3B0PA

Trna-dihydrouridine synthase from thermus thermophilus
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
317
structure length
307
Chain Sequence
LDPRLSVAPMVDRTDRHFRFLVRQVSLGVRLYTEMTVDQAVLRGNRERLLAFRPEEHPIALQLAGSDPKSLAEAARIGEAFGYDEINLNLGCPSEKAQEGGYGACLLLDLARVREILKAMGEAVRVPVTVKMRLGLEGKETYRGLAQSVEAMAEAGVKVFVVHARSALIPPLRHDWVHRLKGDFPQLTFVTNGGIRSLEEALFHLKRVDGVMLGRAVYEDPFVLEEADRRVFGLPRRPSRLEVARRMRAYLEEEVLKGTPPWAVLRHMLNLFRGRPKGRLWRRLLSEGRSLQALDRALRLMEEEVGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords tRNA-dihydrouridine synthase
publication title Molecular basis of dihydrouridine formation on tRNA
pubmed doi rcsb
source organism Thermus thermophilus
total genus 116
structure length 307
sequence length 317
chains with identical sequence B
ec nomenclature ec 1.3.1.91: tRNA-dihydrouridine(20) synthase (NAD(P)(+)).
pdb deposition date 2011-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01207 Dus Dihydrouridine synthase (Dus)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1460 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3b0pA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3b0pA01
4AWTA 1G7VA 2DJLA 4AF0A 3R12A 5J5DA 4LW7A 4M7SA 2F84A 1QPRA 4W9TA 5I3FA 1FCUA 4LRTA 2ZYFA 3B8DA 3U2OA 1FXPA 3G1DA 3R2GA 4Z1AA 5D09A 2NUXA 1F7BA 1LLZA 5AN7A 4LT9A 2Y7DA 4QNEA 3NQ8A 4IWWA 4A22A 4JS3A 5LNSA 4O11A 1TPC1 1JVNA 1FDZA 1W5MA 3PVFA 5I3JA 2CLFA 3NOEA 1AW1A 2GVGA 4POCA 3KVMA 2NUYA 2ZZ1A 3GDLA 3L21A 4QIUA 1OX6A 1T0OA 2QUUA 4NJIA 1DV7A 4DO5A 4LV4A 3W72A 1XDLA 3G1SA 2R91A 3UNDA 2H3BA 4MLJA 4KFOA 3QEZA 4RKAA 1ME7A 3P84A 3MHUA 4LU0A 4R53A 3DENA 1AW5A 3C2EA 1KTBA 2ZRZA 1ZHAA 1A53A 1H7WA 3G1HA 1WBHA 4LVBA 5DXYA 2WJZA 5F2IA 2DORA 1F6PA 1DQWA 3LXAA 3V1PA 2YYUA 3NNTA 4YWIA 3FKKA 3S6DA 5FF0A 5D33A 1H63A 1BEUA 2VXNA 2GVJA 4ZL1A 5CPMA 2ZA3A 1FWTA 1MXSA 3DZ1A 2V30A 1QPNA 5HWJA 1N8FA 4FNUA 5EKYA 3GYEA 1W54A 3N14A 1SO3A 1W3NA 1UASA 1MEWA 2YPIA 4EF8A 4FX8A 1W3IA 4CCDA 4PL1A 3HIJA 1KFCA 3L5LA 4UXDA 5AOUA 2YW3A 1NEYA 2HTMA 4XKYA 1FX6A 1HUVA 3SGZA 1EWEA 2V81A 5CPOA 3B0UX 3NG3A 1W31A 5EA9A 1GTEA 4IUOA 1RV8A 1UBSA 4CQAA 3GDKA 4O4VA 3LTSA 1G4TA 3OVPA 