2RD9A

Crystal structure of a putative yfit-like metal-dependent hydrolase (bh0186) from bacillus halodurans c-125 at 2.30 a resolution
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
189
structure length
189
Chain Sequence
KIHHHHHHENLYFQGMNFQMNEAIQLLERTPKTLEVFLEGLSDSWHQCNEGYETWTVYEVVVHLIEAEKTNWIPRLRFILQEGEHKPFPAFDRFSHLNQSNAVPISERFKEFQQLRKENLNTLRSLVQSEADLERTGAHPAFGVVKVRELLSAWVVHDLTHIAQIVRSMAKRYDTDVGPWKEYLGILND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BH0186 protein
publication title Crystal structure of YfiT-like putative metal-dependent hydrolase (NP_241052.1) from Bacillus halodurans at 2.30 A resolution
rcsb
source organism Bacillus halodurans c-125
total genus 61
structure length 189
sequence length 189
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12867 DinB_2 DinB superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.450 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) dinb family like domain 2rd9A01
2YQYA 1RXQA 5CIVA 5COMA 3QTHA 2QE9A 2NSFA 2OQMA 2OU6A 3DKAA 5COFA 4N6CA 2QNLA 3DI5A 3GORA 2P1AA 2HKVA 2F22A 2RD9A 3CEXA 2NSGA 5COGA
chains in the Genus database with same CATH superfamily
4N4WA 2VCCA 2HJMA 1MMNA 2E87A 2R7SA 3S27A 3N24A 5CIVA 1QKRA 1OXBA 4IAQA 3W4YA 3ITFA 4F4BA 4L6RA 1MMDA 4U9EA 4HFFB 1S7ZA 3UMIA 3DMDA 3WHNA 4MW8A 1RMVA 3ZTZA 1TFOB 1CPRA 5JLIA 2JD3A 3NMKA 2QY9A 3QZCA 3O6XA 4M63A 1BZ4A 4E17A 1OCZC 2OEVA 3US6A 3U0CA 4GQHA 1UG7A 1QQ3A 2OJED 4AE4A 1OW6A 3C18A 2EPOA 2CCYA 2Q00A 1BR2A 3N0TA 3QW0A 4CDVA 2IXMA 2OJQA 2MWQA 2XM4A 2P0NA 3PMRA 4FX5A 2D5RB 2HMZA 2LK4A 1Z6AA 2W9YA 4NTFA 3G4ZA 3HLZA 1HMDA 2P6VA 1YZAA 2LFFA 2XRHA 1QZXA 2JX0A 3U2LA 1TWGA 2Y3BA 1LVKA 3M1CB 3L8JA 3T9OA 3TOMA 1ZW2A 2HV6A 2CGEA 4KBLA 3LEVA 2IXPA 1L7CA 4NC3A 2EILC 2HJ3A 4EKWA 2YLIA 2GA0A 3LAYA 2V3CC 1VYKA 1MNEA 2MHRA 2WVQA 3C8GB 2LP4A 1JPNA 3OA1A 2IOQA 3RFYA 3RVZA 4U5DE 1QSPA 4IARA 3AQCA 2BL2A 2KK1A 3EJNA 2RD9A 1ORYA 1LPEA 2XXAA 4RDAA 3S28A 1LM3B 3L34A 3HTKC 3C63A 4JURI 2G3KA 3N2ZB 3I5QA 4KC9A 4E0HA 5EGYA 1YVIA 5COMA 4IJJA 3RW0A 4O6NA 1FMWA 4FAPB 4MVOA 3U3FA 2R25A 3JRTA 4OIOF 2H7VC 3K33A 4PJMA 4QI2A 1JR8A 3SXZA 3QW1A 1WOLA 2UUHA 4I1OB 2YRFA 3AG4C 2R7WA 5F5FA 3U3BA 3T6JA 3ABLC 3BEHA 3FOPA 1AEPA 2JPUA 4PFPA 1ZZPA 1O5HA 4XEVA 1PD1A 3DI5A 5T3WA 1EQ1A 1KU2A 2PNOA 4K0DA 4G7ZF 3EGXA 4Q7CA 4O6YA 5KYUB 4YL3A 4UDVA 1ORSC 3ZTMA 2H8AA 5KYXB 4JTCB 5L0IA 3KPHA 3PHF2 3RKOF 1CGME 5JS5A 1Y6DA 1M2OA 3MYFA 5T1DB 3NG1A 3MX3A 3VRCA 4CIPA 4YT5A 2YQYA 