3JTLO

Crystal structure of archaeal 20s proteasome in complex with mutated p26 activator
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
228
structure length
218
Chain Sequence
KRAALIQNLRDSYTETSSFAVIEEWAAGTLQEIEGIAKAAAEAHGVIRNSTYGRAQAEKSPEQLLGVLQRYQDLCHNVYCQAETIRTVIAIRIPEHKEEDNLGVAVQHAVLKIIDELEIKTLGSGEKSGSGGAPTPIGMYALREYLSARSTVEDKLLGGGSQSPSLLLELRQIDADFMLKVELATTHLSTMVRAVINAYLLNWKKLIQPRTHLDVLYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proteasome subunit alpha
publication title Structural Models for Interactions between the 20S proteasome and its PAN/19S activators.
pubmed doi rcsb
source organism Thermoplasma acidophilum
molecule tags Hydrolase/hydrolase activator
total genus 84
structure length 218
sequence length 228
chains with identical sequence P, Q, R, S, T, U
ec nomenclature
pdb deposition date 2009-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF02252 PA28_beta Proteasome activator pa28 beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.180 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Proteasome activator pa28, C-terminal domain 3jtlO01
1AVOB 1FNTc 1YARO 1YA7O 3IPMO 3JSEO 3JTLO 3JRMO 1Z7Qc 1YAUO
chains in the Genus database with same CATH superfamily
4P9TA 3GM1A 2EPMX 3EJNA 1BR4A 3EZHA 4NQFA 2J45A 4AL0A 1B68A 3DE8A 3TOMA 3V5XA 2XSEA 3LLIA 2J9WA 2OJQA 2RD9A 3W8HA 2R7XA 1G8XA 1I4ZA 2HV7A 2G3VA 2LSEA 3K7DA 1W2WA 4X0RA 3LUTB 1OW6A 3ZG1A 3NYJA 2Q9CA 5B3SC 3N0TA 3G4ZA 3TJ5A 4YT2A 3RQEA 5L0HA 2XLVA 2R7UA 3VAYA 1M57C 2CNWD 4HFKB 4U5HA 1WTYA 2XS8A 1M2VB 3UMIA 2LFFA 5JRAA 1SR2A 4JCZA 3RFYA 3IQTA 4PK4A 3C7JA 3ITFA 3IHUA 4XPYA 4DRJB 5DS6A 1TKNA 2BC5A 4BJ5C 4C3BA 2R02A 1VLSA 1XZPA 1NBBA 1M6TA 1Q0DA 1OCRC 4KNWA 2M4EA 2R7VA 4N6HA 1VLTA 1IW7F 2H8AA 4XPXA 1SF8A 1JOGA 1ZHZA 1ZVZA 4LDKA 3RF3A 1RKEA 1JPNA 1ZW3A 2NPUA 2P7VA 3GANA 3JCUQ 3CEXA 3WG7C 4E18A 2KSFA 1YYJA 1OCOC 4PJLA 3NMIA 2H7BA 3T9OA 4B6IA 1HE1A 3AQCA 1TWCA 1NZEA 3LNMB 4DOZA 3UNGC 5DQTA 3ASNC 4PR9A 2WZFA 2IM8A 2CCYA 4CDYA 2PFDA 3FAJA 4O6MA 1OXKA 3QVZA 3K1HA 1YA7O 2MYSA 3EFOA 4NTAA 3C8GA 2HV6A 4Q5SF 3ZC4A 2WZLA 4YT4A 4IAOA 2NUPB 2J9UA 5KYXA 1AEPA 3U8PA 3U2MA 3SYNA 4CJGA 3TOLA 2YKZA 1K40A 4YL0A 2NSFA 3L8IA 2E87A 4IWBA 5JT4A 4XEVA 1FFHA 3U9JA 2PBEA 3U0CA 1CGME 1MMDA 2GDCA 1VOMA 2DB4A 3NYMA 3Q7GA 2XXAA 3Q6MA 2J46A 3HJCA 3UMHA 3MFNA 3S29A 1Z7Qc 1M2OA 3TJ6A 1ZU5A 4DRIB 4E7ZA 2WVNA 4N06A 2H7OA 2QY9A 1T6IA 3S28A 4C7OB 3GEIA 2Y69C 5JVEA 3VM6A 