2RD9A

Crystal structure of a putative yfit-like metal-dependent hydrolase (bh0186) from bacillus halodurans c-125 at 2.30 a resolution
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
189
structure length
189
Chain Sequence
KIHHHHHHENLYFQGMNFQMNEAIQLLERTPKTLEVFLEGLSDSWHQCNEGYETWTVYEVVVHLIEAEKTNWIPRLRFILQEGEHKPFPAFDRFSHLNQSNAVPISERFKEFQQLRKENLNTLRSLVQSEADLERTGAHPAFGVVKVRELLSAWVVHDLTHIAQIVRSMAKRYDTDVGPWKEYLGILND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BH0186 protein
publication title Crystal structure of YfiT-like putative metal-dependent hydrolase (NP_241052.1) from Bacillus halodurans at 2.30 A resolution
rcsb
source organism Bacillus halodurans c-125
molecule tags Hydrolase
total genus 61
structure length 189
sequence length 189
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12867 DinB_2 DinB superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.450 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) dinb family like domain 2rd9A01
2OU6A 1RXQA 2P1AA 2F22A 4N6CA 5CIVA 2HKVA 3DI5A 2RD9A 3QTHA 2NSFA 3GORA 5COMA 2QE9A 2QNLA 2OQMA 5COGA 2NSGA 2YQYA 3CEXA 5COFA 3DKAA
chains in the Genus database with same CATH superfamily
1K40A 3IHUA 2V26A 4U5HA 2EPOA 2OG2A 4LDQA 1G4WR 2XRHA 2W4MA 3C8GA 3KYJA 1LKXA 2A6HF 1QZXA 1RKEA 4I1OB 5D91A 4K7BA 3RVZA 4MVUA 4B6IA 1Q0GA 2PFDA 2D5RB 1Z23A 4P6IC 3GODA 3WAQA 2JD3A 2YLDA 1MNEA 2XM4A 3BEHA 4O6NA 2I15A 2YLGA 1T9KA 4U5FE 3MLGA 4MS2A 3ZDLA 2IXNA 5L3VA 4CS9A 2Q9BA 4ZLDA 1QPUA 3DM5A 2PX0A 3CEXA 4MW8A 1Z63A 2H7VC 1YZCA 4XEFA 4YL1A 2TMVP 1EQ1A 3KH2A 3HTKC 4MVQA 2HSQA 4MVOA 2R02A 3I5PA 5E3CA 5DQZA 4C3BA 2Q00A 1PD0A 1FAPB 2B0JA 3GEHA 4MTOA 1HMOA 2A0UA 2YL1A 3ABMC 1IZMA 1OR2A 3HNKA 4PFPA 5B1AC 3LS0A 4NY3A 3U2MA 2IXMA 3LEVA 3Q6MA 1A41A 4CS7A 3POVA 1VB5A 4IB4A 4OIRF 2HJ3A 3SXYA 1QKRA 1CPRA 2LFDA 2HS5A 1TWHA 1W2WA 5DS6A 4DRIB 3LNMB 1CGME 2OCCC 3NRHA 4CS8C 4OIOF 4P9TA 3ABKC 5B3IA 4DVZA 5KYUB 3RF3A 4IAQA 3EG9B 3EGXB 2NSGA 3A11A 3NYMA 4BJTA 4H54A 2MHRA 2C03A 1TFOB 4PJMA 3ZC4A 3LUTB 5A69A 4CSAA 1ZYRF 3AG4C 4FESA 4EKWA 1K05A 4RDAA 1U0BB 1C17M 2OKUA 3O6XA 3JT1A 4XQ1A 5E3AA 1LIHA 2F22A 2GA0A 3S28A 4BJ5C 3FDQA 4WGZA 3RQGA 3UMKA 1ZU4A 1YJGA 2XL4A 3Q7GA 4NCQA 2QUPA 2P7VA 3SEOA 4KNWA 2EPNA 4MTGA 1RJ9A 3AJMA 4H4KC 4CIHA 4CX9A 3CQZA 4LLEA 1A7DA 2DYRC 2P6VA 3QTHA 3RW0A 4YWQA 5A6KA 2WVOA 2R7TA 5JVEA 4ONSA 3QW1A 1V4AA 1G8XA 1ZU5A 1FR0A 1J8MF 1PV3A 1MNDA 4ANJA 3UMIA 2DB4A 1JR8A 3SXZA 3EZHA 3JRMO 5IY5C 4U5DE 1SF8A 2R7SA 