1WGWA 4I1MA 2P7VA 1IZMA 1SF8A 3IHUA 2PX0A 4JJGA 3EPVA 4CSAA 3K66A 4MTOA 3TULA 1V55C 2PF4E 1JAFA 2YZSA 1T6UA 3RQGA 3IPMO 3RYLA 4W8KA 1LE4A 2HSBA 3RQEA 3DZAA 3FOOA 5DVWA 5HV9A 1YARO 1L3PA 1NFNA 1SR2A 3UMHA 3UR3C 3EZHA 5JVEA 1EA8A 4U5GA 5L0DA 1JOGA 3J06A 3LS0A 1VK5A 2I8BA 2AWCA 2NG1A 2R05A 1MQVA 3AG3C 3CSKA 3LUTB 4H54A 1O87A 2IXNA 4YT4A 4CS8A 1SYQA 2ZXOA 3GM1A 4D4NA 1ZHZA 2EINC 2V26A 1BR1A 2B0HA 1OKKD 1Z23A 2XLHA 2KSFA 3WODF 4XPYA 3MBGA 3ZC4A 3KMIA 1I5NA 1QVXA 5KYYA 2XLDA 4AE4B 5T3TA 5BQHA 2KQ9A 1HMOA 3B29A 1RXQA 4JEBA 4YK5A 5EK0A 4OIRF 4CS8C 5DS4A 2J0XA 3LNRA 1R4TA 4B6IA 1D1CA 4CS9C 3A9CA 4P9TA 2R7XA 4C7OA 2NSFA 2EIJC 1E85A 2OKUA 4EWCA 3NYLA 2VASA 2HFIA 2YKZA 4ULVA 1RJ9A 2Y69C 2J8WA 2WZGA 3DKAA 3MFNA 3WAQA 4AX2A 2LD6A 4NCQA 1YDIA 1VLTA 1VYIA 4C3EA 3H65A 4JVSA 2A0BA 4JZAA 2YL7A 2LIGA 3SXMA 4DRHB 4CBEA 2L81A 1H6GA 1G8XA 3QMKA 1I4ZA 5DQTA 2YL3A 1NBBA 1RKEB 1ORJA 2DYSC 2UUIA 4HE8D 3M4BA 4X0RA 1Z7Qc 2Q7RA 3F47A 3R2PA 3X2QC 1GQAA 3S84A 3T4RA 3AGTA 2XXAB 3BRJA 2PFDA 2MYSA 4FESA 5BUOA 2LFDA 1QLEC 4MVZA 4MTGA 2WZFA 3DJUB 1A7EA 2Q9AA 1A41A 2OG2A 5B1AC 3T6BA 1WTYA 4N6HA 3C62A 3IEEA 4EBKA 3CQZA 4MW3A 4N6CA 1VB5A 2Q9CA 2NUPA 2ZPAA 2NUTA 4PJLA 4AL0A 3K1IA 1Q0DA 4YWQA 1AVOB 1J8YF 2YL0A 1ST6A 3C7JA 3CZ6A 3CAXA 3EHNA 1C03A 1K04A 3Q6MA 2A6HF 3ATPA 2C03A 3EGDA 3EQLF 2AU5A 4DRJB 3EHMA 4LDRA 3EG9A 3LESA 2XL6A 1V74B 4CJGA 3EGXB 1LS4A 3RQFA 2L6FA 2R7OA 1M6TA 1V54C 2IXOA 3S90A 4O7GA 4XTKA 3DD7A 3OWTA 2WB7A 2X51A 3TQOA 4XWJA 1H9GA 1NU9C 1CPQA 1GM5A 1RKCA 2D4UA 2VCBA 3K7DA 4ULWA 4DVYP 1TWAA 3B9QA 1A7VA 2Y39A 2OQMA 3JRMO 1FMVA 3JSEO 3ZIBA 1R5ID 2R02A 3EH2A 4BJ5A 2IM8A 3JTLO 3L1MA 2W4MA 3FAPB 4NTBA 3RH3A 3DE8A 5AC4A 1M2VA 4JCHA 4JIOA 4BJ6A 3DM9B 4WABA 5JT4A 1YYJA 2W4BA 3B71A 2YWAA 4U5HA 1NG1A 4NY3A 1WN0A 2HMQA 2CDQA 4Q5SF 3SZRA 1GS9A 2QUPA 4BJ5C 4IGGA 3KL4A 4MNDA 4H4KC 2GAQA 3DE9A 3KYIA 1LI7A 2XS8A 5D92A 3SNHA 3W2WA 5KYWA 5L0HA 1M56C 1Z3IX 3DWWA 5F5HA 3K6BA 4WGYA 3SEOA 2CNWD 1LS1A 5KYYB 1YJGA 3FMSA 1E86A 1HE1A 4K7BA 2BE5F 1Z5ZA 1OCRC 2J46A 5DQZA 1C17M 1D0YA 2M4EA 3GEIA 2OU6A 4GYTA 3EH1A 5AC5A 4WJ0A 4C7OB 4ONSA 3UMKA 3POVA 3VM6A 2P1AA 1MMGA 3M79A 4JRZA 2G62A 3FVYA 5A6BD 4BEMJ 2XLEA 1D1AA 3HJCA 1UFBA 2Q4FA 1E84A 1NSGB 1RJ9B 3DJNB 4E7ZA 2NSGA 5JP7A 2PBEA 4JW1A 3S29A 3TJ6A 4KI2A 3B0UX 2CNWA 1T6IA 3ZDLA 2HV7A 4G0HA 1O3UA 1T6QA 3R7CA 1T9KA 4P6IC 4O6MA 4U5BE 3GEEA 4MVMA 5AGFA 4BJ1A 1NLXA 5A6AA 1YA7O 3U9JA 1BBHA 1FAPB 5A6BA 1WASA 2WZLA 2A1DD 4JJFA 1ZU4A 1YZCA 4AL1A 1H9TA 1E2XA 4W8PA 