3B0PA

Trna-dihydrouridine synthase from thermus thermophilus
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
317
structure length
307
Chain Sequence
LDPRLSVAPMVDRTDRHFRFLVRQVSLGVRLYTEMTVDQAVLRGNRERLLAFRPEEHPIALQLAGSDPKSLAEAARIGEAFGYDEINLNLGCPSEKAQEGGYGACLLLDLARVREILKAMGEAVRVPVTVKMRLGLEGKETYRGLAQSVEAMAEAGVKVFVVHARSALIPPLRHDWVHRLKGDFPQLTFVTNGGIRSLEEALFHLKRVDGVMLGRAVYEDPFVLEEADRRVFGLPRRPSRLEVARRMRAYLEEEVLKGTPPWAVLRHMLNLFRGRPKGRLWRRLLSEGRSLQALDRALRLMEEEVGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA-dihydrouridine synthase
publication title Molecular basis of dihydrouridine formation on tRNA
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
total genus 116
structure length 307
sequence length 317
chains with identical sequence B
ec nomenclature ec 1.3.1.91: tRNA-dihydrouridine(20) synthase (NAD(P)(+)).
pdb deposition date 2011-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01207 Dus Dihydrouridine synthase (Dus)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1460 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3b0pA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3b0pA01
3W73A 4ZQPA 4AWUA 5K2ZA 1SSDA 5F2MA 2HSAA 3Q94A 5DXXA 2C15A 2J24A 4ZZ9A 1GG0A 4FX7A 1AL8A 3PUDA 2VFEA 1TPEA 2BWGA 4JTTA 3LDVA 3PWAA 1W0MA 4O50A 2IQTA 1RD5A 3BARA 1S5WA 4CCEA 1PVNA 3STGA 3W75A 2H8XA 3OHIA 1KFKA 4HSOA 3GIYA 2EAWA 4XTIA 4NJIA 5K4ZA 1H1YA 1VRDA 2R8WA 1XBXA 4TMCA 3C52A 3N14A 4OT7A 1L2UA 5EPDA 1O95A 1K7FA 5G1TA 2FPYA 5H91A 5F2IA 4Z0JA 3UPBA 3CM4A 3W71A 1IXPA 1HO1A 3W1RA 3UWWA 1ME9A 1GVQA 4H3DA 4XBKA 1WOBA 1KFCA 1SO6A 3O07A 3FEMA 4N2YA 1MEIA 1TV5A 1DVJA 3TIMA 4A22A 3WK0A 3QSRA 1O5KA 2D73A 3DZ1A 4JTIA 4O12A 4AH7A 3STFA 3KVMA 2YFOA 5EYWA 3O6CA 3U6WA 1B9BA 4JTEA 5K9DA 2P1FA 1DKWA 1SZFA 5FI8A 3B03A 4RX0A 4J9JA 1H5YA 5D03A 4XBSA 1H51A 2DZUA 2FPTA 2V81A 4TO8A 1GZGA 1VCFA 3PSWA 1RQBA 3GDMA 4FF7A 4QIUA 3T40A 2R91A 1G4EA 3LCIA 1F6PA 4LS0A 1PHQA 3R12A 2ISVA 1O60A 5I3JA 3ABRA 3P80A 1UUOA 3LOTA 3G22A 3L0GA 2Y7GA 3QPYA 3LHVA 1KM0A 1GQNA 3W7EA 4RZ4A 4RCXA 2RH9A 3QH2A 3TK7A 3UWYA 3M5ZA 2ZFAA 1J2WA 4LTSA 3M47A 4PTNA 3TW6A 4DF0A 3E12A 1ONRA 2GQAA 4JTFA 5SWUA 4ORMA 1SO4A 1TJPA 2CLMA 3S6DA 1OK6A 3T7VA 1KM3A 2V0TA 3BO9A 1SFLA 3B06A 2FB2A 3Q2DA 1LYXA 5K9XA 4N4PA 1KLYA 4JDYA 4UFHA 3TC6A 1K03A 5CPMA 3TJLA 1N7KA 4A29A 1GEQA 4YLWA 4E2BA 3N2MA 3ZS4A 4FIRA 1WAUA 3SGUA 5IM51 4DO6A 1L9WA 2VFGA 2QCDA 3MW7A 4JY9A 3F1QA 4R33A 3G24A 1H7WA 1OFRA 1G6CA 3HG3A 1OYBA 2Y61A 3F03K 4O1DA 3MBDA 1G7UA 3FS2A 2GOUA 3M9YA 5EMUA 5L9FA 1TTIA 4O57A 1YTEA 1XBYA 1TV8A 3A9IA 5KSWA 2E6YA 3NDOA 5HULA 1JCYA 1G7VA 3QW3A 3HPXA 3UD6A 3P61A 2AGKA 1IXNA 3IVSA 5LNWA 2X1RA 2XFWA 3W7PA 2WOQA 2YYUA 5AFDA 1DQWA 2ZTJA 2FTPA 3TNOA 4BI6A 4LWWA 1SUXA 3O1NA 2EF9A 1TRIA 2ZZ5A 4O1BA 4O19A 3A23A 1VYRA 4Z1AA 3W1UA 1PCKA 2YR1A 2RKXA 5F4XA 4YL2A 3TFCA 4I7UA 2V5BA 2GPTA 3EB2A 1W5PA 1RQEA 2NUXA 2E09A 4NNBA 3L67A 4UFLA 4H6KA 5DBUA 2Y63A 3UY7A 2OT1A 3DBPA 4WY0F 4JTHA 3CIXA 1QOPA 2ZBTA 3RFAA 4GBUA 4M6PA 1RVGA 5DCBA 2DU2A 4HKPA 3N2XA 3USBA 3VE7A 3CIWA 5D33A 2J9ZA 3TV8A 3UZ5A 1VH7A 1GTEA 3W76A 2LLEA 3GAKA 3F4NA 2NX1A 4IMFA 1HO4A 4XKYA 3W70A 3S1UA 3S5NA 3W87A 4HHPA 3PB2A 4IMGA 1O4UA 3W7MA 1EWDA 3G0UA 1KA9F 4N4QA 4M6VA 2E1DA 4O1CA 4JTSA 4YCOA 1Z42A 2C0AA 3UZJA 3NYZA 3O15A 1TSIA 4FIQA 4M19A 4AAJA 1LBFA 3T44A 2GVLA 1K7XA 1F76A 2E6FA 2WV8A 1ZAIA 5U7SA 1NEYA 4LV9A 5CPNA 3MP3A 5CPOA 5TBOA 1SZGA 1YPIA 1T96A 2Y89A 3FYPA 2ISWA 4UMCA 3EXRA 3QZEA 3TW7A 5BW6A 3T78A 1VYSX 4CQ8A 2C1HA 4RXFA 4DO5A 5K9CA 3V1PA 2TSYA 3CWOX 1GVSA 1VCVA 2VFIA 3TQVA 2DP3A 3NL6A 1I2QA 4MFEA 4FNUA 1G4PA 4IGHA 5LNUA 1E51A 5AHEA 3MJYA 1TRDA 3LCHA 3THQA 4DELA 4RJEA 1JQXA 1BEUA 3SGZA 3OIXA 3TFXA 4O8RA 3NPVA 2QDHA 2J6XA 2C16A 3UWZA 3MWAA 5K4XA 3GR7A 1VYPX 5GVJA 2JGYA 1F05A 1GVRA 4Y90A 5K3VA 3CC1A 3P74A 1QO2A 3KOFA 2RFGA 2FPVA 1HL2A 3O6YX 4JX6A 3MI2A 1EPXA 2HS6A 5LZLA 5F2LA 3N9SA 3G3MA 2EGZA 1L6YA 2QCEA 4O14A 5CSSA 4Q32A 1OYAA 3BLFA 4ONVA 1H7PA 2X1SA 3TMQA 4ICNA 2H6RA 3DENA 2YCEA 1YXDA 3GAYA 3IIVA 3SR7A 1DBTA 4LVDA 1S5TA 4UMBA 3P62A 1W1ZA 3W72A 3QW4B 1OFOA 3C0JA 5G1YA 1P0NA 3KVLA 2VEPA 1I2PA 5AHMA 1YYAA 1GJPA 1H62A 5BRBA 3LHWA 2RDWA 3GNDA 1VR6A 1SW3A 1LLZA 4L4MA 1W31A 2YFNA 5G2HA 4WJEA 1TJRA 4ADSA 2B7NA 1KM1A 1JCJA 3DFTA 2CLOA 3G1XA 3NQGA 3STCA 1EEPA 4WXYA 3THAA 4LRTA 4PH6A 4DF1A 5KZDA 4A21A 4GRSA 1TPFA 3UXDA 5D2XA 5G4WA 4MY1A 1MEHA 4P61A 3TXVA 3NQEA 2I9EA 4NQ1A 4Z0SA 2NLIA 1PS9A 3NZ1A 3N73A 3ABOA 2BXVA 3CB8A 4K36A 4Y9AA 3P7YA 3HG4A 4H4IA 2DZXA 1TTPA 4O11A 4QISA 4JTLA 1TCDA 3PAJA 3W2KA 2JK2A 2QCMA 3O16A 1W3IA 4GXMA 2BX7A 5FF0A 3C3NA 3DFOA 4IPJA 1FWNA 5IBXA 3R5EA 3ABSA 4OGZA 2NXGA 2NXIA 4OBTA 3DU0A 1SR9A 4A3UA 2Y7EA 1LRQA 4UXDA 3NQVA 2QCGA 1XXXA 1ICPA 4R53A 1M6JA 4ADTA 1EB3A 3PUOA 3C2RA 1QPQA 1OFAA 2CLFA 3CT7A 3PUEA 2DZWA 3UXAA 2VEKA 3TUUA 4FNTA 5D30A 4KFOA 4CCCA 3HO8A 1Z48A 1DJNA 4JIPA 3LBCA 4TX9A 1KBIA 1XDLA 2QAPA 3S1WA 3DI0A 4I7VA 1QMLA 4AXKA 4X22A 2O7SA 1A53A 4LVBA 6ALDA 4POCA 1MSSA 3UWUA 3M6YA 1RPXA 3W2LA 2WNZA 4O4VA 3BGGA 1ICSA 1DORA 3W1LA 4FB7A 2Y62A 4UTHA 3ATZA 2A21A 3TA6A 3W2UA 2CLEA 4IUOA 4PCFA 3B0PA 