2RD9A

Crystal structure of a putative yfit-like metal-dependent hydrolase (bh0186) from bacillus halodurans c-125 at 2.30 a resolution
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
189
structure length
189
Chain Sequence
KIHHHHHHENLYFQGMNFQMNEAIQLLERTPKTLEVFLEGLSDSWHQCNEGYETWTVYEVVVHLIEAEKTNWIPRLRFILQEGEHKPFPAFDRFSHLNQSNAVPISERFKEFQQLRKENLNTLRSLVQSEADLERTGAHPAFGVVKVRELLSAWVVHDLTHIAQIVRSMAKRYDTDVGPWKEYLGILND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BH0186 protein
publication title Crystal structure of YfiT-like putative metal-dependent hydrolase (NP_241052.1) from Bacillus halodurans at 2.30 A resolution
rcsb
source organism Bacillus halodurans c-125
molecule tags Hydrolase
total genus 61
structure length 189
sequence length 189
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12867 DinB_2 DinB superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.450 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) dinb family like domain 2rd9A01
3DKAA 5CIVA 5COFA 2QE9A 3CEXA 2RD9A 2OU6A 3GORA 2QNLA 2NSGA 3QTHA 5COGA 2YQYA 2F22A 2OQMA 5COMA 2HKVA 1RXQA 4N6CA 2P1AA 3DI5A 2NSFA
chains in the Genus database with same CATH superfamily
2EILC 3I4UA 1ZHYA 1R4TA 3FMSA 1Z5ZA 3N24A 1OCCC 1PCXA 1RJ9B 1Z3IX 5L3VA 4EBJA 2XL8A 4J7YA 5A6AA 2YHSA 4ULVA 4WJ0A 4HFFB 3CQZA 5EK0A 1C17M 2AU5A 2JPUA 5JP7A 1UFBA 3ECSA 2DYSC 1BDJB 1APCA 4KNVA 1D0YA 2VB6A 2A0UA 2IM8A 2J8WA 2YLDA 3AQCA 3FOPA 2A1DD 1OW7A 3GEIA 5COGA 3RQGA 3VRCA 4AX2A 4E0IA 1R5ID 1YA7O 2DB4A 3I5QA 3TJ6A 3J06A 2Y3DA 3KYIA 3JSEO 4CDYA 2F22A 2EPMX 4IB4A 2KJGA 4OD5A 3ZIBA 5BQIA 1G5ZA 2IXPA 3TJ5A 4YT4A 5DS5A 3N2ZB 3VM6A 2P61A 3S27A 3SXMA 1QQ3A 4C7OA 1KU2A 4MQ9F 2XLWA 5E33A 3DWWA 1Q0DA 2PF4E 1LM3B 5AC5A 4AL1A 4PJNA 3K1HA 4MVMA 2GFHA 3SYNA 1FTSA 3SP1A 3ZSUA 2A69F 1EKYA 4CJGA 2CW0F 3EJNA 3MYFA 5DS6A 2YLGA 4NQFA 4OD4A 4RD9A 1JPNA 1V55C 3ATPA 3LS0A 2VCAA 4C3BA 3LLKA 2H7OA 1ORSC 2J7PA 4JTCB 3SNHA 3GM1A 1E83A 3HLZA 1YLMA 1ZU4A 3K1IA 1CPQA 4D4NA 3RH3A 5KYNA 3EGXA 4RBNA 3VAYA 2OKUA 4JTDB 5F5HA 4FAPB 1LKXA 1JR8A 4ONSA 2FAPB 5DS4A 2I8BA 1J8YF 2R7RA 3UGPA 3W4YA 3U5SA 2OOCA 2OEXA 4MS2A 4MTGA 3MLGA 4B6IA 2ZXOA 3Q6NA 2QUPA 1KNYA 5JRAA 1B68A 1VMAA 1HMDA 3HNIA 3TOLA 5F5FA 4EWCA 2OEVA 2QE9A 4KNWA 3C7JA 4LACB 1S05A 3HTKC 3CEXA 3MFNA 2LQGA 2OJQA 3KMIA 4JVSA 4QDLA 2DGJA 1M2VA 4U5GA 1Q0KA 4XPXA 2J0WA 5L0JA 2ETSA 3A9CA 2HFIA 3C62A 2QNLA 4XLNF 4CSAA 3IHUA 1D0ZA 3QMKA 4EBKA 3FOOA 1H9GA 1C02A 5L0IA 2CCYA 2R7OA 4OIOF 3JYHA 