1A0BA 4QI0A 4JC7A 1LI5A 1WATA 1MMAA 2J9WA 3O55A 3FXHA 2AWYA 3GWLA 4FWVA 3C8GD 4WGZA 3TJ5A 1B68A 4CSAC 4PACA 4I3MA 3RVYA 3B0PA 4OINF 2EIKC 3VYWA 1YAUO 3G50A 2F22A 3NYJA 5A69A 2OOCA 3X1OA 4PJJA 5TJ5E 1TWCA 4EIYA 2XL4A 4NTAA 4CIHA 1DOVA 1U89A 4D4XA 1YA9A 1ZYRF 2GDCA 3M15A 4MVSA 3ZWIA 1XZQA 3FAJA 3H2VA 4MVUA 4OIQF 1OW8A 1G4WR 3C8ZA 1T01A 256BA 4PJNA 3HNJA 5HSWA 3EGDB 1OR3A 2QE9A 2XL8A 5E3CA 4IAOA 3RF3A 2G3VA 2J9VA 3EG9B 1ZU5A 4HEAJ 4PR9A 5JRAA 2I15A 3A11A 3ABMC 3SXKA 1GGQA 2EIMC 3K1HA 4I44A 4A2NB 4CDYA 2OEXA 2WVOA 3DM5A 1Y4CA 1OKKA 1C02A 3AOUA 2QTVA 3WG7C 4DBQA 1OCOC 1W2WA 2GFHA 3GODA 3KYJA 4PK4A 1U6HA 1V4AA 3VF0A 4DRIB 2B0JA 4U5FE 4IB4A 2J7PD 4IRUA 3S0XA 2ZD9A 5JSLA 3U8VA 2EPKX 4EBJA 4EBBA 2R03A 2ZXPA 3KH2A 5L0FA 3W8HA 1K05A 4LERA 1E83A 3HKKA 4BJTA 4G7HF 3FHDA 1OCCC 1G4US 3HNLA 1M2VB 4YJWA 1TR2A 4CJOA 1LKXA 5A6KA 4YT2A 1FR0A 2R7VA 3DXJF 4E7SA 1NZEA 2W45A 3MYIA 3SYNA 1HE9A 4ZLCA 4KNWA 1D0XA 3S9OA 3I5PA 5DS6A 1AUEA 2DB4A 2R9RB 2YLGA 5KYUA 4C3DA 5EHHA 2YVKA 3LEOA 2DI3A 4J7YA 1J8MF 4JEAA 4NQFA 3TD7A 3H2UA 4LACB 2KYHA 3LNMB 2LSEA 4K1OA 3DAFA 3ZSUA 3RIPA 1HW1A 3DAGA 4XEFA 4XPXA 3NKEA 3JYHA 3QVZA 3ECSA 3L0IA 4N06A 2XLMA 3AG2C 4RD9A 2A68F 4J30B 1EKYA 2EPMX 2KNHA 4BG0A 1F1MA 1NFOA 2XSEA 4U5CE 1TQGA 2KGOA 1TKNA 3IQTA 1Q0FA 1Q0GA 1ZHXA 3ZQVA 2R7RA 1CGNA 4EUKB 2FGYA 3GANA 4IWBA 4YT8A 3V5ZA 2YEVA 1YYXA 4P9FA 3LS1A 2L7AA 3JCUQ 3K1IC 3O10A 3AG1C 1XZPA 4CX9A 4EHPA 1KNYA 1KTMA 3UNGC 1VTMP 2J9BA 2XLOA 2IBFA 4XPWA 3F46A 4HFKB 3ABKC 3NYMA 4U5EE 4Z9JA 3W8IA 1D0ZA 2CYDA 1FTSA 2LCHA 1MNDA 3E70C 3JYYA 4KNVA 1PD0A 2PX3A 1Z63A 3ASOC 4JCZA 3I4UA 1LE2A 4LDQA 5COGA 2A6EF 3EFOA 2NPUA 3NMIA 4DJ9A 3AQBA 3U8PA 1VLSA 3JZ0A 3E9VA 1SMYF 3G4XA 4XLNF 1ZHWA 2HZ8A 4XQ1A 5GPGB 4YL1A 3HNIA 1OQCA 4YN0B 3ZQYA 2H7BA 2DYRC 4BJ6C 2Q9BA 4GEHA 3U2MA 1M57C 4ER9A 3PDMP 5CI9A 1T5OA 1JRAA 4QDLA 3IQCA 4U9DA 1K40A 2EPLX 2R7TA 1DOWA 2J45A 2VB6A 5BQIA 2KJGA 5IY5C 5COFA 2KC3A 3ZVRA 1RKEA 5E2QA 2VCAA 2XLWA 5D91A 3TK0A 1G5ZA 2QLAA 4Z9HA 3JT1A 3TOLA 5L3VA 5B3IA 2XS1A 1TFKB 2ASRA 3CEXA 3O39A 3OEOA 2AVKA 1D1BA 2DGJA 2J9UA 3MLGA 4LDKA 5B1BC 3SXYA 3UGOA 3L8IA 1VOMA 3Q7LA 1FFTC 3LJBA 4BEJA 1HW2A 4DOZA 4MQ9F 1XWJA 2P61A 3V5YA 3GM3A 3QTHA 4MVQA 5K0IA 2VC9A 3EZIA 2HUJA 3AJMA 3B0VC 4E0IA 3U9MA 4C3BA 2ZXRA 4Q4ZF 2A69F 2L6GA 4YL0A 5L0JA 2CW0F 1JPJA 1OW7A 4ZLDA 5DS5A 4LLEA 2ICWG 2Y3DA 4MS2A 5F28E 3AGUA 4J7TA 1APCA 1FFHA 1JMWA 3V7OA 1WWPA 2BC5A 1ZHYA 4XEKA 3IQ5A 4G7OF 2PP4A 3QVYA 4LLCA 1QPUA 3LLKA 3NMJA 1FNTc 3IQ6A 2XLVA 