1LBMA 5AHNA 3PM6A 3W2JA 2Z6JA 3O06A 3EWYA 5G2WA 3NR0A 4JTKA 5L6UA 3UNDA 3C6CA 2ALDA 1QR7A 1XL9A 3UY8A 3R89A 5AHFA 3KVJA 1AW2A 2QCDB 2RDTA 2J88A 3I65A 3P67A 3UYCA 4JYEA 5F1VA 1LBLA 3B4UA 2XN0A 2GVGA 2NZLA 4MIMA 4N9EA 1TV7A 3W83A 2NWRA 4PL2A 1WYIA 3PSVA 4IMCA 3NQDA 3WJXA 1G69A 3UWQA 1JCMP 4HPXA 2VEMA 2BTMA 5HINA 4EVZA 1TPDA 3BW3A 1I2NA 1H60A 2DJLA 2QF7A 1JULA 2Z1BA 4JYDA 4IMEA 1LOSA 3NAVA 3LRLA 1A5SA 4LUJA 3RMJA 3L68A 2Q8LA 3PF3A 3A21A 3C4UA 4UIOA 2WKJA 2DZTA 5HQEA 1X6UA 3LXCA 2WJZA 4RV8A 1H1ZA 1ICQA 4C1KA 1TTJA 4QNWA 5CZTA 3LTSA 1SU5A 3DAQA 4RZ6A 4EOUA 3WJWA 3GKFA 1FWRA 3LTYA 5DY3A 1GG1A 4ORIA 1M7PA 1TQJA 4K6AA 4UTKA 2B0MA 4JEQA 4WOQA 5LNSA 3SZ8A 1UCWA 2GJLA 1F74A 4BR1A 2A2IA 3G1FA 1EP2A 3EWBX 2W0UA 3NL3A 2YGYA 2WSYA 3NQCA 1JCXA 2WSRA 3LHTA 3S5YA 4PFMA 4EF8A 1TPUA 4XKYB 1G4TA 3QRHA 3W7LA 3UPWA 1JRBA 3IIXA 2V82A 5CZJA 2C3ZA 5HUOA 4NU7A 2NWSA 3IV3A 5LHFA 1SQ7A 5LKYA 3G18A 4IXXA 4DXVA 2FDSA 1D9EA 5U4NA 3W7JA 4MOZA 1UJPA 1YADA 4JTJA 3CPRA 3RLUA 3DGRA 1FDYA 4X3ZA 1HUVA 4Z08A 2Y70A 4ML9A 1DL3A 1GVOA 4MPQA 3W9ZA 3QMTA 3ZR4A 2GQ8A 1VC4A 1ZALA 1GYLA 3W74A 1QDSA 4UC5A 1SO5A 4QQ3A 1B57A 3BW4A 3LI1A 2X1TA 3GDLA 3NO5A 5A5WA 1B4KA 4WOZA 3QEZA 3GDTA 2QCHA 3OVQA 4LRSA 4XTDA 2E6AA 1YXCA 5F4SA 3DKJA 3LXAA 4D2JA 3C2VA 3M0ZA 3SJ3A 2TYSA 5A8GA 5AN7A 4AWSA 3TH6A 3TJXA 1NSJA 3QQ0A 2Z0IA 2ZTKA 4KWWA 5FESA 3MYOA 3MHFA 4U28A 2G97A 3TE9A 3FIGA 2A1YA 3TKFA 1W5NA 2X16A 1GVFA 2NX9A 3W1AA 2YDAA 3NOEA 1ZAHA 3W84A 5D05A 3NM3A 1TPVA 4DQWA 1KBJA 1YXYA 3W85A 4E2DA 1RV8A 4NJGA 1VPXA 4NXSA 5C6MA 3QPZA 4MFDA 3CLMA 4G1KA 5LGXA 5CZSA 2NUYA 3QM3A 3SSJA 1H7OA 1UB3A 4DBEA 3KFTA 3C2OA 2V30A 1W3NA 1D3HA 3EKZA 3IIPA 3QFEA 1OJXA 2ZA1A 3GXNA 2VEIA 2B7OA 5HWJA 3TAKA 4CQAA 3HB9A 3HPSA 2GVJA 1XI3A 4OU1A 1GTHA 2ZDRA 5IBXC 3SW6A 3W1MA 3E96A 3HG2A 4HNTA 3AO0A 2ZCGA 5I3FA 3BGJA 3LCXA 1K3UA 1KTNA 5DBTA 4LC8A 2NV2A 2EHHA 3G0XA 3KX6A 3R8RA 1QFEA 2J9YA 5F4WA 3P8IA 1F7BA 5LSMA 2A4AA 2C13A 1FCQA 1NVMA 1GT8A 1KFEA 4GUGA 3EXSA 5HJLA 3VKJA 5HR6A 3CEPA 2KZHA 2QEZA 1T0OA 3B04A 2BZNA 3QJAA 1W5MA 3GK0A 1ZY9A 3DFPA 4NX5A 4ZQOA 4QITA 1K7EA 4IXHA 3ZFHA 2YPIA 5AC6A 5D04C 1K02A 2BSLA 3LCLA 4N9BA 3GYEA 1VQTA 2VENA 1VHNA 3C61A 3A22A 3TROA 2I1OA 3WJYA 3IGXA 2R94A 2FJKA 5I3GA 3WK2A 4NZJA 4ZQCA 5LHEA 3LRKA 1TB3A 1SO3A 4GE8A 5BOOA 2EPHA 3GXPA 3LLDA 1EX5A 1SZEA 3W7KA 3SIZA 5AOUA 1W8SA 2FLIA 1X7FA 4JX4A 4O1AA 4UTUA 2ATSA 2WNNA 1FWWA 5C55A 3A5FA 4S2BA 1AMKA 5D09A 1JUKA 1OX6A 3S5ZA 1FXPA 3EX1A 1KFBA 4IMDA 3G8RA 1KM4A 4PA8A 5KITA 3MP5A 1ZAJA 4OWGA 1FQ0A 1SW0A 1I2OA 3P5YA 5KINA 3G8EA 2AQWA 1UASA 3TSBA 1P4CA 3S42A 5TIMA 3FYOA 1HFBA 3W1PA 1X1ZA 1OFBA 3VI2A 3W7NA 3DHDA 2FQIA 1R2SA 3NM1A 1ZFJA 2E6DA 1L6WA 2O7QA 5FEXA 3LCFA 4GFSA 5KZEA 1KW1A 3M41A 3L9CA 2GQ9A 3ABQA 4O4WA 3KXQA 3FJ6A 4QSHA 3NZRA 4MZ8A 3I7QA 3T55A 3OA3A 4AHOA 5F2GA 3MUXA 1MEWA 4RK8A 2ZRWA 4ADUA 5CSRA 4UMAA 3TXZA 2V9DA 4P2VA 1LCOA 3S1XA 3EX2A 4UTLA 5DCEA 3IIZA 3QQ1A 3PBYA 4JICA 4LVAA 4M7TA 2A5HA 4MKNA 1U83A 3JS3A 1FUYA 2ZRZA 3NL5A 1SSGA 2Y6ZA 2G96A 4UNLA 2A85A 4O10A 1EP1A 3SECA 1AW1A 1PCWA 1TYGA 5H2ZA 1FX6A 1WX0A 3GDKA 1Z44A 4FNRA 4EF9A 4N9DA 1NF7A 1KM2A 5HWMA 3ZWSA 5AYYA 1FY6A 4AHQA 3U8GA 2ZZ3A 1OG0A 4UTTA 3NNTA 4AF0B 4O54A 5HWNA 2G5WA 4RLIA 1XUZA 2W6RA 3LRMA 1TPWA 3WJZA 3GB6A 2VKZG 3LTPA 3B0VC 3W7CA 2PRMA 3B05A 3TR2A 4DEFA 3MBFA 4O16A 3M5YA 1LORA 1F73A 1MZHA 1CW2A 4IWWA 1TPH1 3D0CA 1YDNA 3PG8A 4NNCA 2DZPA 3G1SA 1R46A 1TO3A 3H53A 4L4LA 1OFDA 5D2VA 2G95A 4FO4A 3PVFA 3DFQA 4NX0A 4PEKA 3LB0A 3MO7A 1LDCA 2PRHA 4K38A 3O6DA 1ZNNA 4IOTA 3W7OA 3RLVA 4Z1CA 2A0NA 1K8YA 3NL2A 4UFIA 3JRKA 4AVFA 1SFJA 2QJHA 2A7RA 1DQXA 2YSWA 2F84A 3W7DA 3C2FA 3B0UX 5KTLA 1A50A 4O53A 1V5XA 4PODA 4Y8FA 5E93A 1OF6A 3L65A 2VOMA 1OABA 1QOQA 2VFDA 4NNAA 1T99A 3W88A 2TRSA 3L5MA 5HNRA 1VGAA 3NPWA 4LVFA 4JGDA 1KV8A 1G4SA 1DJQA 3F4WA 2QCCA 1BTMA 4GUFA 2CZEA 4Q4KA 5EL1A 1H61A 2CWNA 5I3KA 1GOXA 1M5WA 1I2RA 2B4GA 3W7QA 3NQFA 2P0OA 1ME8A 3FOKA 3G1AA 3HG5A 3HPZA 2DZSA 4WUIA 4HT3A 2FFCA 3GXTA 1BWKA 4O0KA 1KM5A 8TIMA 2CZ5A 1AL7A 4MLJA 5KMYA 1W54A 2C14A 3BG3A 2YX0A 3A5VA 3BVJA 4KFNA 5TQLA 2QKFA 2Y88A 1FDJA 1KFLA 3TAOA 4MJZA 1WXJA 4DO4A 1P1XA 2ZRXA 5ABTA 4AWTA 3NQMA 3G1HA 2E5BA 4JYFA 4LW7A 4S2CA 3GNNA 1DHPA 1O5XA 3AJXA 1U5JA 3W7RA 4BK9A 5D2YA 1EIXA 4XQ6A 4HNNA 1T8XA 1PL9A 4MZ1A 1FWTA 2WPBA 3L5AA 4NUWA 2YZRA 4Q33A 1Z41A 2VC6A 4N9CA 1LOLA 3HQ1A 5CG7A 4HNUA 3EX3A 4WX2A 2V2DA 1OK4A 1OYCA 5DXYA 1LOQA 2UV8G 4LVGA 4WY0B 2ZZ4A 3W1NA 5C54A 5DN1A 4OHQA 2H3DA 3MHGA 2ABBA 4ZMGA 1H7RA 1WV2A 3DKLA 5AHIA 4LT9A 1K8ZA 4X9SA 4O18A 3FA5A 2Q8ZA 4GUIA 3TC7A 2V2HA 3P60A 1P0KA 1J4EA 3M1ZA 1EP3A 4LU0A 2FIQA 4CNOA 1ZHAA 3LHYA 2CLLA 1XBVA 4FX8A 3W7HA 1ME7A 3I6RA 5DLCA 1KM6A 2E68A 4A2RA 3SI9A 3KAOA 4WD0A 4YWIA 1Q6LA 4UTWA 1JUBA 4HNVA 4UUIA 3W23A 1QO5A 3CWNA 2Q3RA 4JNMA 4WXZA 3N19B 4AF0A 2GJNA 6TIMA 4TU1A 4UFMA 3M16A 4IJBA 2QCFA 3DXIA 4FX6M 1YLVA 2Z2UA 3WJSA 4RR4A 1SPQA 4DPQA 3FLUA 4BI5A 1XCFA 3NEVA 1LROA 1AG1O 3W22A 3DI1A 3NG3A 3NPUA 2JGQA 4WZHA 3OBKA 3M5VA 1W37A 3MI3A 3IIOA 2H3BA 3PS7A 1X1OA 2QDGA 3EXTA 4NXKA 3S9YA 3W6YA 3S0CA 4NJJA 2VELA 3TDFA 1JR1A 4CNPA 3TQKA 3PULA 3BV4A 3L0NA 4MLRA 4UR8A 