4MVRA 3DI5A 1R5ID 3JSZA 3KH2A 4DBQA 2IBFA 1PD0A 3RVZA 3DKAA 3H2VA 3DJNB 4JJGA 5KYUB 4MQ9F 1C02A 2GFHA 2OCCC 3OA1A 1QQ3A 1ZHYA 3SXYA 1Y4CA 3I4UA 4MNDA 1OW8A 2BL2A 3KL4A 4J32B 4KNVA 5COMA 5D91A 2EPOA 3NMJA 5T3WA 2YZSA 2Q7RA 5BUOA 2DYSC 2L6FA 3KYIA 3QZCA 1WATA 2JD3A 2Y3BA 4JVSA 1Z5ZA 4JURI 2R9RB 4LERA 2IXOA 2PX0A 2Q9AA 1NU7D 1A41A 2QLAA 3K1IC 3RH3A 5DQZA 5KYWA 4E0HA 1YVIA 3EG9B 2AU5A 2D4UA 1BDJB 2DGJA 1Y6DA 2YL0A 2XLOA 2YQYA 2R7QA 3BRJA 3G4XA 2ASRA 4U5DE 3RIPA 2XLHA 3KYJA 1NU9C 4MTOA 4AL1A 3GEHA 2IXPA 1PCXA 3EHMA 3ABKC 2J0XA 1EI7A 4HE8D 2X0CA 3RQGA 2YLIA 1WGWA 4I3MA 1V55C 2OEVA 4ANJA 3M4BA 2YLGA 2LFDA 4AX2A 4XWJA 3S84A 4QDLA 2Y3HA 3C8GD 4BJTA 2DI3A 3UR3C 2HMQA 1A7VA 4NC3A 5JUAA 1JRAA 2KYHA 5HSWA 1YA9A 2MWQA 2F22A 5DLJA 4G7ZF 2XL8A 3VF0A 3ZQVA 3ZTMA 2A0UA 3E9VA 4IGGA 2YRFA 4N4WA 2XLMA 5HV9A 2A6HF 5T1DB 3R7CA 1E83A 3C18A 1TR2A 2XL6A 5CIVA 1SMYF 3SXKA 3LJBA 4IB4A 2PF4E 2PX3A 2XLEA 4RDAA 4JZAA 3U5SA 1KNYA 1QSPA 2XLDA 3JRTA 3SXZA 4CSAC 3EQLF 2YWAA 3PHF2 4CBEA 3GEEA 2IYLD 5A6BD 3U3BA 4G78A 2ZXRA 3DZAA 4AE4B 5AGFA 2W4MA 3U2LA 2TMVP 2PNOA 1RKCA 5DVWA 2EILC 2P6VA 4OINF 3O55A 2J8WA 2KQ9A 3S9OA 5L0CA 3UGOA 4MVSA 4BEJA 3L34A 3X1OA 1O87A 2OKUA 1R4TA 4C7OA 5L0DA 5EK0A 2EIMC 3SXMA 1NG1A 1M56C 2C03A 4CS9C 4XTKA 3SP1A 1ZHXA 2QE9A 3EGXA 4OIPF 5COFA 3LS0A 2YL7A 2L6GA 2KC3A 3L8JA 4EHPA 1E84A 3RYLA 3V5ZA 2G3KA 1Z3IX 4JEAA 3WAQA 4J7YA 4MVOA 3AJMA 2OOCA 3TULA 2W45A 2XL4A 1GGQA 3LEVA 2ICWG 4J7TA 1MQVA 4J30B 3AG3C 3JYYA 4MVZA 1J8MF 2A69F 4DRHB 4OIQF 4U5BE 4BJ6C 2V3CC 3CSKA 2YL3A 3S0XA 3B9QA 3ASOC 2OJED 1OW7A 2YEVA 5A69A 3ZIBA 4P6IC 2HZ8A 1ORSC 4NY3A 4WJ0A 1D1AA 2Y39A 4LDQA 4ONSA 1YARO 1HY5A 2B0JA 1MMNA 2R03A 2Q4FA 2W9YA 3DM5A 3CQZA 2AWYA 2ZXPA 1BR1A 2HMZA 3ATPA 4CS8C 1VK5A 3C62A 2HUJA 3NKDA 4JKVA 2HSQA 1YZAA 3DMDA 3M15A 1T9KA 2LK4A 5KYYB 1Q0KA 1E2XA 4ULWA 3PDMP 3AG4C 4GQHA 2YLDA 3HTKC 4H4KC 1BZ4A 3U3FA 1LI7A 5BQHA 5JS5A 2D5RB 3EZIA 4XLNF 4EBBA 2CW0F 4A4AA 5EGYA 1VMAA 4EIYA 1PD1A 2AWCA 2KJGA 2Z15A 4O79A 2AP3A 5EHHA 2DYRC 1UG7A 1RKEB 1OCCC 1ST6A 5E3CA 3RVYA 1WN0A 4D4NA 4P9FA 3V7OA 1APCA 1HMDA 2QTVA 2P61A 3GORA 3LS1A 2MHRA 1YJGA 3OEOA 2I8BA 3C8ZA 3HNKA 4H54A 2BE5F 3FMSA 4I1MA 4F4BA 3J06A 1L3PA 1RJ9A 3FHDA 4OIRF 4XEFA 4XPWA 1Z63A 1C17M 3EFOB 4R32A 3C8GB 3SNHA 3F46A 1YZCA 5F5HA 4BJ6A 2XRHA 1TWGA 1OR3A 1XZQA 5E3AA 1IZMA 2W4BA 1OKKA 3MBGA 5KYXB 1A7EA 2I15A 3DXJF 1LS4A 4PACA 2HJMA 2EPLX 1HMOA 2A68F 3HKKA 4XEKA 5CI8A 5KYUA 5F5FA 1TWHA 2KGOA 3PMRA 4JTDB 4O6YA 