3U5SA 4J32B 2R7UA 2NUPB 2NUTB 2HSQA 2IYLD 3ZG1A 3PCVA 2O9XA 2OCCC 5E3AA 5L0GA 1BDJB 3Q7GA 4BPMA 4DXWA 3C8GA 2J0WA 1A7DA 2ETSA 4G78A 4OD5A 3VAYA 5L3QA 2TMVP 2LQGA 1LIHA 4PFOA 5BQGA 2ZXWC 4DVZA 1VMAA 2EPNA 1ZVZA 4OD4A 5B3SC 4JTDB 3ASNC 1PV3A 1IW7F 2QNLA 3GORA 3NDBB 1RCPA 4CS9A 4CDAA 1N1CA 2L6HA 2FFHA 2HKVA 4E18A 3LLIA 2Y3GA 4R32A 4JKVA 2M64A 5DLJA 4A4AA 2H7OA 1OR2A 2X0CA 3NRHA 5CI8A 5FZTA 4MTFA 2YLDA 1ZW3A 3HNKA 3UGPA 4OIPF 4CS7A 1YLMA 1TWHA 3NKDA 1S05A 5KYNA 4JTAB 2FAPB 3W2VA 3FDQA 3Q6NA 2KW3C 4AK9A 1Q0MA 2YHSA 1I4YA 2GWWA 2RSEB 2VH3A 3GEHA 1ZHTA 4O79A 4Z9IA 3EFOB 1HY5A 2C04A 2Q3TA 3T6GB 5A6JA 1Q0KA 2J7PA 3JSZA 3M4CA 4JE9A 5KYXA 2L9JA 4ANJA 1OXKA 5FCLA 1U0BB 5KYWB 2AP3A 1H7IA 2A0UA 3GWNA 3V5XA 4XLPF 2Y3HA 1NU7D 1CGOA 1SZIA 2YL1A 4MVRA 2R7QA 2Z15A 1EI7A 2XM0A 3KKBA 2WVNA 4RBNA 3SP1A 3GM2A 5E33A 2WL8A 5L0CA 1BR4A 5JUAA 4DBRA 2HS5A 1PCXA
chains in the Genus database with same CATH topology
2YQYA 1RXQA 5CIVA 5COMA 3QTHA 2QE9A 2NSFA 2OQMA 2OU6A 3DKAA 5COFA 4N6CA 2QNLA 3DI5A 3GORA 2P1AA 2HKVA 2F22A 2RD9A 3CEXA 2NSGA 5COGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YQY A;  1RXQ A;  5CIV A;  5COM A;  3QTH A;  2QE9 A;  2NSF A;  2OQM A;  2OU6 A;  3DKA A;  5COF A;  4N6C A;  2QNL A;  3DI5 A;  3GOR A;  2P1A A;  2HKV A;  2F22 A;  2RD9 A;  3CEX A;  2NSG A;  5COG A; 
#chains in the Genus database with same CATH topology
 4N4W A;  2VCC A;  2HJM A;  1MMN A;  2E87 A;  2R7S A;  3S27 A;  3N24 A;  5CIV A;  1QKR A;  1OXB A;  4IAQ A;  3W4Y A;  3ITF A;  4F4B A;  4L6R A;  1MMD A;  4U9E A;  4HFF B;  1S7Z A;  3UMI A;  3DMD A;  3WHN A;  4MW8 A;  1RMV A;  3ZTZ A;  1TFO B;  1CPR A;  5JLI A;  2JD3 A;  3NMK A;  2QY9 A;  3QZC A;  3O6X A;  4M63 A;  1BZ4 A;  4E17 A;  1OCZ C;  2OEV A;  3US6 A;  3U0C A;  4GQH A;  1UG7 A;  1QQ3 A;  2OJE D;  4AE4 A;  1OW6 A;  3C18 A;  2EPO A;  2CCY A;  2Q00 A;  1BR2 A;  3N0T A;  3QW0 A;  4CDV A;  2IXM A;  2OJQ A;  2MWQ A;  2XM4 A;  2P0N A;  3PMR A;  4FX5 A;  2D5R B;  2HMZ A;  2LK4 A;  1Z6A A;  2W9Y A;  4NTF A;  3G4Z A;  3HLZ A;  1HMD A;  2P6V A;  1YZA A;  2LFF A;  2XRH A;  1QZX A;  2JX0 A;  3U2L A;  1TWG A;  2Y3B A;  1LVK A;  3M1C B;  3L8J A;  3T9O A;  3TOM A;  1ZW2 A;  2HV6 A;  2CGE A;  4KBL A;  3LEV A;  2IXP A;  1L7C A;  4NC3 A;  2EIL C;  2HJ3 A;  4EKW A;  2YLI A;  2GA0 A;  3LAY A;  2V3C C;  1VYK A;  1MNE A;  2MHR A;  2WVQ A;  3C8G B;  2LP4 A;  1JPN A;  3OA1 A;  2IOQ A;  3RFY A;  3RVZ A;  4U5D E;  1QSP A;  4IAR A;  3AQC A;  2BL2 A;  2KK1 A;  