5K0IA 4MW3A 3LUTB 3UGOA 2LCHA 4YJWA 2OQMA 4PACA 2D4UA 2KK1A 3GANA 1OR3A 3SEOA 2R9RB 3T6JA 5CI8A 3K6BA 3PMRA 3RYLA 1A0BA 1VYKA 3LAYA 2H8AA 3GM3A 1SYQA 4Q5SF 5A6JA 2R25A 4PFPA 3RKOF 1O87A 3A11A 2HV6A 2VCBA 1F1MA 4U5FE 3TQOA 3U9JA 1RKEB 4JIOA 3F46A 3B0UX 3WG7C 2EIJC 2G3KA 2XRHA 3UR3C 2J7PD 2R05A 2DYRC 3S9OA 3SXZA 1TWAA 3AGUA 3O55A 4OIRF 3ZC4A 3GWNA 1TFKB 3PCVA 3ZQYA 4AL0A 1DOVA 1LS1A 3HNLA 1NG1A 3AJMA 5T1DB 4BEJA 2L7AA 2AP3A 3GM2A 3UMIA 3Q7GA 5L0HA 5DQTA 1Z63A 4DBRA 1NBBA 2GWWA 4YT5A 1NU9C 2EIMC 1LE2A 2G62A 3JCUQ 3B9QA 4YL0A 1OKKA 1NFOA 2HV7A 2V26A 4NC3A 2BC5A 2NSFA 1OXKA 3JTLO 1ZW3A 2P7VA 1JPJA 4G78A 3W8HA 5KYWA 5JSLA 1MNEA 4M63A 5EGYA 2IYLD 2Q3TA 4JC7A 1YAUO 2M4EA 5E2QA 4I3MA 1FMVA 2QTVA 4MTFA 2D5RB 3DE8A 3NYMA 2PFDA 2UUHA 4QI2A 3KPHA 2ZXPA 1Y6DA 3GORA 4ER9A 4AE4A 2WZLA 2CDQA 2WZGA 3ABMC 3IQ6A 1RKCA 3QTHA 1ORYA 3IQ5A 1MMNA 2QY9A 5GPGB 4NCQA 4BJ1A 3LNMB 4GYTA 3LEOA 5KYWB 4LLCA 1OCRC 5BQGA 3R7CA 3U0CA 2EPOA 3S90A 2I15A 4UDVA 2HS5A 5KYYA 1M56C 4O7GA 2P1AA 4F4BA 2A68F 4BJ5A 1JRAA 1FMWA 1A7VA 3EPVA 4MVZA 3AQBA 2YL3A 2XLEA 2Z15A 3G50A 3O6XA 4AE4B 3V5ZA 4U5CE 3W2WA 4HE8D 1S7ZA 2KGOA 3CSKA 4IRUA 3X2QC 5AC4A 1Q0FA 1C03A 1WWPA 4NY3A 2RSEB 1JOGA 1XZPA 2V3CC 1J8MF 4DVZA 5KYYB 4O6YA 4PJJA 2J45A 1HMOA 4ZLDA 2X51A 2WVOA 4MVUA 2Q9BA 5HSWA 3U3FA 4Z9IA 5L0CA 3OA1A 2GAQA 1OKKD 1TWHA 3L8IA 1CGNA 4PK4A 2HKVA 3L34A 2YZSA 2KSFA 4XLPF 2JX0A 4NTAA 1VB5A 3AG3C 3JRMO 4U5EE 1G8XA 3JRTA 4J30B 2R7XA 5COFA 3SXKA 1PD1A 3DXJF 3DJUB 4G7OF 2B0HA 4ZLCA 1QPUA 3V5XA 1MMDA 1BBHA 1I4YA 3ABKC 5KYUB 5FCLA 3RFYA 4WABA 3NDBB 2CNWA 1IZMA 1CGOA 4CDVA 2L9JA 4YT2A 4H54A 3K66A 1GQAA 3K7DA 2BL2A 2HMZA 3OWTA 1V54C 3K33A 3RVYA 5COMA 4CS8C 4L6RA 3O10A 4A4AA 1M2OA 3AGTA 2H7VC 3WODF 4RDAA 1AEPA 3DKAA 3U8VA 3W2VA 3EQLF 2R7UA 2KYHA 3Q7LA 3U8PA 4JJFA 2EPNA 2LD6A 4FX5A 1OCZC 3U2LA 4Q4ZF 2PX0A 3M15A 4G0HA 2NG1A 2Y3HA 1PV3A 3QVZA 1EQ1A 1QZXA 5E3AA 4JE9A 2XL4A 5L0GA 1Z23A 1H7IA 1RMVA 1K05A 1MNDA 1QKRA 1ZZPA 2QLAA 3GWLA 1T6UA 4MNDA 3TULA 4C3DA 1A7DA 2HJ3A 2IXNA 2VCCA 1OQCA 1GGQA 1RKEA 4K0DA 3KL4A 4XEVA 1E85A 1WOLA 1QVXA 3B0VC 4XPYA 1VYIA 4XEFA 4DOZA 4KI2A 3AOUA 1SMYF 2AWCA 2EPLX 2VH3A 2ZXRA 2C04A 4JW1A 4LDKA 1Z7Qc 2XLMA 1LE4A 2Q9CA 1I4ZA 3JZ0A 3C18A 5JVEA 2P0NA 2YL1A 4CBEA 4I44A 5L3QA 1BZ4A 3Q6MA 4NTFA 5CI9A 3H2VA 3IEEA 4CS7A 3S29A 3DJNB 1PD0A 3C8GB 4J7TA 1CGME 4JEBA 5JS5A 4DJ9A 3FAJA 1H9TA 1TQGA 2FFHA 3NMJA 3TOMA 1KTMA 1G4US 4MVOA 4EUKB 4E7ZA 2CNWD 3ABLC 2HZ8A 4JEAA 4ULWA 2G3VA 3HNKA 5JLIA 2B0JA 4JTAB 4XWJA 