1Q0DA

Crystal structure of ni-containing superoxide dismutase with ni-ligation corresponding to the oxidized state
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
117
structure length
117
Chain Sequence
b'HCDLPCGVYDPAQARIEAESVKAIQEKMAANDDLHFQIRATVIKEQRAELAKHHLDVLWSDYFKPPHFESYPELHTLVNEAVKALSAAKASTDPATGQKALDYIAQIDKIFWETKKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Ni]
publication title Crystal structure of nickel-containing superoxide dismutase reveals another type of active site
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 51
structure length 117
sequence length 117
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2003-07-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.400 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nickel-containing superoxide dismutase 1q0dA00
3G50A 1Q0FA 1Q0GA 1Q0KA 1T6QA 1T6IA 1Q0DA 3G4XA 1T6UA 4NCQA 3G4ZA 1Q0MA
chains in the Genus database with same CATH superfamily
1BDJB 3U2MA 4OIQF 4U5GA 1OCOC 3M79A 1CPRA 3S9OA 3UMKA 1L3PA 5KYYB 2EIJC 4BJ5A 5A69A 4OIRF 3MYIA 2JPUA 2W9YA 3EZHA 2NUPB 3GWNA 3NRHA 3TOLA 4MVSA 4FAPB 4E18A 4UDVA 2G62A 2EPKX 1J8MF 2FAPB 1FR0A 2M4EA 2HUJA 1TWCA 2YEVA 3C63A 3AG2C 2A1DD 1YYXA 2R9RB 3U8PA 4XEKA 1OCZC 1CGME 1VK5A 1T5OA 3SYNA 2WL8A 4CSAC 4HE8D 1B68A 1ZVZA 2OEVA 3N2ZB 1TKNA 2OG2A 1T01A 4W8PA 3WHNA 1EKYA 2GA0A 3SXYA 3RW0A 3MFNA 3EFOA 2AWCA 4BJ6C 4HFFB 4IRUA 2A6HF 2HFIA 1G5ZA 2P1AA 3DM9B 3G4XA 5KYUA 3RVZA 2A0UA 1RKEB 3F46A 1VLTA 4DBQA 4KNVA 2NUTB 4G7HF 3QW0A 2IOQA 1HE1A 3E9VA 4DRHB 4CSAA 2YRFA 4LDRA 1QKRA 3JRMO 2YL3A 4MVZA 4MNDA 5T3WA 2PX3A 3EH2A 3V5ZA 4BJ6A 2LIGA 3WG7C 1M57C 2VCBA 4C7OB 2WZFA 3TK0A 2AVKA 4AL0A 2R7RA 3RFYA 2ZXPA 3W8IA 4AL1A 1GM5A 4YT5A 2EIKC 4P6IC 4A2NB 1MMAA 2NSGA 1S05A 2W4BA 3ATPA 1ORYA 4JURI 2LP4A 2NPUA 3JTLO 1FMVA 3ZSUA 2MHRA 1YDIA 4MTGA 1T6UA 4CS9C 5KYWB 3IEEA 4HFKB 3L0IA 1LVKA 1Z3IX 4JIOA 4IGGA 4O6YA 3ABLC 3T6GB 3UR3C 4EIYA 2TMVP 1YZCA 3K66A 4K1OA 2KJGA 2R7WA 4JRZA 3DMDA 4P9TA 3ITFA 4IARA 3R2PA 5DS6A 1BBHA 3DWWA 4OD5A 4D4XA 3JSEO 3U3BA 3NMIA 3X2QC 1KU2A 3U0CA 4CS9A 1K04A 3EHNA 3NDBB 1WTYA 2J9WA 2VH3A 5A6JA 1R4TA 5BQIA 2R25A 4G0HA 4PJMA 2L9JA 2P0NA 4EWCA 3NG1A 4JZAA 1MNDA 1QVXA 2J0WA 5KYNA 1L7CA 1N1CA 3RVYA 1APCA 4DJ9A 2FGYA 4ONSA 4YWQA 4AK9A 1Z6AA 2Y3DA 2YWAA 3EPVA 3QVZA 4QDLA 2UUIA 3UMIA 1SZIA 1LS4A 3CSKA 1TQGA 3UMHA 2LQGA 2P7VA 2ZXWC 3EG9A 4ZLCA 3B71A 2XXAA 1Q0MA 1MQVA 4I3MA 5B3SC 