1Q0DA

Crystal structure of ni-containing superoxide dismutase with ni-ligation corresponding to the oxidized state
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
117
structure length
117
Chain Sequence
b'HCDLPCGVYDPAQARIEAESVKAIQEKMAANDDLHFQIRATVIKEQRAELAKHHLDVLWSDYFKPPHFESYPELHTLVNEAVKALSAAKASTDPATGQKALDYIAQIDKIFWETKKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Ni]
publication title Crystal structure of nickel-containing superoxide dismutase reveals another type of active site
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 51
structure length 117
sequence length 117
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2003-07-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.400 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nickel-containing superoxide dismutase 1q0dA00
1Q0FA 1T6UA 1Q0DA 1Q0KA 1T6IA 1Q0GA 1T6QA 3G4XA 3G4ZA 1Q0MA 3G50A 4NCQA
chains in the Genus database with same CATH superfamily
4CS9A 1V74B 1ORYA 3JRMO 3DM5A 1MNDA 3KL4A 4P9TA 3ABLC 4IGGA 5COMA 2Q7RA 3FMSA 2DB4A 4K1OA 3LLKA 3N2ZB 3M4CA 1HY5A 1GM5A 3UR3C 4G78A 1EI7A 1TWGA 2NUPA 1SMYF 2Q9CA 1JR8A 2KW3C 4EKWA 2R05A 3ZTMA 3C8ZA 3W8HA 5DLJA 3Q6NA 3GORA 2XM4A 3GODA 1OKKD 4KI2A 4P6IC 2LIGA 3MFNA 4MVMA 1JAFA 4YT5A 2W4MA 4E7ZA 2XL6A 3S28A 4BJ1A 4C7OA 1Q0MA 4O6MA 3EGDA 2I15A 2G3VA 3IQ5A 3JCUQ 3U8VA 1FAPB 2HUJA 3T9OA 1NLXA 4E17A 3AJMA 3ASOC 1D0YA 2EIMC 4CBEA 3IPMO 1NSGB 3G4ZA 2J46A 4JVSA 4PACA 3W4YA 2W4BA 5TJ5E 3TOLA 2Y3DA 3ZIBA 1JPJA 4WJ0A 4GEHA 3ASNC 3LJBA 1QPUA 5E3AA 2J0WA 1RJ9B 2EPKX 4ER9A 1T6QA 2FGYA 3E70C 4MTOA 3V5XA 1GQAA 1E2XA 3I5PA 3KYJA 5L3QA 3NDBB 3U3BA 2JX0A 5KYXB 3M1CB 4HE8D 2OKUA 2YVKA 3KKBA 3PHF2 4RD9A 3B29A 4YK5A 4HFFB 4XEKA 3C8GB 3TJ5A 1MMGA 4J7TA 3KMIA 1VTMP 3N24A 3BEHA 3DAGA 4JIOA 4N6CA 2YLIA 2P61A 2P1AA 2IXNA 4Q4ZF 1JMWA 1OQCA 5JSLA 1A41A 2XS1A 3TULA 4ULVA 1XZQA 2YLGA 4ZLCA 4MVSA 3NMKA 3DD7A 5JT4A 1RMVA 2R7TA 1LI7A 4YN0B 3VF0A 4X0RA 2LFDA 4IARA 5L0IA 4W8KA 2M64A 4EBJA 2A1DD 3CEXA 5A6AA 2R02A 2KJGA 4YT4A 2OEXA 2GDCA 2UUHA 4IB4A 3FDQA 1H7IA 1OW6A 1V55C 1I4ZA 4GYTA 2VH3A 4G0HA 3EGXA 1M2OA 4PJLA 4DVZA 4FAPB 1Z23A 1G4US 3C63A 2A6EF 1VYIA 2NUTB 2XRHA 4NC3A 4MVQA 3O39A 4JW1A 1FTSA 1WATA 4XEVA 4XWJA 3F46A 1F1MA 4JTCB 3W2VA 4DOZA 1S7ZA 3QW0A 3K7DA 5DQZA 4WGZA 2NSGA 5EHHA 3AG3C 2YLDA 3RFYA 2WB7A 1M56C 3MYIA 1ZZPA 1ST6A 1VOMA 3FHDA 1L3PA 4MS2A 4WABA 4XPYA 4G7HF 2H8AA 1ZW3A 256BA 2Q9AA 4JTAB 