3B0PA

Trna-dihydrouridine synthase from thermus thermophilus
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
317
structure length
307
Chain Sequence
LDPRLSVAPMVDRTDRHFRFLVRQVSLGVRLYTEMTVDQAVLRGNRERLLAFRPEEHPIALQLAGSDPKSLAEAARIGEAFGYDEINLNLGCPSEKAQEGGYGACLLLDLARVREILKAMGEAVRVPVTVKMRLGLEGKETYRGLAQSVEAMAEAGVKVFVVHARSALIPPLRHDWVHRLKGDFPQLTFVTNGGIRSLEEALFHLKRVDGVMLGRAVYEDPFVLEEADRRVFGLPRRPSRLEVARRMRAYLEEEVLKGTPPWAVLRHMLNLFRGRPKGRLWRRLLSEGRSLQALDRALRLMEEEVGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA-dihydrouridine synthase
publication title Molecular basis of dihydrouridine formation on tRNA
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
total genus 116
structure length 307
sequence length 317
chains with identical sequence B
ec nomenclature ec 1.3.1.91: tRNA-dihydrouridine(20) synthase (NAD(P)(+)).
pdb deposition date 2011-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01207 Dus Dihydrouridine synthase (Dus)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1460 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3b0pA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3b0pA01
1W1ZA 1W5PA 5D33A 1W5QA 3R13A 1Q3NA 3IGSA 1ZALA 3HJZA 3W1AA 2Y61A 1VS1A 4I7WA 2IQTA 5KZEA 2TRSA 1TCDA 3CIXA 3CB8A 5IBXC 5TBOA 3LOTA 3NQFA 3SI9A 2QCCA 4HHPA 4IPJA 5ABTA 3W7HA 4BWLA 5EBUA 4XZ9A 3UWQA 3DI1A 1SQ7A 1TIMA 5F4XA 5HUOA 3GDLA 2VFEA 4CNOA 3UPWA 2J9ZA 3FFSA 4IMEA 5D2VA 2ZZ6A 2OMAA 4FIQA 4O4WA 3L65A 3FOKA 2BZNA 1WOBA 4IJBA 4O16A 5GVJA 5F2IA 4MFEA 3W7LA 3CU2A 4G1KA 2QCDA 3T7VA 4LVBA 4JR5A 1TRDA 4O53A 5AFDA 3C3NA 3CIWA 1KM4A 1QPRA 1XL9A 3TIMA 1NEYA 3LCLA 2RDWA 1QOPA 5HR7A 2QF7A 3H55A 4RZ6A 1OFPA 2RHGA 2R94A 1XDMA 3TCEA 3W2UA 1DJQA 3BG3A 5HWJA 3INPA 2I14A 1UUMA 3W71A 1YDOA 3OBKA 2NWSA 1KLZA 2CLFA 3VKJA 4FB7A 3BARA 1WOAA 1GVSA 1VYSX 1GOXA 1IIGA 4C1KA 2QCFA 3MW7A 2V0TA 3NOEA 1TPDA 3NM3A 1XFBA 3LERA 1DVJA 3E9AA 1JUKA 1RV8A 4IX2A 5BNKA 4LWWA 4QITA 5HULA 4A22A 2CLLA 3N34A 5A5WA 5LZLA 2OT0A 4O0KA 1GYLA 3TNOA 1H62A 3EXRA 1W5MA 3W1PA 3LX9A 4QIUA 1KLYA 3GXTA 3BVJA 1BKSA 5K9DA 2J9YA 1K8ZA 2QCMA 2YX0A 3N73A 1VLWA 4PTNA 4AWSA 4ALDA 4FHAA 7TIMA 4N9CA 1ZAHA 1A5SA 4GUJA 1FDYA 3B0PA 3NR0A 5BOOA 4GJ1A 1EWDA 5KITA 1YDNA 2B4GA 1HG3A 4MLRA 3LCFA 1KTBA 2FIQA 3TSMA 1SW3A 5CSRA 3L68A 3MHGA 4Z1CA 4ZQMA 2DZPA 3LRKA 3EX6A 4DEFA 2RDUA 2FPYA 4A2RA 3LCGA 3W7DA 1PHWA 3NQ8A 1LORA 1YXDA 2YXGA 3EX3A 4FXSA 4DO5A 4N9DA 3NQ7A 3A21A 3LHZA 4CQ8A 3GK0A 2VC6A 2UV8G 4RKAA 2YW4A 2CWNA 3HGRA 4L4MA 3QYQA 5CZTA 2BSLA 3NQVA 1OK4A 1X8FA 2PRHA 2Y70A 3FA5A 2YFOA 3WJWA 3LV6A 5AC8A 1PCKA 2CZEA 3VE9A 2J24A 1YADA 4KFPA 1TTPA 4UFKA 3O15A 4A21A 4QQ3A 2VEPA 3RF9A 3O1NA 4IOTA 4DBEA 4DXVA 1SW0A 3C4UA 4JICA 2ZDRA 1F7BA 2ALDA 5DN1A 1P0NA 3UWUA 3EWBX 3KVMA 5AC6A 3Q58A 4ICNA 4IXXA 1C8VA 2KZHA 3BLIA 2DU2A 1XBYA 3G0XA 3C0JA 1XI3A 2A85A 1NVMA 4O10A 3F4WA 1IF2A 3BGJA 4GUHA 2CFFA 2A4AA 3F03K 4LV4A 2TPSA 2QDGA 3NM1A 4JS3A 4TR9A 2NV2A 2Z0IA 5CG7A 3R89A 1DORA 1JUEA 2WQPA 3CEUA 3M5XA 1JCJA 1Z44A 4E38A 3M6YA 2B7PA 1TPEA 3P61A 1K02A 1L2UA 3ATYA 4HSOA 5EL1A 2GQ9A 1AL7A 3TJXA 1LTDA 2FB2A 3B06A 5AHEA 1A5BA 5C55A 5F2MA 1W0MA 5U4NA 5D2WA 2Y7DA 1YLVA 1S5VA 3STEA 1H7XA 4GWEA 2B7NA 1QDSA 1B3OA 1T8XA 1W54A 4O8RA 5FF4A 5KSWA 1KTCA 1YDVA 4DELA 1OF6A 4NZJA 2PRLA 2WSQA 1GT8A 3G1FA 1K7FA 4NX0A 1EUNA 1KM6A 3W7OA 1R2TA 3N2MA 1PL9A 1JCNA 3NQ6A 4DPQA 1DV7A 2A6NA 4HT3A 3MMTA 4IPIA 3TQVA 4GBUA 3WJXA 2QR6A 4NU7A 4JTFA 1A50A 4HKPA 1G69A 1LCOA 3BPWA 4U28A 1SSDA 4RLIA 1UJPA 4NUWA 3EKLA 4R53A 3GDKA 3ABRA 4N02A 2FPTA 4GXMA 2DJLA 1JCYA 3A5VA 2Y7FA 2Y63A 3IVTA 4TO8A 4I7UA 4YL2A 3W1MA 3VE7A 3W83A 4UFIA 4NX5A 3E96A 3F1QA 1LOLA 3CEPA 5LSMA 1OYCA 3S1WA 4LUIA 2YR1A 3JRKA 3T55A 4ONVA 1LBFA 4CCCA 2DZTA 3TX9A 4YCPA 3RMJA 3DFTA 1SUXA 2A7PA 4PH6A 3W76A 3HIJA 4QAIA 1G6CA 3TSBA 3L0NA 5AYXA 4XWUA 1OFEA 2RFGA 3DFPA 4JN6A 3DXIA 3N2XA 1VZWA 4HNTA 3PBVA 5G2WA 4Y9AA 1AW2A 4K7YA 4TMBA 1R47A 1F6PA 1KM2A 3UYCA 4FNPA 1I45A 2E5DA 4K8HA 1DL3A 3KVKA 5HQEA 3GX9A 1G7UA 1KV8A 3KHJA 3TE9A 4MYXA 3C8FA 1H63A 3TUUA 2ATSA 2Y62A 5J5DA 2V2DA 1I4NA 4JTKA 3W07A 1LROA 5LGZA 1W3NA 5C2XA 4CLMA 5EPDA 1TPB1 3LHTA 3JS3A 3KRZA 2ISVA 4UR8A 4AAJA 1DQXA 1VCGA 3LRLA 5F4SA 4POCA 2A5HA 3MI3A 1J2WA 4O0ZA 1B4EA 4OHQA 3O07A 5C54A 2H8ZA 1T99A 4O52A 3FS2A 4EOUA 2EHHA 2RDTA 4UNKA 1HO1A 4OV9A 2C13A 1LDCA 1MZHA 1OFOA 1NFBA 2W0UA 3FJ6A 3G18A 3QSRA 3UXAA 3KRSA 4O54A 3SSJA 5LKYA 3IEBA 1QMLA 2ZTJA 1I2NA 4H4IA 1NF7A 1ONRA 1R2RA 3DU0A 1KFKA 5L9FA 4LS1A 3PM6A 4IMFA 3NPVA 2BXVA 4FXRA 3UXDA 4RX0A 3NQDA 4O57A 4CCDA 4GRSA 3TA6A 2VKZG 4O28A 3S0CA 1L6WA 1FXQA 5K4ZA 3SGUA 3QH2A 3FYPA 3R5EA 1RQBA 1EP2A 2W79A 4JIPA 2C16A 2ZBTA 1AL8A 2EAWA 3W85A 1THFD 3GNNA 5DCDA 3ZWTA 4OT7A 4UIOA 4WX2A 1BTMA 3ZS4A 3TMQA 1AK5A 1QNVA 4E2BA 3L9CA 3TSDA 5E93A 4BI7A 2GJNA 3W70A 3H54A 5LGXA 5FEXA 4PL2A 3PS7A 3QW4B 1JCXA 1PHQA 3B04A 2HSAA 3PF3A 1HFBA 4WJEA 1H1ZA 1V7YA 1XXXA 4ADSA 3DKJA 1HO4A 5D04C 3ANYA 4HPJA 5C6MA 3SGZA 3C6CA 1RQHA 1ZAIA 3SFKA 3L5AA 3LCXA 3EB2A 3E02A 5HWNA 2XN0A 3O05A 2Z6JA 1ZENA 1VH7A 3C2OA 1GWJA 3W7PA 2E1DA 4NVTA 3DFSA 2WNZA 2A6LA 4NJHA 4LRTA 4MKNA 2FDSA 3PUOA 3VCRA 