3LNRA 3QTHA 3KKBA 2P6VA 2EPNA 2L6HA 2EPMX 4PJLA 1M2VA 1CGOA 1WATA 4N4WA 3EHMA 3EZIA 3JT1A 4EUKB 1E86A 4CJGA 5JT4A 2VCAA 1ZHXA 1NFNA 4XPYA 5IY5C 3HTKC 3RH3A 5KYXA 4PJJA 2QTVA 1A41A 2YZSA 3FMSA 2QUPA 1TWGA 5AGFA 4WABA 1PV3A 1FAPB 2F22A 2BL2A 1O3UA 3I5QA 4LERA 1LPEA 2DB4A 2VASA 4MQ9F 1QQ3A 4MW8A 1OCCC 3G4ZA 3GM2A 4Z9HA 1OCRC 4XLNF 4NC3A 4JEAA 5L0CA 3KH2A 3AGUA 3DI5A 1NG1A 4YL3A 1UFBA 3TJ6A 2I8BA 4CDYA 1YA9A 2CCYA 2RD9A 3CQZA 1RKCA 3GM1A 1HY5A 3IQTA 4YL0A 3RKOF 1LE2A 4XEFA 2XLDA 3T6BA 3AOUA 3KYIA 3EQLF 2QY9A 2FFHA 3LESA 1PD1A 4KC9A 2R7VA 1YAUO 4MVQA 3LLIA 3U9MA 3NMJA 4WJ0A 1BR4A 1ZYRF 3M4BA 4RDAA 3V5YA 1GQAA 4NTFA 3TD7A 1T6QA 4WGZA 4XEVA 3OEOA 4LDKA 4E0HA 2Q00A 4O79A 3RYLA 4XQ1A 5FCLA 1YJGA 2Q3TA 3LAYA 3C8ZA 2YKZA 1OQCA 3LJBA 1KTMA 1JAFA 4ULVA 3R7CA 3LNMB 4O7GA 1ZHZA 1NSGB 2KW3C 4OIPF 5L3QA 3X1OA 2A6EF 4FESA 4J7YA 3DAGA 2XLHA 2OEXA 3JSZA 3BRJA 4AE4B 256BA 3U2LA 3NYMA 4YT2A 1UG7A 2R7TA 1NFOA 2KQ9A 2A0BA 3L1MA 1YZAA 3DD7A 1JOGA 5COMA 1VTMP 3Q6NA 1OW7A 2WVNA 4CDVA 2YLGA 2C04A 1OXKA 2J9BA 3AJMA 2XS8A 5B1AC 4DRIB 3J06A 4L6RA 2GDCA 2Y3GA 3AQCA 1LS1A 3IPMO 1ZW2A 4YK5A 5K0IA 2AU5A 3NKEA 1C02A 3Q7LA 4IJJA 5B3IA 1ZHWA 5E3AA 4U5EE 2HV6A 4O6MA 2D4UA 3QMKA 3VAYA 1QLEC 3EFOB 3OWTA 1WOLA 3AQBA 1BR1A 3C7JA 1J8YF 4EBBA 2Y3HA 2HJ3A 4PR9A 3CZ6A 2BE5F 1H7IA 1T9KA 1XWJA 2J7PD 5KYUB 1RXQA 4MTFA 2LFFA 1ZHYA 3C8GD 3DXJF 3VF0A 5L0FA 1D1BA 2DGJA 2DYSC 4DBRA 4G7OF 5EHHA 4U5BE 4YL1A 4JTDB 5GPGB 5DLJA 3C18A 4BG0A 3HLZA 4EHPA 3O55A 1FFHA 4IAOA 3ZIBA 5JUAA 1FMWA 4PACA 1YA7O 2CNWD 4U5DE 2MYSA 4HEAJ 1M56C 4JTCB 3KPHA 1VLSA 3ZVRA 1HMOA 2E87A 2OJED 1I4ZA 2OU6A 3N0TA 2R7UA 1V74B 3L8JA 2YLIA 3LUTB 1AUEA 4C3EA 2R7OA 2EPOA 3TQOA 3A9CA 2J46A 2IM8A 1AEPA 1FFTC 2R02A 3SXMA 3E70C 1CPQA 4IAQA 4J32B 2G3KA 1OKKD 3RF3A 3IQCA 1NU9C 4CS7A 5L3VA 3LLKA 2V26A 3AG4C 3UGPA 3EJNA 2RSEB 3C62A 4K7BA 1O87A 1HW2A 1U89A 2NSFA 2WVOA 4AE4A 4KI2A 5T3TA 1H9GA 2L7AA 1Z5ZA 2ZPAA 1BZ4A 1T6IA 1A7EA 3O6XA 1SMYF 1G8XA 3NKDA 3PCVA 3AG3C 4Q4ZF 4P9FA 4MVOA 3IQ6A 2LCHA 3DAFA 4G78A 3GEIA 3ZQYA 3U9JA 1AVOB 3MX3A 1LE4A 1ST6A 3CEXA 4QI0A 1A7VA 3V7OA 1MMNA 4F4BA 2CYDA 5AC5A 3LEOA 5EK0A 1K40A 3KMIA 2XXAB 2WZLA 1M2OA 1ORJA 2JX0A 2W45A 1D1AA 1VYIA 3A11A 1SR2A 2KSFA 2PP4A 3GANA 4JKVA 4BEJA 3HNIA 3ZG1A 2R03A 1TR2A 1MMDA 1Y4CA 3EH1A 4JTAB 2XLVA 1NLXA 3GODA 3JZ0A 3QW1A 2IXNA 4DVYP 3JYHA 3DE8A 1JPJA 2QNLA 2NG1A 3POVA 3U3FA 5E2QA 3HNJA 5KYXB 4J7TA 3EGXA 2PBEA 1OR3A 4XPWA 3S29A 3WODF 