3JTLO

Crystal structure of archaeal 20s proteasome in complex with mutated p26 activator
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
228
structure length
218
Chain Sequence
KRAALIQNLRDSYTETSSFAVIEEWAAGTLQEIEGIAKAAAEAHGVIRNSTYGRAQAEKSPEQLLGVLQRYQDLCHNVYCQAETIRTVIAIRIPEHKEEDNLGVAVQHAVLKIIDELEIKTLGSGEKSGSGGAPTPIGMYALREYLSARSTVEDKLLGGGSQSPSLLLELRQIDADFMLKVELATTHLSTMVRAVINAYLLNWKKLIQPRTHLDVLYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase activator
molecule keywords Proteasome subunit alpha
publication title Structural Models for Interactions between the 20S proteasome and its PAN/19S activators.
pubmed doi rcsb
source organism Thermoplasma acidophilum
total genus 84
structure length 218
sequence length 228
chains with identical sequence P, Q, R, S, T, U
ec nomenclature
pdb deposition date 2009-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF02252 PA28_beta Proteasome activator pa28 beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.180 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Proteasome activator pa28, C-terminal domain 3jtlO01
3JTLO 1FNTc 1AVOB 3IPMO 1Z7Qc 1YAUO 1YA7O 1YARO 3JSEO 3JRMO
chains in the Genus database with same CATH superfamily
3Q6NA 3SXZA 3ATPA 1JPJA 3C7JA 4BJTA 5KYUB 5CI8A 1T9KA 1E2XA 4FX5A 4RDAA 4BPMA 1S7ZA 3GM1A 4NTFA 1ZVZA 2QY9A 4AE4A 1I5NA 2AWCA 4C7OA 1OR3A 3K1HA 3RF3A 1MMGA 3EH1A 4YWQA 4EWCA 3TULA 1Y4CA 3ABKC 2PX0A 1I4YA 3G4XA 1D0XA 2DYRC 5F5HA 2NSFA 1QPUA 1U6HA 1LE4A 2XLWA 3S28A 1VLSA 1JRAA 3O55A 3FAJA 2G3KA 3EHMA 3QW1A 1WATA 4JEAA 2QNLA 1OQCA 4DVYP 4XQ1A 5A6BA 4BG0A 4BJ5A 1WGWA 3UMHA 4G7HF 3S90A 5COFA 3T6JA 2J7PA 2R02A 4UDVA 2J8WA 5L0GA 2XL4A 3K33A 4KNVA 3POVA 2OG2A 3RW0A 2Y69C 3HNJA 4CS8A 2Z15A 4N06A 4JCHA 2Q9BA 5KYXA 5L0HA 3K66A 3ZIBA 3AJMA 3EPVA 3QTHA 2Q7RA 4XEFA 4CS7A 1YJGA 2CW0F 3SZRA 2Q00A 5L0CA 4PR9A 4CS8C 3UGOA 4NQFA 1HW2A 1LKXA 1S05A 2YZSA 4JKVA 4LLCA 3TJ5A 3EGDA 4Q5SF 3K7DA 4JCZA 1T6IA 1Z5ZA 3C8GA 5DQTA 3TOMA 1DOVA 5TJ5E 4CBEA 1ZHZA 3I5QA 1V4AA 2H8AA 1T6QA 3CQZA 4JJGA 3IHUA 4N4WA 3N2ZB 4WJ0A 5DQZA 1Z6AA 4EUKB 3GODA 4XEKA 5E33A 3TOLA 4EBBA 1H9GA 2Q9AA 1E86A 3KKBA 4JC7A 2LD6A 3NKEA 4RD9A 3MYFA 3ZDLA 4P9TA 2CCYA 3X2QC 2W4MA 1NU7D 4XPXA 4DBQA 1RJ9A 2R03A 1ORYA 1RKEA 2R7UA 3PDMP 4BJ6A 3B0VC 3GM2A 3GWLA 5DS4A 1RCPA 1XZQA 2LIGA 2CNWD 1YA9A 2XLEA 4LDRA 2L6HA 3U3FA 1ZW2A 2J46A 3S9OA 4CJGA 2J45A 1NU9C 4MVMA 1TFOB 1GGQA 2L6FA 4BJ6C 3O10A 3TJ6A 1ZYRF 1D1BA 