1Q0DA

Crystal structure of ni-containing superoxide dismutase with ni-ligation corresponding to the oxidized state
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
117
structure length
117
Chain Sequence
HCDLPCGVYDPAQARIEAESVKAIQEKMAANDDLHFQIRATVIKEQRAELAKHHLDVLWSDYFKPPHFESYPELHTLVNEAVKALSAAKASTDPATGQKALDYIAQIDKIFWETKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Ni]
publication title Crystal structure of nickel-containing superoxide dismutase reveals another type of active site
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 51
structure length 117
sequence length 117
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2003-07-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.400 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nickel-containing superoxide dismutase 1q0dA00
4NCQA 1Q0DA 1T6QA 3G50A 1Q0MA 1T6IA 3G4XA 3G4ZA 1Q0GA 1Q0KA 1T6UA 1Q0FA
chains in the Genus database with same CATH superfamily
4CIPA 3Q7GA 3NMIA 4JCHA 5IY5C 2C04A 3E9VA 1ZVZA 3WHNA 2Z15A 4U5FE 4JVSA 2EPLX 3ZDLA 5A69A 5COGA 3SXKA 2R7VA 3U9JA 2L6GA 1LS1A 4U5EE 5L0IA 1A7DA 1Y4CA 3DAGA 3FVYA 4HEAJ 4J7TA 2HSQA 1OCRC 3SXYA 3GM2A 3GWNA 3WAQA 4JJFA 3DWWA 2ASRA 1PD1A 4JTCB 1OR2A 4YN0B 3JRTA 3QTHA 5JS5A 3TQOA 3TJ6A 4I44A 4E7ZA 1I5NA 2XRHA 3AQBA 3E70C 3CQZA 2NSGA 3LESA 1QVXA 3AG3C 4U5BE 2ZXRA 1H9GA 3AG2C 1GQAA 4BJTA 2M64A 1YA7O 1NU9C 1VLTA 2PF4E 1XZQA 2LFFA 3B0VC 1CGME 2MYSA 5JSLA 3AOUA 2R7WA 3DZAA 3JSEO 4EWCA 3JZ0A 3RVYA 5AC5A 1PD0A 3HNKA 3NMJA 3NYLA 3HKKA 3M4BA 4IWBA 5B1AC 4BJ6A 3IHUA 3EH2A 5F5HA 3PHF2 4XLPF 1D1BA 1EI7A 3H65A 3K1HA 2C03A 5DS6A 3KL4A 4O7GA 3UMKA 1LPEA 2BL2A 3FMSA 4O6MA 4U5HA 1ORJA 3HTKC 4PJJA 2MHRA 2KQ9A 3T6GB 3UGOA 1G8XA 3EFOB 1Z3IX 2J9WA 2OKUA 4LLCA 4XQ1A 4EBJA 2JX0A 2XLMA 1D1CA 4U9EA 4XPYA 4AL0A 1ORSC 2OEXA 4DRJB 2YZSA 1Q0GA 1ZU5A 3CSKA 3KH2A 1S7ZA 3LLKA 5AGFA 3RIPA 3F46A 3LNRA 1A0BA 3EFOA 2PX0A 3QVYA 4G0HA 4KBLA 4XPXA 3W2WA 2V3CC 2EILC 1H7IA 1CGNA 2PFDA 3MX3A 2AU5A 2J45A 3SYNA 3VF0A 5KYYB 2HMZA 4Q5SF 2KYHA 2YQYA 1ZYRF 2BC5A 4LDRA 5FZTA 1OXBA 3DJNB 1AEPA 2IOQA 2WVOA 2NUPB 2OJQA 4ZLDA 4YWQA 3LLIA 1E83A 1TR2A 2Q9CA 1LM3B 3F47A 3VYWA 4DVZA 3LS0A 4MS2A 3BRJA 3C63A 4OIRF 5KYYA 4Z9IA 2M4EA 2GFHA 3EPVA 4DRIB 2XLVA 3EJNA 1Z5ZA 5L3VA 4X0RA 4BG0A 3C18A 1NG1A 4BEJA 2NUPA 2W4BA 3ECSA 4CDYA 4MTOA 5DS5A 2CGEA 2EPNA 2P7VA 3IEEA 2G62A 3U0CA 4M63A 5E3CA 2XS1A 2IM8A 5KYWB 1E85A 2HV6A 4G78A 5GPGB 1HW1A 