3QMSA 4I7VA 2QUVA 5D37A 3Q37A 3G1SA 4Z1BA 4UMCA 4NT0A 1XBXA 3NPUA 5LNUA 1EP3A 3C61A 3MYPA 4IXHA 5BMWA 1YTKA 2Y85A 3A22A 5EYWA 4RZ4A 3BW3A 2E6FA 2ZTKA 3DKLA 5AHNA 3F4NA 3E0IA 2R8WA 3PR2A 2PRMA 3HOJA 1FCUA 2AGKA 4K37A 1OX6A 3UY7A 3PUEA 2BTMA 3TR2A 4MPQA 1W37A 2BX7A 3QPYA 1IXNA 3GAYA 1LRQA 4OU1A 3SR7A 4Y6GA 1EUAA 1TPH1 4Y8FA 5HNRA 1ICPA 2WPBA 3W75A 4Z1AA 4MZYA 1V5XA 3QPZA 3KVLA 3WFAA 4CCEA 3PWAA 1Z48A 4N9EA 3M1ZA 1MSSA 3FYOA 1GVQA 1PE1A 4KKXA 3W23A 4UFHA 2QCDB 4IUOA 1LOSA 4JY8A 1VQTA 4IMDA 2FTPA 3M44A 5IM51 1XKYA 4GUFA 1X6UA 2QCEA 3O06A 1VYRA 4UTWA 3BO9A 5CKSA 3DAQA 3NQGA 4GC4A 1ZAJA 1W3IA 4HPXA 1CI1A 2DP3A 4UTMA 4A29A 5FF0A 4DPPA 4LVAA 4LVDA 5BW6A 2V82A 1KFBA 3THQA 3FKRA 4N6EA 4WY0F 5I3IA 5H2ZA 4ADTA 3LTYA 2Z2UA 1B9BA 4JIQA 4M6VA 4K36A 2Y7GA 4UTUA 3GXNA 4HNVA 2QCGA 4J9JA 1FWWA 2E77A 4QJ1A 3W74A 5AHFA 4QNWA 1W31A 1TV5A 2VEMA 3GDMA 4N9BA 4JD4A 2GJLA 3TAKA 4LS0A 3ABSA 4D2JA 1FWSA 4XBSA 3SECA 3M7WA 1W5OA 3L2IA 3IIPA 1Q6LA 1EP1A 2FFCA 2E6YA 2QCHA 4AHPA 5BMXA 4S1FA 1X7FA 2GVLA 1QFEA 3LHYA 1JJKA 4UTIA 3A23A 1KM5A 3B4UA 1OF8A 1B57A 4Z0JA 4O18A 4WZHA 3C52A 1QR7A 3O63A 1KM1A 3P5YA 4WUIA 3S5ZA 3A24A 3PB2A 1P1XA 1JRBA 1H7RA 4ADUA 2V5BA 3UWYA 2BWGA 5D30A 4DF0A 4MJZA 3W7KA 3CT7A 1XBVA 2XFWA 2YGYA 3W1NA 1VLIA 1H51A 4GE8A 1QAPA 2CLIA 2ZZ3A 3TFCA 1LLWA 1GPWA 3S9YA 5CSSA 4DQWA 3G1VA 5DCBA 2OT1A 1P4CA 3NQCA 5CPLA 3LB0A 2NXHA 3VFLA 1I2PA 2C14A 3V1PA 3G1YA 3SZ8A 3THAA 1SZGA 2F84A 1SO5A 2I9EA 4PFMA 4ZMGA 4M6QA 4K38A 1Q45A 1VR6A 4JYEA 5T26A 3R8RA 4RZ5A 1YXYA 3L66A 1R30A 4NQ1A 3WK3A 4ZQRA 3W1XA 1FWTA 1JVNA 1S3HA 3GR8A 4U4MA 3AO0A 4UUIA 4UTKA 5EKYA 1TPUA 5L6UA 4BWLC 3S5NA 1YTDA 5AYYA 1VRDA 4JX6A 5TIMA 1H7NA 5LHEA 3WJYA 4MJMA 3GNDA 4O50A 5DXXA 4UFJA 2ZFAA 3P80A 2E5BA 2ABAA 1O94A 1QO2A 4EF9A 2PCQA 2QCLA 3LHVA 1OFBA 4AWTA 3MO7A 3KXQA 4I9AA 2ZZ4A 2ZYFA 1H1YA 1K7EA 3ABQA 3I6RA 4CQ9A 1F2JA 2EPHA 3BW2A 5CZJA 3W72A 1X1ZA 4L4LA 3EWWA 2VENA 3A9IA 1JULA 5SWUA 1OFRA 3W1TA 1W8SA 3W2LA 4HNUA 3ZFHA 2QEZA 5AYZA 4UC5A 1WDWA 3S1XA 3TC6A 3PUDA 3W7NA 3SJ3A 2VXNA 3GAKA 4JTSA 1TO3A 1YTEA 5HMSA 1SZFA 4B5NA 4UTHA 1F5ZA 4LS2A 2WOQA 1ZY9A 3PB0A 4EIVA 3I68A 5F2LA 1KBJA 1SU5A 2CZFA 3HG2A 3NL6A 5U7SA 5HR6A 2V8ZA 3NAVA 3G0UA 3R12A 2VFGA 2CLMA 3U2OA 5AHLA 4KFOA 2OCZA 1MEWA 5E0KA 1M7OA 4E2DA 2NX3A 2I1OA 1A5CA 1ICQA 1VYPX 1OYAA 1OJXA 3CPRA 3TKFA 5DLCA 5AB3A 5FI8A 3IGXA 1TQJA 3CTLA 3KVJA 2NZLA 2CLHA 1OYBA 4IX0A 2Q8LA 1QPQA 2TMDA 4AHQA 2E6AA 3EXTA 1T0OA 3N14A 3MBFA 2DZSA 3LLDA 1O60A 2PE4A 2H6RA 5D03A 2HMCA 3G1XA 5D09A 3LDVA 2NWRA 3GYEA 1SW7A 4LU0A 1JQXA 5FF2A 3TC7A 2H90A 3LBMA 3DZ1A 5CZ0A 1IGSA 3NXFA 3RLUA 3HG3A 1FDJA 3QF0A 3HPZA 1J4EA 1WXJA 3S1UA 4BR1A 4R33A 1UBSA 4JTLA 3ATZA 4IWWA 2OX1A 1TJPA 1OG0A 3G0SA 4LNYA 1L6SA 3EXSA 3L0KA 4LVFA 3CC1A 3TW6A 3MUXA 5K2ZA 1M5WA 3PC0A 2Y6ZA 4M19A 1D9EA 2O7SA 2FLIA 4O12A 3QMRA 4N6FA 1NAL1 4YLWA 2ZRVA 2V5LA 4ZL1A 2ZA2A 2O7QA 2AQWA 1MO0A 3FIGA 2FPVA 1IXPA 4XTIA 3GVGA 4WD0A 1A53A 5BRBA 1D3HA 1GVOA 1W3TA 4LTSA 3G3MA 1VCVA 4JTTA 5LNWA 3MYOA 2QUUA 3W2NA 4TIMA 1VHCA 1RVGA 2X2GA 5G4WA 3QMTA 1IXQA 1H7WA 4LC8A 4OE7A 2GPTA 1TREA 2B7QA 1TV8A 4K6AA 5HINA 4ZQPA 4NJJA 1MEIA 3IGUA 4X9SA 1ME9A 3EX2A 1N8FA 5FEZA 3TQKA 4DO4A 4MUZA 4UMAA 2WSYA 3LBCA 3O6DA 5I3KA 4RJEA 4K7VA 4LY8A 4QM1A 3LXBA 3G1AA 2VOMA 3EWYA 1VHNA 1NSJA 4Q4KA 3FKKA 5LHFA 2VEKA 2YDAA 3M5YA 1FDZA 4O1AA 3I7QA 4P61A 2G96A 2D73A 2QJIA 4JTEA 4DF1A 3P8JA 1AMKA 1EX5A 4OWGA 4NJGA 3GKFA 4LT9A 3M5VA 1XDLA 2WNQA 2TSYA 1ZFJA 3FJLA 3W86A 2H8XA 5DBTA 4FX8A 2X1UA 1XUZA 1H61A 1XC4A 2P1FA 1PCWA 2WV8A 1SO4A 3ZR4A 4JXCA 4M5PA 3PSVA 3QW3A 2VFFA 2J88A 3LLFA 4PL1A 4JX5A 4HN4A 1TPWA 2YW3A 3QQ0A 4DBDA 4WOZA 3P8IA 1EIXA 3K30A 4X22A 3M43A 3QM3A 2CW6A 1SZNA 4GNJA 3DHFA 1JR1A 3WJZA 2YZRA 2G5WA 1OHLA 1UUOA 4MLJA 3W7CA 4N4QA 2Y88A 1NF0A 1O5KA 1GZGA 2NXIA 1TYGA 2ZZ1A 3MJYA 4AEOA 4QSHA 2QKFA 4MIMA 4HIBA 1UCWA 4JY9A 3W1QA 3GXPA 3HB9A 2V2CA 5D38A 1JCLA 3LGEA 5KMYA 3QSTA 3PBUA 1ZHAA 1AW1A 1JRCA 1G7VA 1M7PA 4FIRA 5HJLA 1G4SA 3P60A 3OG3A 4XKYB 3T40A 3HQ1A 4XUGA 4O13A 1U83A 2G97A 2ZRXA 3H53A 4BK9A 3N9RA 1KFLA 3C2EA 4NXSA 4UTJA 3BG5A 3TXZA 3TDFA 2ZQ0A 4EWND 2VELA 4FO4A 2OZ0A 1OK6A 1AW5A 1WQ5A 4GUIA 3Q2DA 3G1DA 1OX5A 2X30A 1RD5A 4TX9A 1FY6A 2QJHA 3G3DA 3MI2A 4UXDA 5AN7A 3E49A 3NVTA 3PVFA 2DZUA 2GVGA 3QQ1A 3OVQA 3MHFA 1ZJIA 3LHWA 2E09A 5I3JA 3DI0A 1M6JA 2WNNA 5DELA 5IBXA 4XKYA 1TJRA 2B7OA 4AXKA 1UB3A 1WBHA 3EWXA 1ML1A 4FNRA 2X1TA 4IGHA 1KV5A 2E68A 3CHVA 4LUJA 4JEQA 5FF7A 1VJIA 2PC4A 2PURA 3HO8A 4JYDA 3W1LA 4UR7A 2WSRA 1JQVA 1YXCA 3DFOA 3LM7A 2J6XA 3RK8A 1TV7A 2ZZ7A 1O95A 1SZEA 4EF8A 1FWRA 2NUXA 3O6CA 5EY5A 1KFCA 1TTQA 5LNSA 1Y0EA 2GVJA 3AJXA 5I3HA 3NEVA 3NPXA 1LYXA 4CQAA 4O19A 2NUYA 3MBDA 5A8GA 4ORIA 1K7XA 2QCNA 4HSNA 3EX4A 4O4VA 1VCFA 3LCWA 3QEZA 3O8AA 3P84A 2RKXA 3JR2A 3PULA 2V81A 1LLZA 1QO5A 4NJKA 5DY2A 2QDHA 3USBA 5CGQA 5G4EA 3UQNA 4MZ8A 4O17A 3L5MA 2ISSA 1GG0A 5C5YA 1H7OA 4YWIA 3TQ0A 3OEXA 3WK2A 3U8GA 4WY0B 4K39A 2DZWA 4NXKA 2FQIA 2ATMA 3TJLA 2V2HA 4N2YA 3KOFA 3TMLA 1G4TA 3W7EA 2Y89A 3HPXA 4FX6M 2YYTA 4X2RA 1GVRA 3ABOA 3N19B 3G8RA 3P74A 4ZQOA 3Q94A 3IIZA 3P82A 1N55A 3PAJA 3BLFA 3T44A 4BF9A 2YYUA 3W87A 1WYIA 