2W4BA 3V5ZA 4KI2A 2NUTB 1YZCA 3O39A 1TWGA 3AGTA 1F1MA 3BRJA 1XZPA 1TR2A 1V55C 2KK1A 1WWPA 2NPUA 3SXKA 4P6IC 1VOMA 2J9VA 1QZXA 2LCHA 3A9CA 4RBNA 2EILC 2P0NA 5KYYA 3EG9A 3E9VA 3J06A 2QUPA 3U3BA 3IQTA 4OIRF 2V3CC 1KTMA 2VH3A 2HFIA 3EFOA 4DOZA 4MTFA 2IOQA 1PCXA 3QZCA 1Q0FA 1GM5A 1HE1A 1MMAA 1OW7A 2Q4FA 2WZLA 2Y3GA 3O6XA 3ASNC 1QVXA 2PFDA 4XWJA 5BQHA 4E17A 2XXAA 1YAUO 2I15A 2M4EA 5COGA 1HMDA 1E85A 4OIPF 4J7TA 2ZXRA 3JT1A 1JOGA 1RKCA 2IXPA 2L9JA 2GA0A 3LAYA 3LLKA 3QW0A 3GORA 4G0HA 4K1OA 5DVWA 5JVEA 1HY5A 256BA 2KJGA 2NUPB 2FGYA 2X51A 2YL3A 1LI5A 1LPEA 3LESA 2ICWG 4Z9JA 4F4BA 3JTLO 4PK4A 3W8IA 1M6TA 4FWVA 3GEHA 1ZHXA 1CGME 4HEAJ 1HW1A 4IWBA 3FAPB 2LFFA 4GYTA 3VRCA 2YL0A 3DJUB 1O5HA 2AVKA 3I5PA 2EPLX 4JJFA 1OR2A 1WN0A 3PCVA 1OKKA 1SYQA 4QI2A 3ZTZA 1Q0DA 1QSPA 3C18A 4LACB 4AE4B 1E83A 4U5DE 4CSAA 2X0CA 2IBFA 4C7OB 3KMIA 5B3SC 1BR1A 1SMYF 4ULWA 4PACA 5L3VA 2J0WA 1A7EA 5KYWA 3T9OA 1JPNA 4CSAC 1FR0A 4O7GA 2Y3HA 2HMZA 4YL3A 2WVQA 3TK0A 1JR8A 1EKYA 1NG1A 2XM4A 3W8HA 3S84A 2H7BA 4NY3A 3LS0A 2HS5A 4EIYA 1J8YF 1N1CA 1M2OA 2HSBA 2WB7A 2VASA 2YWAA 4YL0A 4YK5A 3DKAA 3TQOA 3V5YA 3MYIA 4DRHB 2TMVP 2BL2A 3MBGA 1VLTA 3DWWA 4MW8A 4P9FA 4WGYA 1T6UA 4Z9HA 3V7OA 4YN0B 4BEJA 3RYLA 1ZW3A 5CI9A 3OEOA 5KYXB 4YT5A 1LI7A 1ORSC 1O87A 2YEVA 1SZIA 1ZU4A 3AGUA 5BQGA 1ZU5A 4BEMJ 2MWQA 3AG4C 1W2WA 1UG7A 5K0IA 3QVYA 4ONSA 4J32B 3DE9A 5KYNA 3BEHA 2G3VA 1ST6A 1VYIA 2AWYA 3K1IA 3EGDB 3RFYA 2BC5A 3CZ6A 3IQ6A 3RVZA 2GWWA 2R25A 4NC3A 2G62A 3C8GB 4JTAB 4HFKB 3U8VA 5E2QA 3I4UA 2V26A 2YLIA 2C04A 4X0RA 1QQ3A 4CS9A 2A0BA 2XLOA 1K40A 3DXJF 3SEOA 3K1IC 1VYKA 4PJLA 4N6HA 2PF4E 1D1AA 3EJNA 3GWNA 3JYYA 4BJ5C 4IJJA 2MHRA 4OIQF 3JRMO 3HLZA 2JD3A 1GS9A 4JW1A 2HKVA 2WVOA 4CS9C 4O6YA 4A4AA 5DS6A 2F22A 2JX0A 4E7SA 1HE9A 3AG2C 4N6CA 1A7DA 2KC3A 1FMWA 4NCQA 2J9WA 5E3AA 2KQ9A 1Q0MA 2ZPAA 5B1BC 5AC4A 1M57C 1M2VA 1RJ9B 3K6BA 4BJ1A 3UGPA 2Y39A 1ZHTA 1VTMP 1RKEB 3W2WA 1OW6A 4NTAA 4LLEA 2J7PD 1Z3IX 2WZGA 1OXBA 2XRHA 4EKWA 1MNDA 5EK0A 1HMOA 4OD4A 4W8KA 4EBJA 3NYJA 3RQEA 5L0DA 2YL7A 2VCBA 1J8MF 1TWCA 3SXMA 4WABA 1E84A 1R5ID 2A68F 2ZD9A 4CX9A 2J9BA 4XTKA 2LSEA 2DB4A 2YL1A 3V5XA 3UMKA 5L3QA 2OU6A 5DS5A 1LE2A 2A69F 4OIOF 3H2VA 2KW3C 1Q0GA 3MX3A 2O9XA 3N24A 3AQCA 4XPWA 1T01A 2IXNA 2OCCC 5JSLA 4D4NA 3GEIA 2WVNA 1A41A 1ORJA 2XS8A 3M1CB 5L0JA 4ZLCA 4U9EA 5KYYB 3C8GD 2GFHA 3EG9B 2UUIA 3GANA 4MS2A 5AGFA 4DRIB 1T5OA 2I8BA 1A0BA 3GEEA 4U5HA 3EFOB 5HSWA 3ZWIA 1OCCC 4I3MA 2ZXWC 4B6IA 3LS1A 1PV3A 2D4UA 