3EJN A;  2RD9 A;  1ORY A;  1LPE A;  2XXA A;  4RDA A;  3S28 A;  1LM3 B;  3L34 A;  3HTK C;  3C63 A;  4JUR I;  2G3K A;  3N2Z B;  3I5Q A;  4KC9 A;  4E0H A;  5EGY A;  1YVI A;  5COM A;  4IJJ A;  3RW0 A;  4O6N A;  1FMW A;  4FAP B;  4MVO A;  3U3F A;  2R25 A;  3JRT A;  4OIO F;  2H7V C;  3K33 A;  4PJM A;  4QI2 A;  1JR8 A;  3SXZ A;  3QW1 A;  1WOL A;  2UUH A;  4I1O B;  2YRF A;  3AG4 C;  2R7W A;  5F5F A;  3U3B A;  3T6J A;  3ABL C;  3BEH A;  3FOP A;  1AEP A;  2JPU A;  4PFP A;  1ZZP A;  1O5H A;  4XEV A;  1PD1 A;  3DI5 A;  5T3W A;  1EQ1 A;  1KU2 A;  2PNO A;  4K0D A;  4G7Z F;  3EGX A;  4Q7C A;  4O6Y A;  5KYU B;  4YL3 A;  4UDV A;  1ORS C;  3ZTM A;  2H8A A;  5KYX B;  4JTC B;  5L0I A;  3KPH A;  3PHF 2;  3RKO F;  1CGM E;  5JS5 A;  1Y6D A;  1M2O A;  3MYF A;  5T1D B;  3NG1 A;  3MX3 A;  3VRC A;  4CIP A;  4YT5 A;  2YQY A;  1WGW A;  4I1M A;  2P7V A;  1IZM A;  1SF8 A;  3IHU A;  2PX0 A;  4JJG A;  3EPV A;  4CSA A;  3K66 A;  4MTO A;  3TUL A;  1V55 C;  2PF4 E;  1JAF A;  2YZS A;  1T6U A;  3RQG A;  3IPM O;  3RYL A;  4W8K A;  1LE4 A;  2HSB A;  3RQE A;  3DZA A;  3FOO A;  5DVW A;  5HV9 A;  1YAR O;  1L3P A;  1NFN A;  1SR2 A;  3UMH A;  3UR3 C;  3EZH A;  5JVE A;  1EA8 A;  4U5G A;  5L0D A;  1JOG A;  3J06 A;  3LS0 A;  1VK5 A;  2I8B A;  2AWC A;  2NG1 A;  2R05 A;  1MQV A;  3AG3 C;  3CSK A;  3LUT B;  4H54 A;  1O87 A;  2IXN A;  4YT4 A;  4CS8 A;  1SYQ A;  2ZXO A;  3GM1 A;  4D4N A;  1ZHZ A;  2EIN C;  2V26 A;  1BR1 A;  2B0H A;  1OKK D;  1Z23 A;  2XLH A;  2KSF A;  3WOD F;  4XPY A;  3MBG A;  3ZC4 A;  3KMI A;  1I5N A;  1QVX A;  5KYY A;  2XLD A;  4AE4 B;  5T3T A;  5BQH A;  2KQ9 A;  1HMO A;  3B29 A;  1RXQ A;  4JEB A;  4YK5 A;  5EK0 A;  4OIR F;  4CS8 C;  5DS4 A;  2J0X A;  3LNR A;  1R4T A;  4B6I A;  1D1C A;  4CS9 C;  3A9C A;  4P9T A;  2R7X A;  4C7O A;  2NSF A;  2EIJ C;  1E85 A;  2OKU A;  4EWC A;  3NYL A;  2VAS A;  2HFI A;  2YKZ A;  4ULV A;  1RJ9 A;  2Y69 C;  2J8W A;  2WZG A;  3DKA A;  3MFN A;  3WAQ A;  4AX2 A;  2LD6 A;  4NCQ A;  1YDI A;  1VLT A;  1VYI A;  4C3E A;  3H65 A;  4JVS A;  2A0B A;  4JZA A;  2YL7 A;  2LIG A;  3SXM A;  4DRH B;  4CBE A;  2L81 A;  1H6G A;  1G8X A;  3QMK A;  1I4Z A;  5DQT A;  2YL3 A;  1NBB A;  1RKE B;  1ORJ A;  2DYS C;  2UUI A;  4HE8 D;  3M4B A;  4X0R A;  1Z7Q c;  2Q7R A;  3F47 A;  3R2P A;  3X2Q C;  1GQA A;  3S84 A;  3T4R A;  3AGT A;  2XXA B;  3BRJ A;  2PFD A;  2MYS A;  4FES A;  5BUO A;  2LFD A;  1QLE C;  4MVZ A;  4MTG A;  2WZF A;  3DJU B;  1A7E A;  2Q9A A;  1A41 A;  2OG2 A;  