3C56A 1E51A 4MOZA 1VGAA 3NQAA 3NQMA 3TFXA 1K03A 1KBIA 3IIVA 1I2RA 4JGDA 1DKWA 3P81A 4YMZA 1I2OA 4AF0B 3DGRA 4H3DA 2YFNA 4OBTA 2CZDA 2VFHA 4M7SA 4UFMA 3TXVA 3D0CA 3QC3A 2DZXA 2A0NA 1QPOA 4WY0A 4WXZA 1J5TA 5F4WA 2C0AA 3SIZA 3S1VA 2NV1A 3S6DA 5D02A 3G22A 2NX1A 3C2FA 3LHUA 1H60A 2ABBA 1W56A 4O11A 2HTMA 2JBMA 3NO5A 4DF2A 3UPBA 3CQ0A 4XTDA 2CLKA 3PBWA 5K4XA 3LI0A 3UWVA 5DY3A 5D2XA 2C15A 5HWMA 2A2IA 2VFDA 5LNRA 3NG3A 3GZ3A 1PS9A 5AHMA 2DZVA 3NNTA 4Y90A 4FNQA 3DH7A 2J9XA 4AF0A 1QPNA 1LRNA 2HS8A 1LBMA 1YPFA 4JDYA 5G5IA 4WXYA 1ADOA 1R2SA 5EMUA 3MP3A 3GKAA 5FEPA 3KX6A 1F76A 1P0KA 3LCHA 1RPXA 2FJKA 4O14A 1KTNA 3LXAA 3FEMA 4KWWA 5E1QA 2GOUA 4WQ6A 4UNLA 2A1YA 4AWUA 3NL5A 4UTWC 1CW2A 3NDOA 3DFNA 5D2TA 1DBTA 4OV4A 5G2HA 3LTPA 3STCA 3HGJA 1W5NA 1RR2A 2JK2A 1L9WA 3MI6A 3W2JA 1LRTA 1S5TA 3DFQA 1WX0A 3NQEA 5J5RA 1EPXA 1GTEA 2QJGA 5I3FA 2QAFA 2ZA1A 2Z1BA 4NNAA 4C1LA 3G1HA 4OQVA 1SFLA 3UNDA 2Q3OA 4CNNA 5AOUA 2GUUA 1OFQA 4MY1A 3UZJA 4MZ1A 3O16A 1PIIA 3R2GA 2H3BA 4R34A 2WKJA 2BLEA 1DJNA 1FQ0A 2CU0A 1ZCOA 2A21A 3LI1A 4MFDA 2C19A 1DQWA 3QFEA 4ZQNA 2NUWA 4CNPA 4Q33A 2RH9A 4FNTA 2GQ8A 4M6PA 1FCVA 5AC7A 5KTLA 3IRDA 4EVZA 2GQAA 4Y96A 4W9TA 3W7RA 1X1OA 4LC6A 5AHIA 3NGJA 2QAPA 4AVFA 4Q32A 1C9DA 4LRSA 3W22A 1GEQA 1GYNA 3MHUA 1SSGA 1TTJA 3KFTA 2JKPA 3QRHA 2EGZA 1G4EA 2ZZ5A 3BLEA 2E5CA 4ORMA 5FF3A 3IV3A 3GR7A 1OABA 5KZDA 1GVFA 4AB4A 3HG4A 4ZZ9A 1CX9A 1D3GA 5DCEA 3O6YX 2J27A 3STGA 1TQXA 3BGGA 3C2VA 1IIHA 4PEKA 3GDTA 2NLIA 3W2KA 4GUGA 1WV2A 3VI2A 3B8DA 3PSWA 4M7TA 1RQEA 1HUVA 4RV8A 3WJSA 1WAUA 2R91A 3NA8A 4IQLA 5F2GA 2ISWA 3OA3A 1N7KA 1A5AA 2YPIA 4UMBA 3S8HA 2OJPA 2ZCGA 3HF3A 3TH6A 3M0ZA 3IVUA 2QUTA 4Z0SA 1YYAA 3PBYA 1BWLA 3N9SA 3QJAA 3S5OA 3BG9A 1L6YA 1AG1O 1F6KA 3CLMA 3EWUA 2CLEA 3W7GA 1MXSA 3MP5A 3P62A 2CLOA 2A7NA 4Z1DA 3TV8A 1T96A 2V30A 1VPXA 4RCXA 5EA9A 2P0OA 3NYZA 4JYFA 4BFAA 1RZMA 2ZA3A 3BV4A 1BWKA 1U5JA 4MVAA 5FEWA 3E12A 1F74A 4NZFA 4JNMA 2HS6A 4YCOA 6ALDA 4JTIA 1XCFA 4PA8A 2W6RA 2P10A 3A5FA 5K3VA 1SR9A 1WA3A 1EWEA 4WOQA 4LW7A 1FWNA 3L67A 1EA0A 3LRMA 3IVSA 1P5BA 5K9XA 1TB3A 4JDBA 1SO6A 2Q3RA 3L0GA 5G2IA 1QOQA 1GJPA 1TPC1 3DBPA 1Z42A 3UY8A 3GIYA 4NJIA 1KM3A 3W88A 1QCWA 5F1VA 1LBLA 4JTHA 5TQLA 4BI6A 3B05A 1FUYA 3W7QA 3UZ5A 5CPNA 3DENA 4HNNA 5HUPA 3RLVA 3TROA 4YXGA 3OVPA 4JX4A 1HL2A 1XUUA 4FNUA 3LCIA 2ZRZA 3I7SA 3I65A 3S42A 1DOSA 2LLEA 2XN1A 2WJZA 2X16A 4RK8A 3I7RA 3STFA 3MWAA 2JGYA 5DXYA 5I3GA 3UWZA 4UCGA 4KWVA 4MY9A 3WK1A 3M41A 2G95A 1FX6A 1I2QA 3KAOA 1YPIA 5G1TA 1OX4B 4UTLA 1Q6QA 4RXGA 1BEUA 3MP4A 4O15A 3UD6A 2A7RA 1KFJA 5CPOA 2CZ5A 5DBUA 1G67A 5D2YA 3KRUA 1OFDA 1GQNA 1LOQA 2WO5A 1FXPA 1EEPA 3WK0A 1QWGA 1SO3A 5D32A 4AHOA 2C1HA 4S2BA 1K8YA 4O1DA 1HTIA 1XM3A 1DHPA 2AAMA 4N4PA 3RNDA 4UTTA 1SFJA 4PODA 2F7FA 1GG1A 4NNCA 5KZMA 3YPIA 1PV8A 1ZNNA 3GLCA 4RR4A 3HBLA 2Z6IA 4X3ZA 1ME7A 3RU6A 4ZQCA 3W2MA 4MYAA 3TK7A 3T4CA 3W9ZA 3HMJG 3SY5A 1H50A 3G8EA 3V75A 3PG8A 2ZRWA 4JTJA 4FEZA 1ICSA 2Y7EA 4JTUA 3B03A 1OX4A 4LV9A 3OIXA 4XQ6A 1KA9F 4K8EA 1GTHA 4PC8A 3W3OA 1ME8A 3P5ZA 3VNDA 2EF9A 1I8JA 4AMAA 6TIMA 2Q8ZA 3ZWSA 4LVGA 1KM0A 2JGQA 1KW1A 4R7JA 1Q6OA 3TU9A 1O5XA 3CM4A 4FF7A 3P7YA 4QNEA 3NPWA 2FB3A 5K9CA 2C18A 4O1CA 3W6YA 3TW7A 3LV5A 1WBJA 1F05A 2H3DA 4H6KA 4TU1A 3N3MA 5FESA 1OFAA 3B0UX 4MY8A 1FCBA 4XBKA 3NZ1A 3GDRA 3IIXA 4PCFA 3SW6A 3UWWA 1K3UA 4ZVJA 2X1RA 1EB3A 2DJXA 2TYSA 4O1BA 2VFIA 1TRIA 3CWNA 3PY2A 4TMCA 3NQ2A 1R46A 5LNVA 3M5ZA 1TTIA 2EKCA 1TSIA 4UFLA 3C2RA 4P2VA 2ZZ2A 3ELFA 1H5YA 3W73A 3M16A 3EKZA 3W7JA 3QZEA 4IMGA 1IXOA 3NL3A 2DORA 4E0CA 1KFEA 1LM1A 2ZRUA 1B4KA 3LTSA 5G1YA 1C29A 4OGZA 8TIMA 3OHIA 1XBZA 2E6DA 1SPQA 4UTTC 3B0VC 3W7IA 4NNBA 4DO6A 2X1SA 2JKEA 2YCEA 3L21A 1VC4A 1MEHA 1FCQA 1FBAA 4FNSA 5CZSA 1F73A 2V9DA 3HPSA 5H91A 1PVNA 3OVRA 2C3ZA 3HGOA 3BK0A 5F1UA 4GFSA 5KINA 1OVDA 4JTGA 1ALDA 1S5WA 1Z41A 3NZRA 1K8XA 4A2SA 2ZRYA 3CWOX 4ML9A 5K7JA 3S5YA 1JUBA 4S2CA 2B0MA 1JCMP 1G4PA 1TMHA 3T78A 2XN2A 4RXFA 2JKAA 4BI5A 2NX9A 2NXGA 3G24A 2C6QA 3W1RA 3HGSA 1TPVA 3W1UA 3EWZA 3TAOA 4KFNA 3W7MA 1UASA 3M47A 4LOCA 2YSWA 3DHDA 3GB6A 3L5LA 5CPMA 3HG5A 3P67A 3M9YA 3NL2A 1TPFA 3EX1A 3IIOA 4QISA 4IMCA 1Q6RA 1LP6A 1H7PA 3FLUA 1LZOA 3LXCA 5MHBA 3BW4A 3RFAA 4FX7A 4A3UA 1O4UA 3W84A 3EEGA 3U6WA 5D05A 4Z08A 4AH7A 2R14A 2VEIA 3PG9A
chains in the Genus database with same CATH superfamily
4FLRA 1W1ZA 1YIXA 3TEVA 5C9UA 1W5QA 3IJ9A 1TR1A 2UY5A 5AGFA 3V5YA 5KYNA 3WD0A 4Q8QA 3S2CA 4I7WA 3ZMRA 1BR2A 4FXFA 1XLCA 1VIZA 5KYXA 2QVNA 5COFA 1E0TA 3LNPA 1HQTA 3P3BA 5TBOA 3SCRA 4ES4A 4HHPA 2FFIA 4IPJA 5ABFA 4FX5A 5CAKA 2OCCC 3KWXA 4W86A 5IDIA 4PSRA 3EPOA 5EBUA 4XZ9A 3UWQA 4RDWA 3DI1A 3AALA 4LAUA 1UR4A 4IAQA 4CNOA 1G4US 2J8FA 3UVIA 3T81A 1MMGA 1AEPA 3OLDA 1LWJA 3U0HA 4IJBA 4O16A 2OTDA 3QGAC 2BXZA 3AHXA 2NSGA 3S9OA 4HP5A 3CU2A 2QCDA 2EEXA 4LAOA 1ITUA 4GNVA 4X60A 3LJBA 4A4AA 1XL9A 2J45A 3KBSA 4GXWA 1M1BA 4U5GA 3HMCA 3LCLA 4QQUA 2WMGA 2UY3A 1ZTVA 3W37A 4R27A 3WQOA 2X05A 3RX4A 4AL1A 3AZSA 5C2CA 2GVEA 5IXEA 3TCEA 4HB7A 4P8UA 5B1AC 2NLYA 4J7YA 3Q7LA 1R0MA 4Q7CA 4NY3A 4EKWA 4MUPA 2XVLA 3EOEA 2ZXOA 3VKJA 1GUVA 2DW6A 2OB3A 4GZ7A 1WOAA 4C1KA 4HMDA 2V0TA 4BQ2A 3A6OA 2Y5SA 3LERA 3NM3A 