1OQCA

The crystal structure of augmenter of liver regeneration: a mammalian fad dependent sulfhydryl oxidase
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
112
structure length
112
Chain Sequence
EDCPQDREELGRNTWAFLHTLAAYYPDMPTPEQQQDMAQFIHIFSKFYPCEECAEDIRKRIDRSQPDTSTRVSFSQWLCRLHNEVNRKLGKPDFDCSRVDERWRDGWKDGSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords augmenter of liver regeneration
publication title The refined crystal structure of augmenter of liver regeneration
pubmed doi rcsb
source organism Rattus norvegicus
total genus 42
structure length 112
sequence length 112
chains with identical sequence B, C, D
ec nomenclature ec 1.8.3.2: Thiol oxidase.
pdb deposition date 2003-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04777 Evr1_Alr Erv1 / Alr family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.310 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) ERV/ALR sulfhydryl oxidase domain 1oqcA00
1JR8A 1JRAA 3GWLA 4E0HA 3U2LA 3R7CA 3O55A 2HJ3A 3TK0A 3LLIA 1OQCA 4LDKA 3U2MA 3GWNA 3LLKA 3MBGA 3W4YA 3U5SA 4E0IA 3TD7A
chains in the Genus database with same CATH superfamily
4KI2A 3RVZA 4P9FA 1U89A 3C8GA 3U9MA 1Q0FA 2JX0A 2XL4A 5JS5A 3KH2A 5JLIA 2GAQA 2J9VA 3AG3C 3M4BA 2XM0A 1G5ZA 3HNJA 2Z15A 4O6NA 4X0RA 1WATA 1LI5A 3ZTMA 1R5ID 1OXKA 2WZLA 1BR2A 1I5NA 1WOLA 1Y4CA 1YVIA 2DI3A 1ZHWA 4XPWA 1QKRA 4YT5A 3C8GB 5COFA 2NUTA 2J0XA 2R7UA 4JVSA 4YK5A 4DOZA 5FCLA 5BQIA 1YLMA 4E18A 4JJGA 3S84A 3LESA 1VMAA 2XS1A 4K7BA 1T9KA 3I5QA 3NYLA 4OD5A 2EPKX 1NZEA 1M6TA 2XLVA 1LM3B 1RKEA 2R05A 2PX0A 4U5BE 5JRAA 2PF4E 2NUTB 2L6HA 1Q0GA 2KJGA 2OQMA 3EGDA 1QZXA 1R4TA 1G4WR 1NLXA 3U2LA 1OKKD 3K1HA 2WVOA 2C04A 2YHSA 1O5HA 1CGOA 3IHUA 4U5DE 1YJGA 1RKEB 1ZZPA 3QZCA 3QMKA 5TJ5E 1FNTc 1OKKA 1KNYA 1GS9A 3ITFA 5L0GA 2EPMX 4JTCB 2ZD9A 3NYMA 1S7ZA 3BRJA 2H8AA 1WWPA 2W9YA 2ZPAA 2O9XA 1VYIA 1W2WA 4MTFA 1FMWA 1K40A 4BJ6C 3IQCA 1JPNA 3FOPA 4CDYA 3ASOC 3EH2A 1D1BA 1YZAA 4K0DA 1Q0KA 5K0IA 2E87A 5L0DA 2LFFA 4BEMJ 4JZAA 4JEAA 3IQ5A 4YL0A 2OG2A 2P6VA 3JZ0A 1H9TA 1NG1A 5COGA 4G7OF 3SXKA 5B3IA 1V4AA 2IXOA 3R2PA 4ULVA 2X0CA 2OKUA 1QVXA 3QW0A 2YWAA 2IXMA 3DKAA 1E86A 1G4US 2ZXOA 2G3VA 2OCCC 2LCHA 3L8JA 1ORSC 4I44A 4XEFA 3DWWA 1RJ9A 3HNKA 2NSFA 3LLKA 5DQZA 4DVYP 5HSWA 2Y3HA 1E84A 3OA1A 1TFKB 2FFHA 2L6FA 4JKVA 3RYLA 3TD7A 1WTYA 2L6GA 3DMDA 3S29A 5AGFA 3ABMC 1A41A 4G78A 3TOLA 4O6MA 4CDVA 2HSQA 3SXMA 1Z63A 3JTLO 3O39A 4KNWA 2LD6A 4DVZA 2VH3A 1LPEA 1VB5A 3JRTA 1Z23A 2HMQA 1NU7D 2L9JA 2HJ3A 1RJ9B 2DYRC 2P0NA 2QY9A 3GEEA 4J32B 3QW1A 3MYIA 5COMA 1ZYRF 1NFOA 3SEOA 4IAQA 4CBEA 2RSEB 4EUKB 2XXAA 1BR4A 2V26A 4WJ0A 1APCA 3K66A 5AC5A 2VCBA 4JCZA 4C3DA 1ORJA 2GDCA 3NMIA 2CDQA 1M2VA 3NRHA 4EBKA 4BJ6A 3JRMO 1ZHXA 3H2VA 5DQTA 3NDBB 2CNWD 3TQOA 3VRCA 2A69F 2KYHA 3DM9B 3W4YA 5F5HA 3S90A 1BZ4A 4OIOF 3QTHA 1SZIA 1YZCA 5KYUA 4XLNF 3S28A 2J9WA 1Z5ZA 2R02A 2UUHA 3FAJA 4PJMA 4PK4A 3U8PA 4NTAA 2CNWA 2W4MA 2OJED 4HFKB 2LP4A 3DAFA 2CGEA 1M2VB 2LK4A 3T9OA 2LSEA 5A69A 3Q6MA 4U5HA 1I4YA 3PDMP 3GM1A 3ZWIA 4CS7A 2IM8A 2LIGA 2Y3BA 1M57C 4DRIB 4CDAA 3MYFA 4ER9A 4YT8A 4C7OA 5KYUB 1MQVA 4E7ZA 1E83A 4PJJA 2KGOA 3GM2A 3HKKA 4NTBA 5L3QA 1A7VA 5A6KA 5A6JA 4DRJB 3CSKA 3WODF 4FESA 4HFFB 1VYKA 1MMNA 4K1OA 2C03A 4RDAA 3SZRA 4MW8A 3U3FA 4RD9A 2NSGA 1IZMA 4H4KC 2Y69C 1FFTC 2XLWA 2Y3GA 3QVYA 5JT4A 1Z6AA 4C7OB 1Z3IX 1NU9C 2VASA 3EH1A 4BJTA 2HV7A 4DXWA 3U8VA 3FHDA 2HZ8A 4JC7A 2I8BA 3B9QA 4NCQA 1KTMA 4J30B 1QLEC 1UFBA 2TMVP 1Y6DA 3GODA 3EG9A 1VLSA 1MMGA 5CI8A 4CJGA 4D4NA 4DBRA 3T6GB 5KYWA 3NMKA 2GWWA 5JP7A 5L0IA 1ZHZA 3WG7C 5GPGB 4YN0B 2R9RB 2WL8A 4F4BA 3WAQA 4QDLA 2Q3TA 5KYXA 1SYQA 2EIJC 3S27A 5FZTA 2A0BA 5T3WA 2R7RA 2M4EA 2QE9A 3IQ6A 2OEVA 2PP4A 4CJOA 3IQTA 1V54C 5CIVA 3ZG1A 5BUOA 3EG9B 4BEJA 4QI0A 3ATPA 1EA8A 4MQ9F 2ZXWC 3DJNB 3JYYA 5E3AA 4IGGA 1EI7A 5EHHA 5KYWB 2J0WA 3UGPA 4MVOA 4C3EA 1IW7F 4JRZA 1FR0A 2PNOA 3W2VA 1V55C 1J8MF 3UMKA 5KYXB 3O6XA 1RMVA 3DXJF 3T6BA 2GA0A 3UGOA 1K04A 3ZIBA 3UNGC 2YQYA 4H54A 2ETSA 3RKOF 2LQGA 1FTSA 3A11A 4Q4ZF 1OW7A 1JMWA 2H7BA 3DI5A 1ZVZA 3G4XA 2OEXA 3HNIA 1YA9A 4U9EA 4Z9JA 3RF3A 3K33A 3M79A 5F28E 2AWYA 3TJ5A 3UMIA 2XLHA 3FAPB 2NG1A 2YLDA 2ZXRA 3GWNA 1C03A 1A7DA 4R32A 4E7SA 4CSAA 3T4RA 1OR2A 4U5CE 5IY5C 4AK9A 3VAYA 4Q7CA 4DRHB 4QI2A 2HSBA 4O7GA 2YVKA 4ZLDA 2EPLX 5DS6A 2Q9CA 5L0CA 1MMAA 1LKXA 2IYLD 4NQFA 4DJ9A 4GQHA 3TOMA 3NKEA 2NPUA 3LEOA 2IXPA 3AG1C 2Q7RA 2EPOA 1JR8A 2CW0F 4EBJA 3EFOB 2KNHA 2A0UA 3EHNA 4JJFA 4PACA 1TWGA 1Z7Qc 2IXNA 3E70C 3B0VC 4UDVA 3PCVA 3US6A 4OINF 1QQ3A 3ZDLA 5L3VA 3S0XA 1TR2A 3AGUA 4B6IA 2I15A 2YEVA 3L34A 4RBNA 4BJ5C 4HE8D 2WZFA 1HW1A 4J7YA 2YL3A 3LNMB 4U9DA 2XM4A 1OCZC 2ZXPA 3EZIA 1MNEA 3H2UA 2J9BA 3RQEA 1L3PA 2H7OA 2HV6A 2ASRA 1RXQA 3ZSUA 4YT4A 1PCXA 4FAPB 1T01A 2YLIA 3AJMA 2EIKC 4I1OB 2Q4FA 3ASNC 3FOOA 3LS0A 4I1MA 4Z9HA 3V5XA 4E0IA 1HMOA 1ZW2A 3EHMA 3KPHA 4N6HA 4A2NB 1C17M 4CS9C 3CZ6A 2J46A 3U9JA 1VK5A 1SMYF 3F46A 2J7PD 2RD9A 3NMJA 4BJ1A 2F22A 1YYJA 3RQFA 1UG7A 2AP3A 3O55A 3RW0A 4DBQA 