3C8GD 4RBNA 3HNLA 4LLCA 2Y3GA 4PR9A 3VRCA 4XPWA 4AK9A 3R2PA 2NUTA 1BR2A 4HFFB 2AU5A 1V54C 4ZLCA 5B3SC 5A6BA 3B9QA 4K1OA 4NTAA 3NG1A 1CGOA 4LERA 2NUPA 3ABLC 1YARO 2W45A 3ITFA 4JCHA 4IGGA 4QI0A 3C8GB 2PNOA 1APCA 3H2UA 4MVMA 3RQFA 1LVKA 5KYUA 3T6JA 3NYJA 4U9DA 1RKEB 2WL8A 2J7PA 2PF4E 2OJQA 2AWYA 3B71A 3E70C 3EPVA 3K1IA 2R25A 4G78A 1ZHYA 4KNVA 3FAPB 4JW1A 1QQ3A 5L0JA 4EWCA 1J8YF 2QNLA 3GANA 2ZD9A 3TOLA 3QVZA 1T6IA 2ZPAA 3O10A 4MQ9F 4EUKB 3U0CA 2GDCA 4JIOA 4A2NB 2JX0A 4HFKB 3DD7A 2YEVA 4HE8D 4EBJA 2C04A 3DZAA 4PJJA 1HY5A 2XLWA 2J8WA 1Z6AA 4CBEA 2J0XA 4MW3A 1UFBA 4U5EE 3VM6A 1T6UA 1LE2A 1YVIA 2LP4A 2KGOA 2PX3A 1D1AA 3DE9A 1HMDA 5DVWA 2I8BA 1GS9A 3M79A 3K7DA 3S29A 4FAPB 2IOQA 4G7HF 2YHSA 5F5FA 2WZGA 2FFHA 1M2VA 3EHMA 1BZ4A 4PJLA 1DOWA 2W9YA 2A6EF 4GQHA 1E83A 3SNHA 2QE9A 4GYTA 4I3MA 3VYWA 2KSFA 2BC5A 3G4XA 4CS9C 1Y4CA 5EHHA 4PFOA 3OA1A 1TWAA 2PBEA 4JVSA 2ASRA 3V7OA 1FTSA 1M6TA 3CZ6A 1HE1A 1C02A 2A0BA 3I4UA 1Z3IX 1TR2A 1YAUO 2XLEA 4O7GA 5E2QA 3EQLF 3U8VA 4PACA 3AGUA 1TQGA 1VYKA 3U8PA 5DS5A 3JYYA 3ZVRA 5HV9A 4AE4A 4OINF 3KKBA 4E18A 1TWGA 2J46A 1GQAA 4CJOA 2HKVA 3AG2C 3V5ZA 4DRHB 1XWJA 3O39A 3ZIBA 1G4US 3MX3A 4CDYA 4JE9A 1D0ZA 1ORSC 1Q0FA 2BL2A 2GAQA 2L81A 2R7OA 3U2LA 1C03A 5COMA 1CPQA 4QI2A 3I5QA 3NKEA 5A6JA 3NDBB 1RJ9B 4BG0A 2HFIA 3AOUA 4U5BE 5B1BC 1O87A 3W2VA 3X1OA 1BDJB 3H2VA 2J45A 5KYWA 2LFFA 5FCLA 1S7ZA 4JJFA 2R7WA 2G3VA 3T6BA 5TJ5E 1EI7A 3RYLA 3Q6NA 3V5YA 2R7VA 3AG3C 1NZEA 3U3BA 4CDVA 5L3QA 1ST6A 3UR3C 1HW1A 1ZW3A 3SYNA 4G7OF 3IQTA 2GFHA 5T3WA 1FFHA 4K0DA 4MVRA 2KW3C 2NUTB 4L6RA 3US6A 1UG7A 3EHNA 2EINC 4E17A 4O79A 2X0CA 4JCZA 1XZQA 4BEJA 2OOCA 2KNHA 1ZZPA 2KQ9A 2NUPB 1QVXA 2VCAA 3MBGA 1MQVA 4BPMA 1VLTA 3GORA 3N24A 1OKKA 5E33A 4OIQF 1DOVA 2OQMA 1NSGB 1BBHA 1Y6DA 2Y3DA 3EGDA 3IQ6A 4FX5A 4HEAJ 3T9OA 3R7CA 1M57C 1YLMA 1YYXA 3KMIA 2ETSA 4OD4A 3DAFA 4D4XA 2OEVA 4WABA 5KYYA 2X51A 3PDMP 1O5HA 3TD7A 4EHPA 4G7ZF 1D1CA 2LD6A 2FAPB 1SR2A 1D0XA 3MYIA 3WG7C 1K04A 3C7JA 4I1MA 2J9WA 2IXPA 4XEVA 3B0PA 3B0VC 2OJED 3EFOA 4XPYA 5CI9A 4YJWA 1NLXA 4Q5SF 1E84A 2R7RA 2H7OA 2VC9A 2D4UA 4MTFA 3S0XA 1VMAA 2L6GA 2YKZA 5DLJA 2EIJC 3GEEA 3WODF 3DJUB 3X2QC 3K1IC 3PHF2 3EH1A 3AG1C 3LS1A 5COGA 2Q3TA 1FNTc 1M2VB 2P0NA 4C3EA 1NU9C 2LCHA 4CDAA 3S84A 3MYFA 2ZXPA 2XLOA 4Z9IA 1OQCA 4EBBA 2HZ8A 1AUEA 1FMVA 1JOGA 1S05A 5L0GA 2RSEB 3ZTMA 2XM0A 5F28E 4Q7CA 2PP4A 4JC7A 5T1DB 1GM5A 4KC9A 3N2ZB 1OXKA 4YT5A 4O6YA 5CI8A 4DJ9A 2H8AA 2YRFA 1OCOC 3ZSUA 3DE8A 1JRAA 4C3DA 5K0IA 1TFKB 5JLIA 4AX2A 2QTVA 