5DS4A 2YKZA 3POVA 3SP1A 2TMVP 1C02A 1JRAA 4MVOA 4P6IC 2OOCA 4WGZA 4MVUA 2HUJA 5BQIA 2LK4A 1FNTc 5CIVA 3UR3C 2FAPB 3X2QC 3K33A 2P61A 4K0DA 5KYWA 1OXKA 3Q6MA 4LDKA 2H7OA 3SXMA 2VASA 5COFA 2R7UA 1WGWA 3KKBA 4LERA 3U3FA 1O5HA 4I1OB 2HFIA 3TOLA 4MW8A 4CSAC 5A6BD 1T6UA 3JRMO 2LSEA 3U2LA 1NBBA 1BZ4A 1EA8A 1J8MF 2A68F 2D4UA 4MNDA 2A69F 1RMVA 2AWCA 2ICWG 1ZHXA 4MTGA 4P9TA 4DOZA 2O9XA 3EGXB 3ABMC 2VCAA 2OQMA 3PCVA 2YL1A 1YZAA 1APCA 2J7PA 2XLWA 3JCUQ 1JAFA 2IXNA 3GODA 4XEKA 4QDLA 1NFNA 3KYJA 1E86A 2X0CA 3JSZA 5AC4A 3UMHA 3FDQA 2WVQA 2OJED 1TFKB 3EGXA 4IGGA 1WTYA 3OA1A 1Y6DA 2JPUA 3JTLO 2W9YA 1DOVA 4JTAB 4MQ9F 3ZSUA 4C3EA 3M4CA 2XL4A 1U6HA 3K1IC 5T3WA 4NCQA 4MW3A 3EQLF 5L0FA 2Y3DA 3AGUA 2OCCC 3FOPA 4LDQA 2WVNA 1KNYA 1YA9A 3LJBA 4K1OA 3LUTB 5CI9A 3U9MA 3AJMA 4GQHA 1R5ID 2WL8A 3H2UA 1FAPB 4YK5A 1MNEA 3S9OA 1IW7F 5HV9A 1C03A 2VH3A 3J06A 2G3VA 1YAUO 4BEMJ 3TULA 1OKKA 2PBEA 2LIGA 2WZFA 2X51A 1BDJB 1YDIA 2IXPA 2J9VA 3DXJF 1TWAA 3EZIA 3QZCA 1FFHA 1NSGB 4XWJA 3SNHA 2PNOA 3U2MA 3FHDA 4RBNA 3ABKC 1FMWA 3GWLA 4CDVA 5JVEA 1GM5A 3S29A 1Z7Qc 4RDAA 1T01A 2GDCA 1J8YF 2NG1A 1K05A 2XLOA 2ZXWC 3S28A 4E0HA 4Q4ZF 3NDBB 1V54C 1BR1A 1L7CA 2GWWA 1VYIA 2R7OA 2YWAA 4PFPA 1VOMA 4OIQF 2IYLD 5B1BC 2EPOA 3DI5A 3ZQYA 5KYNA 1RKCA 4N6HA 4D4XA 4OIPF 3O10A 1V4AA 1LI7A 3DKAA 3KMIA 1CGOA 1F1MA 2P1AA 5BUOA 1HE9A 2Q00A 2NSFA 3NRHA 2I15A 2J0WA 2HZ8A 3A9CA 2HSBA 2R9RB 2J0XA 4CS9A 3C7JA 4IB4A 4BJ5C 1O87A 4AE4B 2A0UA 3ZTMA 1YYJA 4IAOA 1TWCA 2XLEA 4CSAA 1T9KA 4G7ZF 5DVWA 2LP4A 5D92A 1D0YA 1Z63A 1LIHA 4U5GA 1H6GA 1RJ9A 2V26A 3QW1A 4PK4A 5E3AA 1ORYA 4AE4A 5A6AA 1QSPA 1ZHWA 2YEVA 5T3TA 5T1DB 2KSFA 1UFBA 2W45A 1Q0KA 2AWYA 5BQGA 4OINF 3B0UX 2L81A 1KTMA 1B68A 3S0XA 2A0BA 3EGDB 4AX2A 3K6BA 3KYIA 4HFKB 1VLSA 4DBQA 4ANJA 1HY5A 4CS7A 2DB4A 3X1OA 1A41A 2R7TA 3ATPA 4JZAA 1PCXA 5E33A 2AVKA 2HMQA 2KGOA 3S90A 1EQ1A 3RFYA 1RXQA 3K1IA 4PFOA 1HMOA 3EGDA 4NQFA 4IARA 3US6A 4CDAA 4D4NA 1ZW3A 1SMYF 2WB7A 1VYKA 2P6VA 2CCYA 2OG2A 4CS8C 4F4BA 1EKYA 3H2VA 4ER9A 3CEXA 5JT4A 4OIOF 2R02A 1YLMA 1G4WR 1TFOB 2H8AA 2OU6A 2EIMC 4UDVA 1TWGA 2YRFA 2XS8A 1A7VA 1N1CA 2R25A 1KU2A 4NY3A 1SR2A 5TJ5E 2MWQA 2EPKX 1QPUA 1V74B 1O3UA 3R2PA 3NYMA 4YT8A 2QE9A 2Q4FA 3HNLA 4OD4A 1RKEB 1YJGA 2UUHA 2VCBA 3G50A 1AUEA 4XEVA 2EIKC 1C17M 1M57C 2QTVA 3IQCA 3NYJA 2F22A 1XZPA 3FOOA 4R32A 4BJ1A 3AQCA 1WWPA 3W8HA 5A6BA 3RQFA 2VCCA 3EZHA 3LEOA 3O55A 1T6IA 1ZW2A 2HJ3A 2XLDA 3ZG1A 5L0HA 4ZLCA 1LKXA 1RKEA 