4ANJA 2KNHA 1M6TA 2KC3A 3BRJA 1A7EA 4C3EA 2EIKC 3DD7A 3ZTMA 1UG7A 2Y3BA 4N6HA 1AVOB 1YVIA 5BUOA 4LLEA 4G7HF 1QSPA 3FHDA 1HW2A 1BR1A 3CAXA 4N6CA 2X0CA 2A6EF 3DI5A 2WVQA 3B71A 2LFDA 4FWVA 4IJJA 3RQEA 1XZQA 2XS1A 4H4KC 5L0DA 3NKDA 2Q00A 2ZPAA 1LI5A 2WL8A 3I5PA 3ZDLA 4J32B 1YA9A 4HFKB 1E86A 4PJMA 1BR2A 3N0TA 4O6MA 3NRHA 3DM5A 3IPMO 4X0RA 1TWCA 1MMGA 2MYSA 2KQ9A 4LDRA 1TFOB 2YL0A 4BEMJ 2L6GA 1FAPB 2AWYA 3KKBA 4IWBA 1OCOC 3M1CB 4A2NB 3PHF2 4EIYA 1YJGA 4YN0B 4D4XA 3SXYA 2YLIA 2Y39A 4PJLA 2YQYA 1LIHA 2YL7A 4W8KA 4CX9A 2Q7RA 1Z6AA 3M4BA 3ZVRA 4MTOA 4HEAJ 3U2MA 2LP4A 3KH2A 2WB7A 3DM9B 1HE1A 1G4WR 4YL3A 5TJ5E 3TD7A 4CS9C 4YWQA 3MBGA 2YKZA 1TWGA 3X1OA 1LI7A 3S84A 3UNGC 2YVKA 3L0IA 2XLDA 1HW1A 5T3TA 5B3IA 3FAPB 1Y4CA 1YDIA 1U89A 5JUAA 5KYXA 3IQTA 3MX3A 4MW8A 3RQFA 1L3PA 1W2WA 5A6BA 3ITFA 2FGYA 4E17A 2J9UA 2PX3A 4JCZA 3ZWIA 5JT4A 4GQHA 3TK0A 4XQ1A 3U9MA 3AG4C 2L81A 4W8PA 2JD3A 3B0PA 2UUIA 4QI0A 1DOWA 4AK9A 3POVA 3AG2C 5BQHA 3FXHA 3EFOB 4U9DA 2C03A 4YL1A 4E7SA 5F28E 1YZCA 2CGEA 2TMVP 2NUPA 4GEHA 3NYJA 4JCHA 5KYXB 1O3UA 1M57C 3CZ6A 1NZEA 1H6GA 2AVKA 4YK5A 3LJBA 5KYUA 1VLTA 1D1BA 4IARA 2R7SA 3JT1A 3VF0A 4MVQA 3KYJA 3EGDB 4EBBA 5DLJA 1U6HA 4BPMA 2R7WA 1YARO 1ZW2A 2H7BA 2NUTB 2PP4A 1EI7A 2J9BA 3L8JA 3MYIA 3NYLA 2EINC 3M4CA 4LERA 5CIVA 1YZAA 1U0BB 2XLVA 3DAGA 2KW3C 4P9TA 2VC9A 3GODA 2Y69C 1TR2A 2E87A 2NUPB 2R03A 2WVNA 4U5HA 3RVZA 2CYDA 3EHMA 3LEVA 1ZVZA 4LDQA 4KBLA 3RIPA 1XWJA 3DZAA 3EH2A 3NMIA 4MVSA 3FVYA 3WAQA 1QLEC 1AUEA 3DMDA 3LNRA 4U9EA 5AGFA 3V7OA 4DRHB 1T9KA 1OXBA 2J46A 2ZXWC 3F47A 1Q0GA 1IW7F 5FZTA 2VASA 1GS9A 1LS4A 1D0XA 4JURI 3RF3A 1E84A 1K40A 2W4MA 1FFHA 2L6FA 3EH1A 1HE9A 3K1IC 5A6BD 2ICWG 2XS8A 3BEHA 2Q9AA 4DRIB 3NG1A 1VTMP 256BA 3NKEA 2J9WA 1YYJA 1WASA 1RCPA 2LSEA 3ZQVA 4CS8A 3C8ZA 3OEOA 3ZG1A 4G7ZF 1A41A 4Z9HA 4OIPF 2OU6A 4IAOA 2A6HF 2OCCC 4WGYA 4C7OB 3EHNA 3FDQA 1ZHTA 2YRFA 3S0XA 2J0XA 3B29A 3C8GA 4N06A 3US6A 2XM4A 2IOQA 3M79A 3W8IA 1EA8A 4DXWA 3PDMP 1T6IA 4CIHA 2OJED 3HJCA 3IQCA 2HSQA 4BG0A 2W4BA 2OG2A 2M64A 4KC9A 3DAFA 1HY5A 4EKWA 1OW8A 1T6QA 1K04A 3LS1A 2XXAA 2J9VA 3DE9A 4MVRA 5DVWA 2HJMA 3EG9A 3HKKA 4CSAC 2LK4A 2XLOA 1ZYRF 4DBQA 5HV9A 5B1BC 1NSGB 3JSZA 2XM0A 4P6IC 1NLXA 2DI3A 3EGXB 2A0BA 4E0HA 4DRJB 4E18A 2PNOA 4BJTA 1VLSA 1ZHZA 3T6GB 5B3SC 4O79A 2HUJA 3WHNA 3QZCA 1FNTc 4R32A 3U3BA 2XXAB 4CIPA 1LPEA 1O5HA 3O39A 3EG9B 1V4AA 3H65A 5DQZA 4K1OA 1D1CA 2GA0A 3HNJA 4WGZA 3ASOC 5IY5C 2IXMA 3T9OA 3L1MA 3V5YA 4CJOA 4IAQA 1L7CA 4PFOA 3G4ZA 1MQVA 1ZU5A 2HSBA 