4BEMJ 5F5FA 5F5HA 4CS8C 3TOMA 5EGYA 2XL6A 5A6AA 1F1MA 1GGQA 4YT8A 2IBFA 4MS2A 3N24A 5B1BC 4U9EA 4JJGA 3VYWA 5HSWA 2R7SA 3SP1A 1D0YA 2BC5A 5F28E 3W2VA 2PFDA 3AGTA 2QE9A 2PX0A 4IB4A 4E7SA 5D92A 1QZXA 4CS8A 1JMWA 2Y3BA 4KBLA 4NTAA 1IW7F 1LKXA 2LD6A 4ULWA 2KNHA 3NMKA 3VRCA 1WWPA 3KYJA 4XPXA 1FTSA 3ECSA 2HSBA 3HNKA 3SXKA 2WVQA 5A6BD 5L0JA 4Z9IA 3F47A 2H7BA 2HJMA 3ASNC 4LDQA 1D1CA 3ZQVA 4Q5SF 3KL4A 3K33A 2YHSA 2J0XA 3EGDA 1ZU5A 2IXMA 2J7PA 3GORA 4RD9A 3FXHA 4R32A 2YL7A 3U8VA 3HJCA 3V5XA 2ZXOA 3C8GA 2X0CA 5JVEA 2LFDA 1EQ1A 5BQGA 5JP7A 1WN0A 4CIHA 1D0ZA 3ZTZA 2HMQA 3K7DA 4K0DA 4CBEA 4BJTA 1V4AA 3FDQA 2MWQA 2CGEA 4PFOA 3B0VC 2L6GA 3Q6MA 4I44A 1E2XA 2X51A 3ASOC 1U6HA 2GWWA 3TULA 4BPMA 2CNWA 2CW0F 2XM4A 5JSLA 4BJ1A 2VC9A 1H6GA 2GFHA 2EPLX 2Q9AA 3O10A 4XWJA 4U5CE 4MVUA 5COFA 3RQGA 1RJ9A 1DOVA 4FX5A 3OA1A 3O39A 2W4MA 3GEHA 2OJQA 3ABKC 3QVYA 1A7DA 5TJ5E 3B0PA 3M15A 3VM6A 1MMGA 2H7OA 2VCCA 2Y69C 3K1IC 4CX9A 2V3CC 4U9DA 4GQHA 3RQEA 5KYYA 3B0UX 2ZD9A 1TFKB 2Q7RA 2HSQA 4JEBA 2HMZA 5L0HA 1OKKA 2NUPA 3FOPA 1S7ZA 1LI7A 2Z15A 2UUHA 3FHDA 3B9QA 1FNTc 2EIMC 3K1IA 3T9OA 1ZU4A 1WASA 1QSPA 3RQFA 4DOZA 1H9TA 3S27A 2KC3A 4E0IA 3DM5A 2XM0A 1Q0KA 3S90A 2I15A 4NTBA 4JCHA 5CI8A 4MW3A 4CJOA 1YYJA 5DS4A 1C03A 3H2VA 2HKVA 1RCPA 2XS1A 5E33A 3SEOA 1YARO 1TWAA 1WGWA 1EI7A 3UGOA 2ETSA 1G4US 4LLEA 1OW8A 1A0BA 1RKEA 5AC4A 2NUTA 4WGYA 4Q7CA 2OQMA 2AWYA 1OW6A 4C3BA 2Q4FA 2J9VA 1CGNA 3FOOA 3CAXA 4JE9A 5COGA 2R05A 4GYTA 5JLIA 1JR8A 3LEVA 4M63A 4C7OA 1NZEA 3H65A 4DRJB 4U5FE 3B29A 4W8KA 3H2UA 1Q0DA 2HZ8A 4YJWA 1PD0A 2YQYA 4PFPA 1Y6DA 5D91A 3U5SA 3IHUA 5T1DB 1RMVA 3G50A 1D0XA 4GEHA 2IXPA 1ORSC 4I1OB 4O6NA 5L0GA 3PHF2 4RBNA 4ANJA 3W8HA 5L0IA 4AX2A 2VB6A 5JRAA 2OKUA 3DKAA 1HMDA 3PMRA 2AP3A 3GM3A 1OXBA 2A68F 2HV7A 1LIHA 4EBJA 1Z23A 3GEEA 2PNOA 3GWLA 5KYWA 3US6A 4U5HA 2XSEA 4QI2A 4J30B 1JPNA 2GAQA 2YL0A 5E3CA 4YT4A 2H7VC 4XTKA 1XZPA 2L81A 2CDQA 2ICWG 4JC7A 5JS5A 3NYJA 2PF4E 4JJFA 5A6BA 1VOMA 2Q9BA 3M1CB 4MVMA 1Q0GA 2M64A 1XZQA 4X0RA 3S28A 2B0JA 5L0DA 1VMAA 2H8AA 2P61A 3QZCA 2XLOA 3EG9B 3M4CA 3JCUQ 2XLWA 4NCQA 1BR2A 2QLAA 2XL4A 3Q7GA 3SXZA 1YLMA 2O9XA 2YL1A 4OINF 2IYLD 3ZWIA 4MTOA 2XRHA 4H4KC 2A69F 4B6IA 3PDMP 1DOWA 2J8WA 4N6HA 4I1MA 1M2VB 5A6KA 4NY3A 5CI9A 1OR2A 3AG1C 2R7XA 4MVRA 1TFOB 2R7QA 3BEHA 4PJNA 4XLPF 3JYYA 3DZAA 4DVZA 1MNEA 2Y39A 3HNLA 4EBKA 4OD4A 4E7ZA 2IXOA 4FWVA 1W2WA 1PCXA 5DQZA 2YVKA 4ER9A 3FVYA 1Z63A 1R5ID 4LACB 2JD3A 1E83A 1ZZPA 