1ORYA 4ER9A 3GM3A 2NPUA 1U89A 4JEBA 1LS4A 4AE4B 2QLAA 5JRAA 1OW7A 2HSBA 3NMIA 4R32A 4XTKA 2NSFA 2O9XA 3U9JA 3PMRA 4JTDB 1VYIA 3MFNA 2YQYA 3TQOA 4CIPA 2EPLX 5COFA 4CSAC 4LACB 2YL7A 1A0BA 5JP7A 4E7SA 2MWQA 3LEOA 3ZTZA 3DAGA 3JTLO 4C7OA 1O3UA 3RQEA 4DRJB 3QVYA 2Q7RA 4JZAA 3AQBA 1JPJA 1OR3A 3IQ5A 1RXQA 2XLDA 3CSKA 4FWVA 3U9MA 5KYWB 2XL6A 1AEPA 5HSWA 2VCBA 2XLMA 3KPHA 1SYQA 1ZHZA 5FZTA 3QZCA 1RMVA 2XXAA 2L9JA 5JSLA 1ZHWA 4YT8A 3JCUQ 3M15A 3C18A 2WVQA 1WASA 5AGFA 5GPGB 1M2OA 3FVYA 1V74B 3F47A 4XLPF 1OKKD 3GWNA 5BQHA 1JMWA 2QY9A 1E86A 1TKNA 2EPKX 2EIMC 3SP1A 1R4TA 3U3FA 1R5ID 2CNWA 3DJNB 1NFOA 1OCCC 2IM8A 4IWBA 2H7BA 3HJCA 4J7YA 3UGPA 5BUOA 2LQGA 4N6HA 3UGOA 2A68F 3T6GB 1F1MA 1BR4A 3AGTA 1H9TA 3EGDB 3JZ0A 3L8JA 4Z9HA 3TJ6A 3LLKA 4O6MA 3H65A 3C8ZA 5JS5A 4YT2A 1CGNA 2FGYA 2NG1A 3EH2A 4Q4ZF 5CIVA 2LIGA 4GEHA 5KYYB 2XSEA 3NYLA 4MNDA 4NQFA 1GGQA 1YYJA 3E9VA 3GM2A 2HV6A 3L1MA 4MVZA 2XS8A 2AVKA 3A9CA 1ZW2A 3RH3A 2YWAA 5DQTA 3S90A 1EKYA 3DMDA 4BJ6A 2Z15A 3UMHA 2DI3A 3EJNA 1N1CA 1JPNA 3G50A 3SZRA 2YVKA 4J32B 1I5NA 3Q7LA 3QW0A 2L7AA 1QLEC 3EFOB 1LM3B 1RCPA 3S9OA 4OD5A 3OEOA 2ZXRA 1T6QA 2GWWA 4ULWA 1WATA 3B29A 3GEIA 2P61A 5A6AA 5KYXA 3M4BA 4JTAB 3JSEO 4AL0A 1I4YA 4P9FA 2CYDA 5A6BD 2VH3A 3W8HA 4J30B 4QDLA 1OXBA 3O55A 3L8IA 4LDKA 4CJGA 4IAOA 3NMJA 1NG1A 5EGYA 4PK4A 1NBBA 2M64A 3J06A 1KTMA 2A69F 4NTFA 2XLHA 2J7PD 1A7EA 1WWPA 4E7ZA 1IW7F 2ZXWC 1VTMP 2ZXOA 3FXHA 1M56C 2L6FA 3ATPA 4EBKA 1OW8A 2R03A 2IXOA 3FOPA 3HNJA 4XWJA 1MMNA 2LK4A 4DVYP 1Z7Qc 2YL3A 3IEEA 5AC5A 4RD9A 4DXWA 4WJ0A 256BA 1E2XA 3CAXA 2Q9CA 2R9RB 2WZFA 1XZPA 2YLIA 1VLSA 1H9GA 3K1HA 3M4CA 3QMKA 3TK0A 2W4BA 3ZG1A 4YL0A 3TJ5A 4DOZA 2J9VA 5JUAA 1HE9A 4DBQA 2R7XA 2CCYA 3GM1A 3WHNA 3RFYA 3AQCA 3T4RA 2WZLA 4ULVA 3W8IA 4C7OB 3ASOC 3SXMA 1KNYA 2EIKC 3U5SA 4W8KA 2RD9A 5L0CA 2A1DD 1OCZC 2XXAB 2G3KA 4PJNA 2CNWD 4JJGA 2J9BA 3RIPA 4KI2A 5EK0A 3K33A 5DS4A 1ORJA 1NU7D 1PCXA 2UUHA 4U5CE 5KYNA 3RKOF 2UUIA 1L7CA 2Q4FA 4IARA 2BE5F 3TULA 4AL1A 2WVNA 4JTCB 3VF0A 3GWLA 1MMAA 1RKCA 3HNIA 4W8PA 4BEMJ 2Y3HA 2OU6A 1D0YA 4A4AA 1SZIA 2HJMA 2KYHA 1FFTC 3C62A 3FOOA 5D92A 1LS1A 1WN0A 3C63A 1KU2A 3LESA 3FHDA 3DM9B 2J9UA 4N4WA 2VCCA 4J7TA 2EPMX 4YN0B 2VB6A 3LJBA 2XL8A 1EA8A 1Q0DA 2OEXA 1WTYA 3G4ZA 4LDRA 3W2WA 3ZQVA 3DI5A 1L3PA 2IBFA 4CS8A 2MYSA 1YA9A 5L0DA 1ZVZA 3N0TA 3V5XA 4YT4A 4D4NA 4YL3A 1Q0MA 4JURI 1WOLA 4JEAA 2KJGA 1ZHTA 2HV7A 2Y39A 5JT4A 1LPEA 4IRUA 1TWCA 2HMQA 4IJJA 1E85A 1T5OA 3SXKA 2Q9AA 4X0RA 3W4YA 2DYSC 1PD1A 3JSZA 4Z9JA 5L0FA 