3DE8A 4U9DA 5GPGB 4MVZA 4DRJB 3DAGA 3C63A 3FOOA 4JURI 4Q7CA 5D91A 2XXAB 1MQVA 3VF0A 4IAQA 2RD9A 4PJMA 1LS1A 1YLMA 3FOPA 2EPMX 3NMJA 3R7CA 4ZLDA 1EQ1A 2HJ3A 1D0YA 4K7BA 4QI0A 1NBBA 3M15A 1LIHA 2VCAA 1CPRA 4GEHA 2PX3A 4PFPA 3ASOC 2YKZA 3HNLA 2YVKA 3NKDA 3JYHA 4XPYA 1BR2A 3IPMO 3L34A 1BZ4A 3NMIA 3UMIA 1EI7A 4O79A 2EPKX 5FZTA 1RXQA 1PD0A 3F47A 1WOLA 4DXWA 2WL8A 2YLGA 1R4TA 2R7VA 1H6GA 5JT4A 1BDJB 2D5RB 3L1MA 4MTOA 1G5ZA 3FXHA 1Q0KA 3CSKA 3IEEA 1XWJA 2P61A 1H9TA 4E18A 3ZTMA 3DJNB 2FAPB 2UUHA 3U2MA 2JPUA 5KYWB 2E87A 2EINC 3LNMB 3PHF2 4HE8D 2B0JA 4OINF 5AC5A 5T1DB 1CGNA 3EGXA 1KNYA 4JVSA 3G50A 5COMA 5DLJA 3NRHA 4YT4A 3HNKA 4IRUA 3S0XA 4O6MA 1UFBA 3MLGA 4G7ZF 2YRFA 3ABLC 2C03A 3M4BA 5A69A 2HV6A 4YT2A 4MW3A 3AOUA 2W9YA 5E3CA 3SNHA 2NUTA 2CDQA 1D0ZA 3R2PA 2ZXPA 4JEBA 5A6KA 2HUJA 3UNGC 2DGJA 2RSEB 1AEPA 4DVZA 2P6VA 2LQGA 3KH2A 4I1MA 1L3PA 3AQBA 1TWHA 3Q7GA 2XLHA 4D4XA 4G78A 1QKRA 2R9RB 1FTSA 2LK4A 4KBLA 4YJWA 4ER9A 4AX2A 1CGOA 2VCCA 3JSZA 2AP3A 3EZIA 1OKKD 4DBRA 4LDQA 4G7OF 2ETSA 1FMVA 5T3TA 2R7OA 3U9MA 1OCOC 1VK5A 3S27A 4U5CE 3X1OA 3CAXA 1O3UA 3VYWA 1OW8A 3E70C 1H7IA 1APCA 4PJNA 4IARA 4U5FE 3RKOF 4MTGA 4A2NB 1QLEC 2HMQA 2HV7A 4U5GA 4MVSA 1M2VB 3G4ZA 2LFDA 4YT8A 5B3IA 3M79A 4CDVA 3FMSA 3ZQVA 1OCRC 4O6NA 5A6AA 3ABMC 2W45A 2XLVA 3DD7A 3M4CA 4JZAA 4E0IA 3EH2A 3T6BA 1B68A 1KU2A 1TWAA 4CIPA 1BBHA 3LUTB 3RIPA 3JSEO 2P1AA 2AU5A 3JRTA 2L6GA 3EQLF 2J9UA 3L8JA 4MVUA 2YQYA 4ANJA 1G4WR 3B0PA 3US6A 2XLDA 4IAOA 3VAYA 3HTKC 4J7YA 1IW7F 2OJQA 2LP4A 4KNWA 1LM3B 2GDCA 5A6BD 1A7VA 1MMNA 1Z7Qc 4C3EA 5HV9A 4MQ9F 3JCUQ 3RQGA 1FFTC 4CJOA 3FDQA 3H2UA 3U9JA 4OD5A 1AUEA 3S29A 1K05A 5KYUA 1YDIA 2EIKC 1Z23A 2MYSA 3A11A 1C17M 1I4ZA 3LLIA 2OKUA 4R32A 1ZHWA 2KSFA 4U5EE 4AL0A 2HSQA 3OA1A 3MFNA 1EA8A 2H7OA 1V74B 1D1CA 3WHNA 1MNEA 3DMDA 3JZ0A 1YYXA 3FHDA 4HFFB 1OCZC 2QLAA 1GQAA 3B71A 4E0HA 1AVOB 4U5BE 1YARO 1SF8A 3L8IA 1NFOA 2Q9CA 4L6RA 5F5FA 2WZFA 2R05A 4GQHA 1U0BB 2OEXA 3DI5A 2QE9A 2CNWA 3B29A 3ZG1A 3FVYA 3ZSUA 1JAFA 2CYDA 3PMRA 3Q7LA 2NSGA 1NFNA 1BR4A 4NTBA 4C3BA 3Q6MA 4EHPA 4IB4A 5BQIA 3U8PA 1U89A 4XEVA 2XL6A 3NMKA 1RMVA 1LVKA 4JIOA 1OXKA 3C62A 3C8ZA 3KPHA 2KGOA 2XM0A 3HJCA 3KYJA 3AG3C 1FFHA 3AG1C 4LERA 4CDYA 1K04A 5T3WA 2XLMA 3RQFA 3EGXB 3NDBB 4FESA 1WASA 1IZMA 3KYIA 3NYLA 1Y6DA 4JTCB 1G8XA 3ZVRA 2ZXOA 1L7CA 1FAPB 2CGEA 4MNDA 2OJED 4XLNF 2EIJC 1TQGA 4MVQA 1SR2A 3TD7A 1JMWA 1YA7O 2P7VA 3NYMA 4Q4ZF 2PNOA 2EPOA 4K0DA 4ULVA 2NG1A 5EHHA 2VB6A 5L0IA 5JP7A 3DAFA 