3IQ5A 3DJUB 2OOCA 3JRTA 3W4YA 4D4NA 4C3DA 3EGXB 3FAPB 2WZGA 5BUOA 3WAQA 4DXWA 4PK4A 1I4YA 2G3VA 2B0HA 2EINC 1O5HA 1SYQA 1YVIA 2C03A 1ZHTA 5BQHA 4JCZA 2Q9CA 3DJNB 1Z7Qc 1GS9A 5HV9A 3TJ5A 5DS5A 1LM3B 3S84A 1U0BB 3S0XA 3LS0A 1KNYA 4IWBA 1NBBA 3W2WA 3DE9A 2DI3A 1K05A 2WB7A 2J9UA 1SF8A 3ABMC 3K6BA 4H54A 1V55C 5FZTA 3UNGC 1QPUA 5CIVA 1TWHA 2KK1A 4N6CA 3SNHA 1V54C 1I5NA 2L6FA 3K1HA 3I4UA 3LS1A 4JVSA 3SZRA 4EKWA 1G4WR 3EGDB 1VB5A 4CIPA 4G7ZF 2KGOA 4YN0B 2J45A 3ZDLA 3C8GB 2DYRC 4KNWA 4N06A 2HS5A 2LK4A 5DQTA 5DVWA 3L34A 1ZW3A 2ASRA 2D5RB 2XL8A 3ZTMA 3I5PA 3HKKA 1E85A 1VYKA 2KYHA 3NYLA 1E84A 1Q0FA 3MLGA 1NU7D 1LI5A 2YLDA 3T6JA 1IZMA 3L8IA 2LSEA 4A4AA 4NQFA 4E17A 3FAJA 4BJ5C 4CDAA 3RIPA 3ZC4A 3MYFA 2EILC 4OIOF 1HE9A 3MBGA 1HW1A 4Z9JA 2OCCC 1C17M 2XLEA 4LLCA 1JRAA 1EA8A 4ZLDA 2ZXRA 1M6TA 1RJ9B 2XLMA 4JW1A 3T4RA
chains in the Genus database with same CATH topology
3G50A 1Q0FA 1Q0GA 1Q0KA 1T6QA 1T6IA 1Q0DA 3G4XA 1T6UA 4NCQA 3G4ZA 1Q0MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G50 A;  1Q0F A;  1Q0G A;  1Q0K A;  1T6Q A;  1T6I A;  1Q0D A;  3G4X A;  1T6U A;  4NCQ A;  3G4Z A;  1Q0M A; 
#chains in the Genus database with same CATH topology
 1BDJ B;  3U2M A;  4OIQ F;  4U5G A;  1OCO C;  3M79 A;  1CPR A;  3S9O A;  3UMK A;  1L3P A;  5KYY B;  2EIJ C;  4BJ5 A;  5A69 A;  4OIR F;  3MYI A;  2JPU A;  2W9Y A;  3EZH A;  2NUP B;  3GWN A;  3NRH A;  3TOL A;  4MVS A;  4FAP B;  4E18 A;  4UDV A;  2G62 A;  2EPK X;  1J8M F;  2FAP B;  1FR0 A;  2M4E A;  2HUJ A;  1TWC A;  2YEV A;  3C63 A;  3AG2 C;  2A1D D;  1YYX A;  2R9R B;  3U8P A;  4XEK A;  1OCZ C;  1CGM E;  1VK5 A;  1T5O A;  3SYN A;  2WL8 A;  4CSA C;  4HE8 D;  1B68 A;  1ZVZ A;  2OEV A;  3N2Z B;  1TKN A;  2OG2 A;  1T01 A;  4W8P A;  3WHN A;  1EKY A;  2GA0 A;  3SXY A;  3RW0 A;  3MFN A;  3EFO A;  2AWC A;  4BJ6 C;  4HFF B;  4IRU A;  2A6H F;  2HFI A;  1G5Z A;  2P1A A;  3DM9 B;  3G4X A;  5KYU A;  3RVZ A;  2A0U A;  1RKE B;  3F46 A;  1VLT A;  4DBQ A;  4KNV A;  2NUT B;  4G7H F;  3QW0 A;  2IOQ A;  1HE1 A;  3E9V A;  4DRH B;  4CSA A;  2YRF A;  4LDR A;  1QKR A;  3JRM O;  2YL3 A;  4MVZ A;  4MND A;  5T3W A;  2PX3 A;  3EH2 A;  3V5Z A;  4BJ6 A;  2LIG A;  3WG7 C;  1M57 C;  2VCB A;  4C7O B;  2WZF A;  3TK0 A;  2AVK A;  4AL0 A;  2R7R A;  3RFY A;  2ZXP A;  3W8I A;  4AL1 A;  1GM5 A;  4YT5 A;  2EIK C;  4P6I C;  4A2N B;  1MMA A;  2NSG A;  1S05 A;  2W4B A;  3ATP A;  1ORY A;  4JUR I;  2LP4 A;  2NPU