4L6RA 4YT2A 2PX3A 1A7DA 3DXJF 3FOPA 4O6YA 3LEOA 4E0IA 1YZAA 3U9MA 2XLMA 4U5GA 4AE4B 2IOQA 2VCBA 4FX5A 4OD5A 3I5QA 4LDRA 2HMQA 3EZHA 2EPMX 1ORJA 2I8BA 3HNKA 3MBGA 4ANJA 2XL8A 4E0HA 4MVUA 4CIPA 1YAUO 2XM0A 2HMZA 1NU7D 3ABMC 4BJ6C 5L0JA 5B3IA 3MYFA 1BZ4A 1QLEC 3B71A 3GM3A 3DAFA 4OD4A 1SYQA 1K05A 1C17M 2IXOA 3H65A 3C18A 4O79A 5GPGB 4K7BA 3JRTA 4IJJA 1M2VB 5KYNA 2P6VA 2YHSA 3TQOA 3AG4C 2KNHA 2VASA 1U6HA 5JP7A 3VRCA 4KBLA 1H9GA 2IXMA 2XLDA 3RYLA 3S27A 2XLWA 1OXBA 1CGNA 1EA8A 1K04A 1RKEB 3DJNB 3L1MA 2CYDA 3V5YA 4LLEA 3SYNA 4KNVA 3EFOB 2NG1A 2GAQA 2PF4E 2YKZA 3HKKA 1HE1A 3EH1A 4P9FA 3NYJA 3SXKA 1J8MF 2WZLA 3U2MA 1E84A 2UUIA 3O55A 2HS5A 2WZFA 1LKXA 4QI0A 2DGJA 4M63A 3TOMA 1IW7F 1QQ3A 2LCHA 3C7JA 4JRZA 5F28E 4QI2A 4O7GA 3LLIA 3MLGA 3EG9B 5EK0A 4XTKA 1E86A 3NKEA 2L6FA 3HNIA 2YZSA 2KQ9A 3Q6MA 2C04A 1T6IA 2EPNA 1Y6DA 2NPUA 2YL3A 4DBQA 1ZHYA 1GS9A 3FVYA 3IEEA 2KGOA 4I44A 4BJ6A 1VMAA 3LS1A 4CDYA 1TWCA 3SEOA 3GM2A 4JCHA 4UDVA 4XQ1A 2D5RB 2EIJC 4XLNF 1WASA 2FAPB 2KC3A 3GWLA 4EHPA 1TFKB 5KYYB 4EUKB 4N4WA 5KYWA 1BR4A 1ZU5A 4U5DE 4MTFA 4H54A 2XXAA 1YA7O 1JRAA 3C62A 3K66A 1A7VA 4DXWA 2IM8A 1O5HA 2MHRA 2W9YA 2YWAA 3HNJA 4AK9A 1RCPA 1SZIA 2ZXRA 2CNWD 2ZXPA 1ZW2A 2FFHA 1HE9A 4YWQA 1K40A 3WODF 5A6KA 3QMKA 5HSWA 2R7RA 1Z7Qc 3EHMA 2ICWG 3DZAA 1D1AA 3S84A 3HNLA 3OEOA 1PD1A 2QY9A 2R7OA 4PJJA 1LS1A 2LFFA 2EILC 2LD6A 3ITFA 3GEHA 2WVOA 2Q3TA 4EIYA 5EGYA 4C3EA 2J8WA 1OW7A 3IHUA 3JYYA 1FFTC 1V4AA 5COGA 1S05A 1O87A 3FAPB 4XPWA 4BEJA 3B0UX 4E18A 3NRHA 3ZG1A 5CI8A 3S29A 3K1HA 5L0CA 3TD7A 1KTMA 4CS7A 1CPRA 1OKKA 1R5ID 2ZD9A 1D1BA 2Z15A 3UGPA 1WGWA 2EPOA 2LQGA 4JC7A 4MVOA 4N06A 4J30B 5B1AC 1N1CA 2CNWA 2HJMA 1ZHXA 2A0UA 4U9DA 3LUTB 2CGEA 2OG2A 4HFKB 3POVA 4IAOA 4DRHB 2J45A 3DE9A 2R7SA 4CDVA 3ATPA 1QKRA 3R2PA 3RKOF 2GWWA 1YA9A 3WAQA 2L7AA 4G7ZF 2LP4A 4CDAA 3IQ6A 3ZDLA 3DE8A 4H4KC 2Q00A 1MNEA 1YDIA 4PFOA 2EPLX 2R7UA 2HV7A 2B0HA 1PCXA 3JT1A 2D4UA 3Q7GA 5COFA 5DS4A 1H6GA 3KH2A 2WVNA 4JJGA 4CJOA 3AG2C 1M57C 1MQVA 3HLZA 2DYRC 2BE5F 1BBHA 2MWQA 1ZU4A 2AU5A 2OEVA 1TR2A 3CSKA 3JYHA 1HMDA 4FWVA 4MVRA 4F4BA 4C3DA 3PCVA 2AP3A 3KPHA 3F47A 1NG1A 4A4AA 5K0IA 4EWCA 2MYSA 2XSEA 1OCRC 4CIHA 1Q0GA 2NUPB 3DI5A 1HW2A 2ETSA 3T6JA 2AVKA 2PX0A 4Z9JA 2WL8A 1NU9C 4IRUA 4EBKA 2AWYA 2IBFA 3EZIA 3GEIA 3RQFA 3U2LA 3ZQVA 1Q0DA 5A6JA 3QTHA 4G7OF 1LI5A 1RXQA 1A7EA 1VLSA 1AUEA 2J7PD 2CW0F 1Z6AA 3US6A 1CPQA 2JD3A 4DJ9A 4C7OB 1WN0A 1JPNA 1VB5A 3EGDB 2QE9A 2KYHA 1VYKA 