1U6HA 5AC4A 1H7IA 3DXJF 4E0HA 2LSEA 3PCVA 4OIPF 2WB7A 4BJ5A 5BQGA 2G62A 3LAYA 3HLZA 5KYXB 2DGJA 1H6GA 1Z5ZA 4G0HA 3UNGC 1I4ZA 3LNRA 4WGYA 5F5HA 1JAFA 3KYIA 1T01A 2ICWG 2YZSA 5L0IA 1VK5A 5T3TA 1YDIA 4MVSA 3F46A 2R7UA 4JRZA 4M63A 3IQCA 1BR1A 2R05A 5L0HA 3NKDA 1OCRC 3EG9A 2KC3A 3NMKA 3EGXA 5BQIA 3LLIA 1B68A 2J0WA 4NC3A 2CDQA 4E0IA 3FAJA 1LI7A 2XS1A 4BJ6C 2EILC 2KK1A 4XLNF 1V55C 4UDVA 3BRJA 3HKKA 1G5ZA 4JKVA 4F4BA 2AWCA 2YL0A 3VAYA 3JYHA 4I44A 3K6BA 3RVYA 2CGEA 3S27A 3ZQYA 3B0UX 2HUJA 2CW0F 2P1AA 3L34A 2HMZA 3DWWA 1MMGA 1D1BA 1MMDA 4N06A 4N6CA 4XPXA 2M4EA 2E87A 3OWTA 1VOMA 3K66A 4BJ1A 1Q0KA 1FMWA 2V3CC 4U9EA 1YA7O 1YZAA 3ECSA 3KL4A 1QSPA 3JRTA 3ZWIA 2XLVA 2L6HA 1AVOB 2VASA 2R7QA 3FMSA 3IPMO 3M1CB 4KBLA 1ZHXA 2B0HA 3ASNC 1A7VA 1LE4A 2Y69C 3L0IA 4NTBA 1LI5A 2Y3BA 1HW2A 2AP3A 4U5GA 3TOMA 1NFNA 4YK5A 4DBRA 4XEKA 2JPUA 3EZIA 3DKAA 1WGWA 2IYLD 1SMYF 4EIYA 1OW6A
chains in the Genus database with same CATH topology
2OU6A 1RXQA 2P1AA 2F22A 4N6CA 5CIVA 2HKVA 3DI5A 2RD9A 3QTHA 2NSFA 3GORA 5COMA 2QE9A 2QNLA 2OQMA 5COGA 2NSGA 2YQYA 3CEXA 5COFA 3DKAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OU6 A;  1RXQ A;  2P1A A;  2F22 A;  4N6C A;  5CIV A;  2HKV A;  3DI5 A;  2RD9 A;  3QTH A;  2NSF A;  3GOR A;  5COM A;  2QE9 A;  2QNL A;  2OQM A;  5COG A;  2NSG A;  2YQY A;  3CEX A;  5COF A;  3DKA A; 
#chains in the Genus database with same CATH topology
 1K40 A;  3IHU A;  2V26 A;  4U5H A;  2EPO A;  2OG2 A;  4LDQ A;  1G4W R;  2XRH A;  2W4M A;  3C8G A;  3KYJ A;  1LKX A;  2A6H F;  1QZX A;  1RKE A;  4I1O B;  5D91 A;  4K7B A;  3RVZ A;  4MVU A;  4B6I A;  1Q0G A;  2PFD A;  2D5R B;  1Z23 A;  4P6I C;  3GOD A;  3WAQ A;  2JD3 A;  2YLD A;  1MNE A;  2XM4 A;  3BEH A;  4O6N A;  2I15 A;  2YLG A;  1T9K A;  4U5F E;  3MLG A;  4MS2 A;  3ZDL A;  2IXN A;  5L3V A;  4CS9 A;  2Q9B A;  4ZLD A;  1QPU A;  3DM5 A;  2PX0 A;  3CEX A;  4MW8 A;  1Z63 A;  2H7V C;  1YZC A;  4XEF A;  4YL1 A;  2TMV P;  1EQ1 A;  3KH2 A;  3HTK C;  4MVQ A;  2HSQ A;  4MVO A;  2R02 A;  3I5P A;  5E3C A;  5DQZ A;  4C3B A;  2Q00 A;  1PD0 A;  1FAP B;  2B0J A;  3GEH A;  4MTO A;  1HMO A;  2A0U A;  2YL1 A;  3ABM C;  1IZM A;  1OR2 A;  3HNK A;  4PFP A;  5B1A C;  3LS0 A;  4NY3 A;  3U2M A;  2IXM A;  3LEV A;  3Q6M A;  1A41 A;  4CS7 A;  3POV A;  1VB5 A;  4IB4 A;  4OIR F;  2HJ3 A;  3SXY A;  1QKR A;  1CPR A;  2LFD A;  2HS5 A;  1TWH A;  1W2W A;  5DS6 A;  4DRI B;  3LNM B;  1CGM E;  2OCC C;  3NRH A;  4CS8 C;  4OIO F;  4P9T A;  3ABK C;  5B3I A;  4DVZ A;  5KYU B;  3RF3 A;  4IAQ A;  3EG9 B;  3EGX B;  2NSG A;  3A11 A;  3NYM A;  4BJT A;  4H54 A;  2MHR A;  2C03 A;  1TFO B;  4PJM A;  3ZC4 A;  3LUT B;  5A69 A;  4CSA A;  1ZYR F;  3AG4 C;  4FES A;  4EKW A;  1K05 A;  4RDA A;  1U0B B;  1C17 M;  2OKU A;  3O6X A;  3JT1 A;  4XQ1 A;  5E3A A;  1LIH A;  2F22 A;  2GA0 A;  3S28 A;  4BJ5 C;  3FDQ A;  4WGZ A;  3RQG A;  3UMK A;  1ZU4 A;  1YJG A;  2XL4 A;  3Q7G A;  4NCQ A;  2QUP A;  2P7V A;  3SEO A;  4KNW A;  2EPN A;  4MTG A;  1RJ9 A;  3AJM A;  4H4K C;  4CIH A;  4CX9 A;  3CQZ A;  4LLE A;  1A7D A;  2DYR C;  2P6V A;  3QTH A;  3RW0 A;  4YWQ A;  5A6K A;  2WVO A;  2R7T A;  5JVE A;  4ONS A;  3QW1 A;  1V4A A;  1G8X A;  1ZU5 A;  1FR0 A;  1J8M F;  1PV3 A;  1MND A;  4ANJ A;  3UMI A;  2DB4 A;  1JR8 A;  3SXZ A;  3EZH A;  3JRM O;  5IY5 C;  4U5D E;  1SF8 A;  2R7S A;  3C8G D;  4RBN A;  3HNL A;  4LLC A;  2Y3G A;  4PR9 A;  3VRC A;  4XPW A;  4AK9 A;  3R2P A;  2NUT A;  1BR2 A;  4HFF B;  2AU5 A;  1V54 C;  4ZLC A;  5B3S C;  5A6B A;  3B9Q A;  4K1O A;  4NTA A;  3NG1 A;  1CGO A;  4LER A;  2NUP A;  3ABL C;  1YAR O;  2W45 A;  3ITF A;  4JCH A;  4IGG A;  4QI0 A;  3C8G B;  2PNO A;  1APC A;  3H2U A;  4MVM A;  3RQF A;  1LVK A;  5KYU A;  3T6J A;  3NYJ A;  4U9D A;  1RKE B;  2WL8 A;  2J7P A;  2PF4 E;  2OJQ A;  2AWY A;  3B71 A;  3E70 C;  3EPV A;  3K1I A;  2R25 A;  4G78 A;  1ZHY A;  4KNV A;  3FAP B;  4JW1 A;  1QQ3 A;  5L0J A;  4EWC A;  1J8Y F;  2QNL A;  3GAN A;  2ZD9 A;  3TOL A;  3QVZ A;  1T6I A;  2ZPA A;  3O10 A;  4MQ9 F;  4EUK B;  3U0C A;  2GDC A;  4JIO A;  4A2N B;  2JX0 A;  4HFK B;  3DD7 A;  2YEV A;  4HE8 D;  4EBJ A;  2C04 A;  3DZA A;  4PJJ A;  1HY5 A;  2XLW A;  2J8W A;  1Z6A A;  4CBE A;  2J0X A;  4MW3 A;  1UFB A;  4U5E E;  3VM6 A;  1T6U A;  1LE2 A;  1YVI A;  2LP4 A;  2KGO A;  2PX3 A;  1D1A A;  3DE9 A;  1HMD A;  5DVW A;  2I8B A;  1GS9 A;  3M79 A;  3K7D A;  3S29 A;  4FAP B;  2IOQ A;  4G7H F;  2YHS A;  5F5F A;  2WZG A;  2FFH A;  1M2V A;  3EHM A;  1BZ4 A;  4PJL A;  1DOW A;  2W9Y A;  2A6E F;  4GQH A;  1E83 A;  3SNH A;  2QE9 A;  4GYT A;  4I3M A;  3VYW A;  2KSF A;  2BC5 A;  3G4X A;  4CS9 C;  1Y4C A;  5EHH A;  4PFO A;  3OA1 A;  1TWA A;  2PBE A;  4JVS A;  2ASR A;  3V7O A;  1FTS A;  1M6T A;  3CZ6 A;  1HE1 A;  1C02 A;  2A0B A;  3I4U A;  1Z3I X;  1TR2 A;  1YAU O;  2XLE A;  4O7G A;  5E2Q A;  3EQL F;  3U8V A;  4PAC A;  3AGU A;  1TQG A;  1VYK A;  3U8P A;  5DS5 A;  3JYY A;  3ZVR A;  5HV9 A;  4AE4 A;  4OIN F;  3KKB A;  4E18 A;  1TWG A;  2J46 A;  1GQA A;  4CJO A;  