3NVTA 1I4NA 1XKYA 2CLIA 3IVUA 3LLFA 4OQVA 1PV8A 3LM7A 4O15A 4AB4A 2XN1A 3N9RA 1SW7A 3CEUA 4N6EA 3CU2A 3W86A 3NXFA 4FXSA 1PHWA 3DFNA 2F7FA 3GX9A 4HN4A 1JQVA 3A24A 3W2MA 4IX2A 3WFAA 3PBVA 3M7WA 3ATYA 5AYXA 4BF9A 4BFAA 3STEA 2V2CA 1C9DA 2RDUA 1C8VA 5DCDA 1TPC1 3ELFA 4O28A 2JKEA 3U2OA 3Q58A 3RK8A 4NJHA 1K8XA 1GPWA 4MYXA 3CHVA 2YYTA 3PY2A 4UTMA 1EA0A 2PURA 4RXGA 5FF2A 4IX0A 4ALDA 4DBDA 4LNYA 1FDZA 3RU6A 4S1FA 1JCNA 1Q6RA 4GNJA 1F5ZA 4GC4A 1XBZA 5J5DA 1XC4A 2DORA 5BMWA 1ZCOA 3KRZA 5G5IA 4TR9A 1LTDA 3HOJA 3L0KA 4UTTC 2J9XA 4K37A 5FEZA 1OHLA 5BMXA 3EWXA 1FBAA 2QR6A 3QMRA 3BW2A 4JX5A 2NX3A 4YCPA 1S5VA 4GJ1A 2DJXA 2QCLA 5HR7A 4XZ9A 1R2TA 3I7RA 3HIJA 3LGEA 1B4EA 1EUAA 2WNQA 5G4EA 3HBLA 5T26A 3O8AA 3MHUA 4QAIA 4WY0A 2CU0A 2NV1A 1HG3A 2ZZ2A 1QPNA 2BLEA 4UTJA 4JR5A 2X1UA 1KTBA 2ISSA 2OMAA 3W1TA 4BWLA 3H55A 3P8JA 2V5LA 4AHPA 3NPXA 3W3OA 3KRUA 1VHCA 1W5OA 3PBWA 3IGUA 1L6SA 3GDRA 4FNPA 1LM1A 5EBUA 2ZRYA 5E1QA 3P5ZA 1A5AA 1I45A 3KRSA 3EWWA 4M5PA 1PE1A 3HGRA 1LRTA 3VFLA 3Q37A 4LC6A 3TX9A 5MHBA 2R14A 4QNEA 4E38A 3FJLA 3W07A 5DY2A 1JVNA 3C56A 3TSMA 4QM1A 1WQ5A 1BKSA 2VXNA 5HUPA 3G0SA 3NQ6A 1VCGA 2OCZA 3YPIA 1FCUA 3LHUA 4RZ5A 3PB0A 1XDMA 2A6NA 4K8EA 4MVAA 3BLIA 3EX6A 2ZA3A 2Y7FA 4GUHA 3VE9A 2W79A 4B5NA 3M44A 2E77A 3O63A 2J27A 2C19A 5D32A 1OFQA 3NQAA 1NF0A 3S5OA 4C1LA 4CCDA 1C29A 1IGSA 3PBUA 1OVDA 1Q6OA 4JIQA 4I7WA 1W3TA 3HGOA 1TIMA 3OVRA 2NXHA 3P82A 2CLKA 4M6QA 3DH7A 4O17A 5FF7A 2HS8A 2XN2A 3TMLA 1IIHA 4DF2A 4MUZA 2ZQ0A 4R7JA 3LCGA 4AMAA 1ADOA 2P10A 5G2IA 4K8HA 1W56A 3IVTA 1QNVA 3R13A 3DFSA 1GWJA 1TMHA 4IQLA 1EWEA 4FHAA 4N02A 4JXCA 4OV4A 4JY8A 2VFFA 3BG9A 4O52A 1DV7A 1B3OA 4CLMA 5FEPA 4X2RA 4QJ1A 4TMBA 1OX4B 3OVPA 4Y96A 3QYQA 1VZWA 1W5QA 1A5BA 2AAMA 3W7GA 2ZRUA 3UWVA 2PRLA 3LI0A 4LUIA 3HF3A 3I7SA 2Y7DA 5I3HA 3OG3A 1QWGA 3G3DA 1OF8A 5HMSA 3KVKA 4I9AA 4W9TA 1YTKA 3PR2A 4ZVJA 3MI6A 5AC7A 1HTIA 1R47A 4WQ6A 1VLWA 1LZOA 4JN6A 1WBHA 4NZFA 1Q3NA 4YXGA 1LP6A 3T4CA 1OFEA 3L5LA 4TIMA 4LV4A 5EY5A 5AHLA 1BWLA 2QUVA 4UTWC 1CX9A 3TU9A 1J5TA 1VJIA 5D38A 1Q45A 3CTLA 2B7QA 5EA9A 5I3IA 1JJKA 4BI7A 1VS1A 1YDOA 4HPJA 5CPLA 3RF9A 4E0CA 1QPOA 1XM3A 1FWSA 1XUUA 3HMJG 3HGSA 3INPA 4UFKA 1H50A 3MYPA 4YMZA 4JD4A 1O94A 2B7PA 2ATMA 4UTIA 3R2GA 3M5XA 4IPIA 3SFKA 3UQNA 2A7NA 3EX4A 3CQ0A 1AK5A 2H8ZA 2ZRVA 4Z1DA 5LNVA 1YPFA 1JRCA 3P81A 1LRNA 3JR2A 4KKXA 3DHFA 4Z1BA 1H63A 2C6QA 1MO0A 2WSQA 2C18A 2CZDA 1UBSA 3E49A 1R2RA 3QC3A 3O05A 4OE7A 1AW5A 2YW4A 1OX5A 3WK1A 4XWUA 2WQPA 1KTCA 3LX9A 5LNRA 4JTGA 4EIVA 1X8FA 4EWND 3LERA 1A5CA 4KFPA 4CQ9A 2HTMA 5E0KA 1FXQA 1R30A 3BG5A 1ML1A 3LCWA 4GWEA 2NUWA 2TMDA 4NT0A 5D2TA 3V75A 1IIGA 2QJGA 4O13A 1IXQA 1S3HA 5C5YA 4JDBA 1WOAA 2Q3OA 5AB3A 2Y85A 5D37A 1WBJA 1KLZA 4LS2A 1M7OA 4UFJA 1H7NA 2A7PA 3VCRA 1F2JA 3EKLA 5FF4A 3NQ2A 1KV5A 4K39A 2PE4A 1THFD 2PCQA 4MJMA 5C2XA 4K7VA 2CLHA 3E02A 7TIMA 1QCWA 2HMCA 2QUUA 1CI1A 1H7XA 1ZENA 4A2SA 5AC8A 2ZZ1A 3G1DA 5DELA 5AYZA 3B8DA 1EUNA 2CFFA 5BNKA 3KHJA 3EWZA 3E9AA 4U4MA 1TTQA 2QAFA 3HGJA 5F1UA 2JBMA 3IRDA 3PG9A 1Y0EA 1SZNA 5CZ0A 3GVGA 3H54A 3L21A 3GKAA 3C8FA 4Y6GA 4MY9A 3P84A 1YTDA 2YXGA 1G67A 3SY5A 3LV5A 2ZZ7A 5EKYA 5FEWA 1GYNA 2ZZ6A 4UR7A 1ZJIA 3RNDA 3EWUA 3NA8A 4ZQRA 3W1QA 2DZVA 4NJKA 3QSTA 4KWVA 3W2NA 4HIBA 4PC8A 1OX4A 3PC0A 4JTUA 1IXOA 1F6KA 3TCEA 4O0ZA 3E0IA 1QAPA 3S8HA 3MMTA 4MYAA 1UUMA 3FFSA 3FKKA 3W1XA 4K7YA 3LV6A 1QPRA 1Q6QA 1TREA 1NAL1 4FNQA 4BWLC 3ZWTA 1JCLA 3BK0A 1RZMA 2CW6A 3G1YA 3FKRA 3NQ7A 1JUEA 3BPWA 3S1VA 3LHZA 4PL1A 3GZ3A 2QJIA 3NQ8A 4M7SA 3TSDA 2OJPA 2ZA2A 4RKAA 1NFBA 2CZFA 2OT0A 3K30A 3GR8A 4N6FA 3GLCA 4R34A 3BLEA 1FCBA 3IGSA 1TQXA 4ZL1A 4FXRA 3MP4A 1LLWA 1WDWA 2X30A 4AEOA 2X2GA 1YDVA 4ZQNA 4LS1A 4MZYA 1V7YA 4GUJA 4CNNA 4FNSA 4LOCA 3HJZA 3L2IA 5LGZA 1MXSA 3I68A 1RQHA 2YW3A 2EKCA 5CKSA 1OFPA 3L66A 1PIIA 3VNDA 1RR2A 5FF3A 1FCVA 2QUTA 3QF0A 3N34A 4MY8A 2WO5A 5D2WA 2RHGA 4XUGA 1D3GA 4FEZA 5J5RA 4JS3A 2V8ZA 3NGJA 3ANYA 5K7JA 3EEGA 4UCGA 3C2EA 5KZMA 4HSNA 2I14A 4NVTA 1IF2A 1N55A 2ABAA 3G1VA 1N8FA 3OEXA 4OV9A 3W7IA 3M43A 1DOSA 3IEBA 1ALDA 2GUUA 5D02A 2JKPA 2Z6IA 2H90A 2VFHA 1TPB1 3LXBA 2FB3A 4UNKA 1KFJA 2OX1A 5CGQA 1WA3A 3LBMA 3TQ0A 3N3MA 4DPPA 4LY8A 2E5CA 2ZYFA 4ZQMA 2QCNA 2OZ0A 1XFBA 3QMSA 1VLIA 2TPSA 2PC4A 3WK3A 2JKAA 1I8JA 1P5BA 2A6LA 2E5DA
chains in the Genus database with same CATH superfamily
1UWSA 3W73A 5K2ZA 1J12A 4HN8A 3GHUA 3FJ4A 3UR3C 2D0HA 3BCFA 4ZBCA 3PWAA 1W0MA 4O50A 2YXXA 1QBAA 2VM8A 3POVA 2J7BA 2A68F 3W75A 3L0IA 3GH7A 1FWIC 4D6JA 1TZ7A 4OIOF 2JE8A 1RJQA 3CIVA 4GI9A 3TLQA 2PMQA 4XTIA 4ATLA 1EJSC 3LUTA 5K4ZA 1VRDA 1XBXA 1S39A 3H23A 4TMCA 3AJ7A 4OT7A 3QVYA 5EPDA 9RUBA 3UVIA 5ENLA 2R9RA 1W17A 4HA3A 5HK4A 1Q7QA 1KB3A 4ES4A 3UPBA 1IXPA 1JDEA 4M0XA 1W2VA 4H3DA 1KFCA 4F2TA 4D8LA 3QHOA 3FEMA 4N2YA 3UP8A 1MEIA 3M15A 4KI2A 3ARWA 3TLLA 2EKGA 4A22A 1O5KA 2D73A 3DZ1A 1UHVA 1CPQA 2WJDA 2GJXB 1M1BA 3O6CA 5EYWA 3U6WA 2FMNA 4B92A 3MU7A 4PBGA 4JTEA 2WHMA 1DKWA 3B03A 4PUNA 1NELA 1XJBA 5D03A 3GM1A 4E3VA 4P8UA 2IXMA 2DZUA 2WSKA 2FPTA 4OECA 1W9PA 1PZ1A 3B0YA 2WZHA 1IT7A 3T40A 1E9LA 1QKRA 3LCIA 4LS0A 4GYJA 4TX6A 1GJWA 3WQVA 2DGJA 1DOWA 3G22A 3WF2A 3WD3A 5KYYB 3C2YA 4XO7A 3WMCA 