2ASRA 3DZAA 3F46A 3RVYA 3ZQYA 4FAPB 5BUOA 5JUAA 2BE5F 3DM9B 4M63A 3HKKA 3UR3C 2M64A 4J30B 5FCLA 3U2LA 3DM5A 2YHSA 2IYLD 2YLDA 5A6JA 5IY5C 4W8PA 2KYHA 1TFKB 2OOCA 1NZEA 4JE9A 2IXMA 4JRZA 2Y3BA 2HZ8A 3ITFA 3WODF 4AK9A 1YZAA 2EPNA 3QMKA 3N0TA 1FNTc 1TKNA 2XL8A 3W4YA 1C02A 4H4KC 3RH3A 1NSGB 2QTVA 2IM8A 1CPQA 2L7AA 3EHNA 3VM6A 1VMAA 2A6EF 4E7ZA 5JS5A 3ECSA 2R7SA 3H65A 1YVIA 3L0IA 3LJBA 3OWTA 4PFOA 4XLPF 4C3DA 1ZHYA 4DJ9A 3U5SA 2XSEA 4I1OB 5L0FA 2A6HF 2IXOA 5D92A 4PJJA 3SYNA 4KC9A 2VC9A 5JLIA 4IGGA 3GM3A 3CEXA 1V54C 3KL4A 3LNRA 1VB5A 5B1AC 4EBKA 2Y3DA 4YL1A 5F28E 3SXYA 3EZHA 1Z63A 1G4US 2A0UA 5EGYA 2R7QA 2L81A 2H7VC 1M56C 2B0HA 2OEVA 3SP1A 2R7WA 4QDLA 2FFHA 2R7RA 4I44A 4Z9IA 1LS4A 3IQ5A 1C03A 4LDKA 3U0CA 1DOWA 2PP4A 3LEOA 3T6GB 2Q3TA 2R7XA 1YYJA 2OQMA 4CIHA 4MVRA 2HJMA 1ZZPA 2KNHA 3WG7C 2DYSC 4JTDB 2EIMC 3NG1A 2DI3A 4CDAA 3HNIA 4MVOA 4WGZA 2GAQA 1MMDA 2NUPA 4AL1A 3W2VA 3IQCA 3B0UX 3B9QA 5JRAA 2J0XA 1PD1A 3QVZA 5CIVA 2R7TA 1NLXA 4H54A 3T4RA 3ZC4A 3WAQA 2PBEA 2A1DD 3LEVA 2XS1A 1WTYA
chains in the Genus database with same CATH topology
3JTLO 1FNTc 1AVOB 3IPMO 1Z7Qc 1YAUO 1YA7O 1YARO 3JSEO 3JRMO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JTL O;  1FNT c;  1AVO B;  3IPM O;  1Z7Q c;  1YAU O;  1YA7 O;  1YAR O;  3JSE O;  3JRM O; 
#chains in the Genus database with same CATH topology
 3Q6N A;  3SXZ A;  3ATP A;  1JPJ A;  3C7J A;  4BJT A;  5KYU B;  5CI8 A;  1T9K A;  1E2X A;  4FX5 A;  4RDA A;  4BPM A;  1S7Z A;  3GM1 A;  4NTF A;  1ZVZ A;  2QY9 A;  4AE4 A;  1I5N A;  2AWC A;  4C7O A;  1OR3 A;  3K1H A;  3RF3 A;  1MMG A;  3EH1 A;  4YWQ A;  4EWC A;  3TUL A;  1Y4C A;  3ABK C;  2PX0 A;  1I4Y A;  3G4X A;  1D0X A;  2DYR C;  5F5H A;  2NSF A;  1QPU A;  1U6H A;  1LE4 A;  2XLW A;  3S28 A;  1VLS A;  1JRA A;  3O55 A;  3FAJ A;  2G3K A;  3EHM A;  3QW1 A;  1WAT A;  4JEA A;  2QNL A;  1OQC A;  4DVY P;  4XQ1 A;  5A6B A;  4BG0 A;  4BJ5 A;  1WGW A;  3UMH A;  4G7H F;  3S90 A;  5COF A;  3T6J A;  2J7P A;  2R02 A;  4UDV A;  2J8W A;  5L0G A;  2XL4 A;  3K33 A;  4KNV A;  3POV A;  2OG2 A;  3RW0 A;  2Y69 C;  3HNJ A;  4CS8 A;  2Z15 A;  4N06 A;  4JCH A;  2Q9B A;  5KYX A;  5L0H A;  3K66 A;  3ZIB A;  3AJM A;  3EPV A;  3QTH A;  2Q7R A;  4XEF A;  4CS7 A;  1YJG A;  2CW0 F;  3SZR A;  2Q00 A;  5L0C A;  4PR9 A;  4CS8 C;  3UGO A;  4NQF A;  1HW2 A;  1LKX A;  1S05 A;  2YZS A;  4JKV A;  4LLC A;  3TJ5 A;  3EGD A;  4Q5S F;  3K7D A;  4JCZ A;  1T6I A;  1Z5Z A;  3C8G A;  5DQT A;  