3JTLO

Crystal structure of archaeal 20s proteasome in complex with mutated p26 activator
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
228
structure length
218
Chain Sequence
KRAALIQNLRDSYTETSSFAVIEEWAAGTLQEIEGIAKAAAEAHGVIRNSTYGRAQAEKSPEQLLGVLQRYQDLCHNVYCQAETIRTVIAIRIPEHKEEDNLGVAVQHAVLKIIDELEIKTLGSGEKSGSGGAPTPIGMYALREYLSARSTVEDKLLGGGSQSPSLLLELRQIDADFMLKVELATTHLSTMVRAVINAYLLNWKKLIQPRTHLDVLYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proteasome subunit alpha
publication title Structural Models for Interactions between the 20S proteasome and its PAN/19S activators.
pubmed doi rcsb
source organism Thermoplasma acidophilum
molecule tags Hydrolase/hydrolase activator
total genus 84
structure length 218
sequence length 228
chains with identical sequence P, Q, R, S, T, U
ec nomenclature
pdb deposition date 2009-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF02252 PA28_beta Proteasome activator pa28 beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.180 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Proteasome activator pa28, C-terminal domain 3jtlO01
1YA7O 1FNTc 3JTLO 3IPMO 3JRMO 1YARO 1AVOB 3JSEO 1Z7Qc 1YAUO
chains in the Genus database with same CATH superfamily
2UUIA 4IB4A 1HE9A 2Y3GA 1QZXA 5D91A 4XTKA 1XZPA 3N0TA 4A4AA 3S0XA 1OQCA 3IEEA 2OOCA 4YT4A 1Q0FA 1SR2A 3CEXA 3FAPB 3NKDA 3RFYA 1J8YF 5FZTA 1ORSC 3AG1C 3R2PA 3PDMP 2WB7A 4U5GA 5L0JA 2ZXOA 4IAOA 2IBFA 4YT5A 5L0IA 2X51A 5L0CA 3B0VC 3KKBA 4G7ZF 2HUJA 3C18A 4PK4A 1RKCA 1ORJA 2J7PA 3V5ZA 2KYHA 4I1OB 4E0HA 2W9YA 3WG7C 1YAUO 3LESA 2YKZA 1ZHYA 3C8ZA 3U9MA 4MVMA 3ZTMA 4NQFA 2EILC 3K7DA 3S27A 4XEFA 3W4YA 4MTOA 2J7PD 3U2MA 1BR2A 4BJTA 3F47A 4OIQF 4MS2A 4JJFA 3RW0A 4CS8C 4CJGA 2VASA 2AP3A 3QW1A 3ZQVA 1LS4A 2C04A 2UUHA 4IAQA 2LK4A 2G3VA 3I5PA 2Y3HA 4IJJA 3MFNA 2Y39A 3AGUA 4I44A 2L6HA 2XLEA 3B29A 1M57C 2NG1A 3KPHA 4PJLA 5B1AC 5KYUB 1V54C 2J45A 3HNIA 5DS6A 1FMWA 2XRHA 1CPRA 3VRCA 2R25A 5JS5A 2TMVP 2C03A 1WATA 3L0IA 3LLKA 1EI7A 3GM2A 3RQFA 3X2QC 1O5HA 4NTAA 1KNYA 5TJ5E 4NCQA 3S84A 3K1IC 1QPUA 3DE9A 1JRAA 1TR2A 2EPMX 3EGDB 3LEVA 1FFTC 1ZU4A 1AEPA 1GQAA 2YL0A 3LNMB 5E3CA 2IXOA 5BQGA 1VB5A 2KW3C 2KQ9A 3W2VA 5AGFA 3UGPA 2WVQA 4Z9HA 2G62A 3B9QA 1C17M 4X0RA 1JOGA 4G78A 3UMKA 4YWQA 1NBBA 2IXMA 4I3MA 3EHNA 5BUOA 2CW0F 4ULVA 5A6JA 1FFHA 5L3VA 1LS1A 4F4BA 4CDVA 1WGWA 1D1AA 1Z3IX 3V5XA 3VYWA 2RD9A 3U3FA 2L6GA 3PCVA 4PJJA 3NMIA 4PJNA 2L6FA 2RSEB 1LI5A 3ZC4A 