1JAFA 1S7ZA 5IY5C 3G50A 1LPEA 5B1AC 256BA 4FESA 5E33A 1WOLA 3EGDA 3H65A 3AGTA 4L6RA 1ZU4A 1LE2A 4Z9JA 2VB6A 3S90A 3MYFA 2HSBA 4CSAA 1QZXA 1Q0MA 3RKOF 4G7OF 4LLCA 4OD4A 3NRHA 3UMKA 5FZTA 4U9EA 1H7IA 5F28E 4CDVA 1EKYA 4PJJA 3T6JA 3JT1A 1RXQA 3M4CA 4JJFA 1T6QA 4XQ1A 3DM9B 1GQAA 3U8VA 3T4RA 4OD5A 2B0HA 2CDQA 2R7WA 4PJNA 5JP7A 1MNDA 3L0IA 1FMVA 4M63A 1NFNA 4LACB 1TWAA 2IXMA 2VCCA 4O7GA 3POVA 1YDIA 1ZHTA 1QPUA 1T6UA 4JTAB 3KMIA 5JSLA 4DJ9A 1D1BA 3ABLC 3EH1A 4AK9A 2WVQA 1YYXA 2EIJC 2J0WA 3X2QC 1ZW2A 1T5OA 2ZD9A 2LP4A 5AC4A 4W8PA 1GM5A 2XM0A 1NFOA 1SZIA 5CI9A 5BQIA 2ETSA 3AGUA 2FAPB 4IRUA 5E2QA 4RD9A 3PCVA 1LI5A 2C04A 1RMVA 4Q7CA 1RCPA 2NUTA 4EBJA 2R7OA 2VASA 1OCZC 4A2NB 4BJ5A 3TQOA 1AVOB 4EWCA 1LVKA 2FFHA 3BEHA 3LAYA 4YN0B 3WODF 5L0FA 4K7BA 3HNLA 3SEOA 1Z23A 4JCHA 4BJ1A 1V54C 2L6HA 1FAPB 2J9VA 4E0IA 3E70C 2P1AA 2J7PA 2RSEB 4QI0A 2XLWA 1S05A 4BPMA 4YWQA 2R7TA 2XS1A 3FOPA 2R7SA 3K66A 1YLMA 2OG2A 4CIHA 4JTCB 5FCLA 3LLKA 1G4US 1QLEC 1ZHWA 4PFOA 1QVXA 3ZVRA 1PV3A 1VB5A 1D0ZA 1J8YF 3ZWIA 3HNJA 4CS7A 1K05A 2GA0A 4JC7A 3OWTA 4MS2A 3W4YA 3NDBB 1A7DA 3GODA 3W8IA 1SYQA 1E86A 1UFBA 2EIKC 4Z9IA 4JRZA 3T6GB 1M2VA 4QI2A 3B0UX 1O3UA 1LKXA 3TD7A 2EPNA 3ZSUA 4CIPA 1I5NA 3O6XA 1OQCA 2FGYA 4MW3A 1LS1A 1V4AA 4Z9HA 1DOWA 2VC9A 4YL3A 5D92A 5BQGA 2XM4A 3VYWA 3QVYA 2OEXA 3EGXB 3IPMO 3M79A 1FR0A 4U5FE 3H2UA 4U5CE 2CYDA 1JPJA 1NSGB 2AVKA 1U0BB 3B0VC 3QW1A 4EKWA 4O6NA 1FFTC 1T01A 2OQMA 1OR2A 3HLZA 4EBKA 1OXBA 4DBRA 2M64A 2EINC 3A11A 1U6HA 4PJMA 1HE9A 4GYTA 3B0PA 2GWWA 3EHNA 1VTMP 2WB7A 4HFFB 3IQ6A 5TJ5E 2WVOA 2KW3C 2UUIA 3N2ZB 5KYYA 2L7AA 1MMGA 2Y3DA 3Q7LA 2HJ3A 3O10A 3SZRA 5A6JA 2R7RA 4I44A 3LEOA 1JR8A 2JX0A 1FTSA 2Q9BA 3AOUA 3MX3A 4G0HA 5L0JA 2VH3A 1BR2A 1FNTc 1H9TA 1Q0GA 3K1IA 2X51A 1Q0FA 2WZGA 1K04A 2LD6A 4NCQA 3FXHA 1E85A 1MNEA 5A6KA 1C03A 4MW8A 5KYNA 2EPKX 4JW1A 2NUPA 1YAUO 2IXNA 4MVMA 2H7VC 2J7PD 4NTBA 4U5GA 1N1CA 4I1OB 3W2VA 4E17A 5JLIA 3RW0A 1U89A 4IJJA 5B3IA 4YT8A 3MLGA 1CPQA 2UUHA 2OU6A 4E7SA 3S27A 4YK5A 2V26A 3L1MA 2NG1A 3GWLA 1JMWA 3QTHA 2A6EF 2LQGA 3GM3A 3VRCA 4C3DA 2LIGA 4CJOA 1AUEA 4ZLCA 4UDVA 3T6BA 2Q3TA 1L7CA 4FAPB 1V74B 4FX5A 3W2WA 1MMAA 1D0YA 3ZDLA 2Y3GA 3AG1C 1D1CA 2QNLA 5COGA 3JZ0A 2NSGA 3B71A 1KU2A 3DAFA 5AC5A 1HW2A 4ER9A 1ORJA 2XXAB 3DJUB 2J9BA 3FOOA 2IOQA 1VYIA 5DS4A 1TQGA 2WL8A 1RJ9B 2R05A 4JE9A 3ZTZA 3DWWA 3LNRA 3FDQA 2GAQA 3DAGA 3JSEO 1BBHA 3CAXA 2HKVA 3AG2C 5A6BA 2HS5A 5B1BC 3FAPB 2YHSA 4MTFA 4CX9A 4U9DA 3IEEA 3NMKA 3EG9A 