5B1A C;  3T6B A;  1WTY A;  4N6H A;  3C62 A;  3IEE A;  4EBK A;  3CQZ A;  4MW3 A;  4N6C A;  1VB5 A;  2Q9C A;  2NUP A;  2ZPA A;  2NUT A;  4PJL A;  4AL0 A;  3K1I A;  1Q0D A;  4YWQ A;  1AVO B;  1J8Y F;  2YL0 A;  1ST6 A;  3C7J A;  3CZ6 A;  3CAX A;  3EHN A;  1C03 A;  1K04 A;  3Q6M A;  2A6H F;  3ATP A;  2C03 A;  3EGD A;  3EQL F;  2AU5 A;  4DRJ B;  3EHM A;  4LDR A;  3EG9 A;  3LES A;  2XL6 A;  1V74 B;  4CJG A;  3EGX B;  1LS4 A;  3RQF A;  2L6F A;  2R7O A;  1M6T A;  1V54 C;  2IXO A;  3S90 A;  4O7G A;  4XTK A;  3DD7 A;  3OWT A;  2WB7 A;  2X51 A;  3TQO A;  4XWJ A;  1H9G A;  1NU9 C;  1CPQ A;  1GM5 A;  1RKC A;  2D4U A;  2VCB A;  3K7D A;  4ULW A;  4DVY P;  1TWA A;  3B9Q A;  1A7V A;  2Y39 A;  2OQM A;  3JRM O;  1FMV A;  3JSE O;  3ZIB A;  1R5I D;  2R02 A;  3EH2 A;  4BJ5 A;  2IM8 A;  3JTL O;  3L1M A;  2W4M A;  3FAP B;  4NTB A;  3RH3 A;  3DE8 A;  5AC4 A;  1M2V A;  4JCH A;  4JIO A;  4BJ6 A;  3DM9 B;  4WAB A;  5JT4 A;  1YYJ A;  2W4B A;  3B71 A;  2YWA A;  4U5H A;  1NG1 A;  4NY3 A;  1WN0 A;  2HMQ A;  2CDQ A;  4Q5S F;  3SZR A;  1GS9 A;  2QUP A;  4BJ5 C;  4IGG A;  3KL4 A;  4MND A;  4H4K C;  2GAQ A;  3DE9 A;  3KYI A;  1LI7 A;  2XS8 A;  5D92 A;  3SNH A;  3W2W A;  5KYW A;  5L0H A;  1M56 C;  1Z3I X;  3DWW A;  5F5H A;  3K6B A;  4WGY A;  3SEO A;  2CNW D;  1LS1 A;  5KYY B;  1YJG A;  3FMS A;  1E86 A;  1HE1 A;  4K7B A;  2BE5 F;  1Z5Z A;  1OCR C;  2J46 A;  5DQZ A;  1C17 M;  1D0Y A;  2M4E A;  3GEI A;  2OU6 A;  4GYT A;  3EH1 A;  5AC5 A;  4WJ0 A;  4C7O B;  4ONS A;  3UMK A;  3POV A;  3VM6 A;  2P1A A;  1MMG A;  3M79 A;  4JRZ A;  2G62 A;  3FVY A;  5A6B D;  4BEM J;  2XLE A;  1D1A A;  3HJC A;  1UFB A;  2Q4F A;  1E84 A;  1NSG B;  1RJ9 B;  3DJN B;  4E7Z A;  2NSG A;  5JP7 A;  2PBE A;  4JW1 A;  3S29 A;  3TJ6 A;  4KI2 A;  3B0U X;  2CNW A;  1T6I A;  3ZDL A;  2HV7 A;  4G0H A;  1O3U A;  1T6Q A;  3R7C A;  1T9K A;  4P6I C;  4O6M A;  4U5B E;  3GEE A;  4MVM A;  5AGF A;  4BJ1 A;  1NLX A;  5A6A A;  1YA7 O;  3U9J A;  1BBH A;  1FAP B;  5A6B A;  1WAS A;  2WZL A;  2A1D D;  4JJF A;  1ZU4 A;  1YZC A;  4AL1 A;  1H9T A;  1E2X A;  4W8P A;  1A0B A;  4QI0 A;  4JC7 A;  1LI5 A;  1WAT A;  1MMA A;  2J9W A;  3O55 A;  3FXH A;  2AWY A;  3GWL A;  4FWV A;  3C8G D;  4WGZ A;  3TJ5 A;  1B68 A;  4CSA C;  4PAC A;  4I3M A;  3RVY A;  3B0P A;  4OIN F;  2EIK C;  3VYW A;  1YAU O;  3G50 A;  2F22 A;  3NYJ A;  5A69 A;  2OOC A;  3X1O A;  4PJJ A;  5TJ5 E;  1TWC A;  4EIY A;  2XL4 A;  4NTA A;  4CIH A;  1DOV A;  1U89 A;  4D4X A;  1YA9 A;  1ZYR