1MMAA 1ORJA 1RXQA 1VK5A 4O6NA 2YWAA 3ZTZA 1M2VB 2LFFA 1OW6A 3G4XA 1JAFA 1FR0A 2PBEA 4I1MA 1N1CA 4IGGA 3SZRA 5A69A 2NPUA 2ZD9A 1WATA 4U5BE 3NMKA 1WTYA 1GM5A 3EZIA 4EHPA 1BR4A 2W45A 5EHHA 5D91A 2P6VA 4OIQF 4Z9JA 3E70C 1JMWA 4DVYP 1NFNA 2BE5F 4PR9A 2Q4FA 3C8GD 1NU7D 4I1OB 3GEHA 4BJ6C 3R2PA 2YEVA 4JJGA 1FFTC 2Y3GA 1T5OA 4CDAA 3H2UA 2EPKX 1ZHWA 1WGWA 2R7QA 4JRZA 1I5NA 2IXOA 3E9VA 2O9XA 4K7BA 4U5DE 5A6KA 1E2XA 2W9YA 3EFOA 3ASNC 4N4WA 2ASRA 2MWQA 4P9FA 4BJ6A 3S28A 4YT8A 3JYYA 3LESA 2R7TA 2R7VA 5T3WA 3QW1A 2GDCA 1OR2A 1ZHXA 1ST6A 3QVYA 1WN0A 2MHRA 2HMQA 3GEEA 2RD9A 4JKVA 1YYXA 5B1AC 4CS9A 4Q7CA 4XPWA 2XL6A 4BJ5C 3EGDA 4JZAA 1D1AA 2NSGA 2WZFA 1TKNA 1RJ9A 2LIGA 2L6HA 3AG1C 2XLHA 4XEKA 1Q0MA 1LVKA 5D92A 2NUTA 4OINF 3C63A 3UMHA 3QW0A 3VYWA 5L0FA 1SR2A 1T01A 4NTBA 1V74B 5E3CA 2R02A 1SZIA 3LLIA 1SF8A 3T4RA 2XSEA 1CPRA 3EZHA 4FESA 3UMKA 4XTKA 3T6BA 3RW0A 1VOMA 2IBFA
chains in the Genus database with same CATH topology
3DKAA 5CIVA 5COFA 2QE9A 3CEXA 2RD9A 2OU6A 3GORA 2QNLA 2NSGA 3QTHA 5COGA 2YQYA 2F22A 2OQMA 5COMA 2HKVA 1RXQA 4N6CA 2P1AA 3DI5A 2NSFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DKA A;  5CIV A;  5COF A;  2QE9 A;  3CEX A;  2RD9 A;  2OU6 A;  3GOR A;  2QNL A;  2NSG A;  3QTH A;  5COG A;  2YQY A;  2F22 A;  2OQM A;  5COM A;  2HKV A;  1RXQ A;  4N6C A;  2P1A A;  3DI5 A;  2NSF A; 
#chains in the Genus database with same CATH topology
 2EIL C;  3I4U A;  1ZHY A;  1R4T A;  3FMS A;  1Z5Z A;  3N24 A;  1OCC C;  1PCX A;  1RJ9 B;  1Z3I X;  5L3V A;  4EBJ A;  2XL8 A;  4J7Y A;  5A6A A;  2YHS A;  4ULV A;  4WJ0 A;  4HFF B;  3CQZ A;  5EK0 A;  1C17 M;  2AU5 A;  2JPU A;  5JP7 A;  1UFB A;  3ECS A;  2DYS C;  1BDJ B;  1APC A;  4KNV A;  1D0Y A;  2VB6 A;  2A0U A;  2IM8 A;  2J8W A;  2YLD A;  3AQC A;  3FOP A;  2A1D D;  1OW7 A;  3GEI A;  5COG A;  3RQG A;  3VRC A;  4AX2 A;  4E0I A;  1R5I D;  1YA7 O;  2DB4 A;  3I5Q A;  3TJ6 A;  3J06 A;  2Y3D A;  3KYI A;  3JSE O;  4CDY A;  2F22 A;  2EPM X;  4IB4 A;  2KJG A;  4OD5 A;  3ZIB A;  5BQI A;  1G5Z A;  2IXP A;  3TJ5 A;  4YT4 A;  5DS5 A;  3N2Z B;  3VM6 A;  2P61 A;  3S27 A;  3SXM A;  1QQ3 A;  4C7O A;  1KU2 A;  4MQ9 F;  2XLW A;  5E33 A;  3DWW A;  1Q0D A;  2PF4 E;  1LM3 B;  5AC5 A;  4AL1 A;  4PJN A;  3K1H A;  4MVM A;  2GFH A;  3SYN A;  1FTS A;  3SP1 A;  3ZSU A;  2A69 F;  1EKY A;  4CJG A;  2CW0 F;  3EJN A;  3MYF A;  5DS6 A;  2YLG A;  4NQF A;  4OD4 A;  4RD9 A;  1JPN A;  1V55 C;  3ATP A;  3LS0 A;  2VCA A;  4C3B A;  3LLK A;  2H7O A;  1ORS C;  2J7P