3JTLO 2ZXWC 2Q00A 3JRMO 4YL1A 4MTGA 1TFOB 3FVYA 4IAQA 4JEBA 1VYKA 1I4YA 2P0NA 3I5PA 4W8KA 3TK0A 3JYHA 1F1MA 3AQBA 1GS9A 2LCHA 4C3EA 4G7HF 3KKBA 1G4WR 5L3VA 4BEMJ 2JPUA 1CPRA 1CGOA 4DXWA 3UGPA 4CS9A 3C63A 3EGDB 2L81A 4Q4ZF 2A0BA 2A1DD 1LM3B 2YVKA 3O39A 5KYWB 1NLXA 2YL1A 4LDRA 4LLEA 1ZYRF 1H6GA 3ABMC 3NYLA 4BG0A 2KNHA 1Z6AA 3B29A 5L0GA 1A0BA 4HEAJ 4K0DA 4KI2A 2CNWA 4DVZA 1H9GA 3A9CA 3GM2A 3WHNA 1TFKB 1WWPA 3K6BA 1QKRA 1O5HA 3CZ6A 5K0IA 1ZZPA 2PP4A 3IQCA 3V5YA 4D4XA 2ZPAA 2HFIA 3ECSA 1DOVA 4MVQA 2R25A 3IQ5A 4K1OA 4MVUA 3MYIA 4NTFA 2KK1A 3GWNA 3NKEA 3QMKA 3QW0A 4FWVA 2VCAA 1WASA 4RBNA 2QUPA 4PFPA 4AE4A 1OKKD 5T3TA 4N6CA 4KC9A 3ZQYA 4EUKB 3EH2A 5DS5A 4U5EE 4XLPF 1XWJA 2G62A 4YT5A 3K33A 4ZLDA 3EPVA 4WGYA 4CS8A 3LESA 3N24A 4JIOA 5GPGB 2ZXOA 3DE9A 3KPHA 4CDAA 4OIOF 4ULVA 1LE4A 2O9XA 2NUTB 3R2PA 1KTMA 1D0XA 5A6AA 3US6A 4YJWA 5L0IA 3DD7A 3M1CB 1HW1A 3I5QA 3NG1A 4WABA 4WGZA 1EQ1A 1EA8A 1CGNA 1G5ZA 1LIHA 3Q6NA 5L3QA 1ORYA 4KBLA 3HNIA 4DVYP 2L9JA 3F47A 2CGEA 1FMWA 3RQFA 3U9MA 2VCBA 4IARA 4GEHA
chains in the Genus database with same CATH topology
1AVOB 1FNTc 1YARO 1YA7O 3IPMO 3JSEO 3JTLO 3JRMO 1Z7Qc 1YAUO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AVO B;  1FNT c;  1YAR O;  1YA7 O;  3IPM O;  3JSE O;  3JTL O;  3JRM O;  1Z7Q c;  1YAU O; 
#chains in the Genus database with same CATH topology
 4P9T A;  3GM1 A;  2EPM X;  3EJN A;  1BR4 A;  3EZH A;  4NQF A;  2J45 A;  4AL0 A;  1B68 A;  3DE8 A;  3TOM A;  3V5X A;  2XSE A;  3LLI A;  2J9W A;  2OJQ A;  2RD9 A;  3W8H A;  2R7X A;  1G8X A;  1I4Z A;  2HV7 A;  2G3V A;  2LSE A;  3K7D A;  1W2W A;  4X0R A;  3LUT B;  1OW6 A;  3ZG1 A;  3NYJ A;  2Q9C A;  5B3S C;  3N0T A;  3G4Z A;  3TJ5 A;  4YT2 A;  3RQE A;  5L0H A;  2XLV A;  2R7U A;  3VAY A;  1M57 C;  2CNW D;  4HFK B;  4U5H A;  1WTY A;  2XS8 A;  1M2V B;  3UMI A;  2LFF A;  5JRA A;  1SR2 A;  4JCZ A;  3RFY A;  3IQT A;  4PK4 A;  3C7J A;  3ITF A;  3IHU A;  4XPY A;  4DRJ B;  5DS6 A;  1TKN A;  2BC5 A;  4BJ5 C;  4C3B A;  2R02 A;  1VLS A;  1XZP A;  1NBB A;  1M6T A;  1Q0D A;  1OCR C;  4KNW A;  2M4E A;  2R7V A;  4N6H A;  1VLT A;  1IW7 F;  2H8A A;  4XPX A;  1SF8 A;  1JOG A;  1ZHZ A;  1ZVZ A;  4LDK A;  3RF3 A;  1RKE A;  1JPN A;  1ZW3 A;  2NPU A;  2P7V A;  3GAN A;  3JCU Q;  3CEX A;  3WG7 C;  4E18 A;  2KSF A;  1YYJ A;  1OCO C;  4PJL A;  3NMI A;  2H7B A;  3T9O A;  4B6I A;  1HE1 A;  3AQC A;  1TWC A;  1NZE A;  3LNM B;  4DOZ A;  3UNG C;  5DQT A;  3ASN C;  4PR9 A;  