5HV9A 2EIMC 2P61A 2WVQA 5A6BD 4LDRA 3EZHA 2J7PA 1OW8A 3LLIA 3ABKC 3M4CA 2B0HA 3JSZA 3K6BA 2EPNA 2AVKA 3LNRA 3O10A 4D4XA 4YT2A 1CGNA 3TJ6A 4KBLA 2FGYA 2Q9BA 5A6BA 1JPJA 4OIRF 2CCYA 2L81A 2G62A 1FFHA 3AGTA 4MVQA 3W8IA 3ABLC 4AL1A 1Q0MA 2X51A 2QNLA 4WGYA 5B1BC 3W8HA 3GEHA 2D5RB 4CS8C 1QSPA 4KNVA 4ULWA 4MVZA 3NG1A 4W8KA 1JOGA 3IPMO 3ZQVA 5A6AA 2HMZA 2JD3A 1OCCC 3T6JA 2KSFA 3GANA 3HLZA 1GGQA 3B0PA 4FX5A 2YLGA 4LDQA 1LE2A 3CQZA 4XEVA 4YL3A 2R7WA 1O3UA 3E9VA 3V5ZA 5L0HA 1EKYA 2R03A 3BEHA 4HEAJ 4N06A 4BJ5A 1WGWA 1NBBA 3ECSA 1L7CA 3K1IA 1AUEA 2QLAA 2A1DD 4N6CA 4Q5SF 1T6UA 3EJNA 5DVWA 3U2MA 3LAYA 4PJLA 1D0ZA 3HTKC 4XQ1A 4FWVA 2JPUA 3RIPA 3V5YA 1K05A 2R7SA 1AEPA 2XL6A 3DE9A 3MBGA 4CS9A 4CSAC 4U5FE 4IB4A 2NUPA 1OCRC 3KYIA 1VOMA 4ZLCA 2B0JA 4MS2A 3C18A 1MNDA 1ZHYA 4Z9IA 2PFDA 1JRAA 3ZC4A 4W8PA 1ZW3A 3VYWA 4IAOA 4KC9A 4XEKA 5E3CA 3U0CA 1HW2A 3J06A 1YA7O 4AL0A 3L0IA 1CGME 5CI9A 1D1CA 3KL4A 2HFIA 4N4WA 1OQCA 4JEBA 2NUPB 1HE9A 3NKDA 3SP1A 2YRFA 1O87A 4MVSA 3KMIA 3N2ZB 2Q00A 3SXZA 3UMHA 2R7TA 4EWCA 4U5EE 2XXAB 2MYSA 2VC9A 4NTFA 2PX3A 2D4UA 4BG0A 3AG2C 4CS8A 2R7XA 2IOQA 3M15A 3L8IA 1ZU5A 2W4BA 3LS1A 2QUPA 3EPVA 1D1AA 3DZAA 3IEEA 4EIYA 3V7OA 1GQAA 5BQHA 2L7AA 3DJUB 2QTVA 2CYDA 4GYTA 2YL7A 3I4UA 4EKWA 2OJQA 3POVA 4JIOA 4ANJA 5EK0A 2DGJA 1HMDA 2G3KA 3HNLA 3VM6A 3JT1A 2R7OA 2HS5A 1VTMP 5E2QA 1H7IA 5B1AC 3JSEO 4MTOA 2Y3DA 1PV3A 2XS8A 4P6IC 4PFOA 1NSGB 1TWAA 3C7JA 3CEXA 1CPQA 3S9OA 3Q6NA 5KYYA 3WHNA 4OIQF 3AQBA 2P7VA 4EHPA 2V3CC 3RQGA 3JYHA 5DS5A 3EFOA 1LVKA 3AOUA 3H65A 3FDQA 3FXHA 2R7VA 1KU2A 5L0JA 2EINC 1T6QA 4MNDA 5AC4A 1TQGA 1B68A 4XTKA 3KYJA 4JTDB 5F5FA 5KYYB 3A9CA 3QVZA 1HE1A 2XLDA 4MVMA 2FAPB 2KK1A 3M1CB 4P9TA 5JSLA 1H6GA 3UR3C 5KYNA 3LEVA 4MVUA 1GM5A 3HJCA 1F1MA 1SR2A 1U0BB 2HJMA 1S05A 4PFPA 5EGYA 3EGXA 2R7QA 3DE8A 4G0HA 4U5GA 3ZVRA 4C3BA 4XLPF 4JTAB 4LERA 2YL1A 2IBFA 1OW6A 5JVEA 1C02A 2VCAA 4O6YA 1TWCA 3RVYA 1G8XA 1XZPA 1HY5A 2A68F 4IARA 1BBHA 1YYXA 2XL8A 4O79A 2DYSC 4XPXA 3AQCA 5T1DB 1LIHA 3EGDB 1E85A 3K1IC 1T6IA 4GEHA 2OOCA 1A7EA 5E33A 3X1OA 3X2QC 3RFYA 3EGXB 4IWBA 2H7VC 3G4ZA 2A6HF 256BA 1DOVA 4AE4A 3U5SA 3F47A 4M63A 4OD4A 3ZQYA 1I4ZA 3I5PA 4XPYA 3MX3A 4YL1A 1NFNA 1M56C 4PR9A 1YAUO 2WVNA 3GWLA 3AG4C 4LACB 4WABA 3SNHA 3CAXA 4JE9A 3DM5A 3Q7GA 1OXBA 3R7CA 1LS4A 1ZU4A 4ONSA 4YJWA 2XLOA 4CIPA 5D91A 1FAPB 4AE4B 1D0XA 1YDIA 2EILC 2YZSA 4JW1A 1Q0DA 4A4AA 4E17A 3B0UX 1YARO 2R25A 1VLTA 3N24A 5B3SC 5L0FA 1OR3A 1WN0A 1RKCA 4YWQA 1N1CA 2LFDA 3VF0A 2OU6A 2HUJA 1PD1A 