3LHVA 1ISVA 4DLFA 3N17A 3QH2A 1VPYA 4LTSA 2LP4A 3JYYA 5D9PA 3H2UA 3BAIA 4W7VA 2DT3A 2WKGA 3LBOA 3DYMA 3E12A 1ONRA 2GQAA 5SWUA 1R85A 2ZX7A 5GQBA 4DM2A 5I0DA 2FB2A 1LWHA 5E6ZA 4N4PA 1NP0A 1RSCA 1TA3B 1A7EA 4UFHA 4XPWA 3FVMA 2J0WA 4PMYA 2VB6A 4E2BA 1ADDA 4FIRA 1WAUA 3RPTA 3SGUA 3FNDA 5IM51 3CXOA 1HIZA 2XWDA 1W9DM 2E7FA 1W1PA 3G24A 5K0IA 3ZSUA 1OFRA 3HG3A 1TFKB 2Y61A 3F03K 1XLAA 3M0KA 3M9YA 5L9FA 1TTIA 4EXAA 3TONA 3ITXA 1D0ZA 2P3ZA 3NDOA 3AMDA 5HULA 5AKQA 3POHA 4QI0A 3HPXA 3UD6A 1IXNA 3KTCA 3DZAA 4FAPB 3W28A 5AFDA 3MKCA 4M24A 7PTDA 2VX7A 3TNOA 5XINA 3ANVA 4J2PA 1L0PA 1GONA 3PPFA 6XIAA 4DAFA 4O1BA 1R9XA 4TV5A 3A23A 2XIIA 1EJVC 3BC9A 4R7WA 2ACRA 1GEHA 2RKXA 2E4TA 2AL2A 2BVDA 1PEZA 3IQCA 4U5IA 4M80A 4HA0A 2X0CA 4YL2A 1RKCA 2V5BA 1ZRQA 1W1TA 1LQ0A 4NNBA 3L67A 3JU2A 3ARTA 4UFLA 2Y63A 2NG1A 2OT1A 4XLNF 3EFOB 5DS5A 1IWBA 2VT0A 1B3YA 4E4PA 4A2NB 4ZXOA 1E73M 6TAAA 2AMXA 4GBUA 1WTYA 4MTFA 4HKPA 3SN4A 3N2XA 3IANA 5BU9A 4L1WA 2EIMC 5JXQA 1VH7A 4XX6A 3E5BA 3W76A 3F4NA 1OCJA 3PJTA 2XIOA 1GOIA 4O1EA 3W87A 4JIRA 3TP4A 4HHPA 1KBBA 3TVAA 4HMEA 1JZ3A 3E0WA 4JKKA 3LGGA 4XZHA 3EGXB 2JIWA 2O9RA 2WJFA 2YDQA 4F40A 4EWJA 4L61A 3URNA 4N4QA 1FH9A 3SP1A 2E1DA 4AIBA 1PD1A 4JTSA 1V6VA 4IP7A 1MDLA 3UZJA 3CMFA 1A5KC 4PBEA 1TSIA 4PTVA 2YHSA 4AAJA 3NO1A 1LBFA 3T44A 2GVLA 1F76A 2VC7A 5BQHA 3KBMA 4LV9A 4IIFA 3ERPA 2O4MA 1QPUA 3T42A 4CNSA 4DBRA 2ISWA 4UMCA 1ZBVA 3POCA 1Z5ZA 3QZEA 3Q6MA 3VNJA 4XZBA 2C1HA 4RXFA 4MB5A 3V1PA 2TSYA 3CWOX 2VFIA 3PHF2 3TQVA 3CZLA 1G4PA 3KL5A 4IGHA 1E5JA 3BQ6A 5DRIA 1H4PA 1S1PA 3THQA 1LKXA 1JQXA 1KKOA 1OCQA 3OIXA 3NPVA 4PGLA 2J6XA 1BYAA 5M2FX 2C16A 2H9AA 2PAJA 4QLLA 4WGZA 5LA0A 3GDBA 5K4XA 5HBFA 2OOFA 5L0CA 2Y2WA 5GVJA 1YYJA 2QS8A 2W91A 3LPOA 4JCLA 1GVRA 1IZCA 3TJ5A 5KYWA 3F46A 3P74A 1QHPA 4P7NA 3KOFA 5FL1A 2FPVA 2A79A 4XG1A 3MI2A 2JFEX 2GLKA 2HS6A 4QSFA 1J6OA 4XAFA 2QPXA 2V67A 1AJ2A 3BLFA 4Y9OA 3TMQA 3CUXA 5HANA 1M56C 4AZIA 3VOGA 2V3DA 3AS0A 4FOJA 3GD6A 4UMBA 1UH4A 1UWRA 3P62A 1W1ZA 3VGBA 1B31A 3QW4B 1XRFA 1V51A 5G1YA 2VEPA 2F6KA 3A4XA 2OTDA 4YTSA 2BG5A 1YYAA 2LFFA 1M2VA 1VMAA 1J0ZA 3EDFA 3GNDA 4ZR8A 1VR6A 2GDCA 4L4MA 5G2HA 1LUCA 5BXRA 1TJRA 1JCJA 4KCUA 4GIRA 3DFTA 2CLOA 3G1XA 4PACA 5GPGB 2X1IA 4LRTA 3EOUA 5KZDA 3FGCA 5DMLA 3MZNA 3LUTB 2OU4A 3DESA 1HGYA 3UXDA 4ZOCA 1JPMA 4MY1A 2R9RB 5REQA 2ZC1A 3NQEA 4G56A 1AQ0A 5EFFA 4PBFA 1CEOA 1E15A 1SJCA 3CB8A 4K36A 3K4DA 1IEXA 1A41A 2DZXA 5EFDA 1K4HA 2INZA 4QISA 4JTLA 1TCDA 5EK0A 3QMKA 3W2KA 4O1FA 2QCMA 1W3IA 5DMMA 3F2DA 1F3TA 4Z17A 4S3CA 3H22A 3R7MA 4ML4A 1LT7A 1L8PA 4EPBC 1C8QA 3P6LA 2NVAA 4E6MA 2WNWA 2R7RA 4W84A 2EPNA 3NJ3A 5BYWA 4GJIA 3FX4A 5FKYA 1HJWA 4I90A 3F2BA 1M6JA 3I10A 3H70A 1KXQA 1OFAA 3WDJA 4GG9A 4NZ4A 4Q6XA 4W8LA 2ZE0A 2WKLA 5I79A 3LBCA 1XDLA 3DI0A 1QMLA 3WLPA 5A2BA 2ISFA 4LVBA 1JNEA 1V55C 2BOGX 4POCA 5PTDA 4TUFA 4JIHA 1O3UA 3WUGA 1RPXA 3W2LA 3V0SA 1XYAA 3GU2A 3QFWA 4CQCA 4E5TA 1RP9A 1GM5A 4J3UA 4IUOA 2ASRA 4ZEPA 3B0PA 2Z6JA 5H8UA 3O06A 4C5ZA 8RUCA 1XG3A 2ALDA 2IKIA 2VO5A 3IHUA 3R89A 5AHFA 3BANA 1XDJA 3RF3A 5IHSA 1WDPA 4JYEA 1IW7F 1LBLA 2XN0A 3OGVA 2JEPA 3NRHA 3H2VA 1MFUA 4J3ZA 1DJWA 3UNGC 4B16A 3W83A 1G5ZA 4IMCA 4ZGYA 3KOWA 1JCMP 4KRZA 1WPCA 4IB4A 3N12A 2BTMA 3J06A 4AISA 4EVZA 3BW3A 1JD7A 1H60A 3LMZA 2YB4A 1JULA 4J40A 4HK5A 4IMEA 2ACUA 4FMVA 1DTNA 3THCA 4UIOA 5T8GA 1LT8A 4RBNA 4F79A 1X6UA 2AL2B 4GXPA 4Q4ZF 4OIPF 1TTJA 3GNXA 4WK9A 5CZTA 3LTSA 4EOUA 3WF4A 4GYPC 4V1XA 3L34A 1FR0A 1OIFA 5C7VA 5DMYA 1TQJA 4K6AA 1UKOA 3WDHA 4UTKA 3CV6A 2EPMX 1Y7VA 3BQ5A 4DOZA 1UCWA 2GJLA 3K1IA 1NWSA 2A2IA 3NDYA 1EP2A 3EWBX 2W0UA 3AHTA 2YGYA 3RR4A 1JCXA 2WSRA 2A0UA 3LHTA 3S5YA 4PFMA 1NSGB 4A3HA 2B31A 4QGCA 1G4TA 2DDXA 3W7LA 4GVHA 4MB4A 1HW1A 1UH2A 4GO9A 5LHFA 4HBKA 4DX3A 1M2OA 1SQ7A 1NOFA 2E9BA 2IPGA 2AVKA 3CT2A 1YADA 1VRXA 4Q7BA 4PMNA 4PB3A 3DGRA 5HPCA 3LS0A 3AIEA 5I24A 5CBIA 4NAFA 4DWSA 1EQPA 3VKCA 3F5KA 1E56A 3D3FA 1LL6A 1TFOB 4ML9A 2BGNE 3G50A 1H9TA 5ECVA 3ZR4A 3W74A 1ZALA 4C6OA 1GYLA 2INEA 1SMAA 4UC5A 1SO5A 1ISWA 4PTWA 1B4KA 3E2QA 4F8XA 3I6TA 4OBRA 3OVQA 2XJ7A 4ZE5A 5A6BD 1H2JA 3M0IA 1YXCA 3OBEA 1MMGA 3C2VA 1BFNA 2TYSA 5A8GA 3SJ3A 4RD9A 3AICA 5CJMA 1BGAA 1CGUA 4KWWA 1A7DA 3SYNA 5FESA 3MHFA 2H9AB 2J7DA 2QJNA 2A1YA 1RXOB 4AE4A 1D1CA 2HNHA 2NX9A 1PAMA 2EIJC 4REQA 2YDAA 1BZ4A 4IQDA 1S2CA 2BVYA 1OXKA 4RZBA 4DQWA 5KYWB 1KBJA 4H9YA 3SB0A 4WABA 3H7UA 4GCAA 4PUEA 1VPXA 4NXSA 5C6MA 4FLSA 2ZADA 2ZUVA 4G1KA 1HY5A 5CZSA 1GGQA 2NUYA 3F4DA 1MW0A 2WL8A 1QJWA 3QM3A 3SSJA 1UB3A 4DBEA 5M17A 1D3HA 3OPSA 2ZICA 4KPLA 4J7YA 2IQ0A 3SBFA 2VR5A 1I4YA 3HB9A 4W87A 1SJBA 3M46A 2D1ZA 3BJSA 4OU1A 2ZDRA 5IFPA 1UIPA 3AO0A 2ZCGA 3BGJA 3EGDA 3LCXA 3CLWA 1V3HA 3GFZA 5BZAA 4LBSA 1EJRC 2YLLA 3G0XA 3DYPA 4IIHA 3JCUQ 4EANA 1M2VB 1S46A 4H8UA 2A4AA 4CD4A 3U4AA 3S84A 4LGXA 5CPTA 4GUGA 1LUCB 5HJLA 2OG2A 3LLXA 1HZYA 3T0TA 1T0OA 3PHAA 3QJAA 5A6AA 2CBJA 3DFPA 4JFUA 4M56A 4IQJA 2DUXA 3LEOA 3CB3A 4AY8A 4NF7A 3FGCB 1E6RA 3MFNA 3SUUA 1DJHA 5REQB 2BSLA 3APTA 3Q7LA 2VENA 4GIEA 4M8UA 4NZJA 1XZQA 3GUWA 3LRKA 4ZENA 4HMNA 4XAYA 2KX9A 4BG0A 3GW3A 4GE8A 3W00A 3OZYA 3WDRA 1U1HA 4AD5A 1OQFA 1X7FA 1JRAA 2HVMA 4RE0A 4UR9A 3WDQA 3EMZA 4E18A 