3TOM A;  1DOV A;  5TJ5 E;  4CBE A;  1ZHZ A;  3I5Q A;  1V4A A;  2H8A A;  1T6Q A;  3CQZ A;  4JJG A;  3IHU A;  4N4W A;  3N2Z B;  4WJ0 A;  5DQZ A;  1Z6A A;  4EUK B;  3GOD A;  4XEK A;  5E33 A;  3TOL A;  4EBB A;  1H9G A;  2Q9A A;  1E86 A;  3KKB A;  4JC7 A;  2LD6 A;  3NKE A;  4RD9 A;  3MYF A;  3ZDL A;  4P9T A;  2CCY A;  3X2Q C;  2W4M A;  1NU7 D;  4XPX A;  4DBQ A;  1RJ9 A;  2R03 A;  1ORY A;  1RKE A;  2R7U A;  3PDM P;  4BJ6 A;  3B0V C;  3GM2 A;  3GWL A;  5DS4 A;  1RCP A;  1XZQ A;  2LIG A;  2CNW D;  1YA9 A;  2XLE A;  4LDR A;  2L6H A;  3U3F A;  1ZW2 A;  2J46 A;  3S9O A;  4CJG A;  2J45 A;  1NU9 C;  4MVM A;  1TFO B;  1GGQ A;  2L6F A;  4BJ6 C;  3O10 A;  3TJ6 A;  1ZYR F;  1D1B A;  2W4B A;  3V5Z A;  4KI2 A;  2NUT B;  1YZC A;  3O39 A;  1TWG A;  3AGT A;  1F1M A;  3BRJ A;  1XZP A;  1TR2 A;  1V55 C;  2KK1 A;  1WWP A;  2NPU A;  3SXK A;  4P6I C;  1VOM A;  2J9V A;  1QZX A;  2LCH A;  3A9C A;  4RBN A;  2EIL C;  2P0N A;  5KYY A;  3EG9 A;  3E9V A;  3J06 A;  2QUP A;  3U3B A;  3IQT A;  4OIR F;  2V3C C;  1KTM A;  2VH3 A;  2HFI A;  3EFO A;  4DOZ A;  4MTF A;  2IOQ A;  1PCX A;  3QZC A;  1Q0F A;  1GM5 A;  1HE1 A;  1MMA A;  1OW7 A;  2Q4F A;  2WZL A;  2Y3G A;  3O6X A;  3ASN C;  1QVX A;  2PFD A;  4XWJ A;  5BQH A;  4E17 A;  2XXA A;  1YAU O;  2I15 A;  2M4E A;  5COG A;  1HMD A;  1E85 A;  4OIP F;  4J7T A;  2ZXR A;  3JT1 A;  1JOG A;  1RKC A;  2IXP A;  2L9J A;  2GA0 A;  3LAY A;  3LLK A;  3QW0 A;  3GOR A;  4G0H A;  4K1O A;  5DVW A;  5JVE A;  1HY5 A;  256B A;  2KJG A;  2NUP B;  2FGY A;  2X51 A;  2YL3 A;  1LI5 A;  1LPE A;  3LES A;  2ICW G;  4Z9J A;  4F4B A;  3JTL O;  4PK4 A;  3W8I A;  1M6T A;  4FWV A;  3GEH A;  1ZHX A;  1CGM E;  4HEA J;  1HW1 A;  4IWB A;  3FAP B;  2LFF A;  4GYT A;  3VRC A;  2YL0 A;  3DJU B;  1O5H A;  2AVK A;  3I5P A;  2EPL X;  4JJF A;  1OR2 A;  1WN0 A;  3PCV A;  1OKK A;  1SYQ A;  4QI2 A;  3ZTZ A;  1Q0D A;  1QSP A;  3C18 A;  4LAC B;  4AE4 B;  1E83 A;  4U5D E;  4CSA A;  2X0C A;  2IBF A;  4C7O B;  3KMI A;  5B3S C;  1BR1 A;  1SMY F;  4ULW A;  4PAC A;  5L3V A;  2J0W A;  1A7E A;  5KYW A;  3T9O A;  1JPN A;  4CSA C;  1FR0 A;  4O7G A;  2Y3H A;  2HMZ A;  4YL3 A;  2WVQ A;  3TK0 A;  1JR8 A;  1EKY A;  1NG1 A;  2XM4 A;  3W8H A;  3S84 A;  2H7B A;  4NY3 A;  3LS0 A;  2HS5 A;  4EIY A;  1J8Y F;  1N1C A;  1M2O A;  2HSB A;  2WB7 A;  2VAS A;  2YWA A;  4YL0 A;  4YK5 A;  3DKA A;  3TQO A;  3V5Y A;  3MYI A;  4DRH B;  2TMV P;  2BL2 A;  3MBG A;  1VLT A;  3DWW A;  4MW8 A;  