A;  3JTL O;  1FMV A;  3ZSU A;  2MHR A;  1YDI A;  4MTG A;  1T6U A;  4CS9 C;  5KYW B;  3IEE A;  4HFK B;  3L0I A;  1LVK A;  1Z3I X;  4JIO A;  4IGG A;  4O6Y A;  3ABL C;  3T6G B;  3UR3 C;  4EIY A;  2TMV P;  1YZC A;  3K66 A;  4K1O A;  2KJG A;  2R7W A;  4JRZ A;  3DMD A;  4P9T A;  3ITF A;  4IAR A;  3R2P A;  5DS6 A;  1BBH A;  3DWW A;  4OD5 A;  4D4X A;  3JSE O;  3U3B A;  3NMI A;  3X2Q C;  1KU2 A;  3U0C A;  4CS9 A;  1K04 A;  3EHN A;  3NDB B;  1WTY A;  2J9W A;  2VH3 A;  5A6J A;  1R4T A;  5BQI A;  2R25 A;  4G0H A;  4PJM A;  2L9J A;  2P0N A;  4EWC A;  3NG1 A;  4JZA A;  1MND A;  1QVX A;  2J0W A;  5KYN A;  1L7C A;  1N1C A;  3RVY A;  1APC A;  4DJ9 A;  2FGY A;  4ONS A;  4YWQ A;  4AK9 A;  1Z6A A;  2Y3D A;  2YWA A;  3EPV A;  3QVZ A;  4QDL A;  2UUI A;  3UMI A;  1SZI A;  1LS4 A;  3CSK A;  1TQG A;  3UMH A;  2LQG A;  2P7V A;  2ZXW C;  3EG9 A;  4ZLC A;  3B71 A;  2XXA A;  1Q0M A;  1MQV A;  4I3M A;  5B3S C;  3LNR A;  3QTH A;  3KKB A;  2P6V A;  2EPN A;  2L6H A;  2EPM X;  4PJL A;  1M2V A;  1CGO A;  1WAT A;  4N4W A;  3EHM A;  3EZI A;  3JT1 A;  4EUK B;  1E86 A;  4CJG A;  5JT4 A;  2VCA A;  1ZHX A;  1NFN A;  4XPY A;  5IY5 C;  3HTK C;  3RH3 A;  5KYX A;  4PJJ A;  2QTV A;  1A41 A;  2YZS A;  3FMS A;  2QUP A;  1TWG A;  5AGF A;  4WAB A;  1PV3 A;  1FAP B;  2F22 A;  2BL2 A;  1O3U A;  3I5Q A;  4LER A;  1LPE A;  2DB4 A;  2VAS A;  4MQ9 F;  1QQ3 A;  4MW8 A;  1OCC C;  3G4Z A;  3GM2 A;  4Z9H A;  1OCR C;  4XLN F;  4NC3 A;  4JEA A;  5L0C A;  3KH2 A;  3AGU A;  3DI5 A;  1NG1 A;  4YL3 A;  1UFB A;  3TJ6 A;  2I8B A;  4CDY A;  1YA9 A;  2CCY A;  2RD9 A;  3CQZ A;  1RKC A;  3GM1 A;  1HY5 A;  3IQT A;  4YL0 A;  3RKO F;  1LE2 A;  4XEF A;  2XLD A;  3T6B A;  3AOU A;  3KYI A;  3EQL F;  2QY9 A;  2FFH A;  3LES A;  1PD1 A;  4KC9 A;  2R7V A;  1YAU O;  4MVQ A;  3LLI A;  3U9M A;  3NMJ A;  4WJ0 A;  1BR4 A;  1ZYR F;  3M4B A;  4RDA A;  3V5Y A;  1GQA A;  4NTF A;  3TD7 A;  1T6Q A;  4WGZ A;  4XEV A;  3OEO A;  4LDK A;  4E0H A;  2Q00 A;  4O79 A;  3RYL A;  4XQ1 A;  5FCL A;  1YJG A;  2Q3T A;  3LAY A;  3C8Z A;  2YKZ A;  1OQC A;  3LJB A;  1KTM A;  1JAF A;  4ULV A;  3R7C A;  3LNM B;  4O7G A;  1ZHZ A;  1NSG B;  2KW3 C;  4OIP F;  5L3Q A;  3X1O A;  2A6E F;  4FES A;  4J7Y A;  3DAG A;  2XLH A;  2OEX A;  3JSZ A;  3BRJ A;  4AE4 B;  256B A;  3U2L A;  3NYM A;  4YT2 A;  1UG7 A;  2R7T A;  1NFO A;  2KQ9 A;  2A0B A;  3L1M A;  1YZA A;  3DD7 A;  1JOG A;  5COM A;  1VTM P;  3Q6N A;  1OW7 