4PTDA 4Z2HA 5HPOA 2XHYA 4D4NA 3F5LA 4Q4SA 3GANA 1AMKA 2L9JA 4ULWA 4PUUA 4EX4A 1AD4A 1EC8A 1QBBA 4FOUA 1EBGA 3S5ZA 5FA5A 4LEFA 3GM3A 3VU2A 1FXPA 3O3RA 3OTRA 3UU0A 1KFBA 1XRTA 4V1YA 3G8RA 4MJ4A 1QVXA 2Q71A 3K8KA 2ZXRA 3RPMA 4OWGA 3IK4A 1CXLA 2WM0A 2V3FA 1PZ2A 3DFYA 5HMEA 1UASA 1P4CA 1AUSL 3FYOA 2G62A 3W1PA 5EMJA 2RAGA 1R2SA 3VNYA 1ZFJA 2E6DA 4PK4A 3QR3A 2O7QA 1E2XA 5KZEA 4G8TA 2XGIA 1XG4A 3PJWA 3L9CA 3ABQA 4MKVA 4O4WA 3IV8A 3R25A 4GISA 4XWJA 3UG4A 3NZRA 4MZ8A 4HZ7A 1QHOA 2YA0A 3OA3A 1E0UA 1ZZPA 2DH3A 4QJ5B 4I44A 4ADUA 2FAPB 4AD3A 4B5TA 2HMQA 2R1LA 2I9UA 3S1XA 2FYMA 3APGA 3GG8A 4HHLA 3B8UA 5DCEA 3IIZA 3QQ1A 3VMPA 1EH9A 2YA1A 1DQUA 3N2TA 4HMDA 2X05A 4JICA 1YPXA 4MKNA 1U83A 4G9PA 3JS3A 5M5DA 4D8AA 1NFNA 2GSEA 2Y6ZA 2G96A 4O10A 4LALA 3C8GA 1TYGA 3VOFA 1WNOA 2NT0A 2OXNA 1WX0A 4FXJA 2OEXA 1UA3A 5T3WA 1RK5A 3ZWSA 2DUAA 4PCPA 1V3JA 5EBAA 1FY6A 4HJFA 4AZ7A 2Q3TA 2DSKA 1O68A 1I1WA 4AF0B 4J32B 4O54A 5HWNA 3K4AA 4KWSA 1XUZA 4MTVA 3WJZA 4FS9A 2NQ5A 2VKZG 1XSJA 2ZUSA 4NTAA 4RL3A 3VIIA 4WVXA 1I5NA 1HMOA 1WDDA 4J5NA 5KYNA 5IOBA 5CI9A 3N6HA 6REQA 3G1SA 2NSGA 1DOVA 2HUJA 4MQ9F 4FX5A 1TO3A 2Y0FA 2OGJA 1ONXA 3AG1C 4YL0A 5D2VA 2G95A 3LNPA 3PVFA 4JJFA 1TCMA 3DFQA 2DW6A 4PEKA 3TYEA 5T9CE 5AZ0A 1PDZA 3D47A 3OQ8A 4IF2A 2WVNA 3SJNA 5HNNA 1MFVA 3W7OA 4LAOA 1K8YA 2Y3DA 1SFJA 2QJHA 4JQ1A 2YSWA 3GIQA 3W7DA 4FA3A 1M03A 3C2FA 4Z2JA 3GEHA 4JQ3A 5KEZA 1ST6A 3LLKA 4Y8FA 3L65A 1QOQA 4NNAA 3GTXA 3KWSA 3OA1A 4LVFA 4QJ3B 3JTLO 1KV8A 1V0KA 3M07A 1FP8A 4Q4KA 1JI1A 1M68A 3AYSA 1KGWA 1V7AA 1G01A 1M5WA 3CYJA 3SUSA 4W8PA 3QBUA 3WQWA 4XD5A 1L8NA 1WDQA 2XGZA 4LAKA 1ME8A 5I23A 4UB9A 3G1AA 3EH1A 3HPZA 2A1DD 3H26A 2FFCA 4PMRA 2HE8A 3GZAA 3MUZ1 3C3UA 4CS8A 8TIMA 3B9EA 5KMYA 1W54A 1B0IA 2C14A 3MVIA 1OGGA 2J8WA 1T01A 3TAOA 4DZIA 2VZTA 3WQPA 4DO4A 1JR8A 1OZQA 2ZRXA 2H8AA 2G3FA 3VAVA 2GQ3A 2CLPA 1XIMA 1O5XA 3W7RA 5A6KA 1C7SA 3OG2A 4NAEB 5D2YA 7REQA 1EIXA 1IZJA 3RMEA 4OOUA 4UQAA 3TN6A 4MZ1A 4AE4B 1VLSA 1FWTA 1EGVA 2J8GA 7ODCA 4REQB 3WIJA 1Z41A 5CG7A 1VEOA 2OOGA 1OK4A 1OYCA 1LS4A 4CNTA 4LJ3A 3W1NA 5DN1A 3MHGA 4OKDA 4JFWA 2GGIA 2UWFA 4GLEA 5B3IA 5E3AA 1N8IA 2MWQA 4X9SA 3LGDA 3TC7A 3M1ZA 1TWDA 4O6YA 3V5ZA 5I2UA 4J1OA 3XIMA 1ZHAA 4GZEA 3LHYA 2PDGA 1XBVA 3M6DA 1HP4A 3R1ZA 3SNHA 1U5VA 3I6RA 3WQCA 5J8LA 3AMKA 2IPJA 2CCRA 5IY5C 4UUIA 1QO5A 3CWNA 1J8VA 4JNMA 4WXZA 4US5A 2GJNA 1REQA 3SN1A 4KERA 3E9VA 2GYIA 2D0GA 4GFIA 3WJSA 1NDZA 4RR4A 1PIGA 1XINA 3FLUA 5XIAA 1DEDA 3CZJA 4LUSB 2R1NA 3NZPA 2PDMA 3NEVA 1A3XA 2VCCA 1AG1O 5HJXA 3DI1A 3NG3A 3M5VA 1W37A 4PB4A 4AYGA 3KEHA 1KXHA 3VIMA 8XIAA 3PS7A 1JL8A 5DMNA 3MQTA 3ATPA 1QWKA 1D2KA 4ACYA 2YQYA 3GE7A 4I5UA 4C90A 1R5YA 1ITUA 2HJ3A 1JR1A 3TQKA 1FNTc 4UR8A 3WDPP 1I4NA 1ZB5A 4RNHA 2WMJA 3LLFA 5L0IA 1S2UA 2XRHA 5A8OA 1TR9A 2IS7A 4L6HA 4PRTA 2YZSA 5C9WA 4O15A 1ZBWA 3CWHA 4HNOA 2PDFA 3W86A 3PBMA 3NXFA 4W86A 4G7OF 1EJWC 1FHVA 3SN0A 1JDAA 4Z1YA 1MW1A 4HN4A 1EF2A 3W2MA 1PKYA 4EPEC 3WFAA 2G50A 5DT7A 5M03A 3ATYA 2AKZA 2AU5A 1UC5A 1Q63A 2XM2A 4O28A 3NVDA 2JKEA 3RK8A 1CNVA 3LQGA 4MYXA 4QCEA 2NV9A 2ON3A 4JQ2A 1O6IA 3UA4A 4DRSA 1GGOA 5FF2A 3W2WA 4X2PA 4LNYA 2XVPA 1ITQA 2FFIA 3LA4A 1Q6RA 2QV4A 1WP6A 3C63A 3E3HA 1P43A 4GC4A 4C6IA 1XBZA 4INFA 2DORA 4US5D 4RPQA 4BHYA 1XIJA 2BV9A 5F28E 3L0KA 5L3VA 1PYMA 1OHLA 1OZMA 2UY2A 3A3XA 3AISA 3QMRA 4DLMA 2J7PA 2VC5A 3BMXA 6ENLA 5HR7A 3QV8A 3HIJA 4AMCA 1CENA 3QTHA 1VPQA 3IK2A 6XIMA 1BTCA 3HBLA 2YLAA 1VBUA 2XIMA 2ZX5A 3U9JA 4U5FE 2D23A 4MDPA 4HTBA 2ISSA 3W1TA 1O7AA 4EWCA 1DJXA 4DVZA 4OZOA 1W5OA 3FXHA 4FNPA 3T1GA 4YHGA 1XIHA 1A5AA 1I45A 1WZAA 1TVPA 3PNZA 2BFGA 1JPDX 1KRCC 3HGRA 1EJXC 1PWMA 1LRTA 1LL4A 4NRRA 3SRKA 2RGMA 2YJQA 4NTFA 1XH1A 4E38A 2C1IA 1ZVZA 5LA1A 4JTAA 3W07A 5DY2A 1CPUA 4AX2A 3RUBL 1POJA 3HNIA 1BKSA 2QYGA 2VXNA 1J10A 5C9ZA 3DHUA 7XIMA 3YPIA 3COTA 4B6IA 3QY8A 2J7HA 2A6NA 2GDQA 3BLIA 1TWWA 4H54A 1QI5A 1PJ9A 2WZTA 1BKHA 3V0TA 2EILC 3M44A 2E77A 3L4TA 2A6EF 2B81A 2C19A 5D32A 4AD4A 3S5OA 3V3WA 1ZS2A 2W9MA 3IJQA 1LPEA 3TJIA 3QKZA 4URIA 2ZUMA 1PXGA 2HS8A 3VGDA 1CB2A 3KP1A 1IIHA 4DF2A 5E9AA 4MUZA 1Z8AA 4IPLA 1TZZA 4R7JA 3LCGA 4CD6A 4IFKA 2X42A 3UJEA 1MDRA 3IVTA 1V3IA 3R13A 1NFPA 3CUIA 4Y9MA 3ARYA 3DFSA 3VNIA 4IQLA 3HMCA 3FK4A 2VFFA 3BG9A 4CQDA 1DE5A 4O52A 4Y96A 3IQ5A 1B90A 4AVNA 4ICMA 1FWHC 2X41A 2AAMA 4W93A 3CAWA 2ZRUA 2PRLA 2Y24A 3MSRA 3RX3A 3OG3A 1E6SM 3KVKA 1YTKA 4Q8MA 3MCMA 5AC7A 1R47A 3L7RA 2DSWA 1KXVA 1QI2A 4JN6A 5F5HA 1FWEC 3G5EA 3MSGA 4J3TA 2PX3A 1LIHA 1DJZA 4EAMA 5I03A 3R7CA 3ZLHA 2QUVA 2QQ6A 4YTRA 3FXGA 1WASA 5D38A 1Q45A 2WSPA 1R87A 4BJTA 3AXXA 4HPJA 5CPLA 3RF9A 1XM3A 3HMJG 4UFKA 4H9XA 3UWEA 2HZ8A 2P7VA 3DAGA 4M63A 3UGOA 1O94A 4NZ3A 4NC3A 1XYLA 7REQB 2A7NA 4PRRA 3EX4A 4U10A 4UWMA 2J8TA 3B40A 3CQ0A 4HJWA 3AG2C 4GGBA 3DECA 4CJOA 1LG2A 4F0KA 2BOEX 1PCXA 1EDGA 3P81A 1LRNA 3JR2A 3R0KA 4DJ9A 1H63A 4GQQA 2C6QA 5COMA 4DRHB 4GQ0A 3VCNA 1FH7A 3U2LA 1W1A1 1RUSA 4ASTA 3QY6A 1OX5A 2R24A 1KTCA 4D6HA 3S5SA 3ZJ8A 1X8FA 1UKPA 4MVRA 2C03A 1DWFM 4KFPA 4XD4A 1PX4A 5E0KA 3WNOA 1R30A 4BQ3A 3AHYA 2Q4FA 2ZUUA 5CAHA 3F2CA 1MNSA 3AI0A 4LAMA 2FH6A 1XIDA 1R3QA 2QJGA 4O13A 3RJXA 1S3HA 1JXJA 4FAMA 4UDVA 4JDBA 1R6WA 