2WZF A;  2IM8 A;  2CCY A;  4CDY A;  2PFD A;  3FAJ A;  4O6M A;  1OXK A;  3QVZ A;  3K1H A;  1YA7 O;  2MYS A;  3EFO A;  4NTA A;  3C8G A;  2HV6 A;  4Q5S F;  3ZC4 A;  2WZL A;  4YT4 A;  4IAO A;  2NUP B;  2J9U A;  5KYX A;  1AEP A;  3U8P A;  3U2M A;  3SYN A;  4CJG A;  3TOL A;  2YKZ A;  1K40 A;  4YL0 A;  2NSF A;  3L8I A;  2E87 A;  4IWB A;  5JT4 A;  4XEV A;  1FFH A;  3U9J A;  2PBE A;  3U0C A;  1CGM E;  1MMD A;  2GDC A;  1VOM A;  2DB4 A;  3NYM A;  3Q7G A;  2XXA A;  3Q6M A;  2J46 A;  3HJC A;  3UMH A;  3MFN A;  3S29 A;  1Z7Q c;  1M2O A;  3TJ6 A;  1ZU5 A;  4DRI B;  4E7Z A;  2WVN A;  4N06 A;  2H7O A;  2QY9 A;  1T6I A;  3S28 A;  4C7O B;  3GEI A;  2Y69 C;  5JVE A;  3VM6 A;  4MVR A;  3DI5 A;  1R5I D;  3JSZ A;  3KH2 A;  4DBQ A;  2IBF A;  1PD0 A;  3RVZ A;  3DKA A;  3H2V A;  3DJN B;  4JJG A;  5KYU B;  4MQ9 F;  1C02 A;  2GFH A;  2OCC C;  3OA1 A;  1QQ3 A;  1ZHY A;  3SXY A;  1Y4C A;  3I4U A;  4MND A;  1OW8 A;  2BL2 A;  3KL4 A;  4J32 B;  4KNV A;  5COM A;  5D91 A;  2EPO A;  3NMJ A;  5T3W A;  2YZS A;  2Q7R A;  5BUO A;  2DYS C;  2L6F A;  3KYI A;  3QZC A;  1WAT A;  2JD3 A;  2Y3B A;  4JVS A;  1Z5Z A;  4JUR I;  2R9R B;  4LER A;  2IXO A;  2PX0 A;  2Q9A A;  1NU7 D;  1A41 A;  2QLA A;  3K1I C;  3RH3 A;  5DQZ A;  5KYW A;  4E0H A;  1YVI A;  3EG9 B;  2AU5 A;  2D4U A;  1BDJ B;  2DGJ A;  1Y6D A;  2YL0 A;  2XLO A;  2YQY A;  2R7Q A;  3BRJ A;  3G4X A;  2ASR A;  4U5D E;  3RIP A;  2XLH A;  3KYJ A;  1NU9 C;  4MTO A;  4AL1 A;  3GEH A;  2IXP A;  1PCX A;  3EHM A;  3ABK C;  2J0X A;  1EI7 A;  4HE8 D;  2X0C A;  3RQG A;  2YLI A;  1WGW A;  4I3M A;  1V55 C;  2OEV A;  4ANJ A;  3M4B A;  2YLG A;  2LFD A;  4AX2 A;  4XWJ A;  3S84 A;  4QDL A;  2Y3H A;  3C8G D;  4BJT A;  2DI3 A;  3UR3 C;  2HMQ A;  1A7V A;  4NC3 A;  5JUA A;  1JRA A;  2KYH A;  5HSW A;  1YA9 A;  2MWQ A;  2F22 A;  5DLJ A;  4G7Z F;  2XL8 A;  3VF0 A;  3ZQV A;  3ZTM A;  2A0U A;  3E9V A;  4IGG A;  2YRF A;  4N4W A;  2XLM A;  5HV9 A;  2A6H F;  5T1D B;  3R7C A;  1E83 A;  3C18 A;  1TR2 A;  2XL6 A;  5CIV A;  1SMY F;  3SXK A;  3LJB A;  4IB4 A;  2PF4 E;  2PX3 A;  2XLE A;  4RDA A;  4JZA A;  3U5S A;  1KNY A;  1QSP A;  2XLD A;  3JRT A;  3SXZ A;  4CSA C;  3EQL F;  2YWA A;  3PHF 2;  4CBE A;  3GEE A;  2IYL D;  5A6B D;  3U3B A;  4G78 A;  2ZXR A;  3DZA A;  4AE4 B;  5AGF A;  2W4M A;  3U2L A;  2TMV P;  2PNO A;  1RKC A;  5DVW A;  2EIL C;  2P6V A;  4OIN F;  3O55 A;  2J8W A;  2KQ9 A;  3S9O A;  5L0C A;  3UGO A;  4MVS A;  4BEJ A;  3L34 A;  3X1O