2HKV A;  3AG2 C;  3V5Z A;  4DRH B;  1XWJ A;  3O39 A;  3ZIB A;  1G4U S;  3MX3 A;  4CDY A;  4JE9 A;  1D0Z A;  1ORS C;  1Q0F A;  2BL2 A;  2GAQ A;  2L81 A;  2R7O A;  3U2L A;  1C03 A;  5COM A;  1CPQ A;  4QI2 A;  3I5Q A;  3NKE A;  5A6J A;  3NDB B;  1RJ9 B;  4BG0 A;  2HFI A;  3AOU A;  4U5B E;  5B1B C;  1O87 A;  3W2V A;  3X1O A;  1BDJ B;  3H2V A;  2J45 A;  5KYW A;  2LFF A;  5FCL A;  1S7Z A;  4JJF A;  2R7W A;  2G3V A;  3T6B A;  5TJ5 E;  1EI7 A;  3RYL A;  3Q6N A;  3V5Y A;  2R7V A;  3AG3 C;  1NZE A;  3U3B A;  4CDV A;  5L3Q A;  1ST6 A;  3UR3 C;  1HW1 A;  1ZW3 A;  3SYN A;  4G7O F;  3IQT A;  2GFH A;  5T3W A;  1FFH A;  4K0D A;  4MVR A;  2KW3 C;  2NUT B;  4L6R A;  3US6 A;  1UG7 A;  3EHN A;  2EIN C;  4E17 A;  4O79 A;  2X0C A;  4JCZ A;  1XZQ A;  4BEJ A;  2OOC A;  2KNH A;  1ZZP A;  2KQ9 A;  2NUP B;  1QVX A;  2VCA A;  3MBG A;  1MQV A;  4BPM A;  1VLT A;  3GOR A;  3N24 A;  1OKK A;  5E33 A;  4OIQ F;  1DOV A;  2OQM A;  1NSG B;  1BBH A;  1Y6D A;  2Y3D A;  3EGD A;  3IQ6 A;  4FX5 A;  4HEA J;  3T9O A;  3R7C A;  1M57 C;  1YLM A;  1YYX A;  3KMI A;  2ETS A;  4OD4 A;  3DAF A;  4D4X A;  2OEV A;  4WAB A;  5KYY A;  2X51 A;  3PDM P;  1O5H A;  3TD7 A;  4EHP A;  4G7Z F;  1D1C A;  2LD6 A;  2FAP B;  1SR2 A;  1D0X A;  3MYI A;  3WG7 C;  1K04 A;  3C7J A;  4I1M A;  2J9W A;  2IXP A;  4XEV A;  3B0P A;  3B0V C;  2OJE D;  3EFO A;  4XPY A;  5CI9 A;  4YJW A;  1NLX A;  4Q5S F;  1E84 A;  2R7R A;  2H7O A;  2VC9 A;  2D4U A;  4MTF A;  3S0X A;  1VMA A;  2L6G A;  2YKZ A;  5DLJ A;  2EIJ C;  3GEE A;  3WOD F;  3DJU B;  3X2Q C;  3K1I C;  3PHF 2;  3EH1 A;  3AG1 C;  3LS1 A;  5COG A;  2Q3T A;  1FNT c;  1M2V B;  2P0N A;  4C3E A;  1NU9 C;  2LCH A;  4CDA A;  3S84 A;  3MYF A;  2ZXP A;  2XLO A;  4Z9I A;  1OQC A;  4EBB A;  2HZ8 A;  1AUE A;  1FMV A;  1JOG A;  1S05 A;  5L0G A;  2RSE B;  3ZTM A;  2XM0 A;  5F28 E;  4Q7C A;  2PP4 A;  4JC7 A;  5T1D B;  1GM5 A;  4KC9 A;  3N2Z B;  1OXK A;  4YT5 A;  4O6Y A;  5CI8 A;  4DJ9 A;  2H8A A;  2YRF A;  1OCO C;  3ZSU A;  3DE8 A;  1JRA A;  4C3D A;  5K0I A;  1TFK B;  5JLI A;  4AX2 A;  2QTV A;  1ORY A;  4ER9 A;  3GM3 A;  2NPU A;  1U89 A;  4JEB A;  1LS4 A;  4AE4 B;  2QLA A;  5JRA A;  1OW7 A;  2HSB A;  3NMI A;  4R32 A;  4XTK A;  2NSF A;  2O9X A;  3U9J A;  3PMR A;  4JTD B;  1VYI A;  3MFN A;  2YQY A;  3TQO A;  4CIP A;  2EPL X;  5COF A;  4CSA C;  4LAC B;  2YL7 A;  1A0B A;  5JP7 A;  4E7S A;  2MWQ A;  3LEO A;  3ZTZ A;  3DAG A;  3JTL O;  4C7O A;  1O3U A;  3RQE A;  4DRJ B;  3QVY A;  2Q7R A;  4JZA