1WOAA 1REQB 2DT2A 4U3AA 3MUCA 5AB3A 1HE1A 5D37A 2WB5A 3BLOA 2VGGA 2GZXA 2VCAA 1OGSA 4ZO6A 2UZ9A 3NDZA 2PCQA 3ZMRA 1V3MA 1KWKA 1QCWA 2D22A 1CI1A 4A2SA 5AC8A 3WUFA 1VK5A 3B8DA 1D1AA 3G6LA 256BA 2OEKA 3EWZA 3TN3A 2CHNA 2QAFA 2QULA 3HGJA 1OC5A 3PG9A 1Y0EA 3GKAA 1PKLA 3TOYA 4MY9A 3P84A 1G67A 2I7GA 4OINF 5EKYA 2J9BA 1MVYA 1GYNA 2ZZ6A 4Q8WA 4GVIA 4KEVA 3S2MA 3LZ3A 2DZVA 4S23A 3WNKA 3W2NA 3W8IA 4GNKB 1OX4A 3VD4A 4JC7A 3LNMA 4B4HA 3SRDA 3TCEA 4QE1A 4O0ZA 2ESCA 3MMTA 4MYAA 3FKKA 1PTGA 3W1XA 4S3JA 1YNYA 2J4GA 4HYVA 4BWLC 3EOEA 3ZWTA 1G4WR 5M1TA 3FKRA 3NQ7A 1JUEA 1AQFA 5AVNA 2CC0A 4PL1A 4JTRA 3GZ3A 4HQVA 3WBYA 3HZ3A 2OJPA 4BEJA 1R5ID 5L3QA 5GNZA 3GLCA 3BLEA 3IGSA 1TQXA 4FXRA 2WVQA 3MP4A 4G7FA 1WDWA 2LCHA 4AEOA 3P0XA 1SM9A 2X2GA 3HJCA 2FVKA 4ULVA 4YVPA 3HA1A 1LE2A 1HNYA 4HGXA 1V7YA 4WHBA 4GUJA 3ISIX 3N25A 3L2IA 1MXSA 3I68A 5CKSA 2YL0A 2IPWA 3R2PA 4IGSA 3QR0A 3SCVA 1BPLB 1PIIA 3VNDA 1RR2A 4W5UA 5FF3A 1O12A 2QUTA 2RDXA 3AU2A 3EWCA 4Q8PA 1R0MA 2WO5A 2PP0A 2RHGA 1BXNA 3TYUA 3VILA 4JS3A 1HL9A 4E0HA 2INFA 3AYVA 1Y6DA 4RDVA 4H8HA 5EGYA 4S3GA 4BZYA 1IF2A 1AFSA 3L2LA 1C3FA 2ABAA 4IPNB 3SADA 4OIQF 1MMAA 3KS5A 5D02A 2JKPA 3O39A 1QW7A 3KWXA 1ZJHA 1BVNP 5CGTA 3PUGA 2P8CA 4U5HA 4H6QA 1LWJA 5BOFA 4RDZA 2YLIA 2NSOA 1V03A 2VWTA 4Z2LA 3QZCA 1BXBA 1ZJAA 3P3BA 4FLOA 1SYQA 5LXXA 4ROPA 4JTAB 1K77A 4A3YA 2VEGA 3R10A 2GGGA 4GYTA 4QG8A 4ZQPA 2HSAA 5DXXA 4ZZ9A 1GG0A 1Q6EA 1HJSA 4FX7A 1AL8A 2QW5A 4JTTA 2BWGA 3WN6A 2PGRA 1K9DA 2IQTA 4F3HA 4MVSA 1PVNA 1V0NA 3AHZA 4DXXA 2H8XA 4DUXA 3AS3A 4JFTA 3SY1A 4F9DA 2GFHA 5TF0A 3WMSA 4NJIA 4A8NA 1H1YA 1E86A 2PBEA 3C52A 1BYBA 1ADSA 4O8AA 1O95A 5JH1A 1PKNA 2V69A 1AD1A 4K1OA 1FWBC 3CM4A 3W53A 3W1RA 3GORA 4M82A 2KGOA 3UMKA 2PDJA 4H9UA 3HV8A 3KZPA 1EXBA 4EPKA 1HW2A 1TWIA 1W9XA 3CBWA 2X40A 4IFKB 1DVJA 2F38A 4J4KA 3GNOA 2ZWZA 2VYOA 4D9PA 1BSIA 3QSRA 4O12A 3AUJA 3KVMA 2GL5A 3STFA 2V5CA 2I16A 5IXEA 2TMVP 3MWCA 2Y8KA 3UG3A 1GOMA 1XYBA 2OQLA 4PJNA 3UG5A 2P1FA 3SCOA 3L23A 3VOHA 1FWAC 5DLJA 1KRMA 1H51A 1EJTC 2V81A 4TO8A 2OKOA 1VCFA 3PSWA 3H6OA 3GDMA 1XIIA 3O10A 4F0RA 3A12A 4JAWA 3R12A 2ISVA 2PF4E 2FDMA 3BLLA 3P80A 1UUOA 3LOTA 4B2DD 3QPYA 2PF0A 3K8LA 3GTHA 3VGFA 3W7EA 4Q8TA 4RZ4A 1A3HA 3QXBA 4IP5A 2RH9A 3WQ4A 3M5ZA 2ZFAA 4YT4A 1PX8A 1ZW2A 3QYSA 3G4XA 1Z69A 3UG8A 1GW1A 3SAZA 4ORMA 4B5SA 1SO4A 4MW3A 3S6DA 2CLMA 3T7VA 2OWXA 5A8NA 5KYXA 3TTOA 3WLNA 3M0JA 3B06A 3OIHA 3Q2DA 5K9XA 2OJQA 1KLYA 3N2BA 3TC6A 3GVWA 1IQ8A 2QMKA 1RPKA 1MW2A 2Z2BA 4IFRA 9CGTA 4CVWA 3QY7A 4H2CA 4L6OA 3MW7A 4C3DA 2XXAB 3F1QA 1KTMA 1NOUA 2Z1WA 2XVKA 1VTMP 4F0SA 4O1DA 1FWJC 2A3LA 5JVLA 2ZUNA 3FS2A 4YTQA 1TV8A 3A9IA 5LYRA 2PCEA 2R7XA 1JCYA 2YCIX 3P61A 3RVYA 3ITOA 2AGKA 3IQ6A 3IVSA 5LNWA 2X1RA 3NTYA 4QE5A 3W7PA 2WOQA 1I1XA 2G4FA 4U5DE 2ZTJA 2FTPA 4BI6A 1SUXA 1OGBA 2YDSA 2EF9A 1VYRA 1B54A 4IAOA 3W1UA 1J79A 3UEQA 4WDXA 1XQKA 3GSMA 3GM8A 1IE7C 1LS1A 3TFCA 1W5PA 3K2GA 2VR4A 3PZMA 4GD0A 4E0IA 3PZTA 4IRUA 3QKEA 3IJ9A 3DBPA 2POTA 3DBNA 4JTHA 1TMQA 1XLKA 1S2TA 2HV7A 3L8IA 4JEJA 3RQGA 1RVGA 3ZLGA 3USBA 4GINA 3U48A 5D33A 3WQ6A 5CQ1A 2RJHA 2J9ZA 2Y3GA 3S1GA 2QIIA 1XLGA 1K4GA 3CPGA 1Q0FA 1Z6KA 4XKYA 4C6EA 1JD9A 1L2QA 2L6HA 3LNMB 1H41A 2QLAA 3NYMA 3REQA 1YARO 3VCCA 3G0UA 4WJ0A 1FAPB 4M6VA 4O1CA 3IGHX 4IJJA 2DSVA 4YCOA 1ORJA 4GI8A 4GABA 3QOKA 2DSZA 2OLSA 2CNWD 3AIQA 1CZ1A 4KEMA 3O15A 4FIQA 5XIMA 2PGWA 5U7SA 4Z9HA 2IXOA 1NEYA 1HJUA 4FK9A 4X0VA 3OZPA 3MP3A 1VFSA 5CH9A 3T9OA 2ZXDA 2XH2A 3EXRA 3T78A 4YJ5A 4JVSA 3WSUA 4DO5A 3EOOA 1UIOA 1G8XA 4LUYA 5JIPA 4LBUA 1VP5A 3MJYA 3WLHA 2IW0A 3CL7A 3CL8A 3N4EA 4AXNA 4YPJA 1QU4A 4QP0A 2CEQA 4B15A 4RJEA 5T9BG 1BEUA 4GY0A 4CU6A 3TFXA 3WQOA 2FHCA 2PBOA 3VPLA 2D69A 3AGTA 5FCZA 1VYPX 3AGUA 1F05A 2XSXA 1UD2A 1A7VA 4ZTXA 4Y90A 4W7UA 3CC1A 4ZO7A 1QO2A 1OT2A 1CLVA 2QLYA 3O6YX 1HL2A 4JX6A 1WXYA 4O0QA 3SQSA 4Y8EA 3MSDA 1AUEA 5LZLA 3N9SA 3G3MA 4I8YA 2EGZA 4QG9A 2WWCA 5BQGA 1ONWA 1P6BA 5CSSA 4ONVA 2X1SA 1H9GA 2GGEA 4YS1A 3N11A 2H6RA 3DENA 2QPUA 2VZVA 4B3LA 2OEMA 1S5TA 1XLBA 3B3DA 1E71M 3EEZA 3C0JA 3WLIA 1P0NA 4MWAE 1I2PA 1XYFA 4LERA 2IYLD 2PWHA 1GJPA 2Z26A 3UA3A 2XLVA 4F48A 2KQ9A 1Q7ZA 2RDWA 3Q65A 1ELSA 1SW3A 1LLZA 1W31A 2O55A 1FOBA 2YFNA 3RGTA 3ZG1A 1LE4A 4OVXA 4ADSA 2WBKA 1G94A 1U2YA 3BLPX 2G3IA 3NQGA 3QVQA 4WXYA 2A3BA 1LI5A 4JQAA 4LNCA 5G4WA 3PBGA 3GH5A 4PCNA 3TXVA 3W24A 2NLIA 2R7OA 4AZ6A 3NZ1A 3N73A 1YDIA 3DD7A 1ZGDA 4Y9AA 1N82A 1AH3A 3MV11 3DX5A 2JALA 2FJUB 1TTPA 3U57A 3LZ5A 4O11A 4LAZA 1T6UA 1RP8A 4DYEA 1Q2SA 2PA6A 3BMWA 2DIEA 4U5BE 4TX8A 3DFOA 3KP0A 1XWJA 1G5AA 3G77A 1FWNA 1TR2A 2VDIA 3R5EA 3PN8A 4OGZA 2NXIA 3V16A 1Z3IX 4LB4A 4IL2A 1LRQA 2J0XA 4JL1A 1XXXA 1YVIA 1ICPA 1RHCA 2HFIA 3QN3A 4S3AA 4QX4A 4ADTA 2M4EA 1JPHA 2CLFA 4XVEA 2DZWA 3TUUA 4FNTA 3AG4C 4KFOA 3H2MA 3RRAA 1JDFA 4CCCA 1JMWA 1Z48A 1W6TA 2XLDA 1FA2A 2VVNA 2ZXBA 4L9YA 1K6WA 5E2QA 4NI8A 4I7VA 3EPOA 4AXKA 1DHKA 1A53A 3WDIA 1BHGA 4GACA 3M6YA 2AGTA 4IHCA 3KUMA 3BGGA 1H0GA 4UTHA 2PWFA 2Q6ZA 5A8PA 4NL1A 3HKKA 4CVUA 1EOMA 2PC8A 2J46A 1E9ZB 2BY1A 1E84A 3FMSA 3WKZA 1OINA 2ZWYA 2IXUA 3O2LA 4W5ZA 1XPYA 1PYFA 5G2WA 4C6QA 4CQBA 2Z7GA 4PMJA 1HKJA 3GNRA 3C6CA 3UPMA 3KVJA 1AW2A 1WGWA 3H65A 