4L6RA 4A2NB 4BPMA 3IQ5A 3T6BA 3B0PA 4JJGA 1NU7D 2UUIA 1QLEC 1OW6A 3TD7A 5L0JA 1NLXA 2H7VC 3HNJA 4JIOA 2R7QA 2Q3TA 2CW0F 1LI5A 2YL0A 4YJWA 2HKVA 4CS9C 2YVKA 4DXWA 2KNHA 4BJ5A 1ST6A 1UG7A 1OCCC 4I3MA 4I1MA 4YL1A 2PP4A 3B9QA 1WN0A 4QI0A 3C8GD 4K7BA 2FGYA 2EIJC 2YLGA 2OEVA 4O79A 4U5DE 4YT5A 1TKNA 3TK0A 2P0NA 4C3BA 3PDMP 2ZXPA 4EBBA 1Q0FA 3M15A 1CPQA 1JPJA 1SF8A 1YARO 1JOGA 2KW3C 4KC9A 4AK9A 3ABLC 3GM1A 4Z9HA 2CNWD 2RD9A 4NC3A 1OR3A 5HSWA 2J8WA 1U89A 2A1DD 2Q9AA 3N24A 1LVKA 3ASOC 4YT2A 2YL3A 3W8IA 2Y39A 1FFTC 5KYXB 1L3PA 2J9BA 2VB6A 3ZIBA 3NG1A 4J30B 4GEHA 1QKRA 4JTDB 2XXAB 2QUPA 2GA0A 3KPHA 1Q0MA 2DYRC 3N2ZB 4JE9A 4MVMA 1FTSA 3WODF 3L1MA 2ZD9A 1VK5A 2AP3A 3L8JA 4H54A 5KYXA 4IRUA 3ZTZA 3SXZA 3LEVA 4EHPA 4CS8A 2JD3A 2HS5A 4JRZA 1NZEA 4Z9JA 4EKWA 3CZ6A 4G7HF 2XXAA 2IXOA 4O6NA 3B71A 4XEFA 2J46A 4E0IA 3AGTA 1TWHA 2GAQA 4CJOA 3ITFA 2QLAA 3JT1A 1W2WA 3MBGA 5A6KA 3JYHA 2L7AA 1QQ3A 3SZRA 3CAXA 3GEHA 4RD9A 4XTKA 4XLNF 2B0JA 3EH1A 4NTFA 5JP7A 4EIYA 5K0IA 5L0GA 4G7OF 4DRHB 1FR0A 3HLZA 3TJ5A 1YZCA 2XLHA 3U8PA 2R05A 3QVZA 4EBKA 3R7CA 2PX3A 3G4XA 3L8IA 3EG9B 4MTFA 3VRCA 5EK0A 3JYYA 3U5SA 3OEOA 4E18A 1WASA 2Y69C 2DGJA 4U5CE 3TOMA 4FWVA 5BQHA 3GEEA 1QZXA 1RCPA 4JKVA 4C3DA 3AG4C 3C62A 2YLIA 2IBFA 3EG9A 1JR8A 3Q7LA 3V5XA 5DQZA 4JCZA 1GS9A 5D91A 1H9TA 1VTMP 1OCZC 1RJ9B 4JW1A 3DD7A 1IZMA 3DE8A 2XL6A 3SEOA 2G3KA 3MYIA 2RSEB 3GM3A 1T6QA 4Q7CA 4EUKB 1U0BB 1SZIA 3FAJA 1OCOC 3I5QA 2NUTB 1OKKD 3GANA 1ZHYA 2E87A 4IJJA 4JEAA 3T6JA 3V7OA 3W4YA 2DI3A 5L0CA 1E84A 4E17A 4DBRA 3DM5A 3NKEA 4ULWA 3MLGA 3RQGA 3NKDA 4FX5A 2NUTA 2QNLA 5L0DA 4IAQA 5FCLA 256BA 2R7XA 3FXHA 2HJMA 3UNGC 4LACB 3T4RA 2Y3BA 4J7YA 4LLEA 2LQGA 3W2VA 3RW0A 2R7RA 5EGYA 1PV3A 1BBHA 3I4UA 4HFFB 1OW7A 1T5OA 3I5PA 3ZVRA 2WZLA 2YL7A 4CX9A 2BE5F 4KNVA 1Z6AA 1LE4A 1ZZPA 5CI8A 1Z23A 2NPUA 3QW0A 3K7DA 2KC3A 2D5RB 5DLJA 4N4WA 4AL1A 2J9UA 4CIHA 2B0HA 3WG7C 3ZC4A 4N06A 1MMNA 3ZWIA 2FFHA 1ZHTA 1LE2A 2DYSC 1CPRA 4W8KA 3RKOF 2Q9BA 3C8GB 4MVZA 5KYUB 2Q7RA 4WGYA 3K66A 3IQ6A 1M6TA 4PR9A 3B29A 1D1AA 1S05A 3RYLA 1JPNA 5E2QA 1K40A 1SYQA 1M56C 2L6FA 1R4TA 4WABA 5B3IA 1D0XA 3DJUB 3C8GA 5KYUA 3DAFA 4NTAA 1MNDA 3VM6A 1V55C 4MVQA 3RF3A 4FAPB 2R7SA 5DQTA 1MMDA 2HV7A 3O6XA 4ULVA 2XSEA 3DM9B 2A6EF 5F5FA 3FAPB 4PJMA 3S84A 4KI2A 2LFDA 2R03A 2CNWA 1G4US 1HE1A 4CJGA 1WATA 1MMGA 1BR4A 2VC9A 1BR2A 3U8VA 3Q6NA 4JC7A 4E7SA 2KK1A 3IPMO 3M79A 1A7EA 3MYFA 1FMVA 4DJ9A 1M2OA 5A6JA 1DOWA 1XWJA 1G5ZA 3GEIA 4C7OB 4ONSA 1I4ZA 5B3SC 4O6YA 2EINC 3MFNA 1ZU4A 3LS1A 4A4AA 4PACA 3RVZA 3V5YA 1MQVA 3NMKA 3RQEA 4YT4A 1GGQA 1AVOB 1YYXA 4HE8D 4C7OA 3GORA 1TQGA 3HJCA 3UGPA 3BEHA 4JEBA 2L6HA 3QMKA 2WZGA 4FESA 2YHSA 4W8PA 3ZQVA 3DE9A 3U3BA 5JLIA 1NFOA 2A6HF 1HW2A 4NTBA 1Q0DA 3OWTA 2LCHA 3HNIA 3C8ZA 1I4YA 4CBEA 5L3QA 1JMWA 4YL0A 1VB5A 3N0TA 1YVIA 2Y3HA 2ZXOA 2ZPAA 3LAYA 2ETSA 4BJ6C 1E2XA 1M2VB 2XL8A 3M1CB 4PJNA 4QI2A 3L34A 5COMA 1HMDA 2Y3GA 2W4MA 2L9JA 2EPMX 2LD6A 2IXMA 1VMAA 2KJGA 4OD5A 5JUAA 5EHHA 5JRAA 3A11A 2XM0A 4U9DA 1M2VA 3L0IA 1OQCA 3ASNC 4J32B 4MVRA 2CDQA 1MMAA 4B6IA 1ZHZA 3AG1C 3RH3A 3S27A 2QY9A 3DMDA 5F28E 3VAYA 2I8BA 3T9OA 4N6CA 3IQTA 4JURI 4WJ0A 3V5ZA 1WOLA 4P9FA 3O39A 2H7BA 1OW8A 4DVYP 4XPWA 4PJLA 1LS4A 2J7PD 3LNMB 4H4KC 4KNWA 3UMIA 1D0ZA 2XM4A 3EHNA 4MVSA 2CYDA 4GYTA 4YL3A 3EHMA 3G4ZA 3PMRA 2YLDA 1K04A
chains in the Genus database with same CATH topology
4NCQA 1Q0DA 1T6QA 3G50A 1Q0MA 1T6IA 3G4XA 3G4ZA 1Q0GA 1Q0KA 1T6UA 1Q0FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NCQ A;  1Q0D A;  1T6Q A;  3G50 A;  1Q0M A;  1T6I A;  3G4X A;  3G4Z A;  1Q0G A;  1Q0K A;  1T6U A;  1Q0F A; 
#chains in the Genus database with same CATH topology
 4CIP A;  3Q7G A;  3NMI A;  4JCH A;  5IY5 C;  2C04 A;  3E9V A;  1ZVZ A;  3WHN A;  2Z15 A;  4U5F E;  4JVS A;  2EPL X;  3ZDL A;  5A69 A;  5COG A;  3SXK A;  2R7V A;  3U9J A;  2L6G A;  1LS1 A;  4U5E E;  5L0I A;  1A7D A;  1Y4C A;  3DAG A;  3FVY A;  4HEA J;  4J7T A;  2HSQ A;  1OCR C;  3SXY A;  3GM2 A;  3GWN A;  3WAQ A;  4JJF A;  3DWW A;  2ASR A;  1PD1 A;  4JTC B;  1OR2 A;  4YN0 B;  3JRT A;  3QTH A;  5JS5 A;  3TQO A;  3TJ6 A;  4I44 A;  4E7Z A;  1I5N A;  2XRH A;  3AQB A;  3E70 C;  3CQZ A;  2NSG A;  3LES A;  1QVX A;  3AG3 C;  4U5B E;  2ZXR A;  1H9G A;  3AG2 C;  1GQA A;  4BJT A;  2M64 A;  1YA7 O;  1NU9 C;  1VLT A;  2PF4 E;  1XZQ A;  2LFF A;  3B0V C;  1CGM E;  2MYS A;  5JSL A;  3AOU A;  2R7W A;  3DZA A;  3JSE O;  4EWC A;  3JZ0 A;  3RVY A;  5AC5 A;  1PD0 A;  3HNK A;  3NMJ A;  3NYL A;  3HKK A;  3M4B A;  4IWB A;  5B1A C;  4BJ6 A;  3IHU A;  3EH2 A;  5F5H A;  3PHF 2;  4XLP F;  1D1B A;  1EI7 A;  3H65 A;  3K1H A;  2C03 A;  5DS6 A;  3KL4 A;  4O7G A;  3UMK A;  1LPE A;  2BL2 A;  3FMS A;  4O6M A;  4U5H A;  1ORJ A;  3HTK C;  4PJJ A;  2MHR A;  2KQ9 A;  3T6G B;  3UGO A;  1G8X A;  3EFO B;  1Z3I X;  2J9W A;  2OKU A;  4LLC A;  4XQ1 A;  4EBJ A;  2JX0 A;  2XLM A;  1D1C A;  4U9E A;  4XPY A;  4AL0 