4DELA 3LCGA 2FFCA 5F2MA 4IPJA 3EWYA 4AWSA 4O19A 4ZQCA 4K37A 4FNPA 1THFD 5FF7A 4H3DA 1EPXA 1HO4A 4BI7A 1KA9F 3OA3A 2ATMA 2Y7FA 3GNDA 3M6YA 4LV9A 3MI3A 3W70A 1JCMP 1WAUA 4LS2A 4O10A 4XBSA 3TXVA 3W2LA 1XCFA 5KINA 2C14A 4BR1A 3GXNA 1IXNA 1W56A 1OK4A 4PCFA 4JTHA 1GPWA 4FNSA 1I2RA 1Z48A 4JDBA 4HSOA 2QDHA 3USBA 2YFNA 4NJGA 3OVQA 4DF0A 3PF3A 1B3OA 2C15A 1ICPA 4MY9A 2NX3A 4QITA 1KLZA 1Q6OA 1WYIA 3UPBA 4PC8A 1UUOA 3UYCA 1OG0A 3BK0A 3MP3A 3NAVA 1GVQA 3KVLA 1QO2A 1JULA 2R8WA 4KFPA 3W1MA 4K8EA 3W9ZA 3GKAA 1F05A 3BG5A 4OQVA 1VS1A 4UTMA 4IXXA 2ZRXA 3W2MA 5CSRA 3TU9A 2BZNA 3TQKA 5FEZA 2Y61A 4N9CA 3M5XA 4KWVA 3FEMA 3GKFA 2E68A 1G4SA 4ZZ9A 3PSVA 1TPDA 1VPXA 3L5MA 4NQ1A 2YDAA 5LNUA 2A85A 5H2ZA 2ZZ6A 1ZFJA 2V9DA 4H4IA 3TQ0A 3M0ZA 1SW7A 3NQEA 1SZFA 1JCXA 4MYAA 2DZWA 2JKAA 2QCHA 1NF0A 4NNAA 1A5BA 1GVRA 1U5JA 3P82A 3QJAA 4P2VA 4PEKA 1VCGA 3ABSA 3WK3A 4UC5A 3PG8A 1IF2A 2B7OA 5EYWA 1RVGA 1TJRA 2V2HA 1OYBA 3HMJG 3S5YA 3WK0A 3PG9A 4FEZA 3W3OA 1S5WA 1TTIA 5LKYA 4MJMA 3T4CA 5FF2A 4FXSA 4FHAA 3W88A 3TA6A 2H8XA 3CEPA 4QQ3A 3GZ3A 1GQNA 4J9JA 3W7NA 2A7PA 2GJLA 1SZGA 3W1PA 5IBXA 4HPJA 1PVNA 2R94A 1EIXA 2W0UA 1IXPA 3LV5A 3BGGA 3VFLA 4MPQA 4UFLA 1EX5A 4ZQPA 2X1UA 3NQGA 3I68A 3VKJA 4Z0SA 3DI1A 4HSNA 2O7QA 3SECA 2CLEA 1R30A 4JY9A 1QR7A 3GAKA 3SGUA 2CZEA 3UWQA 2PRLA 3SFKA 1TCDA 2E6DA 1H1YA 1R2TA 3FLUA 5BW6A 1OVDA 4WXYA 3IVTA 2QCCA 3IVSA 4DO4A 2ISWA 2E6FA 4RZ4A 4X3ZA 2B7QA 3ABOA 3JRKA 2ZRYA 4JTTA 3DH7A 1GJPA 5EPDA 1T99A 3HB9A 1SO6A 1T96A 4CNPA 1TTQA 3DFOA 2V2CA 4LS1A 4BI5A 1TPH1 3BW4A 3STFA 3HOJA 2BXVA 2JKEA 2QR6A 1P4CA 3LCXA 1W1ZA 1EUNA 2ZRVA 1I8JA 3RMJA 3ATYA 1K8ZA 1RQEA 3NQFA 3W7CA 3MP4A 3FIGA 2ZQ0A 1HL2A 3BLEA 4Q33A 2ZZ2A 1SO5A 3M44A 1S5VA 3EWZA 1E51A 5CZSA 3STGA 3W1RA 3ZWSA 4OV9A 5D2WA 4N4PA 3HBLA 5LZLA 2J6XA 1UB3A 3RNDA 1TTPA 1KM5A 4GXMA 1MSSA 4FNRA 4YMZA 2CW6A 1O5KA 4IQLA 4JTSA 3P8IA 7TIMA 4O1AA 1OHLA 4I7WA 3PSWA 5I3IA 2PCQA 2ZTJA 1FWRA 1ZY9A 3O6DA 1LM1A 1YADA 2TYSA 1GEQA 5C54A 3LLDA 2FJKA 3I6RA 3P62A 5FF4A 5U7SA 4K38A 1QOQA 2B4GA 2VFHA 3EWXA 1JQVA 2J9YA 3L5AA 3LHYA 4DPQA 4CCEA 4RZ6A 1B4KA 1V5XA 1I45A 5G5IA 2NWRA 4TMCA 4DF2A 1LCOA 3MO7A 1CX9A 2ZFAA 4NNBA 2H3DA 3BV4A 1RZMA 