A;  4JTC B;  3SNH A;  3GM1 A;  1E83 A;  3HLZ A;  1YLM A;  1ZU4 A;  3K1I A;  1CPQ A;  4D4N A;  3RH3 A;  5KYN A;  3EGX A;  4RBN A;  3VAY A;  2OKU A;  4JTD B;  5F5H A;  4FAP B;  1LKX A;  1JR8 A;  4ONS A;  2FAP B;  5DS4 A;  2I8B A;  1J8Y F;  2R7R A;  3UGP A;  3W4Y A;  3U5S A;  2OOC A;  2OEX A;  4MS2 A;  4MTG A;  3MLG A;  4B6I A;  2ZXO A;  3Q6N A;  2QUP A;  1KNY A;  5JRA A;  1B68 A;  1VMA A;  1HMD A;  3HNI A;  3TOL A;  5F5F A;  4EWC A;  2OEV A;  2QE9 A;  4KNW A;  3C7J A;  4LAC B;  1S05 A;  3HTK C;  3CEX A;  3MFN A;  2LQG A;  2OJQ A;  3KMI A;  4JVS A;  4QDL A;  2DGJ A;  1M2V A;  4U5G A;  1Q0K A;  4XPX A;  2J0W A;  5L0J A;  2ETS A;  3A9C A;  2HFI A;  3C62 A;  2QNL A;  4XLN F;  4CSA A;  3IHU A;  1D0Z A;  3QMK A;  4EBK A;  3FOO A;  1H9G A;  1C02 A;  5L0I A;  2CCY A;  2R7O A;  4OIO F;  3JYH A;  5K0I A;  4MW3 A;  3LUT B;  3UGO A;  2LCH A;  4YJW A;  2OQM A;  4PAC A;  2D4U A;  2KK1 A;  3GAN A;  1OR3 A;  3SEO A;  2R9R B;  3T6J A;  5CI8 A;  3K6B A;  3PMR A;  3RYL A;  1A0B A;  1VYK A;  3LAY A;  2H8A A;  3GM3 A;  1SYQ A;  4Q5S F;  5A6J A;  2R25 A;  4PFP A;  3RKO F;  1O87 A;  3A11 A;  2HV6 A;  2VCB A;  1F1M A;  4U5F E;  3TQO A;  3U9J A;  1RKE B;  4JIO A;  3F46 A;  3B0U X;  3WG7 C;  2EIJ C;  2G3K A;  2XRH A;  3UR3 C;  2J7P D;  2R05 A;  2DYR C;  3S9O A;  3SXZ A;  1TWA A;  3AGU A;  3O55 A;  4OIR F;  3ZC4 A;  3GWN A;  1TFK B;  3PCV A;  3ZQY A;  4AL0 A;  1DOV A;  1LS1 A;  3HNL A;  1NG1 A;  3AJM A;  5T1D B;  4BEJ A;  2L7A A;  2AP3 A;  3GM2 A;  3UMI A;  3Q7G A;  5L0H A;  5DQT A;  1Z63 A;  4DBR A;  1NBB A;  2GWW A;  4YT5 A;  1NU9 C;  2EIM C;  1LE2 A;  2G62 A;  3JCU Q;  3B9Q A;  4YL0 A;  1OKK A;  1NFO A;  2HV7 A;  2V26 A;  4NC3 A;  2BC5 A;  2NSF A;  1OXK A;  3JTL O;  1ZW3 A;  2P7V A;  1JPJ A;  4G78 A;  3W8H A;  5KYW A;  5JSL A;  1MNE A;  4M63 A;  5EGY A;  2IYL D;  2Q3T A;  4JC7 A;  1YAU O;  2M4E A;  5E2Q A;  4I3M A;  1FMV A;  2QTV A;  4MTF A;  2D5R B;  3DE8 A;  3NYM A;  2PFD A;  2UUH A;  4QI2 A;  3KPH A;  2ZXP A;  1Y6D A;  3GOR A;  4ER9 A;  4AE4 A;  2WZL A;  2CDQ A;  2WZG A;  3ABM C;  3IQ6 A;  1RKC A;  3QTH A;  1ORY A;  3IQ5 A;  1MMN A;  2QY9 A;  5GPG B;  4NCQ A;  4BJ1 A;  3LNM B;  4GYT A;  3LEO A;  5KYW B;  4LLC A;  1OCR C;  5BQG A;  3R7C A;  3U0C A;  2EPO A;  3S90 A;  2I15 A;  4UDV A;  2HS5 A;  5KYY A;  1M56 C;  4O7G A;  2P1A A;  4F4B A;  2A68 F;  4BJ5 A;  1JRA A;  1FMW A;  1A7V A;  3EPV A;  4MVZ A;  3AQB A;  2YL3 A;  2XLE A;  2Z15 A;  3G50 A;  3O6X A;  4AE4 B;  3V5Z A;  