A;  1ORS C;  2OEX A;  4DRJ B;  2YZS A;  1Q0G A;  1ZU5 A;  3CSK A;  3KH2 A;  1S7Z A;  3LLK A;  5AGF A;  3RIP A;  3F46 A;  3LNR A;  1A0B A;  3EFO A;  2PX0 A;  3QVY A;  4G0H A;  4KBL A;  4XPX A;  3W2W A;  2V3C C;  2EIL C;  1H7I A;  1CGN A;  2PFD A;  3MX3 A;  2AU5 A;  2J45 A;  3SYN A;  3VF0 A;  5KYY B;  2HMZ A;  4Q5S F;  2KYH A;  2YQY A;  1ZYR F;  2BC5 A;  4LDR A;  5FZT A;  1OXB A;  3DJN B;  1AEP A;  2IOQ A;  2WVO A;  2NUP B;  2OJQ A;  4ZLD A;  4YWQ A;  3LLI A;  1E83 A;  1TR2 A;  2Q9C A;  1LM3 B;  3F47 A;  3VYW A;  4DVZ A;  3LS0 A;  4MS2 A;  3BRJ A;  3C63 A;  4OIR F;  5KYY A;  4Z9I A;  2M4E A;  2GFH A;  3EPV A;  4DRI B;  2XLV A;  3EJN A;  1Z5Z A;  5L3V A;  4X0R A;  4BG0 A;  3C18 A;  1NG1 A;  4BEJ A;  2NUP A;  2W4B A;  3ECS A;  4CDY A;  4MTO A;  5DS5 A;  2CGE A;  2EPN A;  2P7V A;  3IEE A;  2G62 A;  3U0C A;  4M63 A;  5E3C A;  2XS1 A;  2IM8 A;  5KYW B;  1E85 A;  2HV6 A;  4G78 A;  5GPG B;  1HW1 A;  5DS4 A;  2YKZ A;  3POV A;  3SP1 A;  2TMV P;  1C02 A;  1JRA A;  4MVO A;  4P6I C;  2OOC A;  4WGZ A;  4MVU A;  2HUJ A;  5BQI A;  2LK4 A;  1FNT c;  5CIV A;  3UR3 C;  2FAP B;  3X2Q C;  3K33 A;  2P61 A;  4K0D A;  5KYW A;  1OXK A;  3Q6M A;  4LDK A;  2H7O A;  3SXM A;  2VAS A;  5COF A;  2R7U A;  1WGW A;  3KKB A;  4LER A;  3U3F A;  1O5H A;  4I1O B;  2HFI A;  3TOL A;  4MW8 A;  4CSA C;  5A6B D;  1T6U A;  3JRM O;  2LSE A;  3U2L A;  1NBB A;  1BZ4 A;  1EA8 A;  1J8M F;  2A68 F;  2D4U A;  4MND A;  2A69 F;  1RMV A;  2AWC A;  2ICW G;  1ZHX A;  4MTG A;  4P9T A;  4DOZ A;  2O9X A;  3EGX B;  3ABM C;  2VCA A;  2OQM A;  3PCV A;  2YL1 A;  1YZA A;  1APC A;  2J7P A;  2XLW A;  3JCU Q;  1JAF A;  2IXN A;  3GOD A;  4XEK A;  4QDL A;  1NFN A;  3KYJ A;  1E86 A;  2X0C A;  3JSZ A;  5AC4 A;  3UMH A;  3FDQ A;  2WVQ A;  2OJE D;  1TFK B;  3EGX A;  4IGG A;  1WTY A;  3OA1 A;  1Y6D A;  2JPU A;  3JTL O;  2W9Y A;  1DOV A;  4JTA B;  4MQ9 F;  3ZSU A;  4C3E A;  3M4C A;  2XL4 A;  1U6H A;  3K1I C;  5T3W A;  4NCQ A;  4MW3 A;  3EQL F;  5L0F A;  2Y3D A;  3AGU A;  2OCC C;  3FOP A;  4LDQ A;  2WVN A;  1KNY A;  1YA9 A;  3LJB A;  4K1O A;  3LUT B;  5CI9 A;  3U9M A;  3AJM A;  4GQH A;  1R5I D;  2WL8 A;  3H2U A;  1FAP B;  4YK5 A;  1MNE A;  3S9O A;  1IW7 F;  5HV9 A;  1C03 A;  2VH3 A;  3J06 A;  2G3V A;  1YAU O;  4BEM J;  3TUL A;  1OKK A;  2PBE A;  2LIG A;  2WZF A;  2X51 A;  1BDJ B;  1YDI A;  2IXP A;  2J9V A;  3DXJ F;  1TWA A;  3EZI A;  3QZC A;  1FFH A;  1NSG B;  4XWJ A;  3SNH A;  2PNO A;  3U2M A;  3FHD A;  4RBN A;  3ABK C;  1FMW A;  3GWL A;  4CDV A;  5JVE A;  1GM5 A;  3S29 A;  1Z7Q c;  4RDA A;  1T01 A;  2GDC A;  1J8Y F;  2NG1 A;  1K05 A;  2XLO A;  2ZXW C;  3S28 A;  4E0H A;  4Q4Z F;  3NDB B;  1V54 C;  1BR1 A;  1L7C A;  2GWW A;  1VYI A;  2R7O A;  2YWA A;  4PFP A;  1VOM A;  4OIQ F;  2IYL D;  5B1B C;  2EPO A;  3DI5 A;  3ZQY A;  5KYN A;  1RKC A;  4N6H A;  4D4X A;  4OIP F;  3O10 A;  1V4A A;  1LI7 A;  3DKA A;  3KMI A;  1CGO A;  1F1M A;  2P1A A;  5BUO A;  1HE9 A;  2Q00 A;  2NSF A;  3NRH A;  2I15 A;  2J0W A;  2HZ8 A;  3A9C A;  2HSB A;  2R9R B;  2J0X A;  4CS9 A;  3C7J A;  4IB4 A;  4BJ5 C;  1O87 A;  4AE4 B;  2A0U A;  3ZTM A;  1YYJ A;  4IAO A;  1TWC A;  2XLE A;  4CSA A;  1T9K A;  4G7Z F;  5DVW A;  2LP4 A;  5D92 A;  1D0Y A;  1Z63 A;  1LIH A;  4U5G A;  1H6G A;  1RJ9 A;  2V26 A;  3QW1 A;  4PK4 A;  5E3A A;  1ORY A;  4AE4 A;  5A6A A;  1QSP A;  1ZHW A;  2YEV A;  5T3T A;  5T1D B;  2KSF A;  1UFB A;  2W45 A;  1Q0K A;  2AWY A;  5BQG A;  4OIN F;  3B0U X;  2L81 A;  1KTM A;  1B68 A;  3S0X A;  2A0B A;  3EGD B;  4AX2 A;  3K6B A;  3KYI A;  4HFK B;  1VLS A;  4DBQ A;  4ANJ A;  1HY5 A;  4CS7 A;  2DB4 A;  3X1O A;  1A41 A;  2R7T A;  3ATP A;  4JZA A;  1PCX A;  5E33 A;  2AVK A;  2HMQ A;  2KGO A;  3S90 A;  1EQ1 A;  3RFY A;  1RXQ A;  3K1I A;  4PFO A;  1HMO A;  3EGD A;  4NQF A;  4IAR A;  3US6 A;  4CDA A;  4D4N A;  1ZW3 A;  1SMY F;  2WB7 A;  1VYK A;  2P6V A;  2CCY A;  2OG2 A;  4CS8 C;  4F4B A;  1EKY A;  3H2V A;  4ER9 A;  3CEX A;  5JT4 A;  4OIO F;  2R02 A;  1YLM A;  1G4W R;  1TFO B;  2H8A A;  2OU6 A;  2EIM C;  4UDV A;  1TWG A;  2YRF A;  2XS8 A;  1A7V A;  1N1C A;  2R25 A;  1KU2 A;  4NY3 A;  1SR2 A;  5TJ5 E;  2MWQ A;  2EPK X;  1QPU A;  1V74 B;  1O3U A;  3R2P A;  3NYM A;  4YT8 A;  2QE9 A;  2Q4F A;  3HNL A;  4OD4 A;  1RKE B;  1YJG A;  2UUH A;  2VCB A;  3G50 A;  1AUE A;  4XEV A;  2EIK C;  1C17 M;  1M57 C;  2QTV A;  3IQC A;  3NYJ A;  2F22 A;  1XZP A;  3FOO A;  4R32 A;  4BJ1 A;  3AQC A;  1WWP A;  3W8H A;  5A6B A;  3RQF A;  2VCC A;  3EZH A;  3LEO A;  3O55 A;  1T6I A;  1ZW2 A;  2HJ3 A;  2XLD A;  3ZG1 A;  5L0H A;  4ZLC A;  1LKX A;  1RKE A;  4L6R A;  4A2N B;  4BPM A;  3IQ5 A;  3T6B A;  3B0P A;  4JJG A;  1NU7 D;  2UUI A;  1QLE C;  1OW6 A;  3TD7 A;  5L0J A;  1NLX A;  2H7V C;  3HNJ A;  4JIO A;  2R7Q A;  2Q3T A;  2CW0 F;  1LI5 A;  2YL0 A;  4YJW A;  2HKV A;  4CS9 C;  2YVK A;  4DXW A;  2KNH A;  4BJ5 A;  1ST6 