3A9CA 2RD9A 4YL0A 1C02A 2KK1A 1PD0A 5L3VA 2Y69C 4I3MA 1AVOB 4JE9A 2A6HF 3OWTA 2OOCA 4NCQA 1HW1A 4IAQA 3SNHA 4BEMJ 2Q9BA 2DI3A 3S0XA 3B0PA 2YL0A 4ONSA 5BQGA 2HSBA 3T6GB 5KYUB 3HJCA 1LS4A 4DRJB 4U5FE 1Z63A 3JZ0A 1L7CA 2J7PA 2XL4A 2XS8A 3QZCA 3M4BA 4LACB 4QDLA 3UMIA 3OA1A 3G4XA 4D4NA 3G50A 2JPUA 3U5SA 2QTVA 4PK4A 2OCCC 3V7OA 4U5HA 1APCA 2HV6A 2R25A 4U5EE 4OIOF 4O6NA 1ZHWA 2H7OA 4BG0A 4DVYP 1EQ1A 1VK5A 1Z5ZA 2J9UA 1LM3B 3C8GD 4YL1A 2QNLA 2M4EA 1FR0A 3AOUA 4CSAC 2ASRA 3EQLF 1BR2A 3GEEA 2L6HA 3ZSUA 1V54C 3JSEO 1E85A 3HTKC 3CAXA 4J7YA 3ABKC 1U89A 3QVYA 5CIVA 2WZGA 2J0XA 4MVZA 3X2QC 1RJ9A 5DS6A 5L0HA 1E83A 4GQHA 4BPMA 3IQCA 3EGXB 1RKCA 2R7XA 1NBBA 4N6HA 4CS8C 5KYXA 3RH3A 4HEAJ 3RVZA 2LK4A 4U5CE 5AC4A 1WTYA 2XLVA 3L8IA 3VM6A 2RSEB 3C8GA 3AGUA 4JJFA 2VC9A 4BJTA 1JOGA 3JSZA 2R03A 4KNWA 2YEVA 4JURI 1YLMA 1TWHA 1IZMA 1WOLA 3BRJA 3UNGC 1TKNA 5D92A 3UMKA 3WHNA 1LPEA 4NY3A 1LIHA 3LNMB 4NTBA 4AL1A 3W2WA 3RW0A 3NYLA 4BJ5C 3L0IA 3LNRA 4D4XA 3H2VA 2R7WA 1YYXA 1D0ZA 2F22A 3AG1C 2VB6A 3JTLO 4OIQF 2PP4A 4PJMA 3N0TA 3K33A 4U5BE 4ULWA 3RIPA 3LEVA 4DBRA 4U9EA 4EBBA 1WWPA 3KYIA 3EH2A 3SP1A 1W2WA 4RDAA 3U9JA 5L0DA 2NUTA 3ZTZA 3J06A 1KNYA 4CX9A 4CSAA 1ZHTA 2L81A 1VLTA 4WGYA 4XPXA 4Z9IA 3UGOA 5F5FA 2LSEA 2XLHA 3LAYA 2IYLD 4MQ9F 3QVZA 1YZCA 1FNTc 1D1CA 4XLPF 2PNOA 3DWWA 1B68A 3M79A 3SXMA 3L8JA 1KU2A 4C3BA 5DS5A 3L34A 1ORSC 2R7QA 4YL3A 1NFOA 4CS8A 4JZAA 2J9BA 4MNDA 3RQEA 3T4RA 1GGQA 4FESA 4LLCA 4Z9HA 3NKDA 2HKVA 5E2QA 2G62A 4AE4A 2TMVP 2R7VA 5DVWA 1PV3A 3EHNA 2J9VA 3H2UA 1XZPA 1XWJA 3O6XA 4MW3A 5D91A 4JEBA 5E3CA 1YARO 3SXZA 1OXKA 1R4TA 5B3SC 1YYJA 5HV9A 4MTGA 4Q5SF 3AQBA 5DQTA 3K1IC 2G3KA 4LDQA 2HFIA 1Q0KA 4OINF 1J8YF 5AGFA 5F5HA 3U8PA 5KYUA 4E7SA 5BUOA 4BJ5A 5L0GA 1FMVA 3ECSA 4JTDB 2V3CC 3TK0A 1T01A 1H9TA 1M2VA 1T6UA 4RBNA 1Z3IX 2X51A 2L6GA 3DM9B 3NG1A 4LDKA 4LERA 2Y3HA 3U3FA 3V5ZA 1HMOA 1DOVA 2NSFA 4JCZA 2CCYA 3DKAA 3QW1A 5AC5A 1FMWA 1QSPA 1RKEA 2V26A 5JUAA 2DYSC 3WG7C 3EJNA 1TFOB 1QVXA 2A68F 1MMNA 2ZXOA 1UG7A 4K0DA 5BQHA 5FZTA 2R9RB 3EFOA 4OIPF 2GFHA 4KC9A 4Q7CA 2XLEA 2OJQA 4I1OB 3ZWIA 5KYWB 1G5ZA 2BC5A 2VCAA 1Y4CA 2QLAA 1ZVZA 3GM1A 5JRAA 2XXAB 2P0NA 2Q4FA 3UMHA 1G4WR 1OCOC 3RVYA 3PDMP 2Y3GA 3GANA 5E33A 1BR1A 2ZPAA 4XEFA 3FAJA 1SR2A 1OR3A 3EG9A 3NMIA 3E9VA 4NQFA 1NFNA 1OCZC 2YL1A 3TJ6A 2AWCA 3RQGA 2Y39A 4J32B 4A2NB 2P7VA 1LE4A 3SZRA 3VYWA 3RF3A 3S90A 4PJNA 4B6IA 2O9XA 2W45A 1I5NA 1LE2A 1OCCC 2EIKC 4R32A 1G8XA 2YL7A 5JS5A 