3N24A 2D5RB 4XQ1A 4PFPA 2YVKA 3G4XA 3HKKA 2Y69C 2Q7RA 4DOZA 4KNVA 3RVZA 1NFNA 4MW8A 1LI7A 3A9CA 4U5DE 4D4XA 3E70C 2YLGA 2FGYA 4BJ1A 2OKUA 2A1DD 2OJED 2QUPA 1OXKA 3KL4A 5AC5A 5A6KA 1SF8A 1E86A 2EIJC 3DM9B 4YT8A 2J9UA 2H7BA 3G50A 5T3TA 4KNWA 4MQ9F 4OIRF 2VCAA 4LLEA 2EPLX 2V3CC 3JT1A 5JSLA 3JCUQ 1FTSA 4E18A 3C8GA 5F5FA 5JRAA 4OIOF 4U9DA 5K0IA 2P6VA 2YWAA 4JRZA 4OD4A 3UR3C 1E83A 3DJNB 2AVKA 2NSGA 4EIYA 4IGGA 1E84A 2E87A 3EJNA 3N2ZB 3Q6NA 4L6RA 1PD1A 3ECSA 1IZMA 2NSFA 4C7OA 1D0ZA 2R7OA 3GEEA 3NMJA 3UMHA 4PR9A 2NUTB 1A7VA 1TWGA 1BBHA 2YLIA 4AL0A 2V26A 3AQBA 3GODA 3QTHA 2XS1A 4GYTA 2EINC 4KI2A 1AVOB 1ZW2A 2IXPA 3LLIA 2BE5F 4LACB 5E2QA 3T4RA 2R7WA 4CS9A 1H9GA 1BR4A 2KGOA 3KYIA 4RD9A 4LDRA 3CSKA 4UDVA 3S9OA 4KBLA 1NFOA 4MVQA 4DVYP 4BJ5A 3JZ0A 3TOLA 4MVRA 3NKEA 3UGOA 3W2WA 4XLPF 1NZEA 2LFDA 4QDLA 2DGJA 4EBJA 1Q0KA 2EIKC 5CI8A 1LPEA 4Q7CA 3LAYA 4RBNA 4QI2A 4XWJA 3T9OA 1GS9A 3MBGA 2XM4A 1D0YA 4B6IA 4U5CE 3EGXA 1R5ID 3ZQYA 1ZHZA 4JE9A 3U8VA 3DD7A 2R7QA 2OEXA 3QVYA 4MVZA 1M56C 1WTYA 1HE1A 3M1CB 3AG4C 3EGDA 1YJGA 3HNJA 1LKXA 3W8HA 3C8GB 1XZQA 1OR3A 2W45A 2QLAA 3FVYA 3ZIBA 1Z6AA 4E7SA 1ZVZA 3AQCA 2BL2A 2WVNA 3DAGA 3S28A 3FXHA 3JSEO 4XEKA 3U0CA 2ZPAA 1VLSA 2X0CA 2XM0A 2IM8A 2WVOA 2XL4A 3I4UA 3RQEA 2DYSC 1OW6A 3C7JA 4HE8D 4C7OB 3EH2A 5DLJA 1RCPA 1C03A 2GFHA 4O6YA 4YL1A 1LE4A 5GPGB 1RXQA 1L3PA 4JTCB 5DS4A 3SZRA 2B0HA 5DQZA 3DKAA 1NG1A 3UNGC 1GM5A 1HMOA 2GDCA 2Q00A 3MX3A 3BRJA 2PP4A 3DMDA 1YDIA 3EZHA 4W8KA 5E33A 2LCHA 1T6UA 3CZ6A 4WABA 4E17A 1LE2A 1GGQA 3M79A 4AE4B 1RKEB 3JRTA 1TKNA 2QTVA 2HMQA 1Q0MA 1APCA 2R02A 3FOOA 1M2VB 3H2UA 2YLDA 4DBRA 4KC9A 4ZLDA 2QE9A 3QW0A 2W4MA 3EHMA 3H65A 1OCZC 4CIHA 2CGEA 2Q3TA 4EBBA 2P61A 4IWBA 4JJGA 4GQHA 2P7VA 4MNDA 1OXBA 1RMVA 2Y3BA 3EH1A 1MMDA 2IOQA 3BEHA 4PJMA 2HSBA 3Q7LA 5DQTA 2CYDA 5KYYB 3MYIA 3GWNA 2HJMA 3R7CA 3UMIA 1HY5A 2J8WA 1U6HA 3DAFA 4ZLCA 2ZD9A 1BDJB 4Z9JA 2EPOA 2QNLA 1TWCA 3EGXB 1MMNA 1M6TA 3DI5A 4CIPA 1WWPA 1Y6DA 1K04A 2XLDA 5A6BA 1D0XA 2OU6A 2OEVA 1ZZPA 2L81A 3C62A 4JKVA 4K7BA 4AX2A 4CDYA 2Y3DA 3ZWIA 1E2XA 2MWQA 2NUTA 3NG1A 4N6HA 4M63A 1VOMA 3B71A 1Q0GA 4J30B 4LDQA 2AWCA 1S7ZA 3LNRA 5A6BD 5HV9A 2R7RA 4E0IA 3S90A 4Z9IA 1Z5ZA 2HMZA 2YRFA 4RDAA 1HW1A 2PX0A 4XLNF 1V4AA 2JX0A 4JVSA 3ITFA 1TFOB 1TWHA 4N06A 4WGYA 5KYWA 1T6IA 2XSEA 4Q5SF 2YL1A 3NRHA 3NMKA 3HNKA 2DI3A 3PMRA 4J32B 1O87A 3DWWA 1T6QA 3DE8A 2IXNA 2DYRC 2M4EA 3HTKC 3AGTA 2P0NA 4CSAA 4EHPA 5L0DA 2HJ3A 2R05A 4IARA 3M15A 3L8JA 4JCHA 4XEVA 3V7OA 