A;  1O87 A;  2OKU A;  1R4T A;  4C7O A;  5L0D A;  5EK0 A;  2EIM C;  3SXM A;  1NG1 A;  1M56 C;  2C03 A;  4CS9 C;  4XTK A;  3SP1 A;  1ZHX A;  2QE9 A;  3EGX A;  4OIP F;  5COF A;  3LS0 A;  2YL7 A;  2L6G A;  2KC3 A;  3L8J A;  4EHP A;  1E84 A;  3RYL A;  3V5Z A;  2G3K A;  1Z3I X;  4JEA A;  3WAQ A;  4J7Y A;  4MVO A;  3AJM A;  2OOC A;  3TUL A;  2W45 A;  2XL4 A;  1GGQ A;  3LEV A;  2ICW G;  4J7T A;  1MQV A;  4J30 B;  3AG3 C;  3JYY A;  4MVZ A;  1J8M F;  2A69 F;  4DRH B;  4OIQ F;  4U5B E;  4BJ6 C;  2V3C C;  3CSK A;  2YL3 A;  3S0X A;  3B9Q A;  3ASO C;  2OJE D;  1OW7 A;  2YEV A;  5A69 A;  3ZIB A;  4P6I C;  2HZ8 A;  1ORS C;  4NY3 A;  4WJ0 A;  1D1A A;  2Y39 A;  4LDQ A;  4ONS A;  1YAR O;  1HY5 A;  2B0J A;  1MMN A;  2R03 A;  2Q4F A;  2W9Y A;  3DM5 A;  3CQZ A;  2AWY A;  2ZXP A;  1BR1 A;  2HMZ A;  3ATP A;  4CS8 C;  1VK5 A;  3C62 A;  2HUJ A;  3NKD A;  4JKV A;  2HSQ A;  1YZA A;  3DMD A;  3M15 A;  1T9K A;  2LK4 A;  5KYY B;  1Q0K A;  1E2X A;  4ULW A;  3PDM P;  3AG4 C;  4GQH A;  2YLD A;  3HTK C;  4H4K C;  1BZ4 A;  3U3F A;  1LI7 A;  5BQH A;  5JS5 A;  2D5R B;  3EZI A;  4XLN F;  4EBB A;  2CW0 F;  4A4A A;  5EGY A;  1VMA A;  4EIY A;  1PD1 A;  2AWC A;  2KJG A;  2Z15 A;  4O79 A;  2AP3 A;  5EHH A;  2DYR C;  1UG7 A;  1RKE B;  1OCC C;  1ST6 A;  5E3C A;  3RVY A;  1WN0 A;  4D4N A;  4P9F A;  3V7O A;  1APC A;  1HMD A;  2QTV A;  2P61 A;  3GOR A;  3LS1 A;  2MHR A;  1YJG A;  3OEO A;  2I8B A;  3C8Z A;  3HNK A;  4H54 A;  2BE5 F;  3FMS A;  4I1M A;  4F4B A;  3J06 A;  1L3P A;  1RJ9 A;  3FHD A;  4OIR F;  4XEF A;  4XPW A;  1Z63 A;  1C17 M;  3EFO B;  4R32 A;  3C8G B;  3SNH A;  3F46 A;  1YZC A;  5F5H A;  4BJ6 A;  2XRH A;  1TWG A;  1OR3 A;  1XZQ A;  5E3A A;  1IZM A;  2W4B A;  1OKK A;  3MBG A;  5KYX B;  1A7E A;  2I15 A;  3DXJ F;  1LS4 A;  4PAC A;  2HJM A;  2EPL X;  1HMO A;  2A68 F;  3HKK A;  4XEK A;  5CI8 A;  5KYU A;  5F5F A;  1TWH A;  2KGO A;  3PMR A;  4JTD B;  4O6Y A;  1JAF A;  1S7Z A;  5IY5 C;  3G50 A;  1LPE A;  5B1A C;  256B A;  4FES A;  5E33 A;  1WOL A;  3EGD A;  3H65 A;  3AGT A;  4L6R A;  1ZU4 A;  1LE2 A;  4Z9J A;  2VB6 A;  3S90 A;  3MYF A;  2HSB A;  4CSA A;  1QZX A;  1Q0M A;  3RKO F;  4G7O F;  4LLC A;  4OD4 A;  3NRH A;  3UMK A;  5FZT A;  4U9E A;  1H7I A;  5F28 E;  4CDV A;  1EKY A;  4PJJ A;  3T6J A;  3JT1 A;  1RXQ A;  3M4C A;  4JJF A;  1T6Q A;  4XQ1 A;  3DM9 B;  1GQA A;  3U8V A;  3T4R A;  4OD5 A;  2B0H A;  2CDQ A;  2R7W A;  4PJN A;  5JP7 A;  1MND A;  3L0I A;  1FMV