3MFNA 1JAFA 2AWCA 2AU5A 1SF8A 3MLGA 2XRHA 1PD0A 5D92A 2KQ9A 4J7TA 2KW3C 2YKZA 1H9GA 3EQLF 3G50A 3JCUQ 3LUTB 2KC3A 2XLMA 4MTGA 5T3TA 4G7HF 3L1MA 1CPRA 4LLCA 1WASA 2ICWG 2J45A 4BPMA 1FMVA 1XWJA 1LS1A 2DB4A 4L6RA 4E0HA 2W45A 3K7DA 3TK0A 2WZGA 2M64A 3FMSA 4NC3A 4IRUA 4NY3A 2J8WA 1D0YA 3GORA 2GFHA 3Q7LA 2BL2A 3B71A 4LLEA 3SYNA 3PMRA 4JURI 4JCHA 4MW3A 2VCCA 2BC5A 3PHF2 3FVYA 1EQ1A 1ST6A 3RH3A 5JUAA 3DD7A 4IJJA 1J8YF 3SXYA 2MWQA 1T5OA 1V74B 2P1AA 3OEOA 2XLEA 3NYJA 1OCOC 4I3MA 3LJBA 1AVOB 1U6HA 4CIHA 1MMDA 4OIPF 5DLJA 4EBBA 4AX2A 1TKNA 1BDJB 3C62A 4G7ZF 3U3BA 3TULA 1TFOB 1M2OA 1DOWA 5BQGA 2UUIA 2XSEA 2MHRA 2PBEA 3OWTA 1TWHA 3C8ZA 4PJNA 1ORYA 2Y39A 4XWJA 3B29A 2BE5F 4WGZA 1E2XA 3KKBA 4MVRA 4LDKA 3C63A 2J9UA 5DS4A 1A0BA 1ZHTA 1BR1A 1QPUA 1LI7A 2HKVA 2YL0A 3N0TA 3ZTZA 2A6EF 3GM3A 1RCPA 3C8GD 1LE4A 3DAGA 4CX9A 2Q9AA 3W2WA 3GEIA 2VB6A 2WB7A 1XZQA
chains in the Genus database with same CATH topology
1JR8A 1JRAA 3GWLA 4E0HA 3U2LA 3R7CA 3O55A 2HJ3A 3TK0A 3LLIA 1OQCA 4LDKA 3U2MA 3GWNA 3LLKA 3MBGA 3W4YA 3U5SA 4E0IA 3TD7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JR8 A;  1JRA A;  3GWL A;  4E0H A;  3U2L A;  3R7C A;  3O55 A;  2HJ3 A;  3TK0 A;  3LLI A;  1OQC A;  4LDK A;  3U2M A;  3GWN A;  3LLK A;  3MBG A;  3W4Y A;  3U5S A;  4E0I A;  3TD7 A; 
#chains in the Genus database with same CATH topology
 4KI2 A;  3RVZ A;  4P9F A;  1U89 A;  3C8G A;  3U9M A;  1Q0F A;  2JX0 A;  2XL4 A;  5JS5 A;  3KH2 A;  5JLI A;  2GAQ A;  2J9V A;  3AG3 C;  3M4B A;  2XM0 A;  1G5Z A;  3HNJ A;  2Z15 A;  4O6N A;  4X0R A;  1WAT A;  1LI5 A;  3ZTM A;  1R5I D;  1OXK A;  2WZL A;  1BR2 A;  1I5N A;  1WOL A;  1Y4C A;  1YVI A;  2DI3 A;  1ZHW A;  4XPW A;  1QKR A;  4YT5 A;  3C8G B;  5COF A;  2NUT A;  2J0X A;  2R7U A;  4JVS A;  4YK5 A;  4DOZ A;  5FCL A;  5BQI A;  1YLM A;  4E18 A;  4JJG A;  3S84 A;  3LES A;  1VMA A;  2XS1 A;  4K7B A;  1T9K A;  3I5Q A;  3NYL A;  4OD5 A;  2EPK X;  1NZE A;  1M6T A;  2XLV A;  1LM3 B;  1RKE A;  2R05 A;  2PX0 A;  4U5B E;  5JRA A;  2PF4 E;  2NUT B;  2L6H A;  1Q0G A;  2KJG A;  2OQM A;  3EGD A;  1QZX A;  1R4T A;  1G4W R;  1NLX A;  3U2L A;  1OKK D;  3K1H A;  2WVO A;  2C04 A;  2YHS A;  1O5H A;  1CGO A;  3IHU A;  4U5D E;  1YJG A;  1RKE B;  1ZZP A;  3QZC A;  3QMK A;  5TJ5 E;  1FNT c;  1OKK A;  1KNY A;  1GS9 A;  3ITF A;  5L0G A;  2EPM X;  4JTC B;  2ZD9 A;  3NYM A;  1S7Z A;  3BRJ A;  2H8A A;  1WWP A;  2W9Y A;  2ZPA A;  2O9X A;  1VYI A;  1W2W A;  4MTF A;  1FMW A;  1K40 A;  