLKA 3U2MA 3U2LA 3TD7A 3U5SA 4E0HA 3GWLA 4E0IA 3GWNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R7C A;  3O55 A;  3LLI A;  4LDK A;  2HJ3 A;  3MBG A;  1JRA A;  3W4Y A;  1OQC A;  1JR8 A;  3TK0 A;  3LLK A;  3U2M A;  3U2L A;  3TD7 A;  3U5S A;  4E0H A;  3GWL A;  4E0I A;  3GWN A; 
#chains in the Genus database with same CATH topology
 2D4U A;  1V4A A;  2J45 A;  4OD5 A;  4RDA A;  4CX9 A;  1WTY A;  5K0I A;  5DS5 A;  3DE9 A;  1EQ1 A;  4BJ1 A;  1VB5 A;  4AL1 A;  1JPN A;  2Q3T A;  2KGO A;  4JCZ A;  1PCX A;  3IHU A;  3ZWI A;  2HV6 A;  5KYX B;  3LJB A;  4CJO A;  5A69 A;  5JVE A;  1Q0D A;  2EIL C;  1ZHZ A;  1OKK D;  2XLD A;  3LES A;  3W2V A;  4FX5 A;  2EPN A;  2XLH A;  1TR2 A;  1HW2 A;  3G4Z A;  1PV3 A;  1YDI A;  4IAR A;  1RJ9 B;  4MTF A;  3ZDL A;  3LNM B;  4BEJ A;  5BQI A;  4OIQ F;  3HJC A;  5A6K A;  3S0X A;  4N6C A;  3J06 A;  3SXK A;  1YZA A;  5L3V A;  2X51 A;  4FES A;  5DS4 A;  3N0T A;  1C17 M;  3M15 A;  3M79 A;  3OEO A;  1TFK B;  3A11 A;  4C3D A;  5KYW A;  4PJN A;  1QSP A;  2D5R B;  5JLI A;  5COM A;  2GFH A;  2DB4 A;  2NG1 A;  3C8G A;  3NMJ A;  4HE8 D;  1LVK A;  3VRC A;  3ZIB A;  3WHN A;  5DQZ A;  2LQG A;  2G3V A;  2HJ3 A;  4CBE A;  3AOU A;  1BBH A;  1VOM A;  4ANJ A;  1GM5 A;  3WOD F;  4I1M A;  2XL8 A;  1OCR C;  1HW1 A;  4JJF A;  2VCB A;  4K1O A;  3W2W A;  2ICW G;  2QNL A;  2I8B A;  4IAQ A;  3RQG A;  2KK1 A;  3TOL A;  4DRI B;  1E85 A;  3EG9 A;  1CGO A;  4XTK A;  3K1H A;  4OIR F;  2NUP B;  3JRM O;  1RKE B;  4XLN F;  4CS9 C;  5GPG B;  4ER9 A;  2GAQ A;  3T6B A;  3QTH A;  5JUA A;  5CI8 A;  5L0H A;  3QW1 A;  4O7G A;  1OW7 A;  4CS8 C;  3AG4 C;  2OEV A;  4WJ0 A;  1WOL A;  1I4Y A;  2PFD A;  1H9G A;  3PHF 2;  3U3B A;  2XS1 A;  1Y4C A;  3T6G B;  3NYL A;  2A68 F;  3BEH A;  1BZ4 A;  3M4B A;  1CPQ A;  2A0U A;  3VF0 A;  1M2V A;  3LLI A;  4YK5 A;  3Q6N A;  4MVM A;  1HMO A;  4CS9 A;  2L7A A;  2XM0 A;  2L81 A;  3QZC A;  1NLX A;  2ETS A;  4YT4 A;  4CS8 A;  4I44 A;  1K04 A;  1YLM A;  3B29 A;  2HUJ A;  4QI0 A;  3ZG1 A;  2X0C A;  2Q9C A;  2P7V A;  1E83 A;  2W4B A;  1Z3I X;  3ABL C;  2A6H F;  4BJ6 A;  1ZW3 A;  2EIN C;  2H7V C;  1VLT A;  1HE1 A;  2MHR A;  4ULV A;  1D0Z A;  2JX0 A;  3HKK A;  2V3C C;  2HKV A;  3EJN A;  2YLD A;  4MVQ A;  3TD7 A;  2VAS A;  1O3U A;  1S05 A;  