5CPLA 1XUZA 3G1FA 2VEKA 1G67A 3MUXA 4KKXA 5FI8A 3MI6A 3PM6A 1DORA 3N34A 4AWUA 3UWUA 5K4ZA 4JEQA 4UTTC 2Y88A 3BG9A 3LB0A 4HNUA 4ORMA 3NA8A 3C3NA 4RZ5A 4ZQMA 3O07A 1I2QA 2LLEA 1YYAA 2YGYA 3PBWA 3TE9A 3DFPA 3TROA 2E5DA 5HR6A 1P5BA 1X8FA 1EP1A 1TIMA 4RLIA 4Y8FA 2Q3RA 4CLMA 2WOQA 2YYTA 2Y70A 3GAYA 3KHJA 4IMFA 4AHPA 5LSMA 3UXDA 1GYLA 1S5TA 3UWWA 3KOFA 1KV5A 1Q3NA 3EX1A 3FYPA 3IEBA 1EB3A 3W7KA 5BMWA 3C2RA 3LV6A 1H50A 3NPXA 1VGAA 1W0MA 1TRIA 2BX7A 2V5LA 5CSSA 2EPHA 1ZAHA 2QF7A 4MKNA 2A4AA 4O14A 4JN6A 3PUOA 3MI2A 4GWEA 4O8RA 5DXXA 3SI9A 5DBTA 2Y7EA 4JDYA 1EP2A 1PL9A 2IQTA 4NVTA 1LDCA 3G1YA 4LTSA 3B03A 3TNOA 4S2BA 3UZJA 1W5QA 4XTDA 3TW7A 2PC4A 2C13A 4XKYB 1SZEA 5AHNA 5D2XA 3HG2A 3RLVA 3O06A 3HO8A 4O52A 3ABQA 1BKSA 3HG3A 1C29A 4ADTA 2WSQA 3NPUA 3LERA 1Z41A 1A50A 2RFGA 3OEXA 2DJXA 1JCLA 3TW6A 1ONRA 2XFWA 1TPEA 1SZNA 4LWWA 1YXYA 2CLKA 3KRSA 2VELA 3T78A 5DN1A 2ZTKA 1PV8A 1X6UA 4HN4A 3TH6A 3A22A 3NQ7A 3STEA 1SQ7A 1DOSA 4AMAA 4AH7A 4UTHA 2VEPA 4N02A 3IGUA 2FDSA 2WSYA 3ELFA 1TQJA 3KX6A 4Y9AA 2QAPA 1TMHA 1DL3A 2C18A 3T55A 1XC4A 1FUYA 4MYXA 3VE7A 3TAOA 1Q6LA 3FFSA 3TR2A 3BARA 3F03K 1OFDA 2I9EA 3W22A 1K7XA 1KFBA 4OU1A 4UTWC 2E6AA 4LUIA 4JIPA 1TV8A 3QQ0A 4O4WA 5E0KA 3C2VA 1YPFA 3QMTA 2V5BA 1K7FA 4OE7A 1BTMA 1UJPA 3RU6A 3G1AA 3S42A 1Q6RA 2DZUA 1AW2A 2X2GA 1SFJA 3C2FA 3JS3A 5AHFA 3MJYA 3L0KA 3BW2A 1H62A 4RK8A 1NF7A 1FQ0A 2CLHA 4A29A 2YXGA 5TQLA 1LRTA 4HIBA 2VFGA 3E49A 2ZZ4A 3EKLA 3QM3A 3TSMA 1Q45A 5KZDA 1GT8A 4EOUA 2DP3A 5HWNA 1I2OA 3G0UA 4NX5A 5K9DA 4JTJA 4IX2A 2Z0IA 3I7RA 3GNNA 1LLWA 4BI6A 2NXGA 1NFBA 5A8GA 5AYYA 3N2XA 4UCGA 5AB3A 1XKYA 4PA8A 4PL2A 1NSJA 4UFHA 1PHQA 5CZJA 4K39A 2VEIA 3NM3A 4I7VA 4YCOA 8TIMA 2FTPA 3LTPA 6ALDA 3YPIA 2JGQA 3LHTA 2RH9A 4O1DA 3BGJA 1G6CA 4K7VA 4A2RA 3W1NA 3LHUA 1H1ZA 4AHQA 4I9AA 4EF9A 3G24A 1GG0A 3SZ8A 1XBXA 4FIRA 3W7GA 3O16A 4JTGA 3PBYA 1TRDA 4OHQA 5KZEA 2NUWA 4K8HA 3V75A 4X9SA 3ABRA 2C6QA 3KAOA 4Q32A 1A5CA 2FB3A 1SSDA 1XI3A 4AAJA 4UMBA 3DBPA 4WX2A 4JNMA 1TYGA 2YZRA 4CCCA 4QJ1A 3CLMA 2DZXA 2C1HA 4IMDA 1JRCA 4N4QA 2HS6A 3M16A 4PODA 4RV8A 4XWUA 1H51A 1K7EA 3NM1A 3QQ1A 3WK2A 1ZENA 3G8EA 5HUPA 1I4NA 1J2WA 1GWJA 4JY8A 4BWLC 2GPTA 3LCIA 