3K1IA 2OQMA 1ZYRF 2PFDA 1OW8A 2EINC 1D0XA 2A0BA 2ZXWC 3LS0A 1AEPA 5KYYA 1YVIA 3AQCA 1CGOA 2J9WA 4OIRF 4CS9C 2E87A 2X0CA 2WVQA 5JLIA 3T6BA 2HZ8A 4CJGA 2YQYA 3CQZA 1MMAA 1BDJB 3NMJA 4YJWA 3ZC4A 5A6BD 3W8IA 3DMDA 3B0VC 3ZQYA 3U0CA 2B0JA 2YRFA 2L9JA 5FCLA 2H7VC 4AL0A 1T5OA 2VCCA 2GA0A 4I1MA 1TQGA 3CZ6A 4YT8A 5L0FA 5JVEA 1QZXA 1MMDA 1OR2A 3IQTA 3K6BA 2OU6A 2QUPA 3NYMA 4MW8A 1LVKA 5T3TA 2HSQA 1DOWA 4NTFA 4JEAA 2OJED 2IXPA 1O3UA 1UFBA 4PFPA 2BL2A 5T3WA 1FFHA 3GWNA 3DJUB 3FOOA 3I4UA 3A11A 3MX3A 2CDQA 1Q0FA 2PBEA 1CGME 5B1BC 4ZLDA 3S9OA 5A6BA 5A69A 3R7CA 5IY5C 4IWBA 5CI9A 4DRIB 1U0BB 3AGTA 3ZVRA 3M15A 2HJ3A 4PR9A 3VAYA 2H7BA 2KSFA 3B9QA 1C03A 1NZEA 3LESA 4W8PA 3FXHA 1SF8A 1EKYA 2A69F 1ZHZA 3PMRA 5BQIA 1T9KA 1TWAA 4AX2A 3Q7LA 1I4YA 5T1DB 3SXYA 3EPVA 4JKVA 1M6TA 4NTAA 1YJGA 2C03A 1A0BA 2XLOA 2Y3BA 3X1OA 3O10A
chains in the Genus database with same CATH topology
1Q0FA 1T6UA 1Q0DA 1Q0KA 1T6IA 1Q0GA 1T6QA 3G4XA 3G4ZA 1Q0MA 3G50A 4NCQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q0F A;  1T6U A;  1Q0D A;  1Q0K A;  1T6I A;  1Q0G A;  1T6Q A;  3G4X A;  3G4Z A;  1Q0M A;  3G50 A;  4NCQ A; 
#chains in the Genus database with same CATH topology
 4CS9 A;  1V74 B;  1ORY A;  3JRM O;  3DM5 A;  1MND A;  3KL4 A;  4P9T A;  3ABL C;  4IGG A;  5COM A;  2Q7R A;  3FMS A;  2DB4 A;  4K1O A;  3LLK A;  3N2Z B;  3M4C A;  1HY5 A;  1GM5 A;  3UR3 C;  4G78 A;  1EI7 A;  1TWG A;  2NUP A;  1SMY F;  2Q9C A;  1JR8 A;  2KW3 C;  4EKW A;  2R05 A;  3ZTM A;  3C8Z A;  3W8H A;  5DLJ A;  3Q6N A;  3GOR A;  2XM4 A;  3GOD A;  1OKK D;  4KI2 A;  4P6I C;  2LIG A;  3MFN A;  4MVM A;  1JAF A;  4YT5 A;  2W4M A;  4E7Z A;  2XL6 A;  3S28 A;  4BJ1 A;  4C7O A;  1Q0M A;  4O6M A;  3EGD A;  2I15 A;  2G3V A;  3IQ5 A;  3JCU Q;  3U8V A;  1FAP B;  2HUJ A;  3T9O A;  1NLX A;  4E17 A;  3AJM A;  3ASO C;  1D0Y A;  2EIM C;  4CBE A;  3IPM O;  1NSG B;  3G4Z A;  2J46 A;  4JVS A;  4PAC A;  3W4Y A;  2W4B A;  5TJ5 E;  3TOL A;  2Y3D A;  3ZIB A;  1JPJ A;  4WJ0 A;  4GEH A;  3ASN C;  3LJB A;  1QPU A;  5E3A A;  2J0W A;  1RJ9 B;  2EPK X;  4ER9 A;  1T6Q A;  2FGY A;  3E70 C;  4MTO A;  3V5X A;  1GQA A;  1E2X A;  3I5P A;  3KYJ A;  5L3Q A;  3NDB B;  3U3B A;  2JX0 A;  5KYX B;  3M1C B;  4HE8 D;  2OKU A;  2YVK A;  3KKB A;  3PHF 2;  4RD9 A;  3B29 A;  4YK5 A;  4HFF B;  4XEK A;  3C8G B;  3TJ5 A;  1MMG A;  4J7T A;  3KMI A;  1VTM P;  3N24 A;  3BEH A;  3DAG A;  4JIO A;  4N6C A;  2YLI A;  2P61 