3SQMA 4YNGA 2PDBA 3CV6A 4MTOA 2CLLA 1TR2A 3GG8A 2DIKA 4N6HA 2OT0A 4O0KA 1PWLA 2G3IA 3N3TA 2D0HA 1UD3A 3VDGA 2P88A 2QZRA 2IXUA 4NI3A 2PDYA 2XG9A 1LKXA 3BVJA 3KOWA 4B4HA 2BVWA 1FRBA 1L8NA 2QCMA 1A5OC 4AWSA 4B5XA 1WATA 2GL5A 1A5SA 4GUJA 3WQGA 3B0PA 5BOOA 1D8CA 4GJ1A 4XD5A 1EWDA 1L6GA 1J10A 3TSMA 1C3FA 5CSRA 2WZEA 3BSHA 4Z1CA 4ZQMA 2DZPA 6TAAA 4H9XA 2WVOA 2CBVA 4KRUA 3W7DA 1GW9A 1PHWA 3NQ8A 1AODA 1R86A 4GBDA 1YXDA 1VFTA 3AUJA 1K8CA 1DWHM 4GH1A 4WGHA 2VC6A 2UV8G 3NURA 5D92A 1WZLA 4LBSA 3WF0A 4YT8A 3FNDA 4I44A 5BOFA 4GYTA 4PFOA 1LG1A 2BSLA 4C7DA 3EYPA 2PF8A 3GFXA 1S3TC 3LV6A 4IFKB 5I79A 1D1AA 1VJSA 2CZEA 2J24A 1YADA 1CDGA 3WH6A 3QHOA 3K46A 3MMUA 1K04A 4RPQA 1MZRA 3O1NA 1V77A 3JCUQ 3KL4A 1HJUA 4DXVA 1T9KA 1BYAA 1OCNA 3ARRA 4H83A 3VIOA 4IUGA 4F0RA 5DN1A 1G94A 1P0NA 1RJRA 3GVQA 1CXLA 3MKVA 3WBEA 2DQWA 1BPLB 3VZYA 5MF5A 1ZPTA 3BLIA 2YA2A 2YL1A 3ZT5A 1Q6GA 1WZAA 4GH3A 3C0JA 5CEWA 1C93A 3A11A 2VC5A 1B3YA 3QKZA 7ENLA 4KWOA 3UA3A 3H4GA 4IQDA 1BG9A 2A4AA 2VURA 1RCPA 2QDGA 3NM1A 2FGLA 1S7ZA 3QY6A 2NV2A 1QLEC 3V0SA 2OYMA 1NLXA 5CG7A 3RQGA 1JUEA 2P3ZA 2WQPA 4LB3A 4UR9A 2OZ8A 4XEFA 1HVXA 3LESA 3GEEA 3D47A 2B7PA 4N42A 3P61A 1J01A 3UG8A 5E9XA 2GQ9A 4Z2JA 2A1DD 1KXTA 5KETA 1ZJBA 3APYA 3HTKC 1NZEA 2V26A 1V02E 3MSYA 4D6JA 1XLIA 4MDPA 4O8RA 1M2OA 1KTCA 1YDVA 4DELA 3WD4A 1U0BB 5M5DA 1DE5A 4HA3A 4BEJA 3OJGA 3G1FA 1K7FA 4CD5A 4AY1A 3AQBA 1KM6A 5IDZA 2OG9A 1JCNA 1R9ZA 5M03A 4IPIA 4ZXLA 3S1GA 2WZTA 4W8PA 2PP4A 1EDGA 2FDMA 1YA7O 2CHNA 3FXGA 4NCQA 2F6KA 1LI7A 1G69A 3BPWA 3E5BA 4QSFA 3WG6A 3VIGA 3TN5A 3GZAA 4LGXA 1KXQA 4JQ2A 2DJLA 2WAGA 2Y7FA 3C7JA 4ZE5A 4US5A 3W1MA 4YVVA 1OYCA 3S1WA 2EPLX 3MV01 3T55A 5F5FA 4ONVA 4CN4A 1A0EA 1LBFA 5A6TC 1FTSA 4F2UA 3S28A 3TX9A 1JDAA 1XF0A 3MKKA 3HIJA 3H2VA 3L0NA 3GM3A 5AYXA 5HATA 4W89A 1VFLA 3OLGA 2WWCA 1EPVA 1UWQA 1BQCA 1NOUA 3DXIA 2DT2A 3GTFA 1VMAA 2PDWA 3LQGA 4HNTA 4Y9AA 3VIPA 1AW2A 4I9TA 4K7YA 3T09A 2PX0A 1M65A 4AY7A 2VTFA 2XINA 3FAJA 1JPDX 1KV8A 1WTYA 1H63A 4XSLA 4K3ZA 5J5DA 2V2DA 3W07A 2VHLA 3ORWA 1W3NA 4ASTA 3RMEA 1OCCC 3CV7A 3LHTA 5I06A 3KRZA 3WNLA 2J8WA 4UR8A 4GX8A 4HA1A 3WF3A 3R79A 5B3SC 5F4SA 3RXZA 3LLXA 4A3HA 3SCVA 1LUCA 3O07A 2PWFA 2OKTA 4BZYA 2DW7A 1R7AA 1N8WA 3B97A 1YVIA 2M4EA 3Q67A 2VCAA 4O52A 3OBEA 4QJ5B 4EOUA 1V7AA 2QQ6A 1JR8A 1MZHA 3G18A 1E86A 3KRSA 1QMLA 2ACUA 4GNKB 4AISA 1ONRA 3N2ZB 1QNRA 5AC4A 4R85A 3FCPA 1T6UA 2BXVA 5AC5A 4FXRA 3UXDA 1SFTA 3WF1A 3DWWA 4GRSA 5K4ZA 2J7PA 2Z27A 1X7IA 5E9AA 4YT4A 2X0SA 3SIMA 4JIPA 2BXYA 2KQ9A 3WQFA 1UR2A 1F9CA 1J8VA 1IEVA 1H49A 3QZAA 3GTHA 4NKCA 1BTMA 2W91A 4YYCA 2BASA 3TMQA 1AK5A 1QNVA 5C9RA 2XUCA 4ZA0A 5E93A 3VOIA 3W70A 3VOFA 3PBGA 3PS7A 1POJA 1UQYA 4PTMA 1V7YA 3BLKA 3DKJA 1T6MA 5C6MA 3SGZA 5FJTA 1ZAIA 4WDTA 2ODOA 3MTWA 1ZHZA 3SFKA 2V67A 3W0KA 4Q4MA 5HWNA 2XN0A 2ZUVA 2RD9A 2GWNA 1VH7A 1GW1A 1GWJA 2HVOA 3C2OA 4U5HA 3LZ5A 4NVTA 5BQGA 1TV4A 2O9RA 3SN0A 3NZPA 1XYLA 2FDSA 4GC3A 1JXJA 3PUOA 4H00A 5HQMA 5CAHA 2J46A 4G9PA 1T5OA 3GBEA 5D37A 3N2CA 4JKVA 3DE8A 3LPOA 1S2VA 3A22A 3DEQA 4U3CA 3UMHA 3UGRA 5AZ0A 2IOQA 3JVAA 2QV4A 2PU0A 5AHNA 2QMJA 1JDDA 3TWBA 2I17A 4U9EA 3E0IA 2Z1VA 3QKEA 4OIQF 2VO5A 2Y8UA 2WBKA 1OX6A 3UY7A 1JZ4A 2E1WA 3RYSA 1E83A 1W37A 5AZ1A 1Z69A 4RDZA 1NQ6A 3I3EA 1QK0A 4Y8FA 4XPWA 1B3VA 4Z1AA 1LT7A 2J62A 2WHJA 4F79A 1BVZA 3QPZA 3M1ZA 4P8XA 1OGGA 3KTCA 3K33A 2XH4A 1GVQA 4IP5A 2QCDB 3IJLA 4UFHA 3ARSA 1LOSA 4XAGA 1EO7A 2FTPA 3ITYA 3O06A 1ZW2A 3K4AA 4FSAA 1TE6A 3DAQA 3NQGA 1QU4A 4JFSA 1PAMA 3O3RA 2PWDA 4CGTA 4HPXA 1CI1A 1YHTA 3H12A 5FF0A 2PWHA 4LVAA 4PBEA 5BW6A 3MCNA 4IJRA 1V51A 2V82A 2WVSA 1WOLA 3FKRA 4ADTA 3ARQA 5JBFA 1ENUA 3LTYA 4M6VA 2Y7GA 2E77A 5M17A 3G5EA 5AHFA 2YDRA 1EJRC 5MKGA 1TV5A 1PTDA 1RCOB 4WVXA 2OSWA 3TAKA 2YBTA 3TZNA 4FP1A 5HMEA 3U48A 1WB0A 3E70C 4NYUA 4H01A 3BC9A 4HD5A 3U4AA 4LLEA 4NIRA 3SECA 3L2IA 3IIPA 4J2PA 2I15A 3IARA 1ZHYA 5XIMA 2PTZA 4NAEA 4ZR8A 4IFOA 1E3ZA 4PSPA 2HE5A 4UTIA 2OEJA 4Z2IA 3T6GB 2VGFA 1B57A 4Z0JA 1VYIA 5IFPA 1QR7A 4X63A 1A41A 3VD4A 1FWIC 1N1CA 5CPSA 1QI0A 3AMKA 3JTLO 3DG6A 2ANUA 3JW7A 1ISWA 2NQ5A 3W53A 3GQYA 3CK5A 1V93A 2XHYA 2CZVA 3W1NA 4J1OA 3GBDA 2ZZ3A 2EPMX 2VGIA 1B9ZA 1ZS2A 1PUDA 4E2VA 2NT1A 4DQWA 3U8PA 3G1VA 3BAYA 3WIJA 5CPLA 4QDMA 3LB0A 1XZPA 2LSEA 1SJCA 3V1PA 4IM4A 3G1YA 3SZ8A 5JT4A 3M0XA 2QF8A 1EF3A 1HP5A 5C9WA 2H7BA 3V5CA 4RZ5A 1V6XA 1E9IA 2PTDA 1FWTA 2WKGA 1X1NA 1BYCA 5L6UA 4BWLC 3VGFA 1X38A 1UC5A 5B80A 1YTDA 5A8OA 3V5FA 4Q8MA 3X2QC 1HXJA 3IEEA 1F3WA 5TIMA 3TONA 3NGFA 2WVQA 4O50A 1G5ZA 5DXXA 2ABAA 1O94A 4BY3A 4S3EA 3R8GA 3T0CA 4C3EA 4AC1X 1I9CB 3C3UA 3VABA 4CQ9A 1FFTC 3DZAA 2Q8XA 1OFRA 3H2NA 4HNUA 3HQNA 2Y3HA 3PUDA 2QGYA 2YLIA 2YKKA 3F5JA 4FF5A 3MPGA 3W7NA 1SZIA 3RUBL 1TO3A 1V3LA 2Z2BA 2JF7A 5HMSA 1OD0A 2PU1A 2LQGA 4F40A 2YJQA 4LS2A 4F4BA 1IEIA 4WJ8A 3EDJA 4EIVA 3ZT6A 3H8AA 2V3CC 2J66A 4AQLA 1SU5A 5BYWA 2XIIA 4F8XA 1EHNA 3VKCA 4PN2A 3D46A 7REQB 2EG8A 2YVKA 5E0KA 5HQLA 2AL2A 2I1OA 3PZQA 3V1HA 4RUBA 4NG3A 4RBNA 4U3AA 1RJ9B 4E3TA 1TWGA 1OYAA 2PBEA 2GJXA 1OJXA 1DIDA 5DLCA 3IGXA 3DJNB 1TQJA 2FZBA 3CTLA 2WQDA 4IRUA 3VK5A 3RLGA 2NZLA 2CLHA 1PZ1A 4HMNA 1T0OA 3MBFA 2DZSA 4TQTA 3CO4A 1U22A 1OD8A 1LQ2A 3G1XA 