2C0AA 3HGSA 4QAIA 5BOOA 4JTIA 4UFMA 3TFXA 3L66A 3EKZA 4GNJA 5D05A 3S1UA 2ZBTA 4FO4A 1M5WA 3LRLA 3L9CA 4PTNA 1IXOA 1YTEA 2BWGA 2QCNA 5DCEA 3DKLA 1QCWA 3W07A 4RXFA 2BSLA 2O7SA 4UIOA 3W7HA 3IGXA 1LRNA 3C2OA 3W2KA 2G97A 2E5CA 2CFFA 1FY6A 2VFIA 1VLIA 2ABBA 4WY0B 4LVGA 2G5WA 3UWVA 3BO9A 4LC6A 4Y6GA 5MHBA 4LC8A 1W5NA 5EMUA 2NV2A 4K36A 1HO1A 1P0KA 4O18A 2GUUA 4NUWA 4DXVA 1FCVA 3TSDA 1G4PA 1DQXA 4S1FA 3S1XA 3DKJA 5G1YA 4K7YA 2C16A 3T7VA 3RFAA 1KBIA 1XM3A 1OX5A 1K02A 3KVKA 4DBDA 5E93A 5CGQA 4Z1BA 2OX1A 3N9SA 5EL1A 1D3HA 1LOLA 3HJZA 4ZVJA 5U4NA 1B4EA 1KM1A 4M19A 2RDWA 4GFSA 2FB2A 1KM3A 3FA5A 2QCDB 2Y7GA 2JGYA 4U4MA 1SW3A 4C1LA 4QISA 3NL3A 4NXSA 5AC8A 1QPQA 3NVTA 4DF1A 2QUVA 2ZA1A 3C52A 5HNRA 2QCGA 2Y89A 1RQBA 4GE8A 1Z42A 1P0NA 3SR7A 3DFTA 3MBFA 1LBLA 3DAQA 4GC4A 3L65A 4YLWA 5F2GA 2NLIA 2FPTA 3VNDA 4LRSA 2E5BA 4JTFA 1R47A 3EWBX 4E2BA 2G96A 4O16A 3W85A 2NWSA 1AL8A 1ZAJA 3GXPA 4NZFA 1J4EA 1TPUA 1V7YA 1ME8A 3W71A 4WY0F 2AAMA 3O1NA 1OX4B 2NV1A 3TC6A 1OFQA 5HWMA 5SWUA 2ZRWA 2PRMA 4O1CA 3C6CA 1ALDA 4NJJA 1K03A 3NGJA 1BWLA 1WX0A 2GOUA 4UR7A 2NZLA 1NVMA 3LCHA 5HQEA 3NR0A 1KFKA 2A7RA 4CQ8A 3OVRA 2F7FA 2VENA 5K9XA 4TU1A 3P67A 3CWNA 2WO5A 1DHPA 1RD5A 2A21A 1X1OA 2QCLA 1F73A 3UQNA 2DZTA 4CNNA 2HMCA 4O50A 2V8ZA 3DXIA 1C9DA 1GVSA 3W1QA 4BFAA 5CZ0A 1VC4A 5KITA 1PCWA 3M41A 2GQ9A 2Q8LA 4EWND 3B04A 1SFLA 1XDMA 1YDNA 4WQ6A 3NQDA 1BWKA 1JQXA 3E12A 3QRHA 4XBKA 5L6UA 4XUGA 3CQ0A 1ADOA 4O15A 1FDJA 3BLIA 4IMEA 4FX7A 1GYNA 3W1XA 1IGSA 3CIXA 1TSIA 4WY0A 1JR1A 3TV8A 2PRHA 5DBUA 3OBKA 3HPSA 1QO5A 2EKCA 1I2PA 1VHCA 3CHVA 1ZCOA 4X2RA 1SW0A 5DY3A 3G1XA 1PCKA 4HPXA 3M9YA 1KM4A 3PULA 3W23A 3G3MA 4OGZA 2YSWA 4O13A 2YFOA 2J9ZA 3W7OA 4YXGA 3NZRA 3GX9A 5D03A 1ICSA 3SY5A 2GJNA 3IIZA 3W87A 4JD4A 1FCBA 5C5YA 3W7JA 4JTKA 3QSRA 5DCDA 1LOSA 2QCDA 3TC7A 3P8JA 3HGOA 3ANYA 3GDTA 2FPYA 1F2JA 1LROA 1YXDA 4HNTA 1WQ5A 3PBVA 3L0NA 3N3MA 1FDYA 5LHFA 2CLLA 3MYOA 1X1ZA 4Y96A 1R46A 3TFCA 4BF9A 1KM6A 3O05A 5D30A 2H90A 4NJKA 1XL9A 3S5OA 1YXCA 3A21A 4HHPA 3UPWA 2CZ5A 3IIVA 3LCWA 4MUZA 3FKRA 4N9DA 4AB4A 3W7EA 2CZDA 1OX4A 2WNZA 2A7NA 2GQ8A 3LBCA 1W5OA 3L67A 1TQXA 1SSGA 2ALDA 2ZA2A 4AXKA 5H91A 4IMGA 5AC7A 3CC1A 