1G8XA 3FHDA 3IPMO 2A69F 4J7TA 5JP7A 1A7EA 3ASOC 2KNHA 2EIMC 1QQ3A 3Q7GA 4NY3A 1VYIA 2XLHA 3CAXA 3S29A 3FMSA 2IYLD 3DXJF 4BJ6A 1A7DA 1YLMA 1OW7A 3VAYA 3EPVA 5CI9A 4DJ9A 2Z15A 3O10A 4E7ZA 2A0UA 4NTBA 2R7SA 2ZXPA 4YK5A 3AOUA 3GM3A 4K1OA 4U5HA 4JTDB 4XPYA 1LIHA 2KJGA 3EZIA 4JTAB 2LQGA 3LUTB 1LVKA 5T3WA 2QY9A 3Q6MA 1Y4CA 4I1MA 5COGA 4JEBA 1VMAA 1KTMA 2YL7A 4DVZA 3C8GD 1O3UA 2MHRA 3HJCA 4EKWA 5L3QA 4MVUA 3SXMA 2LP4A 2Q9CA 2Q9AA 4XPWA 1BR1A 1F1MA 4HFFB 3FAJA 4DBQA 3IQTA 3NYJA 3SXYA 3B0UX 2YZSA 3OEOA 3JYHA 4PFOA 4AE4A 1RKEA 1WN0A 5KYWB 2L9JA 3K6BA 3ASNC 2A6EF 2H7OA 3ZDLA 5EHHA 1M2VA 1CGOA 4JW1A 2R7TA 1NU7D 4PACA 2VC9A 5L0GA 1ZHXA 1ZHWA 1BZ4A 2LFFA 3O6XA 4P6IC 3CQZA 3VF0A 1UFBA 3EFOA 4FX5A 3TK0A 4OD5A 1L7CA 4FAPB 3GORA 2R7XA 2F22A 5KYYA 4H54A 1ZHTA 2WZFA 3QZCA 2CDQA 3RIPA 4BPMA 4CS8A 1NSGB 5JLIA 2VCCA 2VB6A 3IQ5A 3ABKC 1XWJA 1FNTc 1CGME 1DOVA 3JTLO 1NLXA 2NUPB 2XS8A 2ASRA 2R7UA 5EK0A 1QKRA 1CGNA 2XXAA 1LM3B 1VK5A 3K1HA 4C3DA 3L34A 4BG0A 5BQIA 3O39A 2L7AA 2Q9BA 2XLWA 1FR0A 1T5OA 5FCLA 1H7IA 5JVEA 5D92A 4O7GA 2ICWG 3T6GB 1Q0DA 2HKVA 3IQCA 5L0FA 1EQ1A 1OKKA 2WZLA 1WASA 3LEOA 4ONSA 5B3SC 5HSWA 4O6MA 4DRHB 1T9KA 1K40A 3I5QA 2PX3A 3K1IA 3OA1A 4P9FA 4ER9A 1PV3A 1ZYRF 2DB4A 3EG9A 3RVYA 3SNHA 1OKKD 1I4YA 2Q4FA 2OG2A 2XLMA 1ZU5A 4EUKB 4DXWA 4DRIB 1G5ZA 1JPNA 2BC5A 1MQVA 4ANJA 1CPQA 3ABMC 4CBEA 3FDQA 1H9TA 5KYXB 3GWLA 3NDBB 3RF3A 1S05A 4YJWA 3KMIA 4YL3A 2M64A 3LJBA 3X1OA 2B0JA 2KSFA 3AG2C 2PBEA 3DJUB 2P1AA 2YQYA 4O6NA 2OJQA 5EGYA 1AUEA 1JR8A 2OCCC 3EFOB 4CS9C 2A6HF 2XL8A 3MYFA 2XL6A 4JIOA 2HS5A 2MYSA 3RQGA 3C63A 1TQGA 4YL0A 2YEVA 2A68F 4BJ5C 1QVXA 2HSQA 2J0XA 3ZG1A 1J8MF 256BA 4EBKA 1EKYA 3G4ZA 3JRMO 3M4BA 2ZXWC 3W8IA 1YZCA 4OIPF 2XXAB 3H2VA 4GEHA 1RJ9B 5F28E 4WGZA 1OCCC 1IW7F 4MVOA 3L8IA 4W8PA 4A2NB 1TFKB 2LIGA 3E9VA 2J9WA 1MNEA 1G4WR 1SMYF 1EA8A 4Q4ZF 3RKOF 2R9RB 4N6CA 3U5SA 1N1CA 3U9JA 4C3EA 5A69A 5B1BC 4HEAJ 4MTGA 4BEMJ 4CJOA 1G4US 3OWTA 4AL1A 4JCZA 1PD0A 4EWCA 3M4CA 1YVIA 1V74B 2KK1A 2NPUA 3AG3C 3EQLF 4QI0A 5KYNA 2FFHA 3EG9B 3T6BA 1JAFA 1U89A 3JYYA 4J7YA 4LERA 2J46A 1QLEC 3NYMA 1H6GA 1I4ZA 3SEOA 3TJ5A 3LS0A 3WODF 3HLZA 3TQOA 1UG7A 4JC7A 1NU9C 3FOPA 2W4BA 3U2LA 5DVWA 5L0HA 4YT2A 1ST6A 1KU2A 4HFKB 3NYLA 4C3BA 1K05A 4DRJB 4YN0B 3V5YA 5AC4A 3QMKA 1YYXA 1A41A 4G0HA 2NUPA 4XPXA 1Z23A 1OCOC 1DOWA 2HZ8A 1Z63A 4AK9A 2R03A 3LS1A 2EPKX 3TJ6A 3SP1A 2AWYA 3T6JA 2D4UA 1JPJA 2CCYA 3GM1A 4NTFA 2PNOA 2VCBA 1E85A 1A0BA 2KC3A 4O79A 4U5FE 3TD7A 2YHSA 