1LS1A 3TJ5A 3LSCA 1ODUA 4LU0A 4M1BA 4QS5A 5FF2A 5C9ZA 3R6IA 1HJSA 3NXFA 3A4AA 1X98A 2HV5A 1FDJA 3HPZA 1REQA 4RE3A 4EAMA 4R33A 4DJDA 1AA1B 4LY4A 5TJ5E 3AIQA 4J2MA 4P8WA 2IPJA 3EXSA 3CC1A 3RN6A 1LVKA 2BHUA 3TW6A 4XIMA 2DB4A 4UTFA 4M19A 1XHGA 3QMRA 1NAL1 3EFOA 2WB5A 3TK0A 3WUFA 1JOGA 4E7ZA 2VD9A 5CC3A 1IXPA 1Z6KA 2CKRA 4CX9A 1QHOA 4NASA 4LTSA 1MWOA 1PIFA 2ZIDA 3OP2A 5LNWA 2AKZA 3M4HA 8A3HA 3ZSUA 2ZUMA 4GIEA 1RVGA 3AS0A 3W82A 2GQ3A 2V3FA 4QG8A 1IXQA 4W93A 4LC8A 4OE7A 4BQ4A 1GZ1A 2GPTA 1TREA 1GORA 2F22A 1B30A 4GYJA 1YPXA 4GINA 4K6AA 4JQ3A 3GY1A 1MEIA 4BEMJ 5I00A 1UR9A 2QIIA 2GAQA 4DJDD 1X96A 2PP0A 3WENA 2EPKX 3QQWA 1ST6A 3DBNA 4W4QA 5I3KA 4MSSA 1ZW3A 1SR0A 2BGNE 4QM1A 4AVOA 2VOMA 3EWYA 1NSJA 2B81A 5CG0A 1OZMA 2INFA 3IWPA 2DI3A 4O1AA 2HEJA 3BEHA 3HU7A 3M07A 3F7JA 2D73A 2J4GA 2XGIA 4XLNF 4GVGA 4DF1A 5TF0A 3GKFA 1JPHA 1UWAA 3B71A 3OQ8A 4HPNA 2NW0A 2ZUNA 1ZFJA 4EHPA 3G6MA 5BU6A 3W86A 5DBTA 1RXOB 3O10A 3VKAA 4PCTA 1PCWA 1CPRA 4K8GA 4DWSD 3ZR4A 4JXCA 1MNZA 4M5PA 2OEKA 1WDSA 2DGAA 1LG2A 4HN4A 1MUCA 4C90A 1TPWA 3N0TA 1PKMA 1ZP4A 4FK9A 3WQ4A 2HSQA 2FTYA 1NWSA 1PB0A 2CW6A 2PGWA 1E72M 1U89A 3DHFA 1B3WA 2HJMA 4G8TA 4JKKA 1OHLA 1L7CA 4PE8A 1O5KA 1A3HA 1TYGA 2NXIA 2ZZ1A 1IHIA 4QSHA 2QKFA 3ZJ8A 1UCWA 1B5TA 3GWQA 3TJIA 3URQA 4YN0B 3VNZA 5T9BG 2YL0A 1AW1A 2WVNA 4FIRA 3K8MA 3P60A 3V5XA 3V5OA 4XKYB 3T40A 4XUGA 2G97A 2ZRXA 4R5EA 3H53A 1UH2A 3C2EA 3X1OA 1I0BA 3PUGA 1W8GA 4NXSA 4QG6A 3T9PA 3QXBA 3CYJA 1LI5A 4EWND 2VELA 3TN3A 1TJ2A 3GEIA 2OZ0A 4QHRA 5LA2A 1UA3A 3WLNA 1QOXA 3NDYA 3HNKA 1RA5A 1OX5A 2X30A 4DVZA 1FY6A 4G2DA 3SRHA 5HANA 4C7GA 4JHMA 1GVIA 3NVTA 4UCFA 1EC8A 1TJ0A 4LJ3A 3QVQA 1JAKA 1ZJIA 4FOUA 5A6MA 1W1B1 2VP8A 2F6XA 2HCVA 1EQPA 1Q63A 3VZZA 3TN4A 1QNSA 4AXKA 3GG1A 3EWXA 2C71A 3MZ2A 3B8IA 2X1TA 3CEXA 1KV5A 1UC4A 1C91A 1VJIA 2NSXA 3GW3A 4UR7A 1YXCA 5JVLA 1ZU4A 3ITLA 1PYFA 4M1RA 2NUTB 3O6CA 1V79A 4C6EA 1TTQA 1TA3A 3NEVA 5EU9A 4CQAA 2G3KA 2XLWA 1R5YA 5A8GA 4ORIA 2QCNA 3EX4A 4DRJB 3U2LA 4HJFA 3WD1A 4KWUA 1R87A 2ZWYA 2LIGA 3WLQA 3RYLA 1VD6A 3USBA 4DZIA 3EZ4A 5G4EA 1LT8A 4MZ8A 4O17A 4US6A 3WFLA 2PDXA 2DIJA 5AVNA 5MKGB 1XX1A 3MQTA 3OEXA 4O1EA 4K39A 2DZWA 2W61A 2ATMA 2VJXA 3TJLA 3U57A 3N9KA 2PLJA 1NDYA 4MMWA 3HPXA 2QJNA 4FX6M 4QGCA 5GNXA 4X2RA 4E4UA 4HZMA 3TNBA 4F3HA 3B8SA 3R0DA 2NV9A 1BRLA 1WKEA 3P74A 1GEHA 5HV9A 3ZVIA 1EF2A 3T44A 4N4WA 4ICMA 1JYNA 3U2CA 3B8UA 1CCWB 1R85A 1U30A 3NQMA 3TFXA 1K03A 1KBIA 3IIVA 4CEXC 4AF0B 1TVNA 4JFUA 3ALFA 7ODCA 2CZDA 2QJJA 2WMIA 3ZYZA 3MYFA 1TWDA 3AFBA 3QC3A 2A0NA 1QPOA 2O9XA 2WMKA 1TELA 4WXZA 3WEZA 1B0IA 3GUGA 3WQ6A 3DG3A 4BJ6C 1JEZA 1Z3IX 3I3DA 4M29A 1RUSA 3WQWA 4BF7A 3AI0A 1W56A 1R3RA 4O11A 2D2GA 4E8CA 4MVSA 1OSEA 4KEZA 2LP4A 3CQ0A 2J25A 5DT7A 4CU7A 3CT2A 4J35A 3PBWA 3HQOA 3LGDA 4UWMA 5K4XA 4H7ZA 1KBKA 3TYCA 2A2IA 5LNRA 1VFSA 4M0XA 1PKNA 2H7OA 3C0QA 4LCSA 4FNQA 3R58A 1LRNA 3VDHA 3WUGA 5KZ6A 4JDYA 1DWGM 5RUBA 1R2SA 4LF1A 3FHDA 3OODA 2XM0A 5EMUA 3GKAA 5TNVA 5H8MA 1F76A 2FKPA 3QBUA 2XVGA 1KTNA 3CQKA 2QUNA 2GOUA 4TX8A 4WQ6A 4EPKA 2A1YA 4AWUA 1CW2A 3DFNA 4H9YA 5D2TA 1J2BA 3MU7A 4MAZA 2PGRA 3LTPA 3HGJA 1JF5A 3QPEA 1RR2A 1L9WA 3MI6A 3W2JA 1LRTA 2W45A 1DXEA 4J7TA 3C0SA 1WX0A 2IPFA 4PUKA 3NQEA 1EPXA 1Y4CA 3LSBA 1GTEA 2ZA1A 3GWNA 4JBRA 1KWGA 3UJEA 2PPGA 4INFA 2X09A 5AOUA 1DJZA 1SVDA 2FJUB 3AXIA 4KH2A 3CMGA 4MY1A 3UZJA 4MZ1A 4UB9A 2H3BA 1BXBA 4W8AA 3CAVA 3VD3A 3M0MA 4PMZA 3AJ7A 4N6CA 4PCNA 4L9ZA 1UROA 1XGDA 3JYYA 4MFDA 5DRIA 4REQB 1DQWA 2AMGA 4ZQNA 4CNPA 3EKGA 4FAMA 3VO0A 2A6HF 1ZHTA 4LFYA 1NDZA 4AG0A 4MM1A 4EVZA 2C03A 2GQAA 1U2YA 3TVAA 4DXKA 4Y96A 3HN3A 4FLSA 1HJQA 4A8LA 2NPUA 4LC6A 2PP3A 5AHIA 1E0VA 2Q3TA 3WH9A 2IQ0A 4H9TA 1ZL1A 3MHUA 1SSGA 2AL1A 3KFTA 3E3HA 4XUYA 2ZZ5A 1EC9A 1ZCCA 2E5CA 4ORMA 1BR1A 5FF3A 3GR7A 1W9PA 1O5QA 1REQB 3HG4A 2ONEA 1KC7A 1C7TA 3NZGA 3ECSA 5DCEA 3O6YX 4IICA 1RK5A 1TQXA 3BGGA 1RY0A 4RW3A 4AE4A 2XZ7A 4RV8A 1FNTc 4ML4A 1EJXC 2BV9A 4RNIA 3VKKA 4F0KA 4IQLA 1XGZA 1XIGA 3OA3A 1UQZA 2YPIA 4OBRA 4UOJA 4LERA 3XISA 2QUTA 1YYAA 4KMQA 3TA9A 2Y5JA 2WVVA 5DMMA 3RH3A 1KTMA 1XG4A 2VX4A 3S5OA 2H9AA 1UWRA 2J7BA 3CLMA 3MZNA 2BOFX 3P62A 2QJMA 3ANVA 2A7NA 3R11A 1ZSXA 4H6RA 3PJWA 2YL6A 3KBMA 4ER9A 1VYKA 2X0HA 1UP0A 3NYZA 4BFAA 2ZA3A 1TVPA 3BV4A 1U5JA 4MVAA 3E12A 3AXHA 4JNMA 1EC7A 3AQCA 5BXSA 1MFVA 1Q4NX 3JRMO 4PCPA 1AJ2A 1XCFA 1UP3A 2GOKA 2VRQA 3CLWA 3KCOA 4Q4ZF 5D9MA 1FH7A 4M56A 3KPHA 5K3VA 3NSMA 1Q5MA 3WQ8A 4WOQA 1WPCA 1DPMA 1O1ZA 4LW7A 2Y3BA 2PWGA 1EA0A 3LZ3A 3LRMA 1P5BA 4ACZA 1TB3A 4J30B 4WR3A 5FCLA 1E2XA 5G2IA 1QOQA 1DWIM 2Q09A 3TYBA 5LA0A 4QE1A 2DY3A 3DBPA 1YBQB 1Z42A 3GIYA 1NFOA 5BCAA 4MVQA 1AZ2A 3VF0A 1QCWA 2A3CA 5F1VA 2IM8A 1EJWC 2CITA 3IQCA 2YIHA 4HNNA 2EBNA 3M7SA 1HL2A 1M04A 3FJ4A 2ZRZA 3I7SA 3JU2A 3FVDA 1DOSA 4XPYA 1WDQA 1Z9AA 2LLEA 5H8UA 4BJTA 2Z2AA 1Q8AA 4RK8A 3I7RA 5A6BD 3EPVA 3ZIZA 3QZCA 3ITCA 3VUSA 2UUIA 1E55A 5HSWA 1R3SA 4UCGA 1VFUA 4ZOCA 1I2QA 1PDYA 2VR5A 3OPSA 3KAOA 5G1TA 1OX4B 2G3JA 3WZ0E 4RXGA 3UD6A 2CZ5A 5A8MA 1V3KA 3GYCA 4EXAA 3WG7C 1FFRA 1KO0A 4GI9A 1OFDA 2X7WA 3E0WA 1UR0A 1FXPA 4B15A 2R1PA 1L6FA 3A12A 1LF1A 2C1HA 3VAVA 1JDFA 4BJ5A 3D3FA 4UTTA 4EAYA 1BF6A 4DM1A 3MDUA 