2WQPA 2DZVA 1KTNA 3E02A 2E09A 1O60A 3DFNA 5C6MA 2Z6IA 3ZWTA 2EHHA 3ZS4A 5LGXA 1QMLA 2VEMA 1VJIA 4KWWA 2P0OA 1ZNNA 1H7PA 2FPVA 5G2HA 5BMXA 3C0JA 3QFEA 3LDVA 1QPOA 3EB2A 1KW1A 1TREA 4WJEA 3SIZA 3EEGA 4MFDA 4UNLA 4DPPA 1L9WA 4O57A 2KZHA 3O15A 2WPBA 1OF8A 3TCEA 3LX9A 3PBUA 1TV5A 1DJQA 3E96A 3WJSA 4DQWA 3QMSA 4OV4A 3HPXA 3W1AA 3QYQA 4M6PA 3PB2A 4JX5A 2I14A 2GQAA 4BWLA 3N9RA 5HULA 3PUEA 4MFEA 1OF6A 2Y62A 1MO0A 4O54A 1JCNA 4M7TA 2XN1A 3DHDA 3NO5A 2QEZA 4ADSA 3G22A 3IIOA 3JR2A 4O17A 1SO4A 1EEPA 4GUJA 2PURA 4FIQA 4DBEA 3LCLA 3W7RA 2P10A 4MVAA 2H6RA 2JKPA 3QPYA 3LRKA 3RLUA 1D9EA 1SUXA 3N2MA 2ZZ7A 3W7MA 1W37A 3GXTA 5D2YA 5G1TA 3UWZA 3LHVA 2X16A 3MP5A 4UFKA 1B9BA 1WXJA 3W7QA 3L68A 1KFLA 3QW3A 1SU5A 1HFBA 2NX9A 3Q2DA 1VR6A 3NQCA 3QW4B 2QDGA 1L6SA 3R89A 1EA0A 4XQ6A 3INPA 3NXFA 1KV8A 3S1VA 5LNWA 3U8GA 2X1TA 3GR8A 3EX2A 4N9EA 2RHGA 4O0ZA 3CIWA 3O6YX 1ML1A 3NL6A 3P81A 3SW6A 1WBJA 2EAWA 5HR7A 4JGDA 4X22A 3MYPA 4UTJA 1T8XA 3IV3A 2Y63A 1PE1A 3NQ6A 4GBUA 4YL2A 3KRZA 5D37A 3W2UA 3P60A 1GTHA 2EGZA 4C1KA 1FWWA 5HUOA 4NZJA 1KFEA 1ZJIA 3MBDA 4LS0A 1TB3A 5DELA 4NXKA 5KZMA 3S5ZA 3UZ5A 4LY8A 2V0TA 3WFAA 4FF7A 5G4WA 1VRDA 3M43A 1RR2A 5F4WA 1D3GA 3P61A 3ZR4A 3MHGA 1L6WA 1TO3A 2X1RA 3S9YA 5AHMA 4Z08A 5CZTA 1VCFA 3M5ZA 1GZGA 1ME9A 1R2RA 3KFTA 4KFNA 1OJXA 1G69A 2WSRA 3MMTA 3CEUA 4IPIA 2Q3OA 5HJLA 3S0CA 1TTJA 4XTIA 1EWDA 5AHIA 1WA3A 2R14A 4R33A 5K7JA 3E0IA 2E1DA 3B4UA 3KVJA 3NQMA 4GUFA 4GRSA 5C2XA 2YW4A 4WOQA 1A5SA 3FYOA 4UNKA 2FQIA 2VOMA 3A5FA 4UUIA 2J88A 2E6YA 1FWNA 4IGHA 4OT7A 3TXZA 3Q94A 1YDOA 3HGJA 1FBAA 4MZ1A 3STCA 2FIQA 5D38A 1OABA 4FB7A 3THAA 4LVAA 1AL7A 2QJGA 2CLMA 2P1FA 1JUEA 1H61A 3MWAA 5AYXA 2Q8ZA 3DU0A 3LRMA 5L9FA 4NNCA 4UTLA 1LBFA 1SPQA 1WDWA 4JX6A 3IRDA 5G4EA 3BLFA 3QMRA 2HSAA 1JRBA 3IIPA 1Z44A 4DO6A 2OT1A 3KXQA 4UFJA 1TPWA 2J9XA 2A0NA 2AGKA 4FNTA 4FX6M 4Z0JA 2YR1A 3PR2A 3G18A 3O8AA 3PUDA 1I2NA 3HG4A 1LTDA 1VYPX 1VYSX 4OWGA 1YDVA 5KSWA 1YTKA 3OHIA 4O1BA 1PS9A 3NL5A 4P61A 3CTLA 3A9IA 4L4LA 1OYAA 1F74A 2ZZ5A 3BPWA 4NU7A 4N2YA 3FJLA 3UWYA 2HS8A 3HQ1A 1M7PA 4AEOA 3H53A 3TJXA 1PHWA 1H60A 3W7PA 4Q4KA 4MZYA 4RXGA 5CKSA 3R8RA 3G3DA 3M5YA 2A6NA 2XN2A 3H55A 1KM0A 3HG5A 