A;  2P1A A;  2IXN A;  4Q4Z F;  1JMW A;  1OQC A;  5JSL A;  1A41 A;  2XS1 A;  3TUL A;  4ULV A;  1XZQ A;  2YLG A;  4ZLC A;  4MVS A;  3NMK A;  3DD7 A;  5JT4 A;  1RMV A;  2R7T A;  1LI7 A;  4YN0 B;  3VF0 A;  4X0R A;  2LFD A;  4IAR A;  5L0I A;  4W8K A;  2M64 A;  4EBJ A;  2A1D D;  3CEX A;  5A6A A;  2R02 A;  2KJG A;  4YT4 A;  2OEX A;  2GDC A;  2UUH A;  4IB4 A;  3FDQ A;  1H7I A;  1OW6 A;  1V55 C;  1I4Z A;  4GYT A;  2VH3 A;  4G0H A;  3EGX A;  1M2O A;  4PJL A;  4DVZ A;  4FAP B;  1Z23 A;  1G4U S;  3C63 A;  2A6E F;  1VYI A;  2NUT B;  2XRH A;  4NC3 A;  4MVQ A;  3O39 A;  4JW1 A;  1FTS A;  1WAT A;  4XEV A;  4XWJ A;  3F46 A;  1F1M A;  4JTC B;  3W2V A;  4DOZ A;  1S7Z A;  3QW0 A;  3K7D A;  5DQZ A;  4WGZ A;  2NSG A;  5EHH A;  3AG3 C;  2YLD A;  3RFY A;  2WB7 A;  1M56 C;  3MYI A;  1ZZP A;  1ST6 A;  1VOM A;  3FHD A;  1L3P A;  4MS2 A;  4WAB A;  4XPY A;  4G7H F;  2H8A A;  1ZW3 A;  256B A;  2Q9A A;  4JTA B;  4L6R A;  4YT2 A;  2PX3 A;  1A7D A;  3DXJ F;  3FOP A;  4O6Y A;  3LEO A;  4E0I A;  1YZA A;  3U9M A;  2XLM A;  4U5G A;  4AE4 B;  2IOQ A;  2VCB A;  4FX5 A;  4OD5 A;  3I5Q A;  4LDR A;  2HMQ A;  3EZH A;  2EPM X;  1ORJ A;  2I8B A;  3HNK A;  3MBG A;  4ANJ A;  2XL8 A;  4E0H A;  4MVU A;  4CIP A;  1YAU O;  2XM0 A;  2HMZ A;  1NU7 D;  3ABM C;  4BJ6 C;  5L0J A;  5B3I A;  3MYF A;  1BZ4 A;  1QLE C;  3B71 A;  3GM3 A;  3DAF A;  4OD4 A;  1SYQ A;  1K05 A;  1C17 M;  2IXO A;  3H65 A;  3C18 A;  4O79 A;  5GPG B;  4K7B A;  3JRT A;  4IJJ A;  1M2V B;  5KYN A;  2P6V A;  2YHS A;  3TQO A;  3AG4 C;  2KNH A;  2VAS A;  1U6H A;  5JP7 A;  3VRC A;  4KBL A;  1H9G A;  2IXM A;  2XLD A;  3RYL A;  3S27 A;  2XLW A;  1OXB A;  1CGN A;  1EA8 A;  1K04 A;  1RKE B;  3DJN B;  3L1M A;  2CYD A;  3V5Y A;  4LLE A;  3SYN A;  4KNV A;  3EFO B;  2NG1 A;  2GAQ A;  2PF4 E;  2YKZ A;  3HKK A;  1HE1 A;  3EH1 A;  4P9F A;  3NYJ A;  3SXK A;  1J8M F;  2WZL A;  3U2M A;  1E84 A;  2UUI A;  3O55 A;  2HS5 A;  2WZF A;  1LKX A;  4QI0 A;  2DGJ A;  4M63 A;  3TOM A;  1IW7 F;  1QQ3 A;  2LCH A;  3C7J A;  4JRZ A;  5F28 E;  4QI2 A;  4O7G A;  3LLI A;  3MLG A;  3EG9 B;  5EK0 A;  4XTK A;  1E86 A;  3NKE A;  2L6F A;  3HNI A;  2YZS A;  2KQ9 A;  3Q6M A;  2C04 A;  1T6I A;  2EPN A;  1Y6D A;  2NPU A;  2YL3 A;  4DBQ A;  1ZHY A;  1GS9 A;  3FVY A;  3IEE A;  2KGO A;  4I44 A;  4BJ6 A;  1VMA A;  3LS1 A;  4CDY A;  1TWC A;  3SEO A;  3GM2 A;  4JCH A;  4UDV A;  4XQ1 A;  2D5R B;  2EIJ C;  4XLN F;  1WAS A;  2FAP