4BJ6 C;  3IQC A;  1JPN A;  3FOP A;  4CDY A;  3ASO C;  3EH2 A;  1D1B A;  1YZA A;  4K0D A;  1Q0K A;  5K0I A;  2E87 A;  5L0D A;  2LFF A;  4BEM J;  4JZA A;  4JEA A;  3IQ5 A;  4YL0 A;  2OG2 A;  2P6V A;  3JZ0 A;  1H9T A;  1NG1 A;  5COG A;  4G7O F;  3SXK A;  5B3I A;  1V4A A;  2IXO A;  3R2P A;  4ULV A;  2X0C A;  2OKU A;  1QVX A;  3QW0 A;  2YWA A;  2IXM A;  3DKA A;  1E86 A;  1G4U S;  2ZXO A;  2G3V A;  2OCC C;  2LCH A;  3L8J A;  1ORS C;  4I44 A;  4XEF A;  3DWW A;  1RJ9 A;  3HNK A;  2NSF A;  3LLK A;  5DQZ A;  4DVY P;  5HSW A;  2Y3H A;  1E84 A;  3OA1 A;  1TFK B;  2FFH A;  2L6F A;  4JKV A;  3RYL A;  3TD7 A;  1WTY A;  2L6G A;  3DMD A;  3S29 A;  5AGF A;  3ABM C;  1A41 A;  4G78 A;  3TOL A;  4O6M A;  4CDV A;  2HSQ A;  3SXM A;  1Z63 A;  3JTL O;  3O39 A;  4KNW A;  2LD6 A;  4DVZ A;  2VH3 A;  1LPE A;  1VB5 A;  3JRT A;  1Z23 A;  2HMQ A;  1NU7 D;  2L9J A;  2HJ3 A;  1RJ9 B;  2DYR C;  2P0N A;  2QY9 A;  3GEE A;  4J32 B;  3QW1 A;  3MYI A;  5COM A;  1ZYR F;  1NFO A;  3SEO A;  4IAQ A;  4CBE A;  2RSE B;  4EUK B;  2XXA A;  1BR4 A;  2V26 A;  4WJ0 A;  1APC A;  3K66 A;  5AC5 A;  2VCB A;  4JCZ A;  4C3D A;  1ORJ A;  2GDC A;  3NMI A;  2CDQ A;  1M2V A;  3NRH A;  4EBK A;  4BJ6 A;  3JRM O;  1ZHX A;  3H2V A;  5DQT A;  3NDB B;  2CNW D;  3TQO A;  3VRC A;  2A69 F;  2KYH A;  3DM9 B;  3W4Y A;  5F5H A;  3S90 A;  1BZ4 A;  4OIO F;  3QTH A;  1SZI A;  1YZC A;  5KYU A;  4XLN F;  3S28 A;  2J9W A;  1Z5Z A;  2R02 A;  2UUH A;  3FAJ A;  4PJM A;  4PK4 A;  3U8P A;  4NTA A;  2CNW A;  2W4M A;  2OJE D;  4HFK B;  2LP4 A;  3DAF A;  2CGE A;  1M2V B;  2LK4 A;  3T9O A;  2LSE A;  5A69 A;  3Q6M A;  4U5H A;  1I4Y A;  3PDM P;  3GM1 A;  3ZWI A;  4CS7 A;  2IM8 A;  2LIG A;  2Y3B A;  1M57 C;  4DRI B;  4CDA A;  3MYF A;  4ER9 A;  4YT8 A;  4C7O A;  5KYU B;  1MQV A;  4E7Z A;  1E83 A;  4PJJ A;  2KGO A;  3GM2 A;  3HKK A;  4NTB A;  5L3Q A;  1A7V A;  5A6K A;  5A6J A;  4DRJ B;  3CSK A;  3WOD F;  4FES A;  4HFF B;  1VYK A;  1MMN A;  4K1O A;  2C03 A;  4RDA A;  3SZR A;  4MW8 A;  3U3F A;  4RD9 A;  2NSG A;  1IZM A;  4H4K C;  2Y69 C;  1FFT C;  2XLW A;  2Y3G A;  3QVY A;  5JT4 A;  1Z6A A;  4C7O B;  1Z3I X;  1NU9 C;  2VAS A;  3EH1 A;  4BJT A;  2HV7 A;  4DXW A;  3U8V A;  3FHD A;  2HZ8 A;  4JC7 A;  2I8B A;  3B9Q A;  4NCQ A;  1KTM A;  4J30 B;  1QLE C;  1UFB A;  2TMV P;  1Y6D A;  3GOD A;  3EG9 A;  1VLS A;  1MMG A;  5CI8 A;  4CJG A;  4D4N A;  4DBR A;  3T6G B;  5KYW A;  3NMK A;  2GWW A;  5JP7 A;  5L0I A;  1ZHZ A;  3WG7 C;  5GPG B;  