4P9TA 2XLOA 1D1BA 5B3IA 4FWVA 3HNLA 4CX9A 3SXZA 3RYLA 2GA0A 2H8AA 1TWAA 2PFDA 4K0DA 1YYJA 2PF4E 3A11A 4MVSA 3U8PA 1U0BB 2HV6A 1B68A 4LLCA 5A6AA 2HFIA 3IQ6A 3ZSUA 2VH3A 2JPUA 4CS7A 4LDKA 3GEIA 3JSZA 2WZGA 1M2OA 1FAPB 1SZIA 3KH2A 3WHNA 5JT4A 2HV7A 5COMA 5DS5A 2G3KA 3TULA 1C02A 4G7HF 1MMGA 3GEHA 4N4WA 5COFA 5KYXA 3KYJA 4MTFA 1R4TA 3QVZA 5BQHA 2EPNA 2I15A 1WOLA 3U3BA 3POVA 4U5EE 3DM5A 1MNDA 2OQMA 2O9XA 3K33A 2A0BA 4U5BE 2H7VC 2I8BA 1OCRC 2J9VA 3AJMA 2AU5A 1FMVA 4JEAA 1T01A 4JZAA 2CNWA 2GAQA 3ABLC 5JUAA 1OW8A 3MLGA 2LSEA 4FESA 3SXKA 4H4KC 2LD6A 3IHUA 3SYNA 3GANA 3US6A 1HMDA 3ZVRA 1V55C 2GWWA 3J06A 2R7VA 2YL3A 1YA7O 1I5NA 1MMAA 1PCXA 3DZAA 2CNWD 1YZAA 2ETSA 2FAPB 4BEJA 4CSAC 1RJ9A 1ZW3A 3WAQA 5T1DB 4CDAA 3O55A 4D4NA 1OR2A 3K66A 3F46A 3B0PA 3VM6A 4R32A 4JURI 3ZTZA 3PHF2 1SYQA 2JD3A 3L1MA 2XLVA 5CIVA 1YA9A 1QSPA 4IRUA 1VLTA 1VTMP 1VYKA 4NC3A 5E3AA 3RH3A 3TOMA 1YARO 4BJ6C 2J9BA 5KYUA 4WJ0A 4ULWA 5IY5C 1Z7Qc 3ATPA 5F5HA 1HW2A 4G7OF 1ORYA 1W2WA 4MW3A 2WL8A 1D1CA 2ZXRA 2J0WA 4U9EA 4OINF 1JMWA
chains in the Genus database with same CATH topology
1YA7O 1FNTc 3JTLO 3IPMO 3JRMO 1YARO 1AVOB 3JSEO 1Z7Qc 1YAUO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YA7 O;  1FNT c;  3JTL O;  3IPM O;  3JRM O;  1YAR O;  1AVO B;  3JSE O;  1Z7Q c;  1YAU O; 
#chains in the Genus database with same CATH topology
 2UUI A;  4IB4 A;  1HE9 A;  2Y3G A;  1QZX A;  5D91 A;  4XTK A;  1XZP A;  3N0T A;  4A4A A;  3S0X A;  1OQC A;  3IEE A;  2OOC A;  4YT4 A;  1Q0F A;  1SR2 A;  3CEX A;  3FAP B;  3NKD A;  3RFY A;  1J8Y F;  5FZT A;  1ORS C;  3AG1 C;  3R2P A;  3PDM P;  2WB7 A;  4U5G A;  5L0J A;  2ZXO A;  4IAO A;  2IBF A;  4YT5 A;  5L0I A;  2X51 A;  5L0C A;  3B0V C;  3KKB A;  4G7Z F;  2HUJ A;  3C18 A;  4PK4 A;  1RKC A;  1ORJ A;  2J7P A;  3V5Z A;  2KYH A;  4I1O B;  4E0H A;  2W9Y A;  3WG7 C;  1YAU O;  3LES A;  2YKZ A;  1ZHY A;  3C8Z A;  3U9M A;  4MVM A;  3ZTM A;  4NQF A;  2EIL C;  3K7D A;  3S27 A;  4XEF A;  3W4Y A;  4MTO A;  2J7P D;  3U2M A;  1BR2 A;  4BJT A;  3F47 A;  4OIQ F;  4MS2 A;  4JJF A;  3RW0 A;  4CS8 C;  4CJG A;  2VAS A;  2AP3 A;  3QW1 A;  3ZQV A;  1LS4 A;  2C04 A;  2UUH A;  4IAQ A;  2LK4 A;  2G3V A;  3I5P A;  2Y3H A;  4IJJ A;  3MFN A;  2Y39 A;  3AGU A;  4I44 A;  2L6H A;  2XLE A;  3B29 A;  1M57 C;  2NG1 A;  3KPH A;  4PJL A;  5B1A C;  5KYU B;  1V54 C;  2J45 A;  3HNI A;  5DS6 A;  1FMW A;  2XRH A;  1CPR A;  3VRC A;  2R25 A;  5JS5 A;  2TMV P;  2C03 A;  1WAT A;  