B;  2KC3 A;  3GWL A;  4EHP A;  1TFK B;  5KYY B;  4EUK B;  4N4W A;  5KYW A;  1BR4 A;  1ZU5 A;  4U5D E;  4MTF A;  4H54 A;  2XXA A;  1YA7 O;  1JRA A;  3C62 A;  3K66 A;  1A7V A;  4DXW A;  2IM8 A;  1O5H A;  2MHR A;  2W9Y A;  2YWA A;  3HNJ A;  4AK9 A;  1RCP A;  1SZI A;  2ZXR A;  2CNW D;  2ZXP A;  1ZW2 A;  2FFH A;  1HE9 A;  4YWQ A;  1K40 A;  3WOD F;  5A6K A;  3QMK A;  5HSW A;  2R7R A;  1Z7Q c;  3EHM A;  2ICW G;  3DZA A;  1D1A A;  3S84 A;  3HNL A;  3OEO A;  1PD1 A;  2QY9 A;  2R7O A;  4PJJ A;  1LS1 A;  2LFF A;  2EIL C;  2LD6 A;  3ITF A;  3GEH A;  2WVO A;  2Q3T A;  4EIY A;  5EGY A;  4C3E A;  2J8W A;  1OW7 A;  3IHU A;  3JYY A;  1FFT C;  1V4A A;  5COG A;  1S05 A;  1O87 A;  3FAP B;  4XPW A;  4BEJ A;  3B0U X;  4E18 A;  3NRH A;  3ZG1 A;  5CI8 A;  3S29 A;  3K1H A;  5L0C A;  3TD7 A;  1KTM A;  4CS7 A;  1CPR A;  1OKK A;  1R5I D;  2ZD9 A;  1D1B A;  2Z15 A;  3UGP A;  1WGW A;  2EPO A;  2LQG A;  4JC7 A;  4MVO A;  4N06 A;  4J30 B;  5B1A C;  1N1C A;  2CNW A;  2HJM A;  1ZHX A;  2A0U A;  4U9D A;  3LUT B;  2CGE A;  2OG2 A;  4HFK B;  3POV A;  4IAO A;  4DRH B;  2J45 A;  3DE9 A;  2R7S A;  4CDV A;  3ATP A;  1QKR A;  3R2P A;  3RKO F;  2GWW A;  1YA9 A;  3WAQ A;  2L7A A;  4G7Z F;  2LP4 A;  4CDA A;  3IQ6 A;  3ZDL A;  3DE8 A;  4H4K C;  2Q00 A;  1MNE A;  1YDI A;  4PFO A;  2EPL X;  2R7U A;  2HV7 A;  2B0H A;  1PCX A;  3JT1 A;  2D4U A;  3Q7G A;  5COF A;  5DS4 A;  1H6G A;  3KH2 A;  2WVN A;  4JJG A;  4CJO A;  3AG2 C;  1M57 C;  1MQV A;  3HLZ A;  2DYR C;  2BE5 F;  1BBH A;  2MWQ A;  1ZU4 A;  2AU5 A;  2OEV A;  1TR2 A;  3CSK A;  3JYH A;  1HMD A;  4FWV A;  4MVR A;  4F4B A;  4C3D A;  3PCV A;  2AP3 A;  3KPH A;  3F47 A;  1NG1 A;  4A4A A;  5K0I A;  4EWC A;  2MYS A;  2XSE A;  1OCR C;  4CIH A;  1Q0G A;  2NUP B;  3DI5 A;  1HW2 A;  2ETS A;  3T6J A;  2AVK A;  2PX0 A;  4Z9J A;  2WL8 A;  1NU9 C;  4IRU A;  4EBK A;  2AWY A;  2IBF A;  3EZI A;  3GEI A;  3RQF A;  3U2L A;  3ZQV A;  1Q0D A;  5A6J A;  3QTH A;  4G7O F;  1LI5 A;  1RXQ A;  1A7E A;  1VLS A;  1AUE A;  2J7P D;  2CW0 F;  1Z6A A;  3US6 A;  1CPQ A;  2JD3 A;  4DJ9 A;  4C7O B;  1WN0 A;  1JPN A;  1VB5 A;  3EGD B;  2QE9 A;  2KYH A;  1VYK A;  3A9C A;  2RD9 A;  4YL0 A;  1C02 A;  2KK1 A;  1PD0 A;  5L3V A;  2Y69 C;  4I3M A;  1AVO B;  4JE9 A;  2A6H F;  3OWT A;  2OOC A;  4NCQ A;  1HW1 A;  4IAQ A;  3SNH A;  4BEM J;  2Q9B A;  2DI3 A;  3S0X A;  3B0P A;  2YL0 A;  4ONS A;  5BQG A;  2HSB A;  3T6G B;  5KYU B;  3HJC