3VAY A;  3CEX A;  4JTA B;  1XZQ A;  4YT5 A;  2AWY A;  3FAJ A;  1LS4 A;  3ASN C;  3K1I C;  4Z9J A;  3ZSU A;  2HV7 A;  1YA9 A;  5F5H A;  2Y3B A;  2OKU A;  4KNV A;  1Q0M A;  3UGP A;  2YL7 A;  3CSK A;  3C18 A;  3NDB B;  1YJG A;  3S29 A;  2UUI A;  4OIN F;  3ZQV A;  1LPE A;  3ITF A;  1NG1 A;  1V55 C;  4U5E E;  2YRF A;  3GEI A;  2W9Y A;  3JCU Q;  1D0X A;  1M56 C;  3WAQ A;  1SF8 A;  3W4Y A;  3V5Z A;  1EI7 A;  2BL2 A;  4JW1 A;  4DRJ B;  5IY5 C;  2LCH A;  3L34 A;  3B71 A;  3PMR A;  2WZG A;  4GEH A;  5CI9 A;  3ZC4 A;  1OW6 A;  3ZQY A;  3RKO F;  4DVZ A;  1QKR A;  1S7Z A;  3V7O A;  3IPM O;  1LI5 A;  3DE8 A;  4EWC A;  2CDQ A;  3F47 A;  1XWJ A;  2TMV P;  4AK9 A;  4OD4 A;  2QLA A;  1A7E A;  2ZD9 A;  3HNK A;  1B68 A;  1MMD A;  2R7V A;  1FFH A;  1LE2 A;  3H65 A;  3SXY A;  2AP3 A;  2YLI A;  2YL3 A;  2UUH A;  4GYT A;  4YL1 A;  3JRT A;  4BJT A;  2PNO A;  3M4C A;  4M63 A;  1GS9 A;  3AQB A;  4DOZ A;  2EIM C;  5EK0 A;  3PDM P;  2R7W A;  1J8Y F;  1VMA A;  2AVK A;  1G8X A;  3DMD A;  5DLJ A;  3MBG A;  2IXM A;  4PJM A;  3T6J A;  2Q9B A;  2C03 A;  1H6G A;  4IAO A;  4QI2 A;  3L8I A;  4B6I A;  3LEV A;  4E7Z A;  3JSZ A;  3FOP A;  1EKY A;  3U8P A;  1ZU4 A;  2XL6 A;  2Y3H A;  4N4W A;  1U6H A;  3F46 A;  4R32 A;  4AE4 B;  4YL0 A;  5KYN A;  2Z15 A;  3ZVR A;  4KC9 A;  2WB7 A;  3EH1 A;  3Q7L A;  3NMK A;  4CDY A;  2R7R A;  3NYM A;  2BE5 F;  3RVZ A;  4XEV A;  3QVY A;  4IB4 A;  4NTA A;  4MQ9 F;  4JRZ A;  1D1C A;  2DYR C;  3GOD A;  2IBF A;  4MVS A;  3UMI A;  4AL0 A;  4LDK A;  4ZLC A;  4O6M A;  1VTM P;  2RSE B;  1RMV A;  4UDV A;  1M2O A;  3EFO B;  4WGZ A;  5T1D B;  1IW7 F;  1J8M F;  4Z9H A;  1OCO C;  1Z7Q c;  1OQC A;  3VYW A;  1LS1 A;  2Q9A A;  2VB6 A;  5T3T A;  2YL1 A;  2IYL D;  3T4R A;  4D4X A;  4XEF A;  3L1M A;  5L3Q A;  1APC A;  5E33 A;  3W8H A;  3S84 A;  2WZF A;  3WG7 C;  1ORY A;  1BDJ B;  2LP4 A;  2QTV A;  3US6 A;  4JIO A;  4E7S A;  5KYU B;  4NY3 A;  4YN0 B;  1I5N A;  1F1M A;  2R7O A;  3DD7 A;  1G4U S;  3DXJ F;  3A9C A;  3HNJ A;  4NTF A;  5B1B C;  5KYY A;  4BPM A;  2W45 A;  3RW0 A;  3G50 A;  2NUT B;  2OU6 A;  1YAR O;  4WGY A;  2OEX A;  3EGX A;  2PP4 A;  4C3E A;  1TWG A;  4MND A;  4U5B E;  1OXK A;  1O5H A;  3UGO A;  3KYJ A;  4IJJ A;  2NUP A;  3MYI A;  4LDR A;  4PJL A;  3IQ6 A;  4FAP B;  