A;  2WVN A;  4CDV A;  2YLG A;  2C04 A;  1OXK A;  2J9B A;  3AJM A;  2XS8 A;  5B1A C;  4DRI B;  3J06 A;  4L6R A;  2GDC A;  2Y3G A;  3AQC A;  1LS1 A;  3IPM O;  1ZW2 A;  4YK5 A;  5K0I A;  2AU5 A;  3NKE A;  1C02 A;  3Q7L A;  4IJJ A;  5B3I A;  1ZHW A;  5E3A A;  4U5E E;  2HV6 A;  4O6M A;  2D4U A;  3QMK A;  3VAY A;  1QLE C;  3EFO B;  3OWT A;  1WOL A;  3AQB A;  1BR1 A;  3C7J A;  1J8Y F;  4EBB A;  2Y3H A;  2HJ3 A;  4PR9 A;  3CZ6 A;  2BE5 F;  1H7I A;  1T9K A;  1XWJ A;  2J7P D;  5KYU B;  1RXQ A;  4MTF A;  2LFF A;  1ZHY A;  3C8G D;  3DXJ F;  3VF0 A;  5L0F A;  1D1B A;  2DGJ A;  2DYS C;  4DBR A;  4G7O F;  5EHH A;  4U5B E;  4YL1 A;  4JTD B;  5GPG B;  5DLJ A;  3C18 A;  4BG0 A;  3HLZ A;  4EHP A;  3O55 A;  1FFH A;  4IAO A;  3ZIB A;  5JUA A;  1FMW A;  4PAC A;  1YA7 O;  2CNW D;  4U5D E;  2MYS A;  4HEA J;  1M56 C;  4JTC B;  3KPH A;  1VLS A;  3ZVR A;  1HMO A;  2E87 A;  2OJE D;  1I4Z A;  2OU6 A;  3N0T A;  2R7U A;  1V74 B;  3L8J A;  2YLI A;  3LUT B;  1AUE A;  4C3E A;  2R7O A;  2EPO A;  3TQO A;  3A9C A;  2J46 A;  2IM8 A;  1AEP A;  1FFT C;  2R02 A;  3SXM A;  3E70 C;  1CPQ A;  4IAQ A;  4J32 B;  2G3K A;  1OKK D;  3RF3 A;  3IQC A;  1NU9 C;  4CS7 A;  5L3V A;  3LLK A;  2V26 A;  3AG4 C;  3UGP A;  3EJN A;  2RSE B;  3C62 A;  4K7B A;  1O87 A;  1HW2 A;  1U89 A;  2NSF A;  2WVO A;  4AE4 A;  4KI2 A;  5T3T A;  1H9G A;  2L7A A;  1Z5Z A;  2ZPA A;  1BZ4 A;  1T6I A;  1A7E A;  3O6X A;  1SMY F;  1G8X A;  3NKD A;  3PCV A;  3AG3 C;  4Q4Z F;  4P9F A;  4MVO A;  3IQ6 A;  2LCH A;  3DAF A;  4G78 A;  3GEI A;  3ZQY A;  3U9J A;  1AVO B;  3MX3 A;  1LE4 A;  1ST6 A;  3CEX A;  4QI0 A;  1A7V A;  3V7O A;  1MMN A;  4F4B A;  2CYD A;  5AC5 A;  3LEO A;  5EK0 A;  1K40 A;  3KMI A;  2XXA B;  2WZL A;  1M2O A;  1ORJ A;  2JX0 A;  2W45 A;  1D1A A;  1VYI A;  3A11 A;  1SR2 A;  2KSF A;  2PP4 A;  3GAN A;  4JKV A;  4BEJ A;  3HNI A;  3ZG1 A;  2R03 A;  1TR2 A;  1MMD A;  1Y4C A;  3EH1 A;  4JTA B;  2XLV A;  1NLX A;  3GOD A;  3JZ0 A;  3QW1 A;  2IXN A;  4DVY P;  3JYH A;  3DE8 A;  1JPJ A;  2QNL A;  2NG1 A;  3POV A;  3U3F A;  5E2Q A;  3HNJ A;  5KYX B;  4J7T A;  3EGX A;  2PBE A;  1OR3 A;  4XPW A;  3S29 A;  3WOD F;  4BEM J;  5F5F A;  5F5H A;  4CS8 C;  3TOM A;  5EGY A;  2XL6 A;  5A6A A;  1F1M A;  1GGQ A;  4YT8 A;  2IBF A;  4MS2 A;  3N24 A;  5B1B C;  4U9E A;  4JJG A;  3VYW A;  5HSW A;  2R7S A;  3SP1 A;  1D0Y A;  2BC5 A;  5F28 E;  3W2V A;  2PFD A;  3AGT A;  2QE9 A;  2PX0 A;  4IB4 