A;  1LS4 A;  4DRJ B;  4U5F E;  1Z63 A;  3JZ0 A;  1L7C A;  2J7P A;  2XL4 A;  2XS8 A;  3QZC A;  3M4B A;  4LAC B;  4QDL A;  3UMI A;  3OA1 A;  3G4X A;  4D4N A;  3G50 A;  2JPU A;  3U5S A;  2QTV A;  4PK4 A;  2OCC C;  3V7O A;  4U5H A;  1APC A;  2HV6 A;  2R25 A;  4U5E E;  4OIO F;  4O6N A;  1ZHW A;  2H7O A;  4BG0 A;  4DVY P;  1EQ1 A;  1VK5 A;  1Z5Z A;  2J9U A;  1LM3 B;  3C8G D;  4YL1 A;  2QNL A;  2M4E A;  1FR0 A;  3AOU A;  4CSA C;  2ASR A;  3EQL F;  1BR2 A;  3GEE A;  2L6H A;  3ZSU A;  1V54 C;  3JSE O;  1E85 A;  3HTK C;  3CAX A;  4J7Y A;  3ABK C;  1U89 A;  3QVY A;  5CIV A;  2WZG A;  2J0X A;  4MVZ A;  3X2Q C;  1RJ9 A;  5DS6 A;  5L0H A;  1E83 A;  4GQH A;  4BPM A;  3IQC A;  3EGX B;  1RKC A;  2R7X A;  1NBB A;  4N6H A;  4CS8 C;  5KYX A;  3RH3 A;  4HEA J;  3RVZ A;  2LK4 A;  4U5C E;  5AC4 A;  1WTY A;  2XLV A;  3L8I A;  3VM6 A;  2RSE B;  3C8G A;  3AGU A;  4JJF A;  2VC9 A;  4BJT A;  1JOG A;  3JSZ A;  2R03 A;  4KNW A;  2YEV A;  4JUR I;  1YLM A;  1TWH A;  1IZM A;  1WOL A;  3BRJ A;  3UNG C;  1TKN A;  5D92 A;  3UMK A;  3WHN A;  1LPE A;  4NY3 A;  1LIH A;  3LNM B;  4NTB A;  4AL1 A;  3W2W A;  3RW0 A;  3NYL A;  4BJ5 C;  3L0I A;  3LNR A;  4D4X A;  3H2V A;  2R7W A;  1YYX A;  1D0Z A;  2F22 A;  3AG1 C;  2VB6 A;  3JTL O;  4OIQ F;  2PP4 A;  4PJM A;  3N0T A;  3K33 A;  4U5B E;  4ULW A;  3RIP A;  3LEV A;  4DBR A;  4U9E A;  4EBB A;  1WWP A;  3KYI A;  3EH2 A;  3SP1 A;  1W2W A;  4RDA A;  3U9J A;  5L0D A;  2NUT A;  3ZTZ A;  3J06 A;  1KNY A;  4CX9 A;  4CSA A;  1ZHT A;  2L81 A;  1VLT A;  4WGY A;  4XPX A;  4Z9I A;  3UGO A;  5F5F A;  2LSE A;  2XLH A;  3LAY A;  2IYL D;  4MQ9 F;  3QVZ A;  1YZC A;  1FNT c;  1D1C A;  4XLP F;  2PNO A;  3DWW A;  1B68 A;  3M79 A;  3SXM A;  3L8J A;  1KU2 A;  4C3B A;  5DS5 A;  3L34 A;  1ORS C;  2R7Q A;  4YL3 A;  1NFO A;  4CS8 A;  4JZA A;  2J9B A;  4MND A;  3RQE A;  3T4R A;  1GGQ A;  4FES A;  4LLC A;  4Z9H A;  3NKD A;  2HKV A;  5E2Q A;  2G62 A;  4AE4 A;  2TMV P;  2R7V A;  5DVW A;  1PV3 A;  3EHN A;  2J9V A;  3H2U A;  1XZP A;  1XWJ A;  3O6X A;  4MW3 A;  5D91 A;  4JEB A;  5E3C A;  1YAR O;  3SXZ A;  1OXK A;  1R4T A;  5B3S C;  1YYJ A;  5HV9 A;  4MTG A;  4Q5S F;  3AQB A;  5DQT A;  3K1I C;  2G3K A;  4LDQ A;  2HFI A;  1Q0K A;  4OIN F;  1J8Y F;  5AGF A;  5F5H A;  3U8P A;  5KYU A;  4E7S A;  5BUO A;  4BJ5 A;  5L0G A;  1FMV A;  3ECS A;  4JTD B;  2V3C C;  3TK0 A;  1T01 A;  1H9T A;  1M2V A;  1T6U A;  4RBN A;  1Z3I X;  2X51 