4YN0 B;  2R9R B;  2WL8 A;  4F4B A;  3WAQ A;  4QDL A;  2Q3T A;  5KYX A;  1SYQ A;  2EIJ C;  3S27 A;  5FZT A;  2A0B A;  5T3W A;  2R7R A;  2M4E A;  2QE9 A;  3IQ6 A;  2OEV A;  2PP4 A;  4CJO A;  3IQT A;  1V54 C;  5CIV A;  3ZG1 A;  5BUO A;  3EG9 B;  4BEJ A;  4QI0 A;  3ATP A;  1EA8 A;  4MQ9 F;  2ZXW C;  3DJN B;  3JYY A;  5E3A A;  4IGG A;  1EI7 A;  5EHH A;  5KYW B;  2J0W A;  3UGP A;  4MVO A;  4C3E A;  1IW7 F;  4JRZ A;  1FR0 A;  2PNO A;  3W2V A;  1V55 C;  1J8M F;  3UMK A;  5KYX B;  3O6X A;  1RMV A;  3DXJ F;  3T6B A;  2GA0 A;  3UGO A;  1K04 A;  3ZIB A;  3UNG C;  2YQY A;  4H54 A;  2ETS A;  3RKO F;  2LQG A;  1FTS A;  3A11 A;  4Q4Z F;  1OW7 A;  1JMW A;  2H7B A;  3DI5 A;  1ZVZ A;  3G4X A;  2OEX A;  3HNI A;  1YA9 A;  4U9E A;  4Z9J A;  3RF3 A;  3K33 A;  3M79 A;  5F28 E;  2AWY A;  3TJ5 A;  3UMI A;  2XLH A;  3FAP B;  2NG1 A;  2YLD A;  2ZXR A;  3GWN A;  1C03 A;  1A7D A;  4R32 A;  4E7S A;  4CSA A;  3T4R A;  1OR2 A;  4U5C E;  5IY5 C;  4AK9 A;  3VAY A;  4Q7C A;  4DRH B;  4QI2 A;  2HSB A;  4O7G A;  2YVK A;  4ZLD A;  2EPL X;  5DS6 A;  2Q9C A;  5L0C A;  1MMA A;  1LKX A;  2IYL D;  4NQF A;  4DJ9 A;  4GQH A;  3TOM A;  3NKE A;  2NPU A;  3LEO A;  2IXP A;  3AG1 C;  2Q7R A;  2EPO A;  1JR8 A;  2CW0 F;  4EBJ A;  3EFO B;  2KNH A;  2A0U A;  3EHN A;  4JJF A;  4PAC A;  1TWG A;  1Z7Q c;  2IXN A;  3E70 C;  3B0V C;  4UDV A;  3PCV A;  3US6 A;  4OIN F;  1QQ3 A;  3ZDL A;  5L3V A;  3S0X A;  1TR2 A;  3AGU A;  4B6I A;  2I15 A;  2YEV A;  3L34 A;  4RBN A;  4BJ5 C;  4HE8 D;  2WZF A;  1HW1 A;  4J7Y A;  2YL3 A;  3LNM B;  4U9D A;  2XM4 A;  1OCZ C;  2ZXP A;  3EZI A;  1MNE A;  3H2U A;  2J9B A;  3RQE A;  1L3P A;  2H7O A;  2HV6 A;  2ASR A;  1RXQ A;  3ZSU A;  4YT4 A;  1PCX A;  4FAP B;  1T01 A;  2YLI A;  3AJM A;  2EIK C;  4I1O B;  2Q4F A;  3ASN C;  3FOO A;  3LS0 A;  4I1M A;  4Z9H A;  3V5X A;  4E0I A;  1HMO A;  1ZW2 A;  3EHM A;  3KPH A;  4N6H A;  4A2N B;  1C17 M;  4CS9 C;  3CZ6 A;  2J46 A;  3U9J A;  1VK5 A;  1SMY F;  3F46 A;  2J7P D;  2RD9 A;  3NMJ A;  4BJ1 A;  2F22 A;  1YYJ A;  3RQF A;  1UG7 A;  2AP3 A;  3O55 A;  3RW0 A;  4DBQ A;  5HV9 A;  2EIM C;  2P61 A;  2WVQ A;  5A6B D;  4LDR A;  3EZH A;  2J7P A;  1OW8 A;  3LLI A;  3ABK C;  3M4C A;  2B0H A;  3JSZ A;  3K6B A;  2EPN A;  2AVK A;  3LNR A;  3O10 A;  4D4X A;  4YT2 A;  1CGN A;  3TJ6 A;  4KBL A;  2FGY A;  2Q9B A;  5A6B A;  1JPJ A;  4OIR F;  2CCY A;  2L81 A;  2G62 A;  1FFH A;  3AGT A;  4MVQ A;  3W8I A;  3ABL C;  4AL1 A;  1Q0M A;  2X51 A;  2QNL A;  4WGY