A;  4E7S A;  5D92 A;  1QZX A;  4CS8 A;  1JMW A;  2Y3B A;  4KBL A;  4NTA A;  1IW7 F;  1LKX A;  2LD6 A;  4ULW A;  2KNH A;  3NMK A;  3VRC A;  1WWP A;  3KYJ A;  4XPX A;  1FTS A;  3ECS A;  2HSB A;  3HNK A;  3SXK A;  2WVQ A;  5A6B D;  5L0J A;  4Z9I A;  3F47 A;  2H7B A;  2HJM A;  3ASN C;  4LDQ A;  1D1C A;  3ZQV A;  4Q5S F;  3KL4 A;  3K33 A;  2YHS A;  2J0X A;  3EGD A;  1ZU5 A;  2IXM A;  2J7P A;  3GOR A;  4RD9 A;  3FXH A;  4R32 A;  2YL7 A;  3U8V A;  3HJC A;  3V5X A;  2ZXO A;  3C8G A;  2X0C A;  5JVE A;  2LFD A;  1EQ1 A;  5BQG A;  5JP7 A;  1WN0 A;  4CIH A;  1D0Z A;  3ZTZ A;  2HMQ A;  3K7D A;  4K0D A;  4CBE A;  4BJT A;  1V4A A;  3FDQ A;  2MWQ A;  2CGE A;  4PFO A;  3B0V C;  2L6G A;  3Q6M A;  4I44 A;  1E2X A;  2X51 A;  3ASO C;  1U6H A;  2GWW A;  3TUL A;  4BPM A;  2CNW A;  2CW0 F;  2XM4 A;  5JSL A;  4BJ1 A;  2VC9 A;  1H6G A;  2GFH A;  2EPL X;  2Q9A A;  3O10 A;  4XWJ A;  4U5C E;  4MVU A;  5COF A;  3RQG A;  1RJ9 A;  1DOV A;  4FX5 A;  3OA1 A;  3O39 A;  2W4M A;  3GEH A;  2OJQ A;  3ABK C;  3QVY A;  1A7D A;  5TJ5 E;  3B0P A;  3M15 A;  3VM6 A;  1MMG A;  2H7O A;  2VCC A;  2Y69 C;  3K1I C;  4CX9 A;  2V3C C;  4U9D A;  4GQH A;  3RQE A;  5KYY A;  3B0U X;  2ZD9 A;  1TFK B;  2Q7R A;  2HSQ A;  4JEB A;  2HMZ A;  5L0H A;  1OKK A;  2NUP A;  3FOP A;  1S7Z A;  1LI7 A;  2Z15 A;  2UUH A;  3FHD A;  3B9Q A;  1FNT c;  2EIM C;  3K1I A;  3T9O A;  1ZU4 A;  1WAS A;  1QSP A;  3RQF A;  4DOZ A;  1H9T A;  3S27 A;  2KC3 A;  4E0I A;  3DM5 A;  2XM0 A;  1Q0K A;  3S90 A;  2I15 A;  4NTB A;  4JCH A;  5CI8 A;  4MW3 A;  4CJO A;  1YYJ A;  5DS4 A;  1C03 A;  3H2V A;  2HKV A;  1RCP A;  2XS1 A;  5E33 A;  3SEO A;  1YAR O;  1TWA A;  1WGW A;  1EI7 A;  3UGO A;  2ETS A;  1G4U S;  4LLE A;  1OW8 A;  1A0B A;  1RKE A;  5AC4 A;  2NUT A;  4WGY A;  4Q7C A;  2OQM A;  2AWY A;  1OW6 A;  4C3B A;  2Q4F A;  2J9V A;  1CGN A;  3FOO A;  3CAX A;  4JE9 A;  5COG A;  2R05 A;  4GYT A;  5JLI A;  1JR8 A;  3LEV A;  4M63 A;  4C7O A;  1NZE A;  3H65 A;  4DRJ B;  4U5F E;  3B29 A;  4W8K A;  3H2U A;  1Q0D A;  2HZ8 A;  4YJW A;  1PD0 A;  2YQY A;  4PFP A;  1Y6D A;  5D91 A;  3U5S A;  3IHU A;  5T1D B;  1RMV A;  3G50 A;  1D0X A;  4GEH A;  2IXP A;  1ORS C;  4I1O B;  4O6N A;  5L0G A;  3PHF 2;  4RBN A;  4ANJ A;  3W8H A;  5L0I A;  4AX2 A;  2VB6 A;  5JRA A;  2OKU A;  3DKA A;  1HMD A;  3PMR A;  2AP3 A;  3GM3 A;  1OXB A;  2A68 F;  2HV7 A;  1LIH A;  4EBJ A;  1Z23 A;  3GEE A;  2PNO A;  3GWL A;  5KYW