A;  3AQB A;  1JPJ A;  1OR3 A;  3IQ5 A;  1RXQ A;  2XLD A;  3CSK A;  4FWV A;  3U9M A;  5KYW B;  2XL6 A;  1AEP A;  5HSW A;  2VCB A;  2XLM A;  3KPH A;  1SYQ A;  1ZHZ A;  5FZT A;  3QZC A;  1RMV A;  2XXA A;  2L9J A;  5JSL A;  1ZHW A;  4YT8 A;  3JCU Q;  3M15 A;  3C18 A;  2WVQ A;  1WAS A;  5AGF A;  5GPG B;  1M2O A;  3FVY A;  1V74 B;  3F47 A;  4XLP F;  1OKK D;  3GWN A;  5BQH A;  1JMW A;  2QY9 A;  1E86 A;  1TKN A;  2EPK X;  2EIM C;  3SP1 A;  1R4T A;  3U3F A;  1R5I D;  2CNW A;  3DJN B;  1NFO A;  1OCC C;  2IM8 A;  4IWB A;  2H7B A;  3HJC A;  4J7Y A;  3UGP A;  5BUO A;  2LQG A;  4N6H A;  3UGO A;  2A68 F;  3T6G B;  1F1M A;  1BR4 A;  3AGT A;  1H9T A;  3EGD B;  3JZ0 A;  3L8J A;  4Z9H A;  3TJ6 A;  3LLK A;  4O6M A;  3H65 A;  3C8Z A;  5JS5 A;  4YT2 A;  1CGN A;  2FGY A;  2NG1 A;  3EH2 A;  4Q4Z F;  5CIV A;  2LIG A;  4GEH A;  5KYY B;  2XSE A;  3NYL A;  4MND A;  4NQF A;  1GGQ A;  1YYJ A;  3E9V A;  3GM2 A;  2HV6 A;  3L1M A;  4MVZ A;  2XS8 A;  2AVK A;  3A9C A;  1ZW2 A;  3RH3 A;  2YWA A;  5DQT A;  3S90 A;  1EKY A;  3DMD A;  4BJ6 A;  2Z15 A;  3UMH A;  2DI3 A;  3EJN A;  1N1C A;  1JPN A;  3G50 A;  3SZR A;  2YVK A;  4J32 B;  1I5N A;  3Q7L A;  3QW0 A;  2L7A A;  1QLE C;  3EFO B;  1LM3 B;  1RCP A;  3S9O A;  4OD5 A;  3OEO A;  2ZXR A;  1T6Q A;  2GWW A;  4ULW A;  1WAT A;  3B29 A;  3GEI A;  2P61 A;  5A6A A;  5KYX A;  3M4B A;  4JTA B;  3JSE O;  4AL0 A;  1I4Y A;  4P9F A;  2CYD A;  5A6B D;  2VH3 A;  3W8H A;  4J30 B;  4QDL A;  1OXB A;  3O55 A;  3L8I A;  4LDK A;  4CJG A;  4IAO A;  3NMJ A;  1NG1 A;  5EGY A;  4PK4 A;  1NBB A;  2M64 A;  3J06 A;  1KTM A;  2A69 F;  4NTF A;  2XLH A;  2J7P D;  1A7E A;  1WWP A;  4E7Z A;  1IW7 F;  2ZXW C;  1VTM P;  2ZXO A;  3FXH A;  1M56 C;  2L6F A;  3ATP A;  4EBK A;  1OW8 A;  2R03 A;  2IXO A;  3FOP A;  3HNJ A;  4XWJ A;  1MMN A;  2LK4 A;  4DVY P;  1Z7Q c;  2YL3 A;  3IEE A;  5AC5 A;  4RD9 A;  4DXW A;  4WJ0 A;  256B A;  1E2X A;  3CAX A;  2Q9C A;  2R9R B;  2WZF A;  1XZP A;  2YLI A;  1VLS A;  1H9G A;  3K1H A;  3M4C A;  3QMK A;  3TK0 A;  2W4B A;  3ZG1 A;  4YL0 A;  3TJ5 A;  4DOZ A;  2J9V A;  5JUA A;  1HE9 A;  4DBQ A;  2R7X A;  2CCY A;  3GM1 A;  3WHN A;  3RFY A;  3AQC A;  3T4R A;  2WZL A;  4ULV A;  3W8I A;  4C7O B;  3ASO C;  3SXM A;  1KNY A;  2EIK C;  3U5S A;  4W8K A;  2RD9 A;  5L0C A;  2A1D D;  1OCZ C;  2XXA B;  2G3K A;  4PJN A;  2CNW D;  4JJG A;  2J9B A;  3RIP A;  4KI2 A;  5EK0 A;  3K33 A;  5DS4 A;  1ORJ A;  1NU7 D;  1PCX A;  2UUH A;  4U5C E;  5KYN A;  3RKO F;  2UUI A;  