A;  5B1B C;  3W8H A;  3GEH A;  2D5R B;  4CS8 C;  1QSP A;  4KNV A;  4ULW A;  4MVZ A;  3NG1 A;  4W8K A;  1JOG A;  3IPM O;  3ZQV A;  5A6A A;  2HMZ A;  2JD3 A;  1OCC C;  3T6J A;  2KSF A;  3GAN A;  3HLZ A;  1GGQ A;  3B0P A;  4FX5 A;  2YLG A;  4LDQ A;  1LE2 A;  3CQZ A;  4XEV A;  4YL3 A;  2R7W A;  1O3U A;  3E9V A;  3V5Z A;  5L0H A;  1EKY A;  2R03 A;  3BEH A;  4HEA J;  4N06 A;  4BJ5 A;  1WGW A;  1NBB A;  3ECS A;  1L7C A;  3K1I A;  1AUE A;  2QLA A;  2A1D D;  4N6C A;  4Q5S F;  1T6U A;  3EJN A;  5DVW A;  3U2M A;  3LAY A;  4PJL A;  1D0Z A;  3HTK C;  4XQ1 A;  4FWV A;  2JPU A;  3RIP A;  3V5Y A;  1K05 A;  2R7S A;  1AEP A;  2XL6 A;  3DE9 A;  3MBG A;  4CS9 A;  4CSA C;  4U5F E;  4IB4 A;  2NUP A;  1OCR C;  3KYI A;  1VOM A;  4ZLC A;  2B0J A;  4MS2 A;  3C18 A;  1MND A;  1ZHY A;  4Z9I A;  2PFD A;  1JRA A;  3ZC4 A;  4W8P A;  1ZW3 A;  3VYW A;  4IAO A;  4KC9 A;  4XEK A;  5E3C A;  3U0C A;  1HW2 A;  3J06 A;  1YA7 O;  4AL0 A;  3L0I A;  1CGM E;  5CI9 A;  1D1C A;  3KL4 A;  2HFI A;  4N4W A;  1OQC A;  4JEB A;  2NUP B;  1HE9 A;  3NKD A;  3SP1 A;  2YRF A;  1O87 A;  4MVS A;  3KMI A;  3N2Z B;  2Q00 A;  3SXZ A;  3UMH A;  2R7T A;  4EWC A;  4U5E E;  2XXA B;  2MYS A;  2VC9 A;  4NTF A;  2PX3 A;  2D4U A;  4BG0 A;  3AG2 C;  4CS8 A;  2R7X A;  2IOQ A;  3M15 A;  3L8I A;  1ZU5 A;  2W4B A;  3LS1 A;  2QUP A;  3EPV A;  1D1A A;  3DZA A;  3IEE A;  4EIY A;  3V7O A;  1GQA A;  5BQH A;  2L7A A;  3DJU B;  2QTV A;  2CYD A;  4GYT A;  2YL7 A;  3I4U A;  4EKW A;  2OJQ A;  3POV A;  4JIO A;  4ANJ A;  5EK0 A;  2DGJ A;  1HMD A;  2G3K A;  3HNL A;  3VM6 A;  3JT1 A;  2R7O A;  2HS5 A;  1VTM P;  5E2Q A;  1H7I A;  5B1A C;  3JSE O;  4MTO A;  2Y3D A;  1PV3 A;  2XS8 A;  4P6I C;  4PFO A;  1NSG B;  1TWA A;  3C7J A;  3CEX A;  1CPQ A;  3S9O A;  3Q6N A;  5KYY A;  3WHN A;  4OIQ F;  3AQB A;  2P7V A;  4EHP A;  2V3C C;  3RQG A;  3JYH A;  5DS5 A;  3EFO A;  1LVK A;  3AOU A;  3H65 A;  3FDQ A;  3FXH A;  2R7V A;  1KU2 A;  5L0J A;  2EIN C;  1T6Q A;  4MND A;  5AC4 A;  1TQG A;  1B68 A;  4XTK A;  3KYJ A;  4JTD B;  5F5F A;  5KYY B;  3A9C A;  3QVZ A;  1HE1 A;  2XLD A;  4MVM A;  2FAP B;  2KK1 A;  3M1C B;  4P9T A;  5JSL A;  1H6G A;  3UR3 C;  5KYN A;  3LEV A;  4MVU A;  1GM5 A;  3HJC A;  1F1M A;  1SR2 A;  1U0B B;  2HJM A;  1S05 A;  4PFP A;  5EGY A;  3EGX A;  2R7Q A;  3DE8 A;  4G0H A;  4U5G A;  3ZVR A;  4C3B A;  4XLP F;  4JTA B;  4LER A;  2YL1 A;  2IBF A;  1OW6 A;  5JVE A;  1C02 A;  2VCA A;  4O6Y A;  1TWC A;  3RVY A;  1G8X A;  1XZP