3L0I A;  3LLK A;  1EI7 A;  3GM2 A;  3RQF A;  3X2Q C;  1O5H A;  4NTA A;  1KNY A;  5TJ5 E;  4NCQ A;  3S84 A;  3K1I C;  1QPU A;  3DE9 A;  1JRA A;  1TR2 A;  2EPM X;  3EGD B;  3LEV A;  1FFT C;  1ZU4 A;  1AEP A;  1GQA A;  2YL0 A;  3LNM B;  5E3C A;  2IXO A;  5BQG A;  1VB5 A;  2KW3 C;  2KQ9 A;  3W2V A;  5AGF A;  3UGP A;  2WVQ A;  4Z9H A;  2G62 A;  3B9Q A;  1C17 M;  4X0R A;  1JOG A;  4G78 A;  3UMK A;  4YWQ A;  1NBB A;  2IXM A;  4I3M A;  3EHN A;  5BUO A;  2CW0 F;  4ULV A;  5A6J A;  1FFH A;  5L3V A;  1LS1 A;  4F4B A;  4CDV A;  1WGW A;  1D1A A;  1Z3I X;  3V5X A;  3VYW A;  2RD9 A;  3U3F A;  2L6G A;  3PCV A;  4PJJ A;  3NMI A;  4PJN A;  2L6F A;  2RSE B;  1LI5 A;  3ZC4 A;  3N24 A;  2D5R B;  4XQ1 A;  4PFP A;  2YVK A;  3G4X A;  3HKK A;  2Y69 C;  2Q7R A;  4DOZ A;  4KNV A;  3RVZ A;  1NFN A;  4MW8 A;  1LI7 A;  3A9C A;  4U5D E;  4D4X A;  3E70 C;  2YLG A;  2FGY A;  4BJ1 A;  2OKU A;  2A1D D;  2OJE D;  2QUP A;  1OXK A;  3KL4 A;  5AC5 A;  5A6K A;  1SF8 A;  1E86 A;  2EIJ C;  3DM9 B;  4YT8 A;  2J9U A;  2H7B A;  3G50 A;  5T3T A;  4KNW A;  4MQ9 F;  4OIR F;  2VCA A;  4LLE A;  2EPL X;  2V3C C;  3JT1 A;  5JSL A;  3JCU Q;  1FTS A;  4E18 A;  3C8G A;  5F5F A;  5JRA A;  4OIO F;  4U9D A;  5K0I A;  2P6V A;  2YWA A;  4JRZ A;  4OD4 A;  3UR3 C;  1E83 A;  3DJN B;  2AVK A;  2NSG A;  4EIY A;  4IGG A;  1E84 A;  2E87 A;  3EJN A;  3N2Z B;  3Q6N A;  4L6R A;  1PD1 A;  3ECS A;  1IZM A;  2NSF A;  4C7O A;  1D0Z A;  2R7O A;  3GEE A;  3NMJ A;  3UMH A;  4PR9 A;  2NUT B;  1A7V A;  1TWG A;  1BBH A;  2YLI A;  4AL0 A;  2V26 A;  3AQB A;  3GOD A;  3QTH A;  2XS1 A;  4GYT A;  2EIN C;  4KI2 A;  1AVO B;  1ZW2 A;  2IXP A;  3LLI A;  2BE5 F;  4LAC B;  5E2Q A;  3T4R A;  2R7W A;  4CS9 A;  1H9G A;  1BR4 A;  2KGO A;  3KYI A;  4RD9 A;  4LDR A;  3CSK A;  4UDV A;  3S9O A;  4KBL A;  1NFO A;  4MVQ A;  4DVY P;  4BJ5 A;  3JZ0 A;  3TOL A;  4MVR A;  3NKE A;  3UGO A;  3W2W A;  4XLP F;  1NZE A;  2LFD A;  4QDL A;  2DGJ A;  4EBJ A;  1Q0K A;  2EIK C;  5CI8 A;  1LPE A;  4Q7C A;  3LAY A;  4RBN A;  4QI2 A;  4XWJ A;  3T9O A;  1GS9 A;  3MBG A;  2XM4 A;  1D0Y A;  4B6I A;  4U5C E;  3EGX A;  1R5I D;  3ZQY A;  1ZHZ A;  4JE9 A;  3U8V A;  3DD7 A;  2R7Q A;  2OEX A;  3QVY A;  4MVZ A;  1M56 C;  1WTY A;  1HE1 A;  3M1C B;  3AG4 C;  3EGD A;  1YJG A;  3HNJ A;  1LKX A;  3W8H A;  3C8G B;  1XZQ A;  1OR3 A;  2W45 A;  2QLA A;  3FVY A;  3ZIB A;  1Z6A A;  4E7S A;  1ZVZ A;  3AQC A;  2BL2 A;  2WVN A;  3DAG A;  3S28 A;  3FXH A;  3JSE