3SNH A;  3EGD A;  2Y3D A;  2L6F A;  4HEA J;  2XSE A;  4LAC B;  4PFO A;  2IOQ A;  2P6V A;  1OW8 A;  3DJU B;  4MTG A;  4DJ9 A;  256B A;  1D1B A;  2PX3 A;  2XXA A;  4CDV A;  1JPJ A;  2ZPA A;  1E2X A;  3OWT A;  4J32 B;  3U2M A;  1OKK A;  3X1O A;  2AWC A;  2KSF A;  1ZU5 A;  4JVS A;  3KKB A;  3HTK C;  1SYQ A;  3I4U A;  3LUT B;  1CGN A;  2GWW A;  3MLG A;  3UMH A;  1ZW2 A;  5JT4 A;  3DJN B;  4X0R A;  1A0B A;  1R5I D;  2IXO A;  3FXH A;  4IGG A;  2JPU A;  3GM2 A;  4KNW A;  2RD9 A;  5L0C A;  2Y3G A;  2ZXO A;  3IQ5 A;  4J7Y A;  1O87 A;  2XLW A;  1JAF A;  3HNL A;  1M57 C;  5EHH A;  1NU7 D;  2DYS C;  3FVY A;  4E18 A;  1NSG B;  4YT8 A;  1RCP A;  3SXZ A;  1HMD A;  3B9Q A;  4JEB A;  3RH3 A;  1ZHW A;  3DAG A;  2CGE A;  2EPK X;  3X2Q C;  1LM3 B;  1T01 A;  2WVO A;  3C8G B;  3NRH A;  4XLP F;  1UFB A;  5L0F A;  1Z63 A;  2OJE D;  4DBR A;  2YVK A;  1QZX A;  2L6H A;  3AJM A;  1KNY A;  4LDQ A;  2AU5 A;  2J9W A;  3RQE A;  3EZI A;  1NFO A;  1NZE A;  3IEE A;  3IQT A;  1SZI A;  4QDL A;  2JD3 A;  3JYH A;  5F5F A;  1IZM A;  3BRJ A;  5HSW A;  2R7T A;  2XS8 A;  1C03 A;  1TWH A;  4I1O B;  1GQA A;  4YL3 A;  5T3W A;  4D4N A;  2C04 A;  1MQV A;  4U5D E;  1H9T A;  2NSF A;  5DQT A;  1T9K A;  1U89 A;  3Q6M A;  1C02 A;  2J8W A;  1G5Z A;  3IQC A;  2YKZ A;  3C62 A;  4MVU A;  3RVY A;  4EBJ A;  4YT2 A;  2HFI A;  3CQZ A;  1DOW A;  5L0I A;  2XLV A;  4DBQ A;  1SMY F;  2LFF A;  2KC3 A;  1N1C A;  2HMZ A;  3AG1 C;  3GM3 A;  3K1I A;  3NG1 A;  1Z5Z A;  3T9O A;  1BR1 A;  1Q0K A;  4Q4Z F;  3SXM A;  1Z23 A;  2EPL X;  3M1C B;  4K0D A;  2E87 A;  3L8J A;  4CIP A;  2EPM X;  4H4K C;  2J46 A;  2YWA A;  5HV9 A;  4C7O B;  5EGY A;  1OXB A;  4BJ5 C;  2QUP A;  2F22 A;  3GWL A;  3JZ0 A;  4CDA A;  4W8K A;  4EHP A;  1ZYR F;  3MYF A;  3KH2 A;  3AQC A;  2IXN A;  5B3S C;  3DM5 A;  2YHS A;  3G4X A;  1TWA A;  5FZT A;  4XPX A;  3FHD A;  2KYH A;  1K05 A;  3Q7G A;  4JC7 A;  5AC4 A;  3ZTM A;  4AE4 A;  4DVY P;  1MMN A;  2FFH A;  3NKD A;  3O39 A;  1WAS A;  1XZP A;  4PJJ A;  1I4Z A;  2J7P D;  2KNH A;  1ZZP A;  4RBN A;  1LKX A;  4MVR A;  5AGF A;  3JSE O;  2LK4 A;  2Y39 A;  3QW0 A;  4MVO A;  3QVZ A;  5DVW A;  1W2W A;  2R7X A;  1DOV A;  1YZC A;  4GQH A;  1Q0G A;  4JJG A;  3TJ5 A;  4E0H A;  1NFN A;  2VC9 A;  4RD9 A;  4DXW A;  5CIV