A;  1HY5 A;  2A68 F;  4IAR A;  1BBH A;  1YYX A;  2XL8 A;  4O79 A;  2DYS C;  4XPX A;  3AQC A;  5T1D B;  1LIH A;  3EGD B;  1E85 A;  3K1I C;  1T6I A;  4GEH A;  2OOC A;  1A7E A;  5E33 A;  3X1O A;  3X2Q C;  3RFY A;  3EGX B;  4IWB A;  2H7V C;  3G4Z A;  2A6H F;  256B A;  1DOV A;  4AE4 A;  3U5S A;  3F47 A;  4M63 A;  4OD4 A;  3ZQY A;  1I4Z A;  3I5P A;  4XPY A;  3MX3 A;  4YL1 A;  1NFN A;  1M56 C;  4PR9 A;  1YAU O;  2WVN A;  3GWL A;  3AG4 C;  4LAC B;  4WAB A;  3SNH A;  3CAX A;  4JE9 A;  3DM5 A;  3Q7G A;  1OXB A;  3R7C A;  1LS4 A;  1ZU4 A;  4ONS A;  4YJW A;  2XLO A;  4CIP A;  5D91 A;  1FAP B;  4AE4 B;  1D0X A;  1YDI A;  2EIL C;  2YZS A;  4JW1 A;  1Q0D A;  4A4A A;  4E17 A;  3B0U X;  1YAR O;  2R25 A;  1VLT A;  3N24 A;  5B3S C;  5L0F A;  1OR3 A;  1WN0 A;  1RKC A;  4YWQ A;  1N1C A;  2LFD A;  3VF0 A;  2OU6 A;  2HUJ A;  1PD1 A;  3MFN A;  1JAF A;  2AWC A;  2AU5 A;  1SF8 A;  3MLG A;  2XRH A;  1PD0 A;  5D92 A;  2KQ9 A;  4J7T A;  2KW3 C;  2YKZ A;  1H9G A;  3EQL F;  3G50 A;  3JCU Q;  3LUT B;  2KC3 A;  2XLM A;  4MTG A;  5T3T A;  4G7H F;  3L1M A;  1CPR A;  4LLC A;  1WAS A;  2ICW G;  2J45 A;  4BPM A;  1FMV A;  1XWJ A;  1LS1 A;  2DB4 A;  4L6R A;  4E0H A;  2W45 A;  3K7D A;  3TK0 A;  2WZG A;  2M64 A;  3FMS A;  4NC3 A;  4IRU A;  4NY3 A;  2J8W A;  1D0Y A;  3GOR A;  2GFH A;  3Q7L A;  2BL2 A;  3B71 A;  4LLE A;  3SYN A;  3PMR A;  4JUR I;  4JCH A;  4MW3 A;  2VCC A;  2BC5 A;  3PHF 2;  3FVY A;  1EQ1 A;  1ST6 A;  3RH3 A;  5JUA A;  3DD7 A;  4IJJ A;  1J8Y F;  3SXY A;  2MWQ A;  1T5O A;  1V74 B;  2P1A A;  3OEO A;  2XLE A;  3NYJ A;  1OCO C;  4I3M A;  3LJB A;  1AVO B;  1U6H A;  4CIH A;  1MMD A;  4OIP F;  5DLJ A;  4EBB A;  4AX2 A;  1TKN A;  1BDJ B;  3C62 A;  4G7Z F;  3U3B A;  3TUL A;  1TFO B;  1M2O A;  1DOW A;  5BQG A;  2UUI A;  2XSE A;  2MHR A;  2PBE A;  3OWT A;  1TWH A;  3C8Z A;  4PJN A;  1ORY A;  2Y39 A;  4XWJ A;  3B29 A;  2BE5 F;  4WGZ A;  1E2X A;  3KKB A;  4MVR A;  4LDK A;  3C63 A;  2J9U A;  5DS4 A;  1A0B A;  1ZHT A;  1BR1 A;  1QPU A;  1LI7 A;  2HKV A;  2YL0 A;  3N0T A;  3ZTZ A;  2A6E F;  3GM3 A;  1RCP A;  3C8G D;  1LE4 A;  3DAG A;  4CX9 A;  2Q9A A;  3W2W A;  3GEI A;  2VB6 A;  2WB7 A;  1XZQ A; 
#chains in the Genus database with same CATH homology
 1JR8 A;  1JRA A;  3GWL A;  4E0H A;  3U2L A;  3R7C A;  3O55 A;  2HJ3 A;  3TK0 A;  3LLI A;  1OQC A;  4LDK A;  3U2M A;  3GWN A;  3LLK A;  3MBG A;  3W4Y A;  3U5S A;  4E0I A;  3TD7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...