2WC3A 5HNNA 3OYZA 3WLJA 3WLIA 2J75A 3RR4A 4OTKA 1BSLA 3C86A 4MVRA 2ZXAA 3TK7A 3V7PA 3W9ZA 3SY5A 1Q65A 3KKBA 1H3GA 2ZRWA 1ICSA 3ZIBA 1KCZA 2GUYA 3B03A 3ZQ9A 1NU9C 4K8EA 4BQ5A 4PC8A 3SUSA 1CGYA 3PTDA 3W81A 2AP3A 3RX3A 6TIMA 1TE1A 2Q8ZA 1KW1A 3VCNA 1Q6OA 2CCRA 1O3UA 1UJQA 4FF7A 5PTDA 4G7FA 5E33A 2C18A 3CHEA 4IPPA 1ECQA 3ABXA 4IZGA 1MI3A 3TW7A 3LV5A 4UQAA 3BJFA 5CXPA 5T3WA 1EBHA 3EA3A 1KCXA 3WEOA 2P8BA 4ERIA 3KM8A 4MY8A 1FCBA 4IQEA 4XBKA 3NZ1A 4HHMA 3GDRA 3IIXA 2YLGA 4N0RA 4ZVJA 2QT3A 1FAPB 1CYGA 1TA3B 2VFIA 3FX4A 3PY2A 3DECA 4J27A 3FY1A 3C2RA 4WCJA 4YS1A 5L0GA 3VM5A 4Z17A 2PDMA 3M16A 5HK4A 1RBLA 2Q4FA 1CXHA 2DORA 3OW1A 1LM1A 1DIOA 3LTSA 3RAOA 3R25A 8TIMA 3LS1A 2AQVA 3T6CA 4C7OA 3FDKA 3T4WA 3KOZA 1XIDA 3W7IA 2F61A 3PCVA 2X1SA 1CIUA 1VC4A 4PMUA 2JIWA 4A3RA 1F73A 1PVNA 3BK0A 1HKIA 5F1UA 3KLKA 4GCAA 1ALDA 1EGZA 2FYMA 1Z41A 3UYIA 1K8XA 3GH4A 1V4AA 5XINA 4ML9A 1EI7A 3LEOA 4MNMA 3S5YA 1Q6DA 4KRZA 4AZIA 1XLBA 1TMHA 2J7FA 4RXFA 3NSXA 1TFKB 3LEVA 1JNEA 2X0CA 3W8HA 1ISYA 2F2HA 4KEVA 2WZLA 1TPVA 3AZTA 4GEHA 3OGSA 1KGWA 4GYPC 3W7MA 1US0A 1B1YA 5EMYA 4D6DA 4PUWA 4E2OA 4NTAA 2P8CA 2VI0A 1TPFA 2Q71A 3B0XA 1W3HA 3CZEA 2NT0A 3LXCA 5MHBA 1CEOA 3N4FA 4FX7A 4F9JA 3B3DA 4DUWA 4A3UA 4PMXA 5JBDA 1FVPA 2W27A 1OM0A 3OVGA 1RD6A 4Z08A 4AH7A 2R14A 3PTMA 5EGYA 2A69F 1WN0A 2GVYA 3QGVA 1TKNA 5D33A 3EMCA 3R13A 3MJMA 5E70A 4PFHA 1OC6A 3HJZA 1VS1A 3A3HA 3TOYA 2IQTA 1OW6A 1TCDA 3CIXA 3K1DA 1LE4A 3VGDA 7XIMA 1BR4A 1PJ9A 3LOTA 3NQFA 4KBXA 1APCA 2JEPA 1D1BA 3CPGA 4JJFA 4BWLA 3DMDA 1J0IA 3HV9A 5F4XA 5HUOA 3R10A 4Q4SA 2J9ZA 3C8NA 4IMEA 5D2VA 3OLIA 4FIQA 4O4WA 3OLEA 1WOBA 5GVJA 3VGEA 3A9BA 3W7LA 3GH7A 2JALA 4G1KA 6REQB 1M68A 1TRDA 3TTQA 3C5QA 1QPRA 3TIMA 5IY5C 1IZJA 1D7KA 1QOPA 3CQZA 1K9DA 1YW1A 1D3CA 2Y8KA 2R94A 3SXZA 1XDMA 2G41A 4TXEA 4JTDB 4ZLDA 3GC2A 1RY8A 4S38A 5HWJA 1Q7QA 3INPA 4FMVA 5CBIA 5E6ZA 1UUMA 4QP0A 1YDOA 3M0IA 4TTUA 3UG3A 3OBKA 3VXGA 1V6TA 4MNLA 1KLZA 1GJWA 2PX3A 2Z4GA 1GOXA 4GXPA 1VTMP 2QCFA 3MW7A 3UERA 2VVSA 4QDWA 3OIHA 1XFBA 1LWHA 4LWWA 1JDCA 5HULA 1EOMA 3SEOA 1EKYA 1B90A 2NSOA 5A5WA 3TNOA 1H62A 4LDQA 2XSXA 5EFFA 4YVXA 3GVRA 3A9CA 3HLZA 3LX9A 1S2UA 4ZTXA 4Q8VA 4OIPF 2J9YA 1K8ZA 2PCEA 4XAYA 3BTNA 2BY3A 3AHZA 1Y5VA 4YYFA 4N9CA 3CSKA 1HGYA 1SZRA 4P5UA 4F0SA 4AUBA 3NR0A 4DAIA 3QTPA 2VUNA 4HU8A 1HG3A 3S0XA 1SW3A 3WY1A 3L68A 3MHGA 1FP8A 4RW5A 2HJPA 4XSMA 4DEFA 4E3VA 2FPYA 3REQA 1IWPA 1JFXA 3CWHA 2YXGA 2KX9A 1BYBA 4N9DA 3A21A 3E6EA 4GZEA 3K4WA 3LHZA 4CQ8A 3GK0A 3L2LA 4LSBA 4JJGA 2YW4A 2OGJA 5CZTA 3UPMA 2OO0A 3NQVA 2PRHA 4J3UA 3EZHA 3FA5A 4QBXA 2YFOA 3WJWA 1WKYA 3WDPP 3SCWA 1XJBA 1Z7AA 1VBJA 3WQDA 4G5DA 3VIFA 3TJ6A 1ONWA 1E9LA 4UFKA 2ESCA 1WUFA 1Q7MA 2PAJA 3KTXA 4J28A 4QQ3A 2VEPA 2AMXA 1W3LA 1JZ3A 1DP0A 5F7UA 3IGHX 4HCDA 1QW9A 4JICA 5BROA 3PZVA 5DT5A 1N82A 4ICNA 3APTA 1XBYA 3G0XA 1XI3A 3U3FA 1LE2A 2AVKA 4O10A 1Z5ZA 4ACZB 1QBBA 2VYOA 4PJMA 3MY9A 4GUHA 2CFFA 3T42A 1BBHA 1XH2A 4LYQA 2GGEA 4PB5A 3RO8A 2WB7A 2Z0IA 3R89A 1XSJA 2OSXA 3CEUA 1J6PA 3BSMA 1JCJA 1Z44A 4ICCX 3EMZA 4L56A 3KYJA 5REQA 4E6MA 5EL1A 2R7RA 2C1GA 4WSHA 4JFWA 2FB2A 1Y5XA 1A5BA 2D2OA 5KYUB 1GGOA 5FKYA 5D2WA 2Y7DA 5FCZA 1XV8A 1S5VA 4FXJA 1H7XA 4ZXOA 3C8GD 2XIQA 2DPEA 1YYJA 1P43A 2B7NA 3TYDA 2XXAB 3K6BA 1B3OA 1W54A 5FF4A 5KSWA 3K1GA 4LALA 4D6GA 1XIHA 4NQFA 5LYRA 4M51A 1JPJA 1H4PA 4QI0A 3S2JA 4N7QA 2WL8A 2H8AA 4ZB5A 4YTSA 3W7OA 3UR7A 1S39A 3N2MA 3H2CA 4DPQA 1DV7A 1S2CA 1FOBA 1FHDA 1VBRA 4HT3A 3TQVA 3WEMA 5J04A 5T9CE 4NU7A 3DGBA 1A50A 2G3MA 1BFNA 1OWQA 1UMYA 1NFNA 4RLIA 3TN6A 4JFTA 2VM8A 3N12A 1QQ3A 1JCYA 2Y63A 3IVTA 4TO8A 2E28A 4Q4RA 3QN3A 3VE7A 1TX2A 2IKHA 3F1QA 1UKQA 2BHYA 3WLRA 4LUIA 2YR1A 4HE8D 3EH1A 3W76A 3WBWA 3WNPA 1PX3A 4I1OB 2XL6A 3DFPA 2RFGA 5DQZA 2I5GA 1F61A 3PBVA 5G2WA 2PD9A 3E74A 2GDUA 4E4PA 4Z9HA 4TMBA 3VU2A 1KM2A 1MW0A 3UYCA 1M6TA 4FNPA 1I45A 2E5DA 3VNIA 5HQEA 4QI2A 3GX9A 1G7UA 2PP1A 1KD0A 2YBVA 3VC5A 3UR8A 3BZGA 3L4VA 2ATSA 3N6HA 1QW8A 3ITFA 4JTKA 4WABA 4Q8OA 4ZFMA 5LGZA 3AHTA 3VIKA 5EPDA 1NP0A 3ABZA 4GD0A 3KUMA 3S3GA 2ISVA 3CL8A 4AAJA 1VCGA 1E6SM 5FJJA 1XICA 5J8LA 4O0ZA 4BKNA 3GXIA 4OHQA 5C54A 4RL3A 4HHHA 4YT2A 4EACA 2Q00A 1HNYA 3ENLA 5A6LA 4UNKA 4OV9A 1YQ2A 1CGVA 4LYKA 2W0UA 3QSRA 4JEBA 3UXAA 1PX4A 1AVOB 1EJ7L 4IMAA 4MVMA 4IIEA 5LIYX 5LKYA 4EP8C 3H4WA 3DU0A 2XH0A 1BD0A 1WP6A 1A4MA 3NPVA 2MHRA 3NQDA 2OELA 4O57A 3M4CA 3FDQA 1CPQA 1HY5A 4XZNX 1H41A 1VRXA 1FXQA 2XU2A 3U5SA 3SGUA 3R5EA 3WBAA 2E9LA 2C16A 1E1FA 2ZBTA 2HVNA 3ZWTA 3UP8A 3LNRA 5F5HA 4WX2A 1DJWA 3N04A 3ZS4A 4YU1A 2J0WA 4X2PA 3WLLA 4BI7A 2R7SA 4XZLX 2J77A 2O9OA 3PF3A 1PHQA 3A4WA 1HFBA 1PD1A 4U9DA 1CXIA 4C5YA 3WLKX 1HKJA 1HO4A 5D04C 1WGWA 4XK2A 4CS9C 1RQHA 2E4TA 1RLCL 3M64A 4NYYA 1IQ8A 3VIJA 4JC7A 3LCXA 1YJGA 3EB2A 4R3UA 1CB7B 3O05A 1NELA 1M53A 1V6YA 2Z6JA 4RNHA 2FH6A 2I57A 2W4XA 3HNJA 3IV8A 3DYMA 3A64A 2E1DA 1R38A 3DFSA 3ARYA 4NJHA 3R7MA 5I24A 2E67A 3P14A 4U10A 2HXUA 1X8CA 4PK4A 3BV7A 4HSHA 4ZOBA 4GGHA 3Q37A 4L80A 4UMCA 7CGTA 3NPUA 4JOMA 5LNUA 3PZ9A 5CJMA 4JCZA 3MYPA 3IS4A 4IXHA 5DMYA 1YTKA 2Y85A 3CAXA 5HOSA 3DDMA 1UA7A 5EYWA 2UY2A 3OZYA 2HV7A 3DKLA 3P0XA 4Q8WA 4FI4A 4L4PA 2R8WA 1BAGA 1FH8A 3TTSA 