O;  4XEK A;  3U0C A;  2ZPA A;  1VLS A;  2X0C A;  2XM0 A;  2IM8 A;  2WVO A;  2XL4 A;  3I4U A;  3RQE A;  2DYS C;  1OW6 A;  3C7J A;  4HE8 D;  4C7O B;  3EH2 A;  5DLJ A;  1RCP A;  1C03 A;  2GFH A;  4O6Y A;  4YL1 A;  1LE4 A;  5GPG B;  1RXQ A;  1L3P A;  4JTC B;  5DS4 A;  3SZR A;  2B0H A;  5DQZ A;  3DKA A;  1NG1 A;  3UNG C;  1GM5 A;  1HMO A;  2GDC A;  2Q00 A;  3MX3 A;  3BRJ A;  2PP4 A;  3DMD A;  1YDI A;  3EZH A;  4W8K A;  5E33 A;  2LCH A;  1T6U A;  3CZ6 A;  4WAB A;  4E17 A;  1LE2 A;  1GGQ A;  3M79 A;  4AE4 B;  1RKE B;  3JRT A;  1TKN A;  2QTV A;  2HMQ A;  1Q0M A;  1APC A;  2R02 A;  3FOO A;  1M2V B;  3H2U A;  2YLD A;  4DBR A;  4KC9 A;  4ZLD A;  2QE9 A;  3QW0 A;  2W4M A;  3EHM A;  3H65 A;  1OCZ C;  4CIH A;  2CGE A;  2Q3T A;  4EBB A;  2P61 A;  4IWB A;  4JJG A;  4GQH A;  2P7V A;  4MND A;  1OXB A;  1RMV A;  2Y3B A;  3EH1 A;  1MMD A;  2IOQ A;  3BEH A;  4PJM A;  2HSB A;  3Q7L A;  5DQT A;  2CYD A;  5KYY B;  3MYI A;  3GWN A;  2HJM A;  3R7C A;  3UMI A;  1HY5 A;  2J8W A;  1U6H A;  3DAF A;  4ZLC A;  2ZD9 A;  1BDJ B;  4Z9J A;  2EPO A;  2QNL A;  1TWC A;  3EGX B;  1MMN A;  1M6T A;  3DI5 A;  4CIP A;  1WWP A;  1Y6D A;  1K04 A;  2XLD A;  5A6B A;  1D0X A;  2OU6 A;  2OEV A;  1ZZP A;  2L81 A;  3C62 A;  4JKV A;  4K7B A;  4AX2 A;  4CDY A;  2Y3D A;  3ZWI A;  1E2X A;  2MWQ A;  2NUT A;  3NG1 A;  4N6H A;  4M63 A;  1VOM A;  3B71 A;  1Q0G A;  4J30 B;  4LDQ A;  2AWC A;  1S7Z A;  3LNR A;  5A6B D;  5HV9 A;  2R7R A;  4E0I A;  3S90 A;  4Z9I A;  1Z5Z A;  2HMZ A;  2YRF A;  4RDA A;  1HW1 A;  2PX0 A;  4XLN F;  1V4A A;  2JX0 A;  4JVS A;  3ITF A;  1TFO B;  1TWH A;  4N06 A;  4WGY A;  5KYW A;  1T6I A;  2XSE A;  4Q5S F;  2YL1 A;  3NRH A;  3NMK A;  3HNK A;  2DI3 A;  3PMR A;  4J32 B;  1O87 A;  3DWW A;  1T6Q A;  3DE8 A;  2IXN A;  2DYR C;  2M4E A;  3HTK C;  3AGT A;  2P0N A;  4CSA A;  4EHP A;  5L0D A;  2HJ3 A;  2R05 A;  4IAR A;  3M15 A;  3L8J A;  4JCH A;  4XEV A;  3V7O A;  1G8X A;  3FHD A;  3IPM O;  2A69 F;  4J7T A;  5JP7 A;  1A7E A;  3ASO C;  2KNH A;  2EIM C;  1QQ3 A;  3Q7G A;  4NY3 A;  1VYI A;  2XLH A;  3CAX A;  3S29 A;  3FMS A;  2IYL D;  3DXJ F;  4BJ6 A;  1A7D A;  1YLM A;  1OW7 A;  3VAY A;  3EPV A;  5CI9 A;  4DJ9 A;  2Z15 A;  3O10 A;  4E7Z A;  2A0U A;  4NTB A;  2R7S A;  2ZXP A;  4YK5 A;  3AOU A;  3GM3 A;  4K1O A;  4U5H A;  4JTD B;  4XPY A;  1LIH A;  2KJG A;  3EZI A;  4JTA B;  2LQG A;  3LUT B;  1LVK A;  5T3W A;  2QY9 A;  3Q6M A;  1Y4C A;  4I1M A;  5COG A;  4JEB A;  1VMA