A;  1UG7 A;  1OCC C;  4I3M A;  4I1M A;  4YL1 A;  2PP4 A;  3B9Q A;  1WN0 A;  4QI0 A;  3C8G D;  4K7B A;  2FGY A;  2EIJ C;  2YLG A;  2OEV A;  4O79 A;  4U5D E;  4YT5 A;  1TKN A;  3TK0 A;  2P0N A;  4C3B A;  3PDM P;  2ZXP A;  4EBB A;  1Q0F A;  3M15 A;  1CPQ A;  1JPJ A;  1SF8 A;  1YAR O;  1JOG A;  2KW3 C;  4KC9 A;  4AK9 A;  3ABL C;  3GM1 A;  4Z9H A;  2CNW D;  2RD9 A;  4NC3 A;  1OR3 A;  5HSW A;  2J8W A;  1U89 A;  2A1D D;  2Q9A A;  3N24 A;  1LVK A;  3ASO C;  4YT2 A;  2YL3 A;  3W8I A;  2Y39 A;  1FFT C;  5KYX B;  1L3P A;  2J9B A;  2VB6 A;  3ZIB A;  3NG1 A;  4J30 B;  4GEH A;  1QKR A;  4JTD B;  2XXA B;  2QUP A;  2GA0 A;  3KPH A;  1Q0M A;  2DYR C;  3N2Z B;  4JE9 A;  4MVM A;  1FTS A;  3WOD F;  3L1M A;  2ZD9 A;  1VK5 A;  2AP3 A;  3L8J A;  4H54 A;  5KYX A;  4IRU A;  3ZTZ A;  3SXZ A;  3LEV A;  4EHP A;  4CS8 A;  2JD3 A;  2HS5 A;  4JRZ A;  1NZE A;  4Z9J A;  4EKW A;  3CZ6 A;  4G7H F;  2XXA A;  2IXO A;  4O6N A;  3B71 A;  4XEF A;  2J46 A;  4E0I A;  3AGT A;  1TWH A;  2GAQ A;  4CJO A;  3ITF A;  2QLA A;  3JT1 A;  1W2W A;  3MBG A;  5A6K A;  3JYH A;  2L7A A;  1QQ3 A;  3SZR A;  3CAX A;  3GEH A;  4RD9 A;  4XTK A;  4XLN F;  2B0J A;  3EH1 A;  4NTF A;  5JP7 A;  4EIY A;  5K0I A;  5L0G A;  4G7O F;  4DRH B;  1FR0 A;  3HLZ A;  3TJ5 A;  1YZC A;  2XLH A;  3U8P A;  2R05 A;  3QVZ A;  4EBK A;  3R7C A;  2PX3 A;  3G4X A;  3L8I A;  3EG9 B;  4MTF A;  3VRC A;  5EK0 A;  3JYY A;  3U5S A;  3OEO A;  4E18 A;  1WAS A;  2Y69 C;  2DGJ A;  4U5C E;  3TOM A;  4FWV A;  5BQH A;  3GEE A;  1QZX A;  1RCP A;  4JKV A;  4C3D A;  3AG4 C;  3C62 A;  2YLI A;  2IBF A;  3EG9 A;  1JR8 A;  3Q7L A;  3V5X A;  5DQZ A;  4JCZ A;  1GS9 A;  5D91 A;  1H9T A;  1VTM P;  1OCZ C;  1RJ9 B;  4JW1 A;  3DD7 A;  1IZM A;  3DE8 A;  2XL6 A;  3SEO A;  2G3K A;  3MYI A;  2RSE B;  3GM3 A;  1T6Q A;  4Q7C A;  4EUK B;  1U0B B;  1SZI A;  3FAJ A;  1OCO C;  3I5Q A;  2NUT B;  1OKK D;  3GAN A;  1ZHY A;  2E87 A;  4IJJ A;  4JEA A;  3T6J A;  3V7O A;  3W4Y A;  2DI3 A;  5L0C A;  1E84 A;  4E17 A;  4DBR A;  3DM5 A;  3NKE A;  4ULW A;  3MLG A;  3RQG A;  3NKD A;  4FX5 A;  2NUT A;  2QNL A;  5L0D A;  4IAQ A;  5FCL A;  256B A;  2R7X A;  3FXH A;  2HJM A;  3UNG C;  4LAC B;  3T4R A;  2Y3B A;  4J7Y A;  4LLE A;  2LQG A;  3W2V A;  3RW0 A;  2R7R A;  5EGY A;  1PV3 A;  1BBH A;  3I4U A;  4HFF B;  1OW7 A;  1T5O A;  3I5P A;  3ZVR A;  2WZL A;  2YL7 A;  4CX9 A;  2BE5 F;  4KNV A;  1Z6A A;  1LE4 A;  1ZZP A;  5CI8 A;  1Z23 