A;  4M63 A;  1NFN A;  4LAC B;  1TWA A;  2IXM A;  2VCC A;  4O7G A;  3POV A;  1YDI A;  1ZHT A;  1QPU A;  1T6U A;  4JTA B;  3KMI A;  5JSL A;  4DJ9 A;  1D1B A;  3ABL C;  3EH1 A;  4AK9 A;  2WVQ A;  1YYX A;  2EIJ C;  2J0W A;  3X2Q C;  1ZW2 A;  1T5O A;  2ZD9 A;  2LP4 A;  5AC4 A;  4W8P A;  1GM5 A;  2XM0 A;  1NFO A;  1SZI A;  5CI9 A;  5BQI A;  2ETS A;  3AGU A;  2FAP B;  4IRU A;  5E2Q A;  4RD9 A;  3PCV A;  1LI5 A;  2C04 A;  1RMV A;  4Q7C A;  1RCP A;  2NUT A;  4EBJ A;  2R7O A;  2VAS A;  1OCZ C;  4A2N B;  4BJ5 A;  3TQO A;  1AVO B;  4EWC A;  1LVK A;  2FFH A;  3BEH A;  3LAY A;  4YN0 B;  3WOD F;  5L0F A;  4K7B A;  3HNL A;  3SEO A;  1Z23 A;  4JCH A;  4BJ1 A;  1V54 C;  2L6H A;  1FAP B;  2J9V A;  4E0I A;  3E70 C;  2P1A A;  2J7P A;  2RSE B;  4QI0 A;  2XLW A;  1S05 A;  4BPM A;  4YWQ A;  2R7T A;  2XS1 A;  3FOP A;  2R7S A;  3K66 A;  1YLM A;  2OG2 A;  4CIH A;  4JTC B;  5FCL A;  3LLK A;  1G4U S;  1QLE C;  1ZHW A;  4PFO A;  1QVX A;  3ZVR A;  1PV3 A;  1VB5 A;  1D0Z A;  1J8Y F;  3ZWI A;  3HNJ A;  4CS7 A;  1K05 A;  2GA0 A;  4JC7 A;  3OWT A;  4MS2 A;  3W4Y A;  3NDB B;  1A7D A;  3GOD A;  3W8I A;  1SYQ A;  1E86 A;  1UFB A;  2EIK C;  4Z9I A;  4JRZ A;  3T6G B;  1M2V A;  4QI2 A;  3B0U X;  1O3U A;  1LKX A;  3TD7 A;  2EPN A;  3ZSU A;  4CIP A;  1I5N A;  3O6X A;  1OQC A;  2FGY A;  4MW3 A;  1LS1 A;  1V4A A;  4Z9H A;  1DOW A;  2VC9 A;  4YL3 A;  5D92 A;  5BQG A;  2XM4 A;  3VYW A;  3QVY A;  2OEX A;  3EGX B;  3IPM O;  3M79 A;  1FR0 A;  4U5F E;  3H2U A;  4U5C E;  2CYD A;  1JPJ A;  1NSG B;  2AVK A;  1U0B B;  3B0V C;  3QW1 A;  4EKW A;  4O6N A;  1FFT C;  1T01 A;  2OQM A;  1OR2 A;  3HLZ A;  4EBK A;  1OXB A;  4DBR A;  2M64 A;  2EIN C;  3A11 A;  1U6H A;  4PJM A;  1HE9 A;  4GYT A;  3B0P A;  2GWW A;  3EHN A;  1VTM P;  2WB7 A;  4HFF B;  3IQ6 A;  5TJ5 E;  2WVO A;  2KW3 C;  2UUI A;  3N2Z B;  5KYY A;  2L7A A;  1MMG A;  2Y3D A;  3Q7L A;  2HJ3 A;  3O10 A;  3SZR A;  5A6J A;  2R7R A;  4I44 A;  3LEO A;  1JR8 A;  2JX0 A;  1FTS A;  2Q9B A;  3AOU A;  3MX3 A;  4G0H A;  5L0J A;  2VH3 A;  1BR2 A;  1FNT c;  1H9T A;  1Q0G A;  3K1I A;  2X51 A;  1Q0F A;  2WZG A;  1K04 A;  2LD6 A;  4NCQ A;  3FXH A;  1E85 A;  1MNE A;  5A6K A;  1C03 A;  4MW8 A;  5KYN A;  2EPK X;  4JW1 A;  2NUP A;  1YAU O;  2IXN A;  4MVM A;  2H7V C;  2J7P D;  4NTB A;  4U5G A;  1N1C A;  4I1O B;  3W2V A;  4E17 A;  5JLI A;  3RW0 A;  1U89 A;  4IJJ A;  5B3I A;  4YT8 A;  3MLG A;  1CPQ A;  2UUH A;  2OU6 A;  4E7S A;  3S27 A;  4YK5 A;  