A;  3US6 A;  4U5H A;  2XSE A;  4QI2 A;  4J30 B;  1JPN A;  2GAQ A;  2YL0 A;  5E3C A;  4YT4 A;  2H7V C;  4XTK A;  1XZP A;  2L81 A;  2CDQ A;  2ICW G;  4JC7 A;  5JS5 A;  3NYJ A;  2PF4 E;  4JJF A;  5A6B A;  1VOM A;  2Q9B A;  3M1C B;  4MVM A;  1Q0G A;  2M64 A;  1XZQ A;  4X0R A;  3S28 A;  2B0J A;  5L0D A;  1VMA A;  2H8A A;  2P61 A;  3QZC A;  2XLO A;  3EG9 B;  3M4C A;  3JCU Q;  2XLW A;  4NCQ A;  1BR2 A;  2QLA A;  2XL4 A;  3Q7G A;  3SXZ A;  1YLM A;  2O9X A;  2YL1 A;  4OIN F;  2IYL D;  3ZWI A;  4MTO A;  2XRH A;  4H4K C;  2A69 F;  4B6I A;  3PDM P;  1DOW A;  2J8W A;  4N6H A;  4I1M A;  1M2V B;  5A6K A;  4NY3 A;  5CI9 A;  1OR2 A;  3AG1 C;  2R7X A;  4MVR A;  1TFO B;  2R7Q A;  3BEH A;  4PJN A;  4XLP F;  3JYY A;  3DZA A;  4DVZ A;  1MNE A;  2Y39 A;  3HNL A;  4EBK A;  4OD4 A;  4E7Z A;  2IXO A;  4FWV A;  1W2W A;  1PCX A;  5DQZ A;  2YVK A;  4ER9 A;  3FVY A;  1Z63 A;  1R5I D;  4LAC B;  2JD3 A;  1E83 A;  1ZZP A;  3IQ5 A;  3DJU B;  2OOC A;  3JRT A;  3W4Y A;  4D4N A;  4C3D A;  3EGX B;  3FAP B;  2WZG A;  5BUO A;  3WAQ A;  4DXW A;  4PK4 A;  1I4Y A;  2G3V A;  2B0H A;  2EIN C;  1O5H A;  1SYQ A;  1YVI A;  2C03 A;  1ZHT A;  5BQH A;  4JCZ A;  2Q9C A;  3DJN B;  1Z7Q c;  1GS9 A;  5HV9 A;  3TJ5 A;  5DS5 A;  1LM3 B;  3S84 A;  1U0B B;  3S0X A;  3LS0 A;  1KNY A;  4IWB A;  1NBB A;  3W2W A;  3DE9 A;  2DI3 A;  1K05 A;  2WB7 A;  2J9U A;  1SF8 A;  3ABM C;  3K6B A;  4H54 A;  1V55 C;  5FZT A;  3UNG C;  1QPU A;  5CIV A;  1TWH A;  2KK1 A;  4N6C A;  3SNH A;  1V54 C;  1I5N A;  2L6F A;  3K1H A;  3I4U A;  3LS1 A;  4JVS A;  3SZR A;  4EKW A;  1G4W R;  3EGD B;  1VB5 A;  4CIP A;  4G7Z F;  2KGO A;  4YN0 B;  2J45 A;  3ZDL A;  3C8G B;  2DYR C;  4KNW A;  4N06 A;  2HS5 A;  2LK4 A;  5DQT A;  5DVW A;  3L34 A;  1ZW3 A;  2ASR A;  2D5R B;  2XL8 A;  3ZTM A;  3I5P A;  3HKK A;  1E85 A;  1VYK A;  2KYH A;  3NYL A;  1E84 A;  1Q0F A;  3MLG A;  1NU7 D;  1LI5 A;  2YLD A;  3T6J A;  1IZM A;  3L8I A;  2LSE A;  4A4A A;  4NQF A;  4E17 A;  3FAJ A;  4BJ5 C;  4CDA A;  3RIP A;  3ZC4 A;  3MYF A;  2EIL C;  4OIO F;  1HE9 A;  3MBG A;  1HW1 A;  4Z9J A;  2OCC C;  1C17 M;  2XLE A;  4LLC A;  1JRA A;  1EA8 A;  4ZLD A;  2ZXR A;  1M6T A;  1RJ9 B;  2XLM A;  4JW1 A;  3T4R A; 
#chains in the Genus database with same CATH homology
 3G50 A;  1Q0F A;  1Q0G A;  1Q0K A;  1T6Q A;  1T6I A;  1Q0D A;  3G4X A;  1T6U A;  4NCQ A;  3G4Z A;  1Q0M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...