1XUUA 2ABAA 3MW7A 1O94A 3RF9A 3W86A 3UY8A 5LHEA 3L2IA 4R7JA 3KRUA 5K4XA 4PH6A 3PB0A 1OYCA 3EWUA 4TX9A 3Q37A 3W7IA 1N55A 3CM4A 4PFMA 2QUTA 5F2LA 2ATSA 2C3ZA 3PC0A 2ZRUA 3LOTA 4HNVA 2J27A 2ISVA 1TV7A 2AQWA 3C4UA 4GUIA 5DLCA 3TUUA 2V2DA 4WZHA 3G0SA 5C55A 1L2UA 1JUKA 1GVOA 2ISSA 1JCJA 1KTCA 1J5TA 3A23A 4RJEA 3W7DA 3NPVA 1VQTA 4ZQRA 1QDSA 1LYXA 2QCMA 3PS7A 5EY5A 5D04C 3LI0A 2Y6ZA 4JTLA 1YPIA 3I65A 4OBTA 4K6AA 5GVJA 3O63A 5F1UA 1TPFA 1EP3A 4A3UA 2RDTA 3TAKA 4B5NA 3IVUA 1RQHA 2Z2UA 5F4SA 2Z1BA 1L6YA 3CPRA 3QPZA 1U83A 1S3HA 4UTTA 4N6EA 3GIYA 3QH2A 4UTIA 3WJZA 3FOKA 5K9CA 3H54A 4QNWA 2B7NA 2A6LA 3GDMA 4ML9A 1KM2A 5KMYA 3PAJA 3E9AA 1CW2A 4MIMA 2RDUA 1FCQA 2YCEA 4IXHA 4O28A 1H7XA 1Y0EA 5DY2A 3M7WA 5CG7A 2G95A 1FWSA 5IM51 1WOAA 4NT0A 5F4XA 2WNQA 2JK2A 4M6QA 3M5VA 2UV8G 1M6JA 5T26A 3Q58A 3TMLA 3VCRA 1ICQA 1ZAIA 1DJNA 2CU0A 3BVJA 1W5PA 1HTIA 3WJYA 4WOZA 4U28A 1AK5A 2OZ0A 4JYFA 4ORIA 1QFEA 3P7YA 1OFOA 3W74A 3EX3A 4RCXA 1IIGA 3EX6A 2BLEA 3U6WA 4QSHA 2A5HA 3N73A 3GR7A 4UR8A 2TSYA 3WJWA 3LBMA 5D2TA 3QF0A 3HF3A 1UUMA 3P5ZA 5LNRA 1JUBA 4XZ9A 5I3KA 1OK6A 2CWNA 3N19B 5D32A 3DFQA 1DVJA 3NL2A 5BRBA 2J24A 5ABTA 3PWAA 3G8RA 3TSBA 1MZHA 1WV2A 1LZOA 3MHFA 4LOCA 1O95A 2YX0A 3IIXA 2VKZG 3UXAA 2X30A 3FS2A 1P1XA 2CLOA 4Y90A 1H7RA 4MZ8A 3LXCA 2A2IA 2WKJA 3ZFHA 4JTEA 1F6KA 1H7NA 5K3VA 3F4WA 4JR5A 3I7SA 3P74A 4M6VA 5D02A 4EIVA 4JYDA 2GVLA 4A21A 1B57A 4TMBA 1VYRA 3T44A 3M1ZA 3W7LA 5K2ZA 3W2NA 1WOBA 5D2VA 3EX4A 3TMQA 1XBVA 1OFPA 1CI1A 1MEHA 3A5VA 2VC6A 3L0GA 1LORA 4IMCA 4ONVA 1N7KA 1RPXA 5KTLA 2JBMA 1G7UA 2B7PA 4TO8A 4AVFA 4S2CA 3TX9A 4JX4A 2OCZA 5G2WA 4H6KA 5A5WA 4ADUA 3LGEA 2DZPA 3VE9A 4O12A 4UTWA 3W83A 1GVFA 1O4UA 2OMAA 3UY7A 3W73A 4GUGA 3W76A 4ZMGA 3C61A 1LP6A 1W3TA 2WNNA 3QZEA 3B06A 1O5XA 1KBJA 1IXQA 3QSTA 3SSJA 1FXQA 3NQ2A 2QCFA 4DEFA 3O6CA 1OFEA 4IJBA 5J5RA 2QJIA 3P80A 3DGRA 2TPSA 1M7OA 4GUHA 1XXXA 3G1VA 4LUJA 4O0KA 1LOQA 4UMCA 2PE4A 1VH7A 1DKWA 5CPNA 1TPB1 2QKFA 5FEPA 3B0PA 3UD6A 1AG1O 4D2JA 3D0CA 3NQAA 3EWWA 5AHEA 3K30A 1VZWA 1XBYA 4LVDA 2W79A 1F76A 4UTUA 1VHNA 1GOXA 4R34A 3CB8A 2C19A 1F5ZA 3S8HA 3A24A 4O53A 3GK0A 3TQVA 1KFJA 4ICNA 3IGSA 3R13A 3TIMA 3NZ1A 3B0VC 5TIMA 