4U5C E;  3W2W A;  4HE8 D;  1S7Z A;  2KGO A;  3CSK A;  4IRU A;  3X2Q C;  5AC4 A;  1Q0F A;  1C03 A;  1WWP A;  4NY3 A;  2RSE B;  1JOG A;  1XZP A;  2V3C C;  1J8M F;  4DVZ A;  5KYY B;  4O6Y A;  4PJJ A;  2J45 A;  1HMO A;  4ZLD A;  2X51 A;  2WVO A;  4MVU A;  2Q9B A;  5HSW A;  3U3F A;  4Z9I A;  5L0C A;  3OA1 A;  2GAQ A;  1OKK D;  1TWH A;  3L8I A;  1CGN A;  4PK4 A;  2HKV A;  3L34 A;  2YZS A;  2KSF A;  4XLP F;  2JX0 A;  4NTA A;  1VB5 A;  3AG3 C;  3JRM O;  4U5E E;  1G8X A;  3JRT A;  4J30 B;  2R7X A;  5COF A;  3SXK A;  1PD1 A;  3DXJ F;  3DJU B;  4G7O F;  2B0H A;  4ZLC A;  1QPU A;  3V5X A;  1MMD A;  1BBH A;  1I4Y A;  3ABK C;  5KYU B;  5FCL A;  3RFY A;  4WAB A;  3NDB B;  2CNW A;  1IZM A;  1CGO A;  4CDV A;  2L9J A;  4YT2 A;  4H54 A;  3K66 A;  1GQA A;  3K7D A;  2BL2 A;  2HMZ A;  3OWT A;  1V54 C;  3K33 A;  3RVY A;  5COM A;  4CS8 C;  4L6R A;  3O10 A;  4A4A A;  1M2O A;  3AGT A;  2H7V C;  3WOD F;  4RDA A;  1AEP A;  3DKA A;  3U8V A;  3W2V A;  3EQL F;  2R7U A;  2KYH A;  3Q7L A;  3U8P A;  4JJF A;  2EPN A;  2LD6 A;  4FX5 A;  1OCZ C;  3U2L A;  4Q4Z F;  2PX0 A;  3M15 A;  4G0H A;  2NG1 A;  2Y3H A;  1PV3 A;  3QVZ A;  1EQ1 A;  1QZX A;  5E3A A;  4JE9 A;  2XL4 A;  5L0G A;  1Z23 A;  1H7I A;  1RMV A;  1K05 A;  1MND A;  1QKR A;  1ZZP A;  2QLA A;  3GWL A;  1T6U A;  4MND A;  3TUL A;  4C3D A;  1A7D A;  2HJ3 A;  2IXN A;  2VCC A;  1OQC A;  1GGQ A;  1RKE A;  4K0D A;  3KL4 A;  4XEV A;  1E85 A;  1WOL A;  1QVX A;  3B0V C;  4XPY A;  1VYI A;  4XEF A;  4DOZ A;  4KI2 A;  3AOU A;  1SMY F;  2AWC A;  2EPL X;  2VH3 A;  2ZXR A;  2C04 A;  4JW1 A;  4LDK A;  1Z7Q c;  2XLM A;  1LE4 A;  2Q9C A;  1I4Z A;  3JZ0 A;  3C18 A;  5JVE A;  2P0N A;  2YL1 A;  4CBE A;  4I44 A;  5L3Q A;  1BZ4 A;  3Q6M A;  4NTF A;  5CI9 A;  3H2V A;  3IEE A;  4CS7 A;  3S29 A;  3DJN B;  1PD0 A;  3C8G B;  4J7T A;  1CGM E;  4JEB A;  5JS5 A;  4DJ9 A;  3FAJ A;  1H9T A;  1TQG A;  2FFH A;  3NMJ A;  3TOM A;  1KTM A;  1G4U S;  4MVO A;  4EUK B;  4E7Z A;  2CNW D;  3ABL C;  2HZ8 A;  4JEA A;  4ULW A;  2G3V A;  3HNK A;  5JLI A;  2B0J A;  4JTA B;  4XWJ A;  4ANJ A;  2KNH A;  1M6T A;  2KC3 A;  3BRJ A;  1A7E A;  4C3E A;  2EIK C;  3DD7 A;  3ZTM A;  1UG7 A;  2Y3B A;  4N6H A;  1AVO B;  1YVI A;  5BUO A;  4LLE A;  4G7H F;  1QSP A;  3FHD A;  1HW2 A;  1BR1 A;  3CAX A;  4N6C A;  2X0C A;  2A6E F;  3DI5 A;  2WVQ A;  3B71 A;  2LFD A;  4FWV A;  4IJJ A;  3RQE A;  1XZQ A;  2XS1 A;  4H4K C;  5L0D A;  3NKD A;  2Q00 A;  2ZPA A;  1LI5 A;  2WL8 A;  3I5P A;  3ZDL A;  4J32 