A;  1PD1 A;  1ORJ A;  3S27 A;  1Z6A A;  4AX2 A;  1A7V A;  3AGT A;  4LLE A;  5KYX A;  1VK5 A;  3NMI A;  5L0D A;  4JEA A;  4BEM J;  2CYD A;  3GWN A;  1HE9 A;  1K40 A;  3EHN A;  4FWV A;  3SYN A;  2WZL A;  1MND A;  4LER A;  5COF A;  1MMG A;  3ABM C;  3AGU A;  1RJ9 A;  4PK4 A;  2YQY A;  1RXQ A;  2XLM A;  1SR2 A;  2J9B A;  2O9X A;  2XLE A;  3ASO C;  3U3F A;  3RYL A;  2KW3 C;  3V5Y A;  3POV A;  2MWQ A;  2Q00 A;  4U5F E;  2PX0 A;  3ZTZ A;  4G0H A;  4KBL A;  3SZR A;  2EIJ C;  5A6B D;  1TQG A;  4YWQ A;  2HSB A;  1Y6D A;  2HZ8 A;  1UG7 A;  2M64 A;  2OJQ A;  1WGW A;  2B0H A;  2ZXP A;  4XEK A;  1ZHY A;  4IRU A;  4W8P A;  1WAT A;  3ECS A;  2R03 A;  2BC5 A;  3C8G D;  3TQO A;  1ZHT A;  4N06 A;  2ZXR A;  2YZS A;  5COG A;  4G7H F;  4I3M A;  1WN0 A;  4EUK B;  1OR3 A;  2Q4F A;  3JYY A;  1TWC A;  3LAY A;  3KL4 A;  5JRA A;  1G4W R;  4G78 A;  3MX3 A;  5JP7 A;  2J0W A;  1WWP A;  2LFD A;  3EPV A;  4E17 A;  1RKE A;  1QVX A;  1GGQ A;  3GM1 A;  4C3B A;  1LIH A;  2WVN A;  4U5G A;  2GDC A;  3LEO A;  3FMS A;  2R25 A;  2IM8 A;  2Y69 C;  3AG2 C;  1D0Y A;  3ATP A;  2W4M A;  1VLS A;  3C7J A;  2HJM A;  4U9D A;  3U2L A;  5BQH A;  5A6B A;  5JSL A;  2VH3 A;  5E3C A;  3KYI A;  3U5S A;  2PF4 E;  5L0G A;  1AEP A;  1D1A A;  1MMA A;  2M4E A;  5E2Q A;  4OIP F;  3DM9 B;  2Q7R A;  5TJ5 E;  1FR0 A;  1OCC C;  1NU9 C;  2J0X A;  3GEH A;  2A0B A;  1KU2 A;  3K66 A;  3QMK A;  4EBK A;  2QE9 A;  3CZ6 A;  2R05 A;  2OG2 A;  3HLZ A;  3I5P A;  4NTB A;  4Z9I A;  3RIP A;  2QY9 A;  1NBB A;  1ST6 A;  4F4B A;  5DS6 A;  1HY5 A;  4MW3 A;  5KYY B;  1KTM A;  5KYW B;  2R9R B;  5BQG A;  5B3I A;  5A6A A;  2H8A A;  2ZXW C;  1T6Q A;  4JE9 A;  4XPY A;  1JMW A;  2B0J A;  2V26 A;  4JCH A;  1Q0F A;  4H54 A;  2J9V A;  2L6G A;  3E70 C;  4P9T A;  3EGX B;  4G7Z F;  5E3A A;  2IXP A;  3FAP B;  3MFN A;  1JR8 A;  5F28 E;  2A6E F;  3TJ6 A;  1ORS C;  3OA1 A;  2YEV A;  2XL4 A;  3EGD B;  1R4T A;  3K33 A;  4PAC A;  3AG3 C;  2MYS A;  5L0J A;  2XXA B;  1LI7 A;  4MS2 A;  4BG0 A;  3K7D A;  1JOG A;  1FFT C;  1TFO B;  4LLC A;  2I15 A;  3EG9 B;  4K7B A;  4L6R A;  4O6Y A;  1AVO B;  4JUR I;  1L3P A;  3NYJ A;  4BJ6 C;  1V74 B;  1FNT c;  4EBB A;  4MW8 A;  1E84 A;  2CNW D;  4PR9 A;  3O55 A;  2XLO A;  3R7C A;  2ASR A;  4ZLD A;  4U5C E;  5A6J A;  