2V26 A;  3L1M A;  2NG1 A;  3GWL A;  1JMW A;  3QTH A;  2A6E F;  2LQG A;  3GM3 A;  3VRC A;  4C3D A;  2LIG A;  4CJO A;  1AUE A;  4ZLC A;  4UDV A;  3T6B A;  2Q3T A;  1L7C A;  4FAP B;  1V74 B;  4FX5 A;  3W2W A;  1MMA A;  1D0Y A;  3ZDL A;  2Y3G A;  3AG1 C;  1D1C A;  2QNL A;  5COG A;  3JZ0 A;  2NSG A;  3B71 A;  1KU2 A;  3DAF A;  5AC5 A;  1HW2 A;  4ER9 A;  1ORJ A;  2XXA B;  3DJU B;  2J9B A;  3FOO A;  2IOQ A;  1VYI A;  5DS4 A;  1TQG A;  2WL8 A;  1RJ9 B;  2R05 A;  4JE9 A;  3ZTZ A;  3DWW A;  3LNR A;  3FDQ A;  2GAQ A;  3DAG A;  3JSE O;  1BBH A;  3CAX A;  2HKV A;  3AG2 C;  5A6B A;  2HS5 A;  5B1B C;  3FAP B;  2YHS A;  4MTF A;  4CX9 A;  4U9D A;  3IEE A;  3NMK A;  3EG9 A;  3JTL O;  2ZXW C;  2Q00 A;  3JRM O;  4YL1 A;  4MTG A;  1TFO B;  3FVY A;  4IAQ A;  4JEB A;  1VYK A;  1I4Y A;  2P0N A;  3I5P A;  4W8K A;  3TK0 A;  3JYH A;  1F1M A;  3AQB A;  1GS9 A;  2LCH A;  4C3E A;  4G7H F;  3KKB A;  1G4W R;  5L3V A;  4BEM J;  2JPU A;  1CPR A;  1CGO A;  4DXW A;  3UGP A;  4CS9 A;  3C63 A;  3EGD B;  2L81 A;  4Q4Z F;  2A0B A;  2A1D D;  1LM3 B;  2YVK A;  3O39 A;  5KYW B;  1NLX A;  2YL1 A;  4LDR A;  4LLE A;  1ZYR F;  1H6G A;  3ABM C;  3NYL A;  4BG0 A;  2KNH A;  1Z6A A;  3B29 A;  5L0G A;  1A0B A;  4HEA J;  4K0D A;  4KI2 A;  2CNW A;  4DVZ A;  1H9G A;  3A9C A;  3GM2 A;  3WHN A;  1TFK B;  1WWP A;  3K6B A;  1QKR A;  1O5H A;  3CZ6 A;  5K0I A;  1ZZP A;  2PP4 A;  3IQC A;  3V5Y A;  4D4X A;  2ZPA A;  2HFI A;  3ECS A;  1DOV A;  4MVQ A;  2R25 A;  3IQ5 A;  4K1O A;  4MVU A;  3MYI A;  4NTF A;  2KK1 A;  3GWN A;  3NKE A;  3QMK A;  3QW0 A;  4FWV A;  2VCA A;  1WAS A;  4RBN A;  2QUP A;  4PFP A;  4AE4 A;  1OKK D;  5T3T A;  4N6C A;  4KC9 A;  3ZQY A;  4EUK B;  3EH2 A;  5DS5 A;  4U5E E;  4XLP F;  1XWJ A;  2G62 A;  4YT5 A;  3K33 A;  4ZLD A;  3EPV A;  4WGY A;  4CS8 A;  3LES A;  3N24 A;  4JIO A;  5GPG B;  2ZXO A;  3DE9 A;  3KPH A;  4CDA A;  4OIO F;  4ULV A;  1LE4 A;  2O9X A;  2NUT B;  3R2P A;  1KTM A;  1D0X A;  5A6A A;  3US6 A;  4YJW A;  5L0I A;  3DD7 A;  3M1C B;  1HW1 A;  3I5Q A;  3NG1 A;  4WAB A;  4WGZ A;  1EQ1 A;  1EA8 A;  1CGN A;  1G5Z A;  1LIH A;  3Q6N A;  5L3Q A;  1ORY A;  4KBL A;  3HNI A;  4DVY P;  2L9J A;  3F47 A;  2CGE A;  1FMW A;  3RQF A;  3U9M A;  2VCB A;  4IAR A;  4GEH A; 
#chains in the Genus database with same CATH homology
 1AVO B;  1FNT c;  1YAR O;  1YA7 O;  3IPM O;  3JSE O;  3JTL O;  3JRM O;  1Z7Q c;  1YAU O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...