F;  2GDC A;  3M15 A;  4MVS A;  3ZWI A;  1XZQ A;  3FAJ A;  3H2V A;  4MVU A;  4OIQ F;  1OW8 A;  1G4W R;  3C8Z A;  1T01 A;  256B A;  4PJN A;  3HNJ A;  5HSW A;  3EGD B;  1OR3 A;  2QE9 A;  2XL8 A;  5E3C A;  4IAO A;  3RF3 A;  2G3V A;  2J9V A;  3EG9 B;  1ZU5 A;  4HEA J;  4PR9 A;  5JRA A;  2I15 A;  3A11 A;  3ABM C;  3SXK A;  1GGQ A;  2EIM C;  3K1H A;  4I44 A;  4A2N B;  4CDY A;  2OEX A;  2WVO A;  3DM5 A;  1Y4C A;  1OKK A;  1C02 A;  3AOU A;  2QTV A;  3WG7 C;  4DBQ A;  1OCO C;  1W2W A;  2GFH A;  3GOD A;  3KYJ A;  4PK4 A;  1U6H A;  1V4A A;  3VF0 A;  4DRI B;  2B0J A;  4U5F E;  4IB4 A;  2J7P D;  4IRU A;  3S0X A;  2ZD9 A;  5JSL A;  3U8V A;  2EPK X;  4EBJ A;  4EBB A;  2R03 A;  2ZXP A;  3KH2 A;  5L0F A;  3W8H A;  1K05 A;  4LER A;  1E83 A;  3HKK A;  4BJT A;  4G7H F;  3FHD A;  1OCC C;  1G4U S;  3HNL A;  1M2V B;  4YJW A;  1TR2 A;  4CJO A;  1LKX A;  5A6K A;  4YT2 A;  1FR0 A;  2R7V A;  3DXJ F;  4E7S A;  1NZE A;  2W45 A;  3MYI A;  3SYN A;  1HE9 A;  4ZLC A;  4KNW A;  1D0X A;  3S9O A;  3I5P A;  5DS6 A;  1AUE A;  2DB4 A;  2R9R B;  2YLG A;  5KYU A;  4C3D A;  5EHH A;  2YVK A;  3LEO A;  2DI3 A;  4J7Y A;  1J8M F;  4JEA A;  4NQF A;  3TD7 A;  3H2U A;  4LAC B;  2KYH A;  3LNM B;  2LSE A;  4K1O A;  3DAF A;  3ZSU A;  3RIP A;  1HW1 A;  3DAG A;  4XEF A;  4XPX A;  3NKE A;  3JYH A;  3QVZ A;  3ECS A;  3L0I A;  4N06 A;  2XLM A;  3AG2 C;  4RD9 A;  2A68 F;  4J30 B;  1EKY A;  2EPM X;  2KNH A;  4BG0 A;  1F1M A;  1NFO A;  2XSE A;  4U5C E;  1TQG A;  2KGO A;  1TKN A;  3IQT A;  1Q0F A;  1Q0G A;  1ZHX A;  3ZQV A;  2R7R A;  1CGN A;  4EUK B;  2FGY A;  3GAN A;  4IWB A;  4YT8 A;  3V5Z A;  2YEV A;  1YYX A;  4P9F A;  3LS1 A;  2L7A A;  3JCU Q;  3K1I C;  3O10 A;  3AG1 C;  1XZP A;  4CX9 A;  4EHP A;  1KNY A;  1KTM A;  3UNG C;  1VTM P;  2J9B A;  2XLO A;  2IBF A;  4XPW A;  3F46 A;  4HFK B;  3ABK C;  3NYM A;  4U5E E;  4Z9J A;  3W8I A;  1D0Z A;  2CYD A;  1FTS A;  2LCH A;  1MND A;  3E70 C;  3JYY A;  4KNV A;  1PD0 A;  2PX3 A;  1Z63 A;  3ASO C;  4JCZ A;  3I4U A;  1LE2 A;  4LDQ A;  5COG A;  2A6E F;  3EFO A;  2NPU A;  3NMI A;  4DJ9 A;  3AQB A;  3U8P A;  1VLS A;  3JZ0 A;  3E9V A;  1SMY F;  3G4X A;  4XLN F;  1ZHW A;  2HZ8 A;  4XQ1 A;  5GPG B;  4YL1 A;  3HNI A;  1OQC A;  4YN0 B;  3ZQY A;  2H7B A;  2DYR C;  4BJ6 C;  2Q9B A;  4GEH A;  3U2M A;  1M57 C;  4ER9 A;  3PDM P;  5CI9 A;  1T5O A;  1JRA A;  4QDL A;  3IQC A;  4U9D A;  1K40 A;  2EPL X;  2R7T A;  1DOW A;  2J45 A;  2VB6 A;  5BQI A;  2KJG A;  5IY5 C;  5COF A;  2KC3 