3UNG C;  4XWJ A;  1M6T A;  4C7O A;  5BUO A;  1A41 A;  4ONS A;  3UR3 C;  2GA0 A;  4MTO A;  1T6U A;  1QPU A;  3B0P A;  3N24 A;  1ZHX A;  1M2V B;  4J30 B;  3SEO A;  1FTS A;  1LE4 A;  3EHM A;  5B1A C;  4EIY A;  1QQ3 A;  1YA7 O;  2PBE A;  3LLK A;  1CGM E;  2R7S A;  2NSG A;  2KJG A;  4XPW A;  4BJ5 A;  1L7C A;  3LNR A;  4NCQ A;  4EKW A;  1OR2 A;  4U9E A;  3DI5 A;  4NQF A;  1VYI A;  2HMQ A;  2WL8 A;  3I5Q A;  3EH2 A;  1BR4 A;  1RKC A;  4CIH A;  2R02 A;  4HFF B;  1YAU O;  2KQ9 A;  1PD0 A;  4N6H A;  3RFY A;  3H2V A;  2HS5 A;  1ZVZ A;  1E86 A;  1T6I A;  3H2U A;  2EPO A;  1CPR A;  2R7Q A;  1A7D A;  2P1A A;  3ABK C;  4MVZ A;  2CNW A;  3N2Z B;  4P6I C;  1YYJ A;  4ULW A;  4XQ1 A;  2OQM A;  3LS1 A;  2CW0 F;  4JTC B;  3UMK A;  2L9J A;  3L0I A;  4OIO F;  3E9V A;  3GOR A;  2YL0 A;  1T5O A;  2A69 F;  2HSQ A;  4CJG A;  3O6X A;  4NC3 A;  5D92 A;  1FAP B;  3EZH A;  4Q5S F;  2H7B A;  3GEE A;  3KPH A;  2FAP B;  1YYX A;  1TKN A;  2LIG A;  2P61 A;  3PCV A;  4U5H A;  3U9J A;  3FDQ A;  5AC5 A;  2OOC A;  1OCZ C;  3TUL A;  1EA8 A;  2XRH A;  2YLG A;  3DWW A;  3DAF A;  1YVI A;  4DRH B;  4JTD B;  3NKE A;  2FGY A;  2OCC C;  3DKA A;  2VCA A;  2DI3 A;  3C63 A;  3EFO A;  4O6N A;  3B0V C;  4KI2 A;  4G7O F;  4E0I A;  4P9F A;  2J9U A;  2CCY A;  2WVQ A;  4Q7C A;  3VM6 A;  5D91 A;  1U0B B;  4JKV A;  2LD6 A;  3EQL F;  1FMV A;  1H7I A;  3W8I A;  4IWB A;  2LSE A;  2NPU A;  3RF3 A;  2VCC A;  4CS7 A;  3O10 A;  4A2N B;  3JTL O;  3JT1 A;  1JRA A;  3LS0 A;  5KYU A;  4A4A A;  2P0N A;  4HFK B;  3RQF A;  4J7T A;  3HNI A;  4CSA C;  1VYK A;  2R7U A;  3DZA A;  2J7P A;  2XM4 A;  3GAN A;  2G62 A;  4WAB A;  3TK0 A;  4PFP A;  3KMI A;  3S9O A;  2A1D D;  1FMW A;  2EIK C;  3R2P A;  1V54 C;  3SP1 A;  1QLE C;  1AUE A;  3K6B A;  4YJW A;  3CAX A;  2NUT A;  3B0U X;  2DGJ A;  3S90 A;  3TOM A;  2G3K A;  1MNE A;  4O79 A;  5FCL A;  1BR2 A;  3FOO A;  4JZA A;  3S28 A;  3C8Z A;  3U8V A;  3V5X A;  5JS5 A;  3U0C A;  2H7O A;  4CSA A;  3U9M A; 
#chains in the Genus database with same CATH homology
 3R7C A;  3O55 A;  3LLI A;  4LDK A;  2HJ3 A;  3MBG A;  1JRA A;  3W4Y A;  1OQC A;  1JR8 A;  3TK0 A;  3LLK A;  3U2M A;  3U2L A;  3TD7 A;  3U5S A;  4E0H A;  3GWL A;  4E0I A;  3GWN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...