1L7C A;  2Q4F A;  4IAR A;  2BE5 F;  3TUL A;  4AL1 A;  2WVN A;  4JTC B;  3VF0 A;  3GWL A;  1MMA A;  1RKC A;  3HNI A;  4W8P A;  4BEM J;  2Y3H A;  2OU6 A;  1D0Y A;  4A4A A;  1SZI A;  2HJM A;  2KYH A;  1FFT C;  3C62 A;  3FOO A;  5D92 A;  1LS1 A;  1WN0 A;  3C63 A;  1KU2 A;  3LES A;  3FHD A;  3DM9 B;  2J9U A;  4N4W A;  2VCC A;  4J7T A;  2EPM X;  4YN0 B;  2VB6 A;  3LJB A;  2XL8 A;  1EA8 A;  1Q0D A;  2OEX A;  1WTY A;  3G4Z A;  4LDR A;  3W2W A;  3ZQV A;  3DI5 A;  1L3P A;  2IBF A;  4CS8 A;  2MYS A;  1YA9 A;  5L0D A;  1ZVZ A;  3N0T A;  3V5X A;  4YT4 A;  4D4N A;  4YL3 A;  1Q0M A;  4JUR I;  1WOL A;  4JEA A;  2KJG A;  1ZHT A;  2HV7 A;  2Y39 A;  5JT4 A;  1LPE A;  4IRU A;  1TWC A;  2HMQ A;  4IJJ A;  1E85 A;  1T5O A;  3SXK A;  2Q9A A;  4X0R A;  3W4Y A;  2DYS C;  1PD1 A;  3JSZ A;  4Z9J A;  5L0F A;  1U6H A;  5AC4 A;  1H7I A;  3DXJ F;  4E0H A;  2LSE A;  3PCV A;  4OIP F;  2WB7 A;  4BJ5 A;  5BQG A;  2G62 A;  3LAY A;  3HLZ A;  5KYX B;  2DGJ A;  1H6G A;  1Z5Z A;  4G0H A;  3UNG C;  1I4Z A;  3LNR A;  4WGY A;  5F5H A;  1JAF A;  3KYI A;  1T01 A;  2ICW G;  2YZS A;  5L0I A;  1VK5 A;  5T3T A;  1YDI A;  4MVS A;  3F46 A;  2R7U A;  4JRZ A;  4M63 A;  3IQC A;  1BR1 A;  2R05 A;  5L0H A;  3NKD A;  1OCR C;  3EG9 A;  2KC3 A;  3NMK A;  3EGX A;  5BQI A;  3LLI A;  1B68 A;  2J0W A;  4NC3 A;  2CDQ A;  4E0I A;  3FAJ A;  1LI7 A;  2XS1 A;  4BJ6 C;  2EIL C;  2KK1 A;  4XLN F;  1V55 C;  4UDV A;  3BRJ A;  3HKK A;  1G5Z A;  4JKV A;  4F4B A;  2AWC A;  2YL0 A;  3VAY A;  3JYH A;  4I44 A;  3K6B A;  3RVY A;  2CGE A;  3S27 A;  3ZQY A;  3B0U X;  2HUJ A;  2CW0 F;  2P1A A;  3L34 A;  2HMZ A;  3DWW A;  1MMG A;  1D1B A;  1MMD A;  4N06 A;  4N6C A;  4XPX A;  2M4E A;  2E87 A;  3OWT A;  1VOM A;  3K66 A;  4BJ1 A;  1Q0K A;  1FMW A;  2V3C C;  4U9E A;  1YA7 O;  1YZA A;  3ECS A;  3KL4 A;  1QSP A;  3JRT A;  3ZWI A;  2XLV A;  2L6H A;  1AVO B;  2VAS A;  2R7Q A;  3FMS A;  3IPM O;  3M1C B;  4KBL A;  1ZHX A;  2B0H A;  3ASN C;  1A7V A;  1LE4 A;  2Y69 C;  3L0I A;  4NTB A;  1LI5 A;  2Y3B A;  1HW2 A;  2AP3 A;  4U5G A;  3TOM A;  1NFN A;  4YK5 A;  4DBR A;  4XEK A;  2JPU A;  3EZI A;  3DKA A;  1WGW A;  2IYL D;  1SMY F;  4EIY A;  1OW6 A; 
#chains in the Genus database with same CATH homology
 2OU6 A;  1RXQ A;  2P1A A;  2F22 A;  4N6C A;  5CIV A;  2HKV A;  3DI5 A;  2RD9 A;  3QTH A;  2NSF A;  3GOR A;  5COM A;  2QE9 A;  2QNL A;  2OQM A;  5COG A;  2NSG A;  2YQY A;  3CEX A;  5COF A;  3DKA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...