A;  1KTM A;  2YL7 A;  4DVZ A;  3C8G D;  1O3U A;  2MHR A;  3HJC A;  4EKW A;  5L3Q A;  4MVU A;  3SXM A;  2LP4 A;  2Q9C A;  2Q9A A;  4XPW A;  1BR1 A;  1F1M A;  4HFF B;  3FAJ A;  4DBQ A;  3IQT A;  3NYJ A;  3SXY A;  3B0U X;  2YZS A;  3OEO A;  3JYH A;  4PFO A;  4AE4 A;  1RKE A;  1WN0 A;  5KYW B;  2L9J A;  3K6B A;  3ASN C;  2A6E F;  2H7O A;  3ZDL A;  5EHH A;  1M2V A;  1CGO A;  4JW1 A;  2R7T A;  1NU7 D;  4PAC A;  2VC9 A;  5L0G A;  1ZHX A;  1ZHW A;  1BZ4 A;  2LFF A;  3O6X A;  4P6I C;  3CQZ A;  3VF0 A;  1UFB A;  3EFO A;  4FX5 A;  3TK0 A;  4OD5 A;  1L7C A;  4FAP B;  3GOR A;  2R7X A;  2F22 A;  5KYY A;  4H54 A;  1ZHT A;  2WZF A;  3QZC A;  2CDQ A;  3RIP A;  4BPM A;  4CS8 A;  1NSG B;  5JLI A;  2VCC A;  2VB6 A;  3IQ5 A;  3ABK C;  1XWJ A;  1FNT c;  1CGM E;  1DOV A;  3JTL O;  1NLX A;  2NUP B;  2XS8 A;  2ASR A;  2R7U A;  5EK0 A;  1QKR A;  1CGN A;  2XXA A;  1LM3 B;  1VK5 A;  3K1H A;  4C3D A;  3L34 A;  4BG0 A;  5BQI A;  3O39 A;  2L7A A;  2Q9B A;  2XLW A;  1FR0 A;  1T5O A;  5FCL A;  1H7I A;  5JVE A;  5D92 A;  4O7G A;  2ICW G;  3T6G B;  1Q0D A;  2HKV A;  3IQC A;  5L0F A;  1EQ1 A;  1OKK A;  2WZL A;  1WAS A;  3LEO A;  4ONS A;  5B3S C;  5HSW A;  4O6M A;  4DRH B;  1T9K A;  1K40 A;  3I5Q A;  2PX3 A;  3K1I A;  3OA1 A;  4P9F A;  4ER9 A;  1PV3 A;  1ZYR F;  2DB4 A;  3EG9 A;  3RVY A;  3SNH A;  1OKK D;  1I4Y A;  2Q4F A;  2OG2 A;  2XLM A;  1ZU5 A;  4EUK B;  4DXW A;  4DRI B;  1G5Z A;  1JPN A;  2BC5 A;  1MQV A;  4ANJ A;  1CPQ A;  3ABM C;  4CBE A;  3FDQ A;  1H9T A;  5KYX B;  3GWL A;  3NDB B;  3RF3 A;  1S05 A;  4YJW A;  3KMI A;  4YL3 A;  2M64 A;  3LJB A;  3X1O A;  2B0J A;  2KSF A;  3AG2 C;  2PBE A;  3DJU B;  2P1A A;  2YQY A;  4O6N A;  2OJQ A;  5EGY A;  1AUE A;  1JR8 A;  2OCC C;  3EFO B;  4CS9 C;  2A6H F;  2XL8 A;  3MYF A;  2XL6 A;  4JIO A;  2HS5 A;  2MYS A;  3RQG A;  3C63 A;  1TQG A;  4YL0 A;  2YEV A;  2A68 F;  4BJ5 C;  1QVX A;  2HSQ A;  2J0X A;  3ZG1 A;  1J8M F;  256B A;  4EBK A;  1EKY A;  3G4Z A;  3JRM O;  3M4B A;  2ZXW C;  3W8I A;  1YZC A;  4OIP F;  2XXA B;  3H2V A;  4GEH A;  1RJ9 B;  5F28 E;  4WGZ A;  1OCC C;  1IW7 F;  4MVO A;  3L8I A;  4W8P A;  4A2N B;  1TFK B;  2LIG A;  3E9V A;  2J9W A;  1MNE A;  1G4W R;  1SMY F;  1EA8 A;  4Q4Z F;  3RKO F;  2R9R B;  4N6C A;  3U5S A;  1N1C A;  3U9J A;  4C3E A;  5A69 A;  5B1B C;  4HEA J;  4MTG A;  4BEM J;  4CJO A;  1G4U S;  3OWT A;  4AL1 A;  4JCZ A;  1PD0 A;  4EWC A;  3M4C A;  1YVI A;  1V74 B;  2KK1 A;  2NPU A;  3AG3 C;  