4P9F A;  4WGY A;  1T6U A;  4Z9H A;  3V7O A;  4YN0 B;  4BEJ A;  3RYL A;  1ZW3 A;  5CI9 A;  3OEO A;  5KYX B;  4YT5 A;  1LI7 A;  1ORS C;  1O87 A;  2YEV A;  1SZI A;  1ZU4 A;  3AGU A;  5BQG A;  1ZU5 A;  4BEM J;  2MWQ A;  3AG4 C;  1W2W A;  1UG7 A;  5K0I A;  3QVY A;  4ONS A;  4J32 B;  3DE9 A;  5KYN A;  3BEH A;  2G3V A;  1ST6 A;  1VYI A;  2AWY A;  3K1I A;  3EGD B;  3RFY A;  2BC5 A;  3CZ6 A;  3IQ6 A;  3RVZ A;  2GWW A;  2R25 A;  4NC3 A;  2G62 A;  3C8G B;  4JTA B;  4HFK B;  3U8V A;  5E2Q A;  3I4U A;  2V26 A;  2YLI A;  2C04 A;  4X0R A;  1QQ3 A;  4CS9 A;  2A0B A;  2XLO A;  1K40 A;  3DXJ F;  3SEO A;  3K1I C;  1VYK A;  4PJL A;  4N6H A;  2PF4 E;  1D1A A;  3EJN A;  3GWN A;  3JYY A;  4BJ5 C;  4IJJ A;  2MHR A;  4OIQ F;  3JRM O;  3HLZ A;  2JD3 A;  1GS9 A;  4JW1 A;  2HKV A;  2WVO A;  4CS9 C;  4O6Y A;  4A4A A;  5DS6 A;  2F22 A;  2JX0 A;  4E7S A;  1HE9 A;  3AG2 C;  4N6C A;  1A7D A;  2KC3 A;  1FMW A;  4NCQ A;  2J9W A;  5E3A A;  2KQ9 A;  1Q0M A;  2ZPA A;  5B1B C;  5AC4 A;  1M57 C;  1M2V A;  1RJ9 B;  3K6B A;  4BJ1 A;  3UGP A;  2Y39 A;  1ZHT A;  1VTM P;  1RKE B;  3W2W A;  1OW6 A;  4NTA A;  4LLE A;  2J7P D;  1Z3I X;  2WZG A;  1OXB A;  2XRH A;  4EKW A;  1MND A;  5EK0 A;  1HMO A;  4OD4 A;  4W8K A;  4EBJ A;  3NYJ A;  3RQE A;  5L0D A;  2YL7 A;  2VCB A;  1J8M F;  1TWC A;  3SXM A;  4WAB A;  1E84 A;  1R5I D;  2A68 F;  2ZD9 A;  4CX9 A;  2J9B A;  4XTK A;  2LSE A;  2DB4 A;  2YL1 A;  3V5X A;  3UMK A;  5L3Q A;  2OU6 A;  5DS5 A;  1LE2 A;  2A69 F;  4OIO F;  3H2V A;  2KW3 C;  1Q0G A;  3MX3 A;  2O9X A;  3N24 A;  3AQC A;  4XPW A;  1T01 A;  2IXN A;  2OCC C;  5JSL A;  4D4N A;  3GEI A;  2WVN A;  1A41 A;  1ORJ A;  2XS8 A;  3M1C B;  5L0J A;  4ZLC A;  4U9E A;  5KYY B;  3C8G D;  2GFH A;  3EG9 B;  2UUI A;  3GAN A;  4MS2 A;  5AGF A;  4DRI B;  1T5O A;  2I8B A;  1A0B A;  3GEE A;  4U5H A;  3EFO B;  5HSW A;  3ZWI A;  1OCC C;  4I3M A;  2ZXW C;  4B6I A;  3LS1 A;  1PV3 A;  2D4U A;  3DE8 A;  4U9D A;  5GPG B;  4MVZ A;  4DRJ B;  3DAG A;  3C63 A;  3FOO A;  4JUR I;  4Q7C A;  5D91 A;  2XXA B;  1MQV A;  3VF0 A;  4IAQ A;  2RD9 A;  4PJM A;  1LS1 A;  1YLM A;  3FOP A;  2EPM X;  3NMJ A;  3R7C A;  4ZLD A;  1EQ1 A;  2HJ3 A;  1D0Y A;  4K7B A;  4QI0 A;  1NBB A;  3M15 A;  1LIH A;  2VCA A;  1CPR A;  4GEH A;  2PX3 A;  4PFP A;  3ASO C;  2YKZ A;  3HNL A;  2YVK A;  3NKD A;  3JYH A;  4XPY A;  1BR2 A;  3IPM O;  3L34 A;  1BZ4 A;  3NMI A;  3UMI A;  1EI7 A;  4O79 A;  2EPK X;  5FZT A;  1RXQ A;  1PD0 A;  