B;  1YA9 A;  4HFK B;  1E86 A;  4PJM A;  1BR2 A;  3N0T A;  4O6M A;  3NRH A;  3DM5 A;  3IPM O;  4X0R A;  1TWC A;  1MMG A;  2MYS A;  2KQ9 A;  4LDR A;  1TFO B;  2YL0 A;  4BEM J;  2L6G A;  1FAP B;  2AWY A;  3KKB A;  4IWB A;  1OCO C;  3M1C B;  4A2N B;  3PHF 2;  4EIY A;  1YJG A;  4YN0 B;  4D4X A;  3SXY A;  2YLI A;  2Y39 A;  4PJL A;  2YQY A;  1LIH A;  2YL7 A;  4W8K A;  4CX9 A;  2Q7R A;  1Z6A A;  3M4B A;  3ZVR A;  4MTO A;  4HEA J;  3U2M A;  2LP4 A;  3KH2 A;  2WB7 A;  3DM9 B;  1HE1 A;  1G4W R;  4YL3 A;  5TJ5 E;  3TD7 A;  4CS9 C;  4YWQ A;  3MBG A;  2YKZ A;  1TWG A;  3X1O A;  1LI7 A;  3S84 A;  3UNG C;  2YVK A;  3L0I A;  2XLD A;  1HW1 A;  5T3T A;  5B3I A;  3FAP B;  1Y4C A;  1YDI A;  1U89 A;  5JUA A;  5KYX A;  3IQT A;  3MX3 A;  4MW8 A;  3RQF A;  1L3P A;  1W2W A;  5A6B A;  3ITF A;  2FGY A;  4E17 A;  2J9U A;  2PX3 A;  4JCZ A;  3ZWI A;  5JT4 A;  4GQH A;  3TK0 A;  4XQ1 A;  3U9M A;  3AG4 C;  2L81 A;  4W8P A;  2JD3 A;  3B0P A;  2UUI A;  4QI0 A;  1DOW A;  4AK9 A;  3POV A;  3AG2 C;  5BQH A;  3FXH A;  3EFO B;  4U9D A;  2C03 A;  4YL1 A;  4E7S A;  5F28 E;  1YZC A;  2CGE A;  2TMV P;  2NUP A;  4GEH A;  3NYJ A;  4JCH A;  5KYX B;  1O3U A;  1M57 C;  3CZ6 A;  1NZE A;  1H6G A;  2AVK A;  4YK5 A;  3LJB A;  5KYU A;  1VLT A;  1D1B A;  4IAR A;  2R7S A;  3JT1 A;  3VF0 A;  4MVQ A;  3KYJ A;  3EGD B;  4EBB A;  5DLJ A;  1U6H A;  4BPM A;  2R7W A;  1YAR O;  1ZW2 A;  2H7B A;  2NUT B;  2PP4 A;  1EI7 A;  2J9B A;  3L8J A;  3MYI A;  3NYL A;  2EIN C;  3M4C A;  4LER A;  5CIV A;  1YZA A;  1U0B B;  2XLV A;  3DAG A;  2KW3 C;  4P9T A;  2VC9 A;  3GOD A;  2Y69 C;  1TR2 A;  2E87 A;  2NUP B;  2R03 A;  2WVN A;  4U5H A;  3RVZ A;  2CYD A;  3EHM A;  3LEV A;  1ZVZ A;  4LDQ A;  4KBL A;  3RIP A;  1XWJ A;  3DZA A;  3EH2 A;  3NMI A;  4MVS A;  3FVY A;  3WAQ A;  1QLE C;  1AUE A;  3DMD A;  3LNR A;  4U9E A;  5AGF A;  3V7O A;  4DRH B;  1T9K A;  1OXB A;  2J46 A;  2ZXW C;  3F47 A;  1Q0G A;  1IW7 F;  5FZT A;  2VAS A;  1GS9 A;  1LS4 A;  1D0X A;  4JUR I;  3RF3 A;  1E84 A;  1K40 A;  2W4M A;  1FFH A;  2L6F A;  3EH1 A;  1HE9 A;  3K1I C;  5A6B D;  2ICW G;  2XS8 A;  3BEH A;  2Q9A A;  4DRI B;  3NG1 A;  1VTM P;  256B A;  3NKE A;  2J9W A;  1YYJ A;  1WAS A;  1RCP A;  2LSE A;  3ZQV A;  4CS8 A;  3C8Z A;  3OEO A;  3ZG1 A;  4G7Z F;  1A41 A;  4Z9H A;  4OIP F;  2OU6 A;  4IAO A;  2A6H F;  2OCC C;  4WGY A;  4C7O B;  3EHN A;  3FDQ A;  1ZHT A;  2YRF A;  3S0X A;  2J0X A;  3B29 A;  3C8G A;  4N06 A;  3US6 A;  2XM4 A;  2IOQ A;  3M79 A;  3W8I A;  