A;  2L6G A;  3DM9 B;  3NG1 A;  4LDK A;  4LER A;  2Y3H A;  3U3F A;  3V5Z A;  1HMO A;  1DOV A;  2NSF A;  4JCZ A;  2CCY A;  3DKA A;  3QW1 A;  5AC5 A;  1FMW A;  1QSP A;  1RKE A;  2V26 A;  5JUA A;  2DYS C;  3WG7 C;  3EJN A;  1TFO B;  1QVX A;  2A68 F;  1MMN A;  2ZXO A;  1UG7 A;  4K0D A;  5BQH A;  5FZT A;  2R9R B;  3EFO A;  4OIP F;  2GFH A;  4KC9 A;  4Q7C A;  2XLE A;  2OJQ A;  4I1O B;  3ZWI A;  5KYW B;  1G5Z A;  2BC5 A;  2VCA A;  1Y4C A;  2QLA A;  1ZVZ A;  3GM1 A;  5JRA A;  2XXA B;  2P0N A;  2Q4F A;  3UMH A;  1G4W R;  1OCO C;  3RVY A;  3PDM P;  2Y3G A;  3GAN A;  5E33 A;  1BR1 A;  2ZPA A;  4XEF A;  3FAJ A;  1SR2 A;  1OR3 A;  3EG9 A;  3NMI A;  3E9V A;  4NQF A;  1NFN A;  1OCZ C;  2YL1 A;  3TJ6 A;  2AWC A;  3RQG A;  2Y39 A;  4J32 B;  4A2N B;  2P7V A;  1LE4 A;  3SZR A;  3VYW A;  3RF3 A;  3S90 A;  4PJN A;  4B6I A;  2O9X A;  2W45 A;  1I5N A;  1LE2 A;  1OCC C;  2EIK C;  4R32 A;  1G8X A;  2YL7 A;  5JS5 A;  3K1I A;  2OQM A;  1ZYR F;  2PFD A;  1OW8 A;  2EIN C;  1D0X A;  2A0B A;  2ZXW C;  3LS0 A;  1AEP A;  5KYY A;  1YVI A;  3AQC A;  1CGO A;  2J9W A;  4OIR F;  4CS9 C;  2E87 A;  2X0C A;  2WVQ A;  5JLI A;  3T6B A;  2HZ8 A;  4CJG A;  2YQY A;  3CQZ A;  1MMA A;  1BDJ B;  3NMJ A;  4YJW A;  3ZC4 A;  5A6B D;  3W8I A;  3DMD A;  3B0V C;  3ZQY A;  3U0C A;  2B0J A;  2YRF A;  2L9J A;  5FCL A;  2H7V C;  4AL0 A;  1T5O A;  2VCC A;  2GA0 A;  4I1M A;  1TQG A;  3CZ6 A;  4YT8 A;  5L0F A;  5JVE A;  1QZX A;  1MMD A;  1OR2 A;  3IQT A;  3K6B A;  2OU6 A;  2QUP A;  3NYM A;  4MW8 A;  1LVK A;  5T3T A;  2HSQ A;  1DOW A;  4NTF A;  4JEA A;  2OJE D;  2IXP A;  1O3U A;  1UFB A;  4PFP A;  2BL2 A;  5T3W A;  1FFH A;  3GWN A;  3DJU B;  3FOO A;  3I4U A;  3A11 A;  3MX3 A;  2CDQ A;  1Q0F A;  2PBE A;  1CGM E;  5B1B C;  4ZLD A;  3S9O A;  5A6B A;  5A69 A;  3R7C A;  5IY5 C;  4IWB A;  5CI9 A;  4DRI B;  1U0B B;  3AGT A;  3ZVR A;  3M15 A;  2HJ3 A;  4PR9 A;  3VAY A;  2H7B A;  2KSF A;  3B9Q A;  1C03 A;  1NZE A;  3LES A;  4W8P A;  3FXH A;  1SF8 A;  1EKY A;  2A69 F;  1ZHZ A;  3PMR A;  5BQI A;  1T9K A;  1TWA A;  4AX2 A;  3Q7L A;  1I4Y A;  5T1D B;  3SXY A;  3EPV A;  4JKV A;  1M6T A;  4NTA A;  1YJG A;  2C03 A;  1A0B A;  2XLO A;  2Y3B A;  3X1O A;  3O10 A; 
#chains in the Genus database with same CATH homology
 1Q0F A;  1T6U A;  1Q0D A;  1Q0K A;  1T6I A;  1Q0G A;  1T6Q A;  3G4X A;  3G4Z A;  1Q0M A;  3G50 A;  4NCQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...