A;  2NPU A;  3QW0 A;  3K7D A;  2KC3 A;  2D5R B;  5DLJ A;  4N4W A;  4AL1 A;  2J9U A;  4CIH A;  2B0H A;  3WG7 C;  3ZC4 A;  4N06 A;  1MMN A;  3ZWI A;  2FFH A;  1ZHT A;  1LE2 A;  2DYS C;  1CPR A;  4W8K A;  3RKO F;  2Q9B A;  3C8G B;  4MVZ A;  5KYU B;  2Q7R A;  4WGY A;  3K66 A;  3IQ6 A;  1M6T A;  4PR9 A;  3B29 A;  1D1A A;  1S05 A;  3RYL A;  1JPN A;  5E2Q A;  1K40 A;  1SYQ A;  1M56 C;  2L6F A;  1R4T A;  4WAB A;  5B3I A;  1D0X A;  3DJU B;  3C8G A;  5KYU A;  3DAF A;  4NTA A;  1MND A;  3VM6 A;  1V55 C;  4MVQ A;  3RF3 A;  4FAP B;  2R7S A;  5DQT A;  1MMD A;  2HV7 A;  3O6X A;  4ULV A;  2XSE A;  3DM9 B;  2A6E F;  5F5F A;  3FAP B;  4PJM A;  3S84 A;  4KI2 A;  2LFD A;  2R03 A;  2CNW A;  1G4U S;  1HE1 A;  4CJG A;  1WAT A;  1MMG A;  1BR4 A;  2VC9 A;  1BR2 A;  3U8V A;  3Q6N A;  4JC7 A;  4E7S A;  2KK1 A;  3IPM O;  3M79 A;  1A7E A;  3MYF A;  1FMV A;  4DJ9 A;  1M2O A;  5A6J A;  1DOW A;  1XWJ A;  1G5Z A;  3GEI A;  4C7O B;  4ONS A;  1I4Z A;  5B3S C;  4O6Y A;  2EIN C;  3MFN A;  1ZU4 A;  3LS1 A;  4A4A A;  4PAC A;  3RVZ A;  3V5Y A;  1MQV A;  3NMK A;  3RQE A;  4YT4 A;  1GGQ A;  1AVO B;  1YYX A;  4HE8 D;  4C7O A;  3GOR A;  1TQG A;  3HJC A;  3UGP A;  3BEH A;  4JEB A;  2L6H A;  3QMK A;  2WZG A;  4FES A;  2YHS A;  4W8P A;  3ZQV A;  3DE9 A;  3U3B A;  5JLI A;  1NFO A;  2A6H F;  1HW2 A;  4NTB A;  1Q0D A;  3OWT A;  2LCH A;  3HNI A;  3C8Z A;  1I4Y A;  4CBE A;  5L3Q A;  1JMW A;  4YL0 A;  1VB5 A;  3N0T A;  1YVI A;  2Y3H A;  2ZXO A;  2ZPA A;  3LAY A;  2ETS A;  4BJ6 C;  1E2X A;  1M2V B;  2XL8 A;  3M1C B;  4PJN A;  4QI2 A;  3L34 A;  5COM A;  1HMD A;  2Y3G A;  2W4M A;  2L9J A;  2EPM X;  2LD6 A;  2IXM A;  1VMA A;  2KJG A;  4OD5 A;  5JUA A;  5EHH A;  5JRA A;  3A11 A;  2XM0 A;  4U9D A;  1M2V A;  3L0I A;  1OQC A;  3ASN C;  4J32 B;  4MVR A;  2CDQ A;  1MMA A;  4B6I A;  1ZHZ A;  3AG1 C;  3RH3 A;  3S27 A;  2QY9 A;  3DMD A;  5F28 E;  3VAY A;  2I8B A;  3T9O A;  4N6C A;  3IQT A;  4JUR I;  4WJ0 A;  3V5Z A;  1WOL A;  4P9F A;  3O39 A;  2H7B A;  1OW8 A;  4DVY P;  4XPW A;  4PJL A;  1LS4 A;  2J7P D;  3LNM B;  4H4K C;  4KNW A;  3UMI A;  1D0Z A;  2XM4 A;  3EHN A;  4MVS A;  2CYD A;  4GYT A;  4YL3 A;  3EHM A;  3G4Z A;  3PMR A;  2YLD A;  1K04 A; 
#chains in the Genus database with same CATH homology
 4NCQ A;  1Q0D A;  1T6Q A;  3G50 A;  1Q0M A;  1T6I A;  3G4X A;  3G4Z A;  1Q0G A;  1Q0K A;  1T6U A;  1Q0F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...