1FCUA 3WO8A 4K37A 4PJJA 5D9PA 5GNYA 3FXHA 5A8NA 1YLMA 3OBAA 3QPYA 1IXNA 4GPNA 4OU1A 3SR7A 1TPH1 1TWIA 1JZ8A 2O9TA 3W75A 4C60A 1TQGA 1GZJA 3NIYA 1V5XA 2WXDM 1FHLA 3AXKA 2L6HA 3B0YA 4CCEA 1KCKA 3DHPA 2E9MA 3C18A 1DJIA 3N2BA 3FYOA 2G4JA 2ZKMX 4HYWA 3SB0A 1C7SA 2Z7GA 4JY8A 1VQTA 4IMDA 3EPMA 3M44A 4JL1A 4OD4A 3AIWA 4CQDA 3SRFA 5CKSA 2IKJA 4GC4A 3T0DA 3EGXA 4X0RA 1W3IA 3WLHA 2DP3A 4RE0A 4PTXA 2GK1A 1W9VA 4WKAA 1KFBA 5A2BA 4D6EA 1K77A 3O39A 2Y39A 3GORA 4WY0F 3CH0A 4PBGA 1CBGA 1B9BA 4W8BA 4UTUA 1WDPA 1VFMA 1ZBCA 2D22A 4J9JA 5C8BB 4QJ1A 2Y3DA 5CIVA 1ISXA 1GQIA 2PS2A 3QLLA 1KQYA 4JURI 2A68F 4EXBA 1EOKA 3BLOA 3CS2A 5XIAA 1UUQA 4IGGA 2DQXA 3QGKC 2R25A 1JPNA 4D2JA 3WODF 3M7WA 2IQDA 1J12A 4W7UA 5BMXA 3IUDA 4XD3A 2ZXWC 5FJPA 3T07A 2VRJA 3KLLA 3W02A 1UKTA 1S05A 1KM1A 4PUUA 2F2KA 2V5BA 2Y4SA 4G6CA 2BWGA 2OYLA 4MJZA 4BJ1A 1EHAA 4AL0A 3AMGA 1XBVA 4B3KA 4FAPB 1H51A 2WJEA 2PLKA 4GHRA 1RCQA 1LLWA 4PZVA 4MGGA 4KIRA 5CSSA 3M0KA 5DCBA 2OT1A 1P4CA 1I1XA 3UMKA 3VFLA 3CPUA 4QG9A 2QXWA 2C14A 3VNMA 3THAA 3B9NA 3RJXA 3MDWA 4DJFD 1W2VA 2FVLA 2I9EA 4JZ5A 4S3CA 4M6QA 2NQJA 2OX4A 4XG1A 1I5NA 3UXIA 1JZ5A 4ZEPA 3M4BA 5T26A 4CN1A 1LS4A 2QYGA 4ZQRA 2FHBA 3W1XA 2PF0A 1VBUA 1XISA 4UTKA 5EKYA 3NRHA 4JE9A 4L61A 3C8GB 3MVIA 5AYYA 1UR1A 2E3ZA 4IF2A 3DI5A 5LHEA 3WJYA 4MJMA 5G4HC 3DD7A 3AGTA 3G6LA 4J32B 4AWTA 4V1YA 3E2QA 2ZX8A 3KXQA 2R24A 3RCYA 1H1YA 4S3AA 2PODA 3ABQA 3S4TA 1RCXB 1F2JA 4ULVA 1K1DA 2EPHA 5CZJA 4L4LA 3EDFA 1JULA 5SWUA 4UZSA 1GGQA 2C1IA 3W2LA 3ZFHA 2QEZA 5CBBA 2MNRA 4UC5A 2OKUA 2L9JA 2Z1KA 3S1XA 3TC6A 3SUWA 3IAPA 3S29A 1RSCA 1ZJAA 3O2LA 5EFDA 2GJPA 3C8ZA 4JTSA 4P7QA 4B5NA 4UTHA 4OVXA 1IZKA 1ZY9A 3I68A 1UFBA 4DM2A 1NWRA 1LPEA 2R1NA 3HA1A 3UR3C 4ECLA 3NAVA 5HR6A 3G0UA 3U2OA 3VX0A 2DVXA 1G5AA 1RHCA 4JKMA 4DZ5A 1PZ3A 1A5UA 1MEWA 4E2DA 2CGEA 2GJRA 1VYPX 4ZOAA 4GY7A 2FGBA 5AB3A 4HBKA 2R02A 3KVJA 5T3TA 3QLDA 3PZNA 1OYBA 2W92A 4IX0A 4OUEA 2TMDA 4AHQA 2E6AA 4H04A 4MB3A 3FDGA 3OA1A 3BJTA 2HMCA 3ZJ6A 1JQXA 1OKKA 3K2GA 3TC7A 5L3VA 5B3IA 2R1KA 3IANA 2OR2A 4JTAA 5CZ0A 3WFZA 1B68A 2CNCA 3QF0A 3MVTA 1WXJA 1HN1A 3F2CA 5CPQA 1UBSA 4JTLA 4Q6JA 4LAMA 1OG0A 3G0SA 4LNYA 4I9JA 2PGEA 1J11A 3PZGA 5EHHA 2WSKA 3L0KA 4LVFA 2XLHA 3RM9A 5B7YA 3FSUA 2DFAA 2ZC8A 3MUXA 3RPTA 5HJXA 5K2ZA 3GVVA 3PC0A 4A6GA 1HL9A 4DIAA 1SYQA 2ZRVA 4MB4A 3E2VA 3CXOA 4XD6A 4ZL1A 2ZA2A 2C0HA 1ORJA 2AQWA 3FIGA 4XAFA 2FPVA 4XTIA 3GVGA 3MCMA 2BOEX 2VOTA 3QR3A 2FZ9A 5BRBA 1UPPA 4AZ5A 3CZJA 1W3TA 3G3MA 2D24A 1W1IE 2X40A 3RX2A 1M3UA 4HFKB 2ZC1A 1XWJA 4GY1A 4H1ZA 1WZKA 4TIMA 1VHCA 2X2GA 4DJ9A 1XC6A 2ON3A 4D8AA 3FVMA 1OKKD 1QTWA 4LYPA 4JCLA 2P7VA 2PSNA 2HPMA 3DYOA 2B7QA 1TV8A 3GO2A 5HINA 1WDRA 4ZQPA 1JYVA 3IGUA 1N8FA 2I9UA 5FEZA 1S2TA 1QW7A 1YA9A 2WSYA 3BLPX 3QW0A 4GACA 3UETA 3LQLA 3DFYA 4LY8A 3BUVA 1PSCA 2REQA 3URAA 3AISA 3BL3A 1VHNA 1S5MA 4Q4KA 5LHFA 4GK8A 3UW6A 1ISVA 4IIBA 4JTEA 3PNUA 1AMKA 4OWGA 3VA8A 1U1HA 2G50A 2L6FA 3M5VA 3IJDA 2CPUA 2WNQA 3FJLA 2H8XA 2L5HA 3H2EA 2ZE0A 1H61A 1XC4A 3JSEO 2P1FA 1TWHA 2ZPAA 2WV8A 3PSVA 1BVNP 3LLFA 4PL1A 1MNDA 3KL5A 5FL1A 4JX5A 3BOXA 2XH7A 2FMOA 4C6NA 3SAZA 3P8IA 1EIXA 3WQVA 3QM3A 1RJPA 3SN4A 4C3BA 3FGCA 3NKDA 1SZNA 4IB4A 3R94A 4NY2A 2G5WA 3W7CA 1VFFA 2Y88A 1NF0A 1E71M 4AYSA 3MJYA 3AS2A 3B29A 3WF4A 3CL7A 4B90A 4A3QA 1J93A 2V2CA 5D38A 1R7OA 1B54A 1JCLA 4DYJA 3WDIA 3PBUA 1ZHAA 1EJVC 3QY7A 4GYPA 1ZBKA 3OG3A 5T91A 2Q9CA 3HQ1A 2VZTA 2QMKA 2CNWD 1P0EA 3EWCA 2ISFA 4HNOA 2HRWA 2MWQA 3RCNA 4DB7A 3ONBA 4DJEA 4WJXA 2ZQ0A 3I3BA 3K8LA 1JDEA 1AW5A 4U5KA 3DOPA 1H11A 3SM0A 1DYSA 3Q65A 4TX9A 2WC7A 2DH2A 4ULWA 4HZ8A 1QXLA 1TJ1A 3DHUA 2HBVA 4DHGA 3VKDA 1XW8A 3FJNA 3QQ1A 3AIVA 3MHFA 1R9XA 3B9DA 3SNHA 4GISA 2XFRA 1M6JA 1TJRA 4H9MA 5C9XA 1UB3A 1WBHA 5F28E 4I9MA 2FH8A 4FNRA 5FF7A 4LUJA 2PC4A 2PURA 1UR3M 2CERA 3W1LA 2BGQA 3DAGA 1TV7A 2INEA 3CH9A 3KW3A 1FWRA 1KFCA 4YL3A 1Y0EA 1TV2A 1RPKA 3L0IA 1LYXA 4O19A 1TWZA 4G7EB 3MBDA 4J3ZA 3EJNA 4Q7NA 1K7XA 5FJUA 4HPGA 4HEAJ 2CBJA 4C6DA 3LCWA 4QEHA 3QEZA 3BXWA 1DWFM 3HPAA 1EQCA 2VCBA 3PULA 4KCUA 1PYMA 5BQIA 1W91A 4Q8UA 5CC7A 5DY2A 3TYUA 5AVHA 2GDQA 3PPHA 3RRXA 3R0KA 4OIRF 1M01A 3RVZA 3BOLA 3V5ZA 1B3XA 2W9YA 3FA4A 3KP1A 3KBWA 1GG0A 3U9MA 4ZSUA 1IT7A 5C5YA 1H7OA 4YWIA 2FQIA 1XYAA 1VJZA 4M8UA 3RPMA 2JPUA 1A7EA 1KWKA 5I78A 4DBWA 3KWSA 5D8ZA 3PJUA 1HL8A 1GVRA 1AD4A 3ABOA 3L4XA 3G8RA 3PPFA 3IQ5A 5L0JA 3Q94A 3IIZA 4PRTA 3D5HA 4B5SA 3W87A 3W8IA 1WYIA 1ZUAX 1E4LA 3RU8X 1OW7A 3C56A 1E51A 4MOZA 4WGXA 5BU9A 3WQEA 4DBQA 4UOZA 4I90A 1GKQA 4QXIA 1NWUA 1QNPA 4UFMA 3O7UA 3TXVA 5GJMA 2DZXA 5DANA 4WY0A 1J5TA 2C0AA 3SIZA 2XPKA 2NV1A 3GC5A 2WHKA 3C2FA 3LHUA 4B2DA 2ABBA 2I5IA 1M2VB 3BCDA 3VRCA 2W9MA 1KGUA 4HNLA 2PNOA 3UPBA 1E70M 5GPGB 3N17A 1SFSA 3QV6A 3LI0A 5DY3A 5D2XA 2C15A 1T6IA 3T2QA 3VIHA 3NG3A 3GZ3A 3BCJA 4IJCA 1TWAA 1SJDA 2CC0A 4Q8NA 5E6YA 1FWBC 2FTWA 5G5IA 1OINA 3GC4A 5A6KA 4MS2A 4WXYA 3W26A 1O87A 2VX7A 4JTRA 1BGGA 5BRQA 1P0KA 2FJKA 3GNPA 3E0LA 4DO7A 2YL5A 4UTWC 4FA3A 1OQCA 1YEYA 3SRKA 3QOKA 3STCA 4AC7C 2L81A 5DFAA 2YXXA 5GNZA 3SCQA 3O6AA 2J79A 4JKLA 3B9EA 2HPIA 1E1CB 3F4DA 2QJGA 5I3FA 4C1LA 3G1HA 5HJYA 2DSKA 3FHAA 4B3ZA 4C6IA 2BB0A 2RUSA 2EINC 3VPLA 4PMOA 