3F47 A;  1WOL A;  4DXW A;  2WL8 A;  2YLG A;  1R4T A;  2R7V A;  1H6G A;  5JT4 A;  1BDJ B;  2D5R B;  3L1M A;  4MTO A;  1G5Z A;  3FXH A;  1Q0K A;  3CSK A;  3IEE A;  1XWJ A;  2P61 A;  1H9T A;  4E18 A;  3ZTM A;  3DJN B;  2FAP B;  2UUH A;  3U2M A;  2JPU A;  5KYW B;  2E87 A;  2EIN C;  3LNM B;  3PHF 2;  4HE8 D;  2B0J A;  4OIN F;  5AC5 A;  5T1D B;  1CGN A;  3EGX A;  1KNY A;  4JVS A;  3G50 A;  5COM A;  5DLJ A;  3NRH A;  4YT4 A;  3HNK A;  4IRU A;  3S0X A;  4O6M A;  1UFB A;  3MLG A;  4G7Z F;  2YRF A;  3ABL C;  2C03 A;  3M4B A;  5A69 A;  2HV6 A;  4YT2 A;  4MW3 A;  3AOU A;  2W9Y A;  5E3C A;  3SNH A;  2NUT A;  2CDQ A;  1D0Z A;  3R2P A;  2ZXP A;  4JEB A;  5A6K A;  2HUJ A;  3UNG C;  2DGJ A;  2RSE B;  1AEP A;  4DVZ A;  2P6V A;  2LQG A;  3KH2 A;  4I1M A;  1L3P A;  3AQB A;  1TWH A;  3Q7G A;  2XLH A;  4D4X A;  4G78 A;  1QKR A;  2R9R B;  1FTS A;  2LK4 A;  4KBL A;  4YJW A;  4ER9 A;  4AX2 A;  1CGO A;  2VCC A;  3JSZ A;  2AP3 A;  3EZI A;  1OKK D;  4DBR A;  4LDQ A;  4G7O F;  2ETS A;  1FMV A;  5T3T A;  2R7O A;  3U9M A;  1OCO C;  1VK5 A;  3S27 A;  4U5C E;  3X1O A;  3CAX A;  1O3U A;  3VYW A;  1OW8 A;  3E70 C;  1H7I A;  1APC A;  4PJN A;  4IAR A;  4U5F E;  3RKO F;  4MTG A;  4A2N B;  1QLE C;  2HMQ A;  2HV7 A;  4U5G A;  4MVS A;  1M2V B;  3G4Z A;  2LFD A;  4YT8 A;  5B3I A;  3M79 A;  4CDV A;  3FMS A;  3ZQV A;  1OCR C;  4O6N A;  5A6A A;  3ABM C;  2W45 A;  2XLV A;  3DD7 A;  3M4C A;  4JZA A;  4E0I A;  3EH2 A;  3T6B A;  1B68 A;  1KU2 A;  1TWA A;  4CIP A;  1BBH A;  3LUT B;  3RIP A;  3JSE O;  2P1A A;  2AU5 A;  3JRT A;  2L6G A;  3EQL F;  2J9U A;  3L8J A;  4MVU A;  2YQY A;  4ANJ A;  1G4W R;  3B0P A;  3US6 A;  2XLD A;  4IAO A;  3VAY A;  3HTK C;  4J7Y A;  1IW7 F;  2OJQ A;  2LP4 A;  4KNW A;  1LM3 B;  2GDC A;  5A6B D;  1A7V A;  1MMN A;  1Z7Q c;  4C3E A;  5HV9 A;  4MQ9 F;  3JCU Q;  3RQG A;  1FFT C;  4CJO A;  3FDQ A;  3H2U A;  3U9J A;  4OD5 A;  1AUE A;  3S29 A;  1K05 A;  5KYU A;  1YDI A;  2EIK C;  1Z23 A;  2MYS A;  3A11 A;  1C17 M;  1I4Z A;  3LLI A;  2OKU A;  4R32 A;  1ZHW A;  2KSF A;  4U5E E;  4AL0 A;  2HSQ A;  3OA1 A;  3MFN A;  1EA8 A;  2H7O A;  1V74 B;  1D1C A;  3WHN A;  1MNE A;  3DMD A;  3JZ0 A;  1YYX A;  3FHD A;  4HFF B;  1OCZ C;  2QLA A;  1GQA A;  3B71 A;  4E0H A;  1AVO B;  4U5B E;  1YAR O;  1SF8 A;  3L8I A;  1NFO A;  2Q9C A;  4L6R A;  5F5F A;  2WZF A;  2R05 A;  4GQH A;  1U0B B;  2OEX A;  3DI5 A;  2QE9 A;  2CNW A;  3B29 A;  3ZG1 A;  3FVY A;  3ZSU A;  1JAF A;  