1EA8 A;  4DXW A;  3PDM P;  1T6I A;  4CIH A;  2OJE D;  3HJC A;  3IQC A;  2HSQ A;  4BG0 A;  2W4B A;  2OG2 A;  2M64 A;  4KC9 A;  3DAF A;  1HY5 A;  4EKW A;  1OW8 A;  1T6Q A;  1K04 A;  3LS1 A;  2XXA A;  2J9V A;  3DE9 A;  4MVR A;  5DVW A;  2HJM A;  3EG9 A;  3HKK A;  4CSA C;  2LK4 A;  2XLO A;  1ZYR F;  4DBQ A;  5HV9 A;  5B1B C;  1NSG B;  3JSZ A;  2XM0 A;  4P6I C;  1NLX A;  2DI3 A;  3EGX B;  2A0B A;  4E0H A;  4DRJ B;  4E18 A;  2PNO A;  4BJT A;  1VLS A;  1ZHZ A;  3T6G B;  5B3S C;  4O79 A;  2HUJ A;  3WHN A;  3QZC A;  1FNT c;  4R32 A;  3U3B A;  2XXA B;  4CIP A;  1LPE A;  1O5H A;  3O39 A;  3EG9 B;  1V4A A;  3H65 A;  5DQZ A;  4K1O A;  1D1C A;  2GA0 A;  3HNJ A;  4WGZ A;  3ASO C;  5IY5 C;  2IXM A;  3T9O A;  3L1M A;  3V5Y A;  4CJO A;  4IAQ A;  1L7C A;  4PFO A;  3G4Z A;  1MQV A;  1ZU5 A;  2HSB A;  1MMA A;  1ORJ A;  1RXQ A;  1VK5 A;  4O6N A;  2YWA A;  3ZTZ A;  1M2V B;  2LFF A;  1OW6 A;  3G4X A;  1JAF A;  1FR0 A;  2PBE A;  4I1M A;  1N1C A;  4IGG A;  3SZR A;  5A69 A;  2NPU A;  2ZD9 A;  1WAT A;  4U5B E;  3NMK A;  1WTY A;  1GM5 A;  3EZI A;  4EHP A;  1BR4 A;  2W45 A;  5EHH A;  5D91 A;  2P6V A;  4OIQ F;  4Z9J A;  3E70 C;  1JMW A;  4DVY P;  1NFN A;  2BE5 F;  4PR9 A;  2Q4F A;  3C8G D;  1NU7 D;  4I1O B;  3GEH A;  4BJ6 C;  3R2P A;  2YEV A;  4JJG A;  1FFT C;  2Y3G A;  1T5O A;  4CDA A;  3H2U A;  2EPK X;  1ZHW A;  1WGW A;  2R7Q A;  4JRZ A;  1I5N A;  2IXO A;  3E9V A;  2O9X A;  4K7B A;  4U5D E;  5A6K A;  1E2X A;  2W9Y A;  3EFO A;  3ASN C;  4N4W A;  2ASR A;  2MWQ A;  4P9F A;  4BJ6 A;  3S28 A;  4YT8 A;  3JYY A;  3LES A;  2R7T A;  2R7V A;  5T3W A;  3QW1 A;  2GDC A;  1OR2 A;  1ZHX A;  1ST6 A;  3QVY A;  1WN0 A;  2MHR A;  2HMQ A;  3GEE A;  2RD9 A;  4JKV A;  1YYX A;  5B1A C;  4CS9 A;  4Q7C A;  4XPW A;  2XL6 A;  4BJ5 C;  3EGD A;  4JZA A;  1D1A A;  2NSG A;  2WZF A;  1TKN A;  1RJ9 A;  2LIG A;  2L6H A;  3AG1 C;  2XLH A;  4XEK A;  1Q0M A;  1LVK A;  5D92 A;  2NUT A;  4OIN F;  3C63 A;  3UMH A;  3QW0 A;  3VYW A;  5L0F A;  1SR2 A;  1T01 A;  4NTB A;  1V74 B;  5E3C A;  2R02 A;  1SZI A;  3LLI A;  1SF8 A;  3T4R A;  2XSE A;  1CPR A;  3EZH A;  4FES A;  3UMK A;  4XTK A;  3T6B A;  3RW0 A;  1VOM A;  2IBF A; 
#chains in the Genus database with same CATH homology
 3DKA A;  5CIV A;  5COF A;  2QE9 A;  3CEX A;  2RD9 A;  2OU6 A;  3GOR A;  2QNL A;  2NSG A;  3QTH A;  5COG A;  2YQY A;  2F22 A;  2OQM A;  5COM A;  2HKV A;  1RXQ A;  4N6C A;  2P1A A;  3DI5 A;  2NSF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...