2J88A 4PJMA 2VUYA 2P6VA 3P67A 4GO8A 2JEQA 1JF6A 2Q7RA 5D4YA 4DVOA 4BQ2A 2GVGA 2NZLA 2Q9BA 2J62A 1RCXB 4MIMA 1YBQA 3RFYA 1LF1A 4L7ZA 1WYIA 4PL2A 1MW3A 3PPCA 3ZJ7A 3VIOA 3R43A 3UWQA 3SCSA 4ZFCA 2VEMA 4HD5A 3RM9A 2AP3A 1KKRA 4QDWA 1R4TA 1NDVA 2DJLA 4IZGA 1QVBA 3EAUA 3WNNA 4RDYA 3TTSA 3LRLA 4GEHA 2NSFA 2CWXA 3RMJA 5JH2A 3L68A 4GI6A 2WKJA 2GVYA 3W8HA 3LXCA 4RV8A 2DYSC 1H1ZA 4QDMA 3T2PA 1EYEA 1Q2RA 1OW6A 3SO7A 2DW7A 4OD5A 3BSHA 4PZVA 4IP4A 3PJUA 1GG1A 4ORIA 1M7PA 2B0MA 4XZLX 4L80A 3UT0A 2W63A 5LNSA 1YZAA 4BF7A 3VDHA 3S46A 1BBHA 1FMVA 2GDVA 1Q85A 4EPDC 4WGYA 4LAUA 2WSYA 3UF9A 3PCVA 1Q8JA 2P76A 4MVZA 2CBIA 2ZXPA 2Z2AA 4XKYB 4XKMA 4DJEC 1FFQA 3VFCA 1DWJM 4B5WA 3OZOA 1JRBA 4Q4PA 3IIXA 2C3ZA 5HUOA 3N2OA 3IJDA 4NU7A 2NWSA 4ZSTA 2EIKC 1ZHTA 3UR5A 1XLDA 1D9EA 4JOMA 4M6UA 2IQDA 4MOZA 2VDGA 1L7CA 2XL6A 1XC6A 3RLUA 2CESA 1HF6A 4Z08A 3WAQA 3BE7A 1R3SA 1KCZA 5AZ1A 1DL3A 1GVOA 4PR4A 4ANJA 2GQ8A 1H1NA 3MUIA 3DWWA 1ISYA 2OSWA 4HOXA 5HMDA 5LIWX 1C7TA 3VO0A 4HFKB 3LI1A 2X1TA 3GDLA 1M41A 4XK2A 1K9EA 1S2VA 3MMWA 2QCHA 1IR2A 1QASA 2E6AA 5F4SA 4LLEA 1DYSA 3WF0A 2I5IA 4CIPA 3KBSA 1VFMA 1HP5A 3DOPA 3E74A 3QQ0A 2Z0IA 4AG0A 3FCPA 2Z1KA 3MYOA 3A4JA 3TE9A 4FLRA 1K1DA 3TKFA 2PDQA 3UJRA 1J18A 4MVQA 3W84A 1QSPA 1CWYA 4IJCA 3CQIA 2LSEA 1RV8A 3QPZA 1BG4A 2W4XA 5IFTA 1X7IA 5LGXA 1R9YA 5ABGA 1JAKA 4MB1A 2D3LA 3KFTA 3MY9A 3MCOA 3JZEA 1F6YA 4GMEA 3RO6A 1OJXA 2ZA1A 3GEEA 4CQAA 3OOQA 2XL8A 2GVJA 1MMFA 1W32A 2E87A 3VM5A 1UOZA 4EK7A 1ZP3A 2XVNA 1BD0A 3A4WA 3LEPA 3R11A 2YCLB 4C6CA 4PFPA 4HNTA 4PUWA 4UQCA 1OT1A 4S39A 1FFHA 4LC8A 1RY8A 1A49A 2EHHA 3W38A 4J7TA 3PAOA 1QFEA 1OW8A 2F22A 2J9YA 3ZR6A 5F4WA 3P8IA 2J6VA 1F7BA 5HNUA 3KCLA 3BH4A 3NDBB 1DPMA 3EXSA 3FOOA 1YHTA 2QEZA 2D3NA 3TZNA 2FH8A 3CZKA 3GNPA 2BZNA 2F9RA 3BAWA 3OEOA 1J0YA 1ZY9A 4ZQOA 4D6DA 1JPKA 4QITA 1CB7B 1K7EA 1OKKD 2PTXA 4GVGA 4IXHA 3B4YA 4I5RA 1RJPA 1B9ZA 5AC6A 3CZ6A 1K02A 5D8ZA 3I3EA 4AD1A 3C61A 3X1OA 3TROA 3JRMO 1BRLA 4HPNA 3WFLA 2C8NA 4F4BA 1XLEA 2BASA 1VD6A 3T0BA 2OKUA 1MUWA 4DB7A 1TB3A 3TOPA 4UZSA 1EX5A 1SZEA 3W7KA 3ANUA 4B5UA 4KIEA 4HYWA 4NP7A 2VZSA 2AL1A 4O1AA 3BOLA 2WHLA 2L6FA 4UTUA 2ATSA 4H9VA 3UJFA 1FWWA 1JGMA 3A5FA 1YIXA 4S2BA 5D09A 4UCFA 3GR4A 3HPAA 1OX6A 2ICWG 1NDYA 4MVOA 3BAYA 2NQHA 3EPMA 1QQ3A 4Q7CA 4P7OA 3UERA 4J3VA 3HPFA 5KITA 2IXPA 1FQ0A 3WD0A 4O6MA 1I2OA 3U9MA 3P5YA 4DY1A 2AQWA 4L64A 2XPKA 2XLWA 3S42A 4MB3A 4RUBA 5TIMA 1Q6FA 1HFBA 1X1ZA 3K1GA 4CNUA 3DHDA 1GVYA 2FQIA 3GC4A 5E9XA 1SMDA 1YX1A 1L6WA 1SJAA 5FEXA 4JTDA 4GFSA 3V7PA 1BVZA 4CDVA 3RM8A 2NSXA 2PSNA 4LCRA 3R94A 4AEEA 4DXKA 3ALFA 3NSMA 4HZMA 1QNOA 1GOOA 4Z9JA 3T55A 5F2GA 1MNZA 2PZ0A 4GC3A 4RK8A 5CSRA 2WZEA 3K1IC 4UMAA 5CAKA 4XAPA 4E7SA 2L81A 1X96A 2WVUA 3ZJKA 4D6EA 3W4YA 3AIRA 4JRZA 5IRPA 4ROQA 4UTLA 4MNMA 3KOXA 3T2OA 1Q66A 1YBQB 1FUYA 2ZRZA 5A6LA 1SSGA 1V93A 3HV9A 4WR3A 4UNLA 4X0NA 2ZXWC 3CAQA 1EP1A 1H49A 5F5FA 3SECA 2VR2A 1R7AA 3RLHA 5H2ZA 3RN6A 4E17A 3AROA 1KM2A 4ONSA 5AYYA 5BQIA 4DWSC 3U8GA 3ZDLA 3KCOA 4UTTA 2Z28A 4RLIA 2D2GA 3M64A 1OCNA 1YW1A 3C8ZA 2MHRA 1C9WA 3GB6A 1E6ZA 3DCPA 2PNOA 2AQOA 4O16A 3M5YA 1T8QA 3AQUA 1LORA 3MYIA 3VD5A 1CW2A 1VENA 3D0CA 1MYRA 3PG8A 4LUTA 2DZPA 4Z2GA 5RUBA 1P48A 4AW7A 1XGZA 3AIVA 2XH4A 1JZ5A 3U2EA 4H41A 2PRHA 3EWDA 4K38A 1JYNA 4GQGA 1ZNNA 4DUOA 1QATA 1UMLA 1CIUA 5HV9A 3TWAA 3NL2A 1UH3A 3JRKA 4AVFA 3JSZA 5CGMA 1QPKA 2ZX6A 4QDLA 1A50A 4O53A 1V5XA 3OHMB 5E93A 2QTVA 2VOMA 2VFDA 2EPOA 1TMLA 1T99A 4NCQA 1G4SA 1B30A 3F4WA 4C65A 4GUFA 1C8YA 5EL1A 4C91A 4H01A 1GOXA 4QI2A 1I2RA 3NWRA 2B4GA 3GHRA 3NQFA 1NWUA 2P0OA 5AYBA 1TIWA 3TD7A 4MWAC 3MLGA 4JHOA 1I4ZA 1X97A 4HT3A 2YL9A 1HKWA 3WFZA 3G6MA 1XGEA 3EHNA 3B9QA 4H9MA 5CI8A 1DWHM 1K8CA 2CZ5A 3BG3A 2YX0A 3A5VA 4GVFA 3BVJA 4KFNA 3K13A 4LDQA 3OODA 4Z9IA 1A5LC 3S90A 5COGA 1Q8AA 3ZVHB 5ABTA 1UR8A 3NQMA 4LYPA 3MDWA 1TUXA 5EMLA 3L4ZA 3DDMA 2CITA 1DHPA 2QUNA 1WZLA 1WOLA 2VRKA 3DUGA 1V4AA 4BK9A 1GKRA 2IUZA 4HB7A 2WC7A 1PL9A 1CPRA 3MYFA 3FAXA 1X1NA 1I0BA 4NUWA 1A0EA 4Q33A 3EZHA 3FY1A 4WX2A 1LOQA 3OZMA 4WY0B 3GTNA 4OHQA 3CAXA 3FVYA 1H7RA 1T7LA 1WV2A 4LT9A 3WD1A 3DERA 5E3CA 4ER9A 3MS8A 4O18A 1HJQA 2Q8ZA 4GUIA 4XPYA 1PO9A 3HNJA 3P60A 5CG0A 3BZJA 1EP3A 1IHIA 1SGJA 3ITLA 4CNOA 2KSFA 2XS8A 1V02A 1R9ZA 2CLLA 3DXJF 4FX8A 3EPVA 1ME7A 5BXPA 4L5ZA 2E68A 4Q8NA 4FXFA 4WD0A 1Q6LA 2PTWA 1UZHA 3W23A 1WAWA 2Q3RA 3TQOA 1EOKA 1M57C 2YEVA 3UXKA 2Q02A 4NZ1A 3TYCA 2QCFA 1YLVA 2Z2UA 1ZTVA 4QS6A 4DPQA 2J78A 2VGBA 4BI5A 1XCFA 3BAJA 1TJ1A 1JOGA 2REQA 1A5UA 5I00A 1LROA 3N13A 3L8JA 3EOLA 4MSSA 4IL0A 3NPUA 4TQTA 3MZ2A 1MMDA 3TQPA 4IIGA 2CXEA 1J0HA 3EXTA 4GIAA 4UQDA 8XIMA 1EBHA 3W6YA 2VELA 2VURA 4MLRA 3L0NA 1BRLB 1XKYA 4PMDA 3RHGA 4FPSA 4HHHA 1PV8A 1XYMA 4AD2A 2CKRA 1C8XA 1UWUA 4MUPA 5C71A 1WATA 2RD9A 1JPIA 3IAPA 4N6EA 3GFYA 1NU5A 1EA9C 2FTWA 4XAGA 3CH0A 1UP0A 3LEVA 1JQVA 4HU4A 3BICA 4EP8C 3STEA 2RDUA 5D9NA 4AU0A 5DCDA 1T9KA 1XIGA 3ASNC 3MDUA 1K8XA 2J7EA 3ABLC 4PMQA 1GOWA 4WJ8A 2FGBA 2Z24A 1UJQA 1XLMA 2PURA 4DBDA 3HURA 1MUMA 4OTKA 4GNJA 3ZC4A 5A2CA 4L4PA 5BMWA 2OVLA 4TR9A 3OBAA 1LTDA 3N2ZB 3HOJA 1XP3A 5BMXA 3AXIA 4JTDB 8CGTA 1FBAA 2QR6A 1UWIA 5LIUX 4KRUA 3FAPB 2QCLA 4DIAA 4XZ9A 3I7RA 