2CYD A;  3PMR A;  3Q7L A;  2NSG A;  1NFN A;  1BR4 A;  4NTB A;  4C3B A;  3Q6M A;  4EHP A;  4IB4 A;  5BQI A;  3U8P A;  1U89 A;  4XEV A;  2XL6 A;  3NMK A;  1RMV A;  1LVK A;  4JIO A;  1OXK A;  3C62 A;  3C8Z A;  3KPH A;  2KGO A;  2XM0 A;  3HJC A;  3KYJ A;  3AG3 C;  1FFH A;  3AG1 C;  4LER A;  4CDY A;  1K04 A;  5T3W A;  2XLM A;  3RQF A;  3EGX B;  3NDB B;  4FES A;  1WAS A;  1IZM A;  3KYI A;  3NYL A;  1Y6D A;  4JTC B;  1G8X A;  3ZVR A;  2ZXO A;  1L7C A;  1FAP B;  2CGE A;  4MND A;  2OJE D;  4XLN F;  2EIJ C;  1TQG A;  4MVQ A;  1SR2 A;  3TD7 A;  1JMW A;  1YA7 O;  2P7V A;  3NYM A;  4Q4Z F;  2PNO A;  2EPO A;  4K0D A;  4ULV A;  2NG1 A;  5EHH A;  2VB6 A;  5L0I A;  5JP7 A;  3DAF A;  2ASR A;  3DZA A;  3F46 A;  3RVY A;  3ZQY A;  4FAP B;  5BUO A;  5JUA A;  2BE5 F;  3DM9 B;  4M63 A;  3HKK A;  3UR3 C;  2M64 A;  4J30 B;  5FCL A;  3U2L A;  3DM5 A;  2YHS A;  2IYL D;  2YLD A;  5A6J A;  5IY5 C;  4W8P A;  2KYH A;  1TFK B;  2OOC A;  1NZE A;  4JE9 A;  2IXM A;  4JRZ A;  2Y3B A;  2HZ8 A;  3ITF A;  3WOD F;  4AK9 A;  1YZA A;  2EPN A;  3QMK A;  3N0T A;  1FNT c;  1TKN A;  2XL8 A;  3W4Y A;  1C02 A;  4H4K C;  3RH3 A;  1NSG B;  2QTV A;  2IM8 A;  1CPQ A;  2L7A A;  3EHN A;  3VM6 A;  1VMA A;  2A6E F;  4E7Z A;  5JS5 A;  3ECS A;  2R7S A;  3H65 A;  1YVI A;  3L0I A;  3LJB A;  3OWT A;  4PFO A;  4XLP F;  4C3D A;  1ZHY A;  4DJ9 A;  3U5S A;  2XSE A;  4I1O B;  5L0F A;  2A6H F;  2IXO A;  5D92 A;  4PJJ A;  3SYN A;  4KC9 A;  2VC9 A;  5JLI A;  4IGG A;  3GM3 A;  3CEX A;  1V54 C;  3KL4 A;  3LNR A;  1VB5 A;  5B1A C;  4EBK A;  2Y3D A;  4YL1 A;  5F28 E;  3SXY A;  3EZH A;  1Z63 A;  1G4U S;  2A0U A;  5EGY A;  2R7Q A;  2L81 A;  2H7V C;  1M56 C;  2B0H A;  2OEV A;  3SP1 A;  2R7W A;  4QDL A;  2FFH A;  2R7R A;  4I44 A;  4Z9I A;  1LS4 A;  3IQ5 A;  1C03 A;  4LDK A;  3U0C A;  1DOW A;  2PP4 A;  3LEO A;  3T6G B;  2Q3T A;  2R7X A;  1YYJ A;  2OQM A;  4CIH A;  4MVR A;  2HJM A;  1ZZP A;  2KNH A;  3WG7 C;  2DYS C;  4JTD B;  2EIM C;  3NG1 A;  2DI3 A;  4CDA A;  3HNI A;  4MVO A;  4WGZ A;  2GAQ A;  1MMD A;  2NUP A;  4AL1 A;  3W2V A;  3IQC A;  3B0U X;  3B9Q A;  5JRA A;  2J0X A;  1PD1 A;  3QVZ A;  5CIV A;  2R7T A;  1NLX A;  4H54 A;  3T4R A;  3ZC4 A;  3WAQ A;  2PBE A;  2A1D D;  3LEV A;  2XS1 A;  1WTY A; 
#chains in the Genus database with same CATH homology
 3JTL O;  1FNT c;  1AVO B;  3IPM O;  1Z7Q c;  1YAU O;  1YA7 O;  1YAR O;  3JSE O;  3JRM O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...