3EQL F;  4QI0 A;  5KYN A;  2FFH A;  3EG9 B;  3T6B A;  1JAF A;  1U89 A;  3JYY A;  4J7Y A;  4LER A;  2J46 A;  1QLE C;  3NYM A;  1H6G A;  1I4Z A;  3SEO A;  3TJ5 A;  3LS0 A;  3WOD F;  3HLZ A;  3TQO A;  1UG7 A;  4JC7 A;  1NU9 C;  3FOP A;  2W4B A;  3U2L A;  5DVW A;  5L0H A;  4YT2 A;  1ST6 A;  1KU2 A;  4HFK B;  3NYL A;  4C3B A;  1K05 A;  4DRJ B;  4YN0 B;  3V5Y A;  5AC4 A;  3QMK A;  1YYX A;  1A41 A;  4G0H A;  2NUP A;  4XPX A;  1Z23 A;  1OCO C;  1DOW A;  2HZ8 A;  1Z63 A;  4AK9 A;  2R03 A;  3LS1 A;  2EPK X;  3TJ6 A;  3SP1 A;  2AWY A;  3T6J A;  2D4U A;  1JPJ A;  2CCY A;  3GM1 A;  4NTF A;  2PNO A;  2VCB A;  1E85 A;  1A0B A;  2KC3 A;  4O79 A;  4U5F E;  3TD7 A;  2YHS A;  4P9T A;  2XLO A;  1D1B A;  5B3I A;  4FWV A;  3HNL A;  4CX9 A;  3SXZ A;  3RYL A;  2GA0 A;  2H8A A;  1TWA A;  2PFD A;  4K0D A;  1YYJ A;  2PF4 E;  3A11 A;  4MVS A;  3U8P A;  1U0B B;  2HV6 A;  1B68 A;  4LLC A;  5A6A A;  2HFI A;  3IQ6 A;  3ZSU A;  2VH3 A;  2JPU A;  4CS7 A;  4LDK A;  3GEI A;  3JSZ A;  2WZG A;  1M2O A;  1FAP B;  1SZI A;  3KH2 A;  3WHN A;  5JT4 A;  2HV7 A;  5COM A;  5DS5 A;  2G3K A;  3TUL A;  1C02 A;  4G7H F;  1MMG A;  3GEH A;  4N4W A;  5COF A;  5KYX A;  3KYJ A;  4MTF A;  1R4T A;  3QVZ A;  5BQH A;  2EPN A;  2I15 A;  1WOL A;  3U3B A;  3POV A;  4U5E E;  3DM5 A;  1MND A;  2OQM A;  2O9X A;  3K33 A;  2A0B A;  4U5B E;  2H7V C;  2I8B A;  1OCR C;  2J9V A;  3AJM A;  2AU5 A;  1FMV A;  4JEA A;  1T01 A;  4JZA A;  2CNW A;  2GAQ A;  3ABL C;  5JUA A;  1OW8 A;  3MLG A;  2LSE A;  4FES A;  3SXK A;  4H4K C;  2LD6 A;  3IHU A;  3SYN A;  3GAN A;  3US6 A;  1HMD A;  3ZVR A;  1V55 C;  2GWW A;  3J06 A;  2R7V A;  2YL3 A;  1YA7 O;  1I5N A;  1MMA A;  1PCX A;  3DZA A;  2CNW D;  1YZA A;  2ETS A;  2FAP B;  4BEJ A;  4CSA C;  1RJ9 A;  1ZW3 A;  3WAQ A;  5T1D B;  4CDA A;  3O55 A;  4D4N A;  1OR2 A;  3K66 A;  3F46 A;  3B0P A;  3VM6 A;  4R32 A;  4JUR I;  3ZTZ A;  3PHF 2;  1SYQ A;  2JD3 A;  3L1M A;  2XLV A;  5CIV A;  1YA9 A;  1QSP A;  4IRU A;  1VLT A;  1VTM P;  1VYK A;  4NC3 A;  5E3A A;  3RH3 A;  3TOM A;  1YAR O;  4BJ6 C;  2J9B A;  5KYU A;  4WJ0 A;  4ULW A;  5IY5 C;  1Z7Q c;  3ATP A;  5F5H A;  1HW2 A;  4G7O F;  1ORY A;  1W2W A;  4MW3 A;  2WL8 A;  1D1C A;  2ZXR A;  2J0W A;  4U9E A;  4OIN F;  1JMW A; 
#chains in the Genus database with same CATH homology
 1YA7 O;  1FNT c;  3JTL O;  3IPM O;  3JRM O;  1YAR O;  1AVO B;  3JSE O;  1Z7Q c;  1YAU O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...