3ENLA 2HVOA 3NMJA 3VAYA 1EUAA 2WNQA 4G6CA 3ZIBA 5T26A 2UUIA 1CXKA 4QAIA 4CS9A 2CU0A 1IR1A 3KTSA 2ZZ2A 4JCZA 2Z29A 2BLEA 1CXHA 4JR5A 5DANA 2E8ZA 4AHPA 2VX6A 3W3OA 3PBWA 3AXKA 3GDRA 3WNPA 3EBVA 5EBUA 2ZRYA 2W4BA 3P5ZA 1PE1A 3RX2A 3U9IA 1V77A 3VM7A 4LC6A 5A8QA 4QNEA 4G7ZF 2OJED 1E3XA 5E0FA 2VD8A 3MVTA 4C6JA 1SF8A 2OQYA 3C56A 1ITXA 3TSMA 3NIYA 2YOCA 3N4AA 2BB0A 2OOCA 5EU9A 3NQ6A 3L1MA 1KO0A 5HNTA 1BAGA 4EXQA 3KH2A 2RSEB 5B80A 4YYCA 1P0EA 1XDMA 3S27A 4K8EA 4MVAA 3D6NA 2ISDA 4C7DA 2ZA3A 3T81A 3TW9A 2EEXA 2W79A 1CGXA 3ONBA 3UXLA 2V5DA 2J9WA 5CC7A 4OJYA 4CD7A 2R7WA 1NF0A 3HN3A 1C29A 4J27A 3UNTA 4CS8C 1IGSA 4LUTB 3VABA 4JIQA 4DBUA 1W3TA 3L4XA 2PFDA 3OVRA 3GFXA 4HPGA 1E1CA 4M6QA 1AVAA 4O17A 5FF7A 1S38A 4MNJA 1GOQA 4Q4RA 2ZQ0A 1Q0KA 3NQBA 2QY9A 3FA3A 1GWJA 4HSHA 3C7JA 2IXNA 3NCOA 1B3OA 4CLMA 5FEPA 4X2RA 4PFHA 3QYQA 4CJGA 3WQ8A 4ZB2A 1A5BA 1K40A 3W7GA 2YA2A 3UWVA 1PD0A 1IEQA 3NGFA 4HCHA 1GORA 3HFTA 3MUAA 1QWGA 4G5DA 3G3DA 4JNZA 4KNVA 3VKKA 3VYLA 3KBVA 3MI6A 3OW1A 2BGSA 2O0TA 3S9ZA 1WBHA 1Q3NA 2Y8UA 1W1VA 1JXKA 3E0FA 2GAQA 3PFMA 2I17A 1V74B 3WEZA 4H7VA 3LK6A 4GJJA 3L5LA 3L4WA 4LV4A 5EY5A 3V36A 1E40A 4GA8A 1BWLA 3CUFA 3W37A 2P3EA 3TU9A 1ZSXA 4P8VA 2FKPA 1GZ1A 3BSGA 2QNLA 3R4IA 5HMFA 3SQLA 1VS1A 1QPOA 2V6AA 4LF1A 3HGSA 4B9ZA 2EPKX 1H50A 3MYPA 4YMZA 2WZMA 2YLDA 4OD4A 2ATMA 5DO8A 1YYXA 3WLSA 3UQNA 5JP7A 4HOWA 2LD6A 4ZB0A 4AIUA 3AYTA 4DJEA 2ZRVA 3WNLA 1OC6A 4GKTA 1NU9C 3VIFA 4F66A 5LNVA 4BEQA 2CW0F 3LPFA 1MO0A 3BWWA 2VQUA 5C8BB 1JPNA 1OR2A 1CYGA 4ZB5A 2WSQA 4NYYA 1R86A 2C18A 5I07A 1UBSA 3QC3A 1NQKA 5CEWA 3AZTA 2YW4A 3A9CA 3AAMA 1O5HA 2WQPA 3LX9A 4JTGA 4EIVA 4EWND 1US0A 3CPUA 4JZ5A 2HTMA 1DXEA 3T2QA 1ML1A 3G2GA 1EDTA 3LCWA 4Z42C 1XWYA 2J66A 1PB0A 4NY2A 4NT0A 3RLGA 1FHUA 2XZ7A 2R25A 3AZSA 3FA4A 3AU6A 5FJOA 2XLOA 1XRSA 5HDRA 1VEMA 1H7NA 1QI4A 3VCRA 1VYKA 5MKGA 4K39A 2GK1A 2PE4A 4D4XA 1THFD 3VDGA 3NKDA 1MQVA 2REQB 4LQ1A 2HMCA 2ZZ1A 3OO2A 4XZMX 4D6CA 5AYZA 3KHJA 3KW3A 3BTNA 3E9AA 1KCLA 3AYRA 1Z63A 2BBFA 3OP2A 2JBMA 2XWEA 1TZ9A 4PCSA 5CZ0A 4DJDA 2VDHA 1BXCA 1Y8BA 3H12A 3TYBA 3NO3A 2VMFA 2HVNA 3RNDA 3NA8A 3ZT6A 3N29A 4H2HA 4KWVA 4HCDA 5DX7A 2J7GA 4HU0A 4PC8A 1WDRA 3EQLF 1RLDA 1BLIA 1C92A 4FP1A 5GJPA 1GOKA 1E85A 4DJED 1Z23A 1QAPA 5GPRA 3S8HA 4RDAA 3FHDA 4KMQA 2CETA 2YXOA 5TD4A 3LV6A 1QPRA 1FVPA 4H4KC 1NAL1 4FNQA 2WM1A 1JCLA 1W9UA 2CW6A 1U6HA 3S1VA 1YKWA 3LHZA 4W8KA 4S38A 4LYQA 3TC3A 1JGIA 3NQ8A 3TSDA 2V63A 3DGBA 2ZA2A 4RKAA 2CZFA 3GR8A 4P8XA 2BY0A 2WQDA 1UD4A 3CHFA 1UUQA 4R34A 3S2JA 4TVDA 4CEUC 2PX0A 1J0IA 2CYDA 2CIPA 4NZCA 3KDOA 1M65A 3E70C 3UCDA 2QUPA 4CNNA 4XSLA 4HP5A 4FNSA 2WCSA 1XH0A 2X0HA 3CZ8A 4YU1A 2VUNA 4KF1A 2WHJA 4E8DA 4BJ5C 1JZ6A 2G3VA 1E6XM 2XH0A 3Q67A 2HEJA 2YL8A 1UA7A 1JZ4A 4DXWA 3QF0A 3GBEA 4NHVA 1RBLA 2BXZA 4XUGA 1D3GA 5J5RA 3V4BA 3WG7C 2V8ZA 5K7JA 3ANYA 3UYIA 1I9CB 3HM7A 3EEGA 3CZEA 4KH2A 5DFAA 4NVTA 4DWDA 3G1VA 4LCSA 1N8FA 4OV9A 3W7IA 1DOSA 2GUUA 4B91A 4MNDA 1XCXA 3BMVA 3DC0A 3KZSA 4DJDD 3AMGA 3I5QA 1UZDA 3LQLA 3VKDA 4XEVA 1YNPA 2YKZA 4XZIA 5HA7A 1VIWA 3LBMA 2HZGA 1ZHXA 4LY8A 4ZQMA 3QMSA 3KYIA 2TPSA 2JKAA 2OYMA 2PDCA 3U2MA 1TUFA 1GQKA 4XAZA 5AY7A 4AWUA 2LIGA 3B8WA 5F2MA 2C15A 2J24A 2X7VA 1LI7A 4KBLA 1AZ2A 1SJDA 3DJUB 3PUDA 2VFEA 4MG4A 3LDVA 2QHAA 4UQBA 1RD5A 3BARA 5DQTA 4NG3A 3STGA 4CCEA 5JMUA 1DXIA 4TVUA 1H7IA 4HSOA 4U2ZA 4U9DA 3UBPC 1D8CA 2NQZA 3GIYA 3NG1A 5JUAA 1UG6A 1V6TA 2R8WA 5I5RA 1L2UA 1K7FA 4YVVA 3CH9A 5H91A 5F2IA 1Q0MA 4Z0JA 3W71A 1E1CB 1HO1A 1ME9A 2FZBA 4XBKA 1WOBA 1SO6A 3O07A 4PSRA 2KW3C 2PP3A 5I7GA 1YQ2A 1CGYA 2XTKA 3T6BA 3ABXA 4F0HA 5CCZA 4U9EA 1RAKA 4WSKA 3VVGA 5A6JA 1XRVA 1HVQA 4JTIA 4AH7A 1TWSA 3VIGA 2YFOA 3QGKC 4JIOA 3VOCA 2W9YA 3ITGA 3ITTA 1ZW3A 3DC8A 1EQ1A 5CPSA 4PE8A 5FI8A 4RX0A 5JS5A 6PTDA 4CD8A 2HJPA 2FMOA 4XBSA 1U1UA 4FF7A 3V5FA 3EG9A 4U5EE 2BY2A 2ZDSA 3M7SA 2HSBA 1G4EA 1F6PA 1XPGA 1PHQA 5BRPA 5I3JA 4Q8OA 1C17M 1TWHA 1XSKA 1IEIA 3GXDA 4MDOA 3L0GA 3F7JA 1BVWA 3QOMA 4UNIA 3MKVA 3KOYA 3RKOF 3TK7A 4KRTA 1QUMA 4I9TA 4C6NA 1M9HA 1CGTA 3M47A 3SRHA 3FAWA 4DF0A 4JEBA 2ICSA 4GH3A 1FTXA 1OK6A 3UZXA 1KM3A 3W2VA 3BO9A 3WENA 3BGAA 1YRRA 2R7VA 3RQFA 4GGHA 2QDDA 2UY3A 1LYXA 2DQXA 3LM3A 2AMGA 1Q5MA 4ECLA 4JDYA 1PKMA 4Q4OA 1K03A 1N7KA 4A29A 1KBLA 4N7QA 1ZU4A 4W7WA 3ZS4A 2CZVA 3QTPA 2OYKA 2VWSA 1M6TA 4DO6A 1TFVA 1GQLA 2F6UA 4M51A 5G4HC 1OYBA 2Z1XA 3PTMA 4AYSA 4AZBA 3M0XA 2QDEA 2FZ8A 1HE9A 1UKQA 2YL6A 1XBYA 4PCTA 1G7VA 4JCHA 3OLGA 3QW3A 2NUPA 3K66A 3PWIA 1YEYA 4DHGA 5C9RA 2XFWA 3S4TA 3ARUA 4MWAA 5I78A 3A6OA 1J8MF 1VF8A 3P14A 4JKMA 3VIPA 2FGLA 1TRIA 2ZZ5A 4O19A 2Y5EA 4Z1AA 4JIIX 3IJ8A 1PCKA 3K33A 2KYHA 5F4XA 3OA5A 2VVSA 1AA1B 4WKFA 3RITA 1B68A 1US3A 1Q4NX 4I7UA 3UMHA 4DWSD 4PTMA 1ONEA 1G1YA 2E09A 2P50A 2OR2A 3PZOA 4H7CA 3UY7A 1Q6GA 2YZ5A 4WY0F 3DHPA 2VRJA 3CIXA 4MAVA 1QOPA 2ZBTA 3RFAA 1QW9A 4M6PA 5DCBA 2VD9A 3VE7A 3N9KA 1UKTA 3CIWA 4C7OA 3DEQA 3JW7A 1ECQA 4J3XA 1JPJA 2J74A 2FZNA 3TV8A 3UZ5A 3AHXA 3C0QA 2LLEA 4IMFA 3W70A 3S1UA 4KNWA 1QHZA 4IMGA 1VBGA 3UGPA 2YCKX 3RAOA 3VMOA 2FZ9A 3JYHA 5H1WA 1KA9F 1UR9A 1KFWA 3PWGA 1EX1A 3E5PA 1Y5WA 2PB1A 3T0AA 1UR1A 1RJRA 3NYZA 2OZ3A 2BL2A 2WV8A 2E6FA 2ETSA 3T0CA