A;  3ZVR A;  1RKE A;  5E2Q A;  2VCA A;  2XLW A;  5D91 A;  3TK0 A;  1G5Z A;  2QLA A;  4Z9H A;  3JT1 A;  3TOL A;  5L3V A;  5B3I A;  2XS1 A;  1TFK B;  2ASR A;  3CEX A;  3O39 A;  3OEO A;  2AVK A;  1D1B A;  2DGJ A;  2J9U A;  3MLG A;  4LDK A;  5B1B C;  3SXY A;  3UGO A;  3L8I A;  1VOM A;  3Q7L A;  1FFT C;  3LJB A;  4BEJ A;  1HW2 A;  4DOZ A;  4MQ9 F;  1XWJ A;  2P61 A;  3V5Y A;  3GM3 A;  3QTH A;  4MVQ A;  5K0I A;  2VC9 A;  3EZI A;  2HUJ A;  3AJM A;  3B0V C;  4E0I A;  3U9M A;  4C3B A;  2ZXR A;  4Q4Z F;  2A69 F;  2L6G A;  4YL0 A;  5L0J A;  2CW0 F;  1JPJ A;  1OW7 A;  4ZLD A;  5DS5 A;  4LLE A;  2ICW G;  2Y3D A;  4MS2 A;  5F28 E;  3AGU A;  4J7T A;  1APC A;  1FFH A;  1JMW A;  3V7O A;  1WWP A;  2BC5 A;  1ZHY A;  4XEK A;  3IQ5 A;  4G7O F;  2PP4 A;  3QVY A;  4LLC A;  1QPU A;  3LLK A;  3NMJ A;  1FNT c;  3IQ6 A;  2XLV A;  3U5S A;  4J32 B;  2R7U A;  2NUP B;  2NUT B;  2HSQ A;  2IYL D;  3ZG1 A;  3PCV A;  2O9X A;  2OCC C;  5E3A A;  5L0G A;  1BDJ B;  3Q7G A;  4BPM A;  4DXW A;  3C8G A;  2J0W A;  1A7D A;  2ETS A;  4G78 A;  4OD5 A;  3VAY A;  5L3Q A;  2TMV P;  2LQG A;  1LIH A;  4PFO A;  5BQG A;  2ZXW C;  4DVZ A;  1VMA A;  2EPN A;  1ZVZ A;  4OD4 A;  5B3S C;  4JTD B;  3ASN C;  1PV3 A;  1IW7 F;  2QNL A;  3GOR A;  3NDB B;  1RCP A;  4CS9 A;  4CDA A;  1N1C A;  2L6H A;  2FFH A;  2HKV A;  4E18 A;  3LLI A;  2Y3G A;  4R32 A;  4JKV A;  2M64 A;  5DLJ A;  4A4A A;  2H7O A;  1OR2 A;  2X0C A;  3NRH A;  5CI8 A;  5FZT A;  4MTF A;  2YLD A;  1ZW3 A;  3HNK A;  3UGP A;  4OIP F;  4CS7 A;  1YLM A;  1TWH A;  3NKD A;  1S05 A;  5KYN A;  4JTA B;  2FAP B;  3W2V A;  3FDQ A;  3Q6N A;  2KW3 C;  4AK9 A;  1Q0M A;  2YHS A;  1I4Y A;  2GWW A;  2RSE B;  2VH3 A;  3GEH A;  1ZHT A;  4O79 A;  4Z9I A;  3EFO B;  1HY5 A;  2C04 A;  2Q3T A;  3T6G B;  5A6J A;  1Q0K A;  2J7P A;  3JSZ A;  3M4C A;  4JE9 A;  5KYX A;  2L9J A;  4ANJ A;  1OXK A;  5FCL A;  1U0B B;  5KYW B;  2AP3 A;  1H7I A;  2A0U A;  3GWN A;  3V5X A;  4XLP F;  2Y3H A;  1NU7 D;  1CGO A;  1SZI A;  2YL1 A;  4MVR A;  2R7Q A;  2Z15 A;  1EI7 A;  2XM0 A;  3KKB A;  2WVN A;  4RBN A;  3SP1 A;  3GM2 A;  5E33 A;  2WL8 A;  5L0C A;  1BR4 A;  5JUA A;  4DBR A;  2HS5 A;  1PCX A; 
#chains in the Genus database with same CATH homology
 2YQY A;  1RXQ A;  5CIV A;  5COM A;  3QTH A;  2QE9 A;  2NSF A;  2OQM A;  2OU6 A;  3DKA A;  5COF A;  4N6C A;  2QNL A;  3DI5 A;  3GOR A;  2P1A A;  2HKV A;  2F22 A;  2RD9 A;  3CEX A;  2NSG A;  5COG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...