2GUUA 1VKFA 2QHAA 2J8GA 2OO6A 1A4LA 4HMEA 3THUA 1PIIA 4W8KA 3R2GA 2VR4A 2WKJA 2ASHA 2IPGA 2CU0A 3WH5A 1ZCOA 1RKEA 4G56A 3MSDA 4CIHA 1FWFC 4FS9A 3E2SA 4ROPA 4QJ3B 1NSGB 3RKOF 4WGYA 4EWJA 4KETA 5JRAA 1E84A 2RH9A 1J8YF 3XINA 4M6PA 4UQ9A 3S6OA 1FCVA 3N29A 3S2LA 4BS0A 2ZE3A 2VQTA 4DUVA 2FMNA 3UR2A 3GRIA 1C9DA 3W22A 2AOSA 4MW8A 1TTJA 1SMDA 3QRHA 2GZXA 1AVAA 1G4EA 3UESA 2FAPB 1O5HA 2QV5A 5ABHA 2XRHA 3OU8A 1H0IA 3TOLA 1D3GA 4B9YA 2YKZA 2HISA 3C2VA 3P0WA 4PEKA 3VIMA 1HW6A 3PNZA 1YZCA 4KWSA 3PSWA 3TP4A 4M7TA 1HJVA 2HNHA 5C0QA 6A3HA 5EMJA 4IL2A 1KRCC 4NZ5A 3NA8A 1KRAC 1C03A 2VZSA 3F47A 3LG3A 3GU9A 3IJ8A 3S8HA 3EGDB 4AX2A 2OJPA 2ZCGA 3TH6A 2GSJA 3VOHA 1QASA 4KIEA 4Z0SA 1UZ4A 3BLDA 2R7VA 3PBYA 4DX3A 2EIKC 2BY1A 1PIGA 2D3LA 3SADA 1HE1A 4GJIA 3N24A 2XL4A 3U2EA 2E7FA 3BG9A 5AKQA 1AG1O 3TULA 3WDRA 2CLEA 2HZ8A 3M0JA 1M56C 4Z1DA 3TV8A 4B5TA 5IFTA 1VPXA 4U5EE 1JD9A 1T7LA 3EBVA 1QT1A 2P0OA 4JQAA 4HA4A 4QCEA 2YCLA 1NIUA 3OYXA 2OOCA 1L8PA 1F74A 1WDDA 3EA1A 3UZYA 2HK1A 4YCOA 2P53A 4CNUA 3MMWA 2YA1A 2OPJA 2AGTA 4H4KC 4LYRA 1SR9A 1GKRA 1EWEA 4H2CA 2XS1A 1FWNA 1FHVA 4P7OA 1RA0A 3L67A 3LA4A 3KL3A 1RP9A 1SO6A 4MQ9F 3RHGA 3L0GA 3KYIA 3P2VA 3S9IA 1GJPA 3T0TA 3W00A 1KM3A 4V28A 3FEQA 4JTHA 4CD7A 3B05A 3F4CA 6XIAA 5CGMA 2NQZA 2IKGA 5HUPA 5EB8A 3RLVA 2BC5A 2SFPA 2Z1WA 2R9RA 1XUUA 3LCIA 2R7XA 2X0YA 3SCSA 2QPXA 1VEOA 3HZ3A 2WJZA 2X16A 2QLYA 1ORSC 3MWAA 3GU1A 3BZJA 4X0VA 1S46A 3LBOA 5DXYA 4CD8A 5I3GA 3UWZA 3LUTA 3FGCB 1FWAC 4MY9A 1X39A 2D0FA 2G95A 2ZDSA 1FX6A 1OIMA 4A3YA 1MFUA 4UTLA 1AFSA 1Q6QA 3TTOA 3VDBA 1UKOA 1BEUA 1ITCA 3U5YA 1AH3A 4PUNA 5DBUA 4CEUC 2WMFA 1GQNA 1LQ0A 3WQCA 3WK0A 4G7ZF 1QWGA 4CS8C 5D32A 1YAUO 2RJHA 1K8YA 4O1DA 1XLDA 1HTIA 2MUCA 3NTYA 3U8VA 1LM3B 4K1WA 4CS9A 2AAMA 3RM4A 3RNDA 1SFJA 3Q7GA 1KRBC 4CUCA 4PODA 3W4RA 2F7FA 2VT0A 5LA1A 3CHCA 4RR4A 5BXTA 4GYKA 3WQ5A 1Y5WA 1V02A 3UJFA 5A8PA 5I77A 2GFTA 1ME7A 4OD5A 4X61A 4PUJA 1CB2A 4ZQCA 3DESA 4E4FA 4NAFB 2OOGA 3EZIA 3OB8A 2XYLA 4HK7A 3OZMA 3PG8A 4FR6A 1UIPA 4JTUA 2Y7EA 4V27A 4XQ6A 1KA9F 4Y9OA 1UW9A 3W3OA 3P5ZA 1F4AA 2QULA 4US5D 2CW0F 4H6EA 4E0HA 1OADA 4BEUA 3VZXA 4U31A 3ZWSA 4Q4QA 3TU9A 3AU6A 3NCOA 3SSZA 4QNEA 1H9GA 3I10A 2O4MA 3TTYA 4JL2A 5HDRA 2PDUA 2UBPC 2HWGA 3URNA 2A3LA 3W6YA 3QHNA 4AY8A 3ARWA 1F05A 1FHUA 1YNPA 3N3MA 2YLLA 4Y7EA 3B0UX 3AMLA 2ICSA 1BLIA 2ZUSA 4QS6A 4HHLA 1HGWA 3UJRA 3WD2A 2XTKA 2CKSA 4PCFA 3J06A 1K3UA 1EB3A 2WLYA 3MA8A 5BXPA 1R46A 3U9IA 5LNVA 3OZPA 1TTIA 2PI6A 3B40A 3F5KA 3UCDA 5ENLA 1TV3A 1A3WA 2E0PA 3ELFA 4DY1A 3W7JA 1DXFA 2BVYA 3NL3A 3EOOA 5HBFA 4E0CA 3U7VA 3D3AA 1C17M 1GOWA 5G1YA 1CTNA 4PACA 4TTGA 4H7CA 1V0NA 3K7DA 3AG3C 1XBZA 1Z8AA 4BJ5C 3W4YA 1ZQ5A 4UTTC 1E1EA 4U2YA 4GZIA 4QDLA 3TLQA 4NNBA 3MANA 2DT1A 2HDJA 3L21A 4XLPF 2C79A 2QDEA 2JIEA 2VZOA 3SCNA 2V9DA 1P7TA 4CVWA 5H91A 3OVRA 2HJ3A 4EXQA 5I07A 4GFSA 2IUZA 4JTGA 3KZSA 3PWGA 4JIOA 3NZRA 1EGMA 4LUSB 2ZRYA 2FZMA 1T6QA 1DIKA 2C91A 5K7JA 1ESWA 2LCHA 4S2CA 2J9BA 2J7PD 2A0BA 2XN2A 4FALA 4WGZA 2JKAA 1GVYA 2Z24A 1BDJB 2PWVA 3ES8A 2NXGA 4DLFA 4AIBA 1RH9A 1H5VA 3CV1A 3B9QA 3EWZA 2CBUA 5KYXB 1UASA 4LOCA 2DVUA 2WZMA 1MXGA 1XDJA 3GB6A 5CPMA 1J5SA 3UGVA 1OT2A 3AXXA 5ABFB 4B9ZA 3P67A 2PDLA 4B4FA 7PTDA 3IIOA 3WLTA 1MNSA 5DS5A 1Q6RA 3OTRA 1XP3A 3BW4A 3RFAA 3WH8A 2IBFA 1O4UA 5I5RA 3NMJA 3U6WA 5D05A 1GOOA 4RNJA 3BURA 1NU7D 1ZRQA 1ZHWA 3IGSA 1GQKA 1IW7F 2Y61A 3HJCA 2PTXA 4WEVX 1AH4A 3CNYA 3GXMA 3AOFA 3AHVA 1V0KA 2YB4A 4GQBA 1AUSL 3CUIA 3SI9A 3CIVA 1MRQA 4GQRA 1XRSA 2I7GA 5E3CA 1PWMA 3H2AA 1SQ7A 1BSIA 2J8TA 3FFSA 2OMAA 4C6BA 4HN8A 4GABA 4DXXA 3FOKA 2BZNA 4QLKA 3RGTA 4AD3A 9XIAA 3WCZA 5F2IA 3OWTA 4DYEA 1SJAA 3PFRA 1LWIA 1V74B 3PBMA 4LVBA 4JR5A 4O53A 1XLLA 5AFDA 3C3NA 2VWSA 1KM4A 2G62A 2BODX 4AZ7A 4KNVA 1J79A 1MMFA 1KXHA 4KNWA 2P5NA 1IGWA 3JZEA 2WCAA 3AXMA 4R9XA 2RHGA 2YL8A 1S1PA 1SM9A 3W2UA 3P93A 4DBUA 3QVYA 1RXQA 3PZOA 1IEXA 3W71A 4PRWA 2J47A 3VINA 4XD4A 1GQAA 3L4WA 4GQGA 1E0XA 3BARA 1GVSA 3FAPB 3TTEA 5CLTA 3TQOA 3NOEA 1TPDA 3AZRA 1DVJA 1ONEA 2ZVIA 4IX2A 3DCPA 5CI8A 1NY1A 4A22A 3AQUA 2XZ9A 5LZLA 3SY8A 1AQ0A 2CWXA 2R1LA 3W1PA 4EPBC 2WANA 1K4GA 1UP2A 1KLYA 1TZZA 3GXTA 4YJ5A 2GFHA 1BKSA 5K9DA 2B0HA 2W66A 2ZVRA 3N73A 4KW2A 1VLWA 3MUY1 4XX6A 4ALDA 4L1XA 1UH3A 1ZAHA 5I03A 3UBPC 1I4YA 1U1UA 1B3ZA 1FDYA 2XL8A 1QNQA 3AAMA 3ZLGA 5KITA 4MLRA 1KTBA 3LS9A 5DLJA 1CXFA 3LRKA 3BGAA 3POHA 4A2RA 4C6FA 2EO7A 1PKYA 3V18A 3USZA 4HOXA 4EBJA 1K4HA 1OBAA 4W87A 3TOMA 4FXSA 5HNUA 3VYLA 4RDVA 1UHVA 4V33A 3STPA 1E3XA 1HW1A 2CWNA 3KBVA 1E56A 4QX4A 4C6JA 2FVMA 2BY0A 2Y70A 3SUVA 4IFRA 5AC8A 2PDFA 2VASA 1RALA 3FVYA 4JRZA 4YHGA 3VE9A 4KFPA 1F3XA 1TTPA 3O15A 2VDGA 4A21A 3UXLA 4CNTA 4LUYA 2EPOA 4BCEA 3N1AA 3PN8A 5CJNA 4IOTA 5I3DA 4DBEA 2Q9AA 2OZTA 2YCLB 3C4UA 2ZDRA 2D2JA 2BMBA 2ALDA 1CGME 3EWBX 3KVMA 5AC6A 3Q58A 4IXXA 6PTDA 1C8VA 1J9YA 2KZHA 1AD1A 4AZHA 4XPXA 4NZCA 4I8YA 3ERPA 2A85A 1NVMA 4IIHA 3F4WA 1IF2A 3BGJA 2W62A 3BMWA 2D4UA 3PZTA 1GOKA 3SDOA 4LV4A 2TPSA 3VIIA 4YK5A 1PDZA 3W01A 4TR9A 1PCXA 1KGXA 1M9HA 5EK0A 1OCJA 1MNEA 4E38A 3SUTA 4CQCA 3WAQA 4FESA 1TPEA 1K02A 3AHYA 4KERA 2DDXA 1L2UA 3ATYA 4HSOA 4S3KA 1VPYA 2R9RB 2Q9BA 1ODZA 1B2YA 3HJEA 3B06A