3TJLA 1H7OA 3OIXA 4IOTA 3W84A 2VFDA 1NAL1 1GG1A 1H5YA 3R5EA 4AHOA 4Z1CA 2VFFA 5E1QA 1OFBA 4CNOA 1JJKA 2WV8A 4MY8A 1VCVA 3GLCA 1K8YA 3AJXA 3BG3A 4MOZA 3WK1A 4QM1A 1OFRA 5LNVA 3WJXA 3LHZA 1DBTA 1JCYA 5G2IA 3LI1A 3OG3A 4NX0A 2X1SA 4M5PA 4YCPA 4MJZA 4HNNA 1KLYA 2FLIA 3TK7A 2V82A 1LRQA 3C8FA 4RR4A 4TR9A 2VFEA 5AYZA 4UMAA 4CQ9A 2Y85A 3S1WA 2DZSA 1QAPA 2EF9A 4LVFA 1W8SA 3DI0A 4E2DA 5AFDA 4AF0B 3NQVA 3NYZA 1G4EA 3QC3A 4ZQNA 4FXRA 1PIIA 2H8ZA 3G0XA 3VI2A 3W6YA 3T40A 4ALDA 3LTYA 1K8XA 1Q6QA 5FF3A 3I7QA 3W1LA 4EVZA 4HKPA 3CT7A 4E38A 1XFBA 2OT0A 5TBOA 1OFAA 2NXHA 5DCBA 5I3GA 3EXTA 4G1KA 2XN0A 2I1OA 2QCEA 3PY2A 1AMKA 1YTDA 2DU2A 1XBZA 3HGRA 3DFSA 4L4MA 4JYEA 2TMDA 3W1TA 4N9BA 4A2SA 3LXBA 4BK9A 1K3UA 1LBMA 5BNKA 3EXSA 1EUAA 4UTKA 4JXCA 3C56A 4LNYA 5FESA 3RK8A 4NJHA 3NDOA 1SR9A 5F1VA 2CZFA 1QNVA 3NEVA 3THQA 4MY1A 4RX0A 2BTMA 6TIMA 2QAFA 3GB6A 3P5YA 5I3HA 2CLIA 1C8VA 2NXIA 3LCFA 5HMSA 2B0MA 3DHFA 2NX1A 2ZZ3A 3CU2A 3LLFA 4JTUA 3BW3A 1R2SA 3M47A 5EBUA 3W1UA 3ATZA 4FNQA 2A1YA 1MEIA 5HINA 3CWOX 2Z6JA 4JICA 1ZALA 1QWGA 3LHWA 4UFIA 3SJ3A 5FEXA 4WD0A 1A5AA 1X7FA 4IX0A 1QOPA 1UCWA 3FJ6A 2QJHA 3EXRA 1YLVA 3TDFA 3S5NA 5IBXC 4WUIA 1IIHA 2ZCGA 3TKFA 4TIMA 5AHLA 4Z1DA 3GVGA 3HPZA 4N6FA 5FEWA 3AO0A 2E77A 3LM7A 2TRSA 2OJPA 4ZQOA 4HT3A 5AC6A 1TJPA 3GDRA 4MLRA 4GJ1A 1HG3A 4WXZA 3NPWA 2ZDRA 3W75A 4I7UA 3F4NA 3F1QA 5LGZA 2D73A 4JIQA 2RKXA 1TPVA 1VLWA 3W2JA 3B05A 2W6RA 4E0CA
chains in the Genus database with same CATH superfamily
4AWTA 2G3IA 2H9AA 2WWDA 2PTDA 4AF0A 4XKMA 2F84A 1QPRA 3UZXA 2ZIDA 5H8MA 1FCUA 1UUQA 4LRTA 6XIMA 4KQNA 3U2OA 4Z1AA 2WL8A 2Y7DA 4AZIA 3W24A 1TPC1 1JVNA 6ENLA 4Y2WA 2Y8VA 3NOEA 1AW1A 2HV5A 1KCKA 3KBSA 4DJFA 3DYOA 1OX6A 3BLDA 4K8GA 3W72A 3U2LA 3QR3A 3O39A 2XRHA 4AD1A 3H2CA 2ZDSA 2PDYA 3P84A 3MHUA 3BAIA 1M03A 1PX3A 1QI3A 1EKYA 5M2FX 4TX6A 1KTBA 2YA0A 2Q8XA 4OBRA 5GNZA 1WUEA 3WDQA 4LVBA 3WQ6A 1PZ0A 2R7WA 3HMCA 5F2IA 5TF0A 4PR9A 3D3FA 4NI8A 1PKMA 4MADA 1DQWA 1U2YA 4YWIA 3V1PA 4JN8A 4WDTA 4XD6A 3S6DA 5FF0A 4ZSUA 3WEOA 1WDRA 3DZ1A 1TE6A 5HWJA 1XIBA 1JXKA 5EKYA 3WD3A 1W54A 1W3NA 2PP3A 3FAJA 4FX8A 4AVOA 1W3IA 1TV4A 1JFHA 4HSHA 3NMKA 4UXDA 5AOUA 4X2PA 1CLXA 1LVKA 2YW3A 1NEYA 4CNUA 1HUVA 1YX1A 2RDXA 3U48A 5EA9A 4JOMA 4IUOA 2QPSA 3WQEA 4IMAA 1UD8A 1UZDA 3ZIZA 1GZ1A 2FHFA 1A47A 4BY3A 2HJMA 3CASA 1G4TA 1MFUA 1J2BA 3GIPA 4D1IA 3FSTA 4IPJA 2ZD9A 3EWYA 1REQA 5M1TA 1NQKA 5D91A 4I5XA 4X63A 1THFD 4KNVA 2VDGA 1EPXA 3R43A 4BI7A 1KA9F 1XWYA 3NGFA 2R05A 5CPSA 3M6YA 3PK7A 3VNIA 1WAUA 1PZ3A 5M3WA 4O10A 4LUSB 4G5DA 3DUGA 5DS4A 5JU6A 4C6CA 1IXNA 3AISA 4UB9A 2Z28A 1GPWA 1I2RA 1Q5MA 3CQZA 4JDBA 4HSOA 1P0DA 3QZAA 1M2VA 3FAPB 5COMA 7REQB 4DF0A 3ID7A 3PF3A 4PCPA 4CCZA 3KW3A 1WUFA 3K1GA 3U9IA 4PC8A 1UUOA 2Y5JA 2VASA 3UYCA 1OG0A 1WKFA 4MMWA 5CG0A 1Z7AA 1OW8A 1JULA 2OQYA 4KFPA 4DYJA 3W1MA 1EX1A 3DYPA 1YA7O 3UW6A 4UTMA 1GZJA 3FXHA 2AQVA 3LEVA 3A12A 2J7CA 2IOQA 3W2MA 3GVWA 3CL8A 2Y61A 3SCNA 1QSPA 3FEMA 3GKFA 5CJMA 4I3GA 5KYUB 3PSVA 3ALFA 4B4HA 4DXXA 2Y3HA 2TMVP 3L5MA 2NVAA 5LNUA 1ZFJA 4H4IA 3U3BA 3ZLHA 2DZWA 4A4AA 4AD4A 1Q7MA 2AWYA 2QCHA 4NNAA 3AS0A 4ZENA 1GVRA 1U5JA 4P2VA 1TR9A 3GH4A 4NCQA 1M1BA 3WK3A 2VVSA 5L0GA 1S2CA 3SYNA 3ZLGA 1POJA 3WLTA 1XYBA 2DVXA 3QV9A 4GO9A 1VFOA 1GQLA 1ONXA 3AIWA 4NZ4A 3S5YA 1DOWA 3WK0A 1YARO 1XH0A 1HQTA 4FEZA 2G50A 3W3OA 1S5WA 1MUCA 3PMRA 4EWJA 4E3TA 1V0KA 4FHAA 3UGRA 2VEGA 2AWCA 4NL1A 1DWFM 1TWDA 3WF2A 4IF2A 1GK8A 3FHDA 3QN3A 1E6SM 4J9JA 3W7NA 1SZGA 2PCEA 1EBHA 5CLTA 4DAIA 3K8LA 2OZTA 1IXPA 3LV5A 3VD3A 4V28A 2YCJA 3WG6A 3CUFA 3QVZA 1DJYA 1QVBA 2O7QA 4HOXA 3SECA 1SM9A 2CLEA 1BYDA 1B2YA 4JY9A 1QR7A 4R9XA 2CZEA 1F8IA 3VKKA 2O92A 2PRLA 3ITCA 2E6DA 3GVRA 1H1YA 2F6UA 5BW6A 3LA4A 3IVSA 2ISWA 4GYFA 4XX6A 3ABOA 3DH7A 4H7ZA 1NU7D 3LS1A 1W1IE 1T99A 2R25A 1UH4A 1E6XM 3DFOA 2V2CA 3KLKA 4LS1A 4CNTA 2EQDA 3CXOA 4GEHA 4KPLA 4QQUA 1YYJA 4UQCA 1R6WA 1EC9A 3STFA 3HOJA 5DT5A 2WM0A 1P4CA 3CV6A 4W93A 1I8JA 3RMJA 1UC4A 3CZ8A 3W7CA 3GTHA 2ZQ0A 4Q4RA 1L7CA 1Q85A 4OD5A 4RDAA 1EGZA 3E74A 3VDAA 4MWAB 1S5VA 4JEBA 3EWZA 2I5IA 3N17A 2DSKA 2MHRA 1EBGA 3CPGA 5LZLA 2J6XA 1UB3A 2V38A 3LLKA 4GINA 1TTPA 3TYUA 1DIKA 1B3WA 1KM5A 3PFMA 4GXMA 4Q6JA 5CC6A 3ZSUA 3CZKA 3WN6A 4LAOA 1LM3B 5I02A 1XQKA 2PTZA 4JTSA 1OHLA 4I7WA 1XICA 5I3IA 1M9HA 2ZTJA 3O6DA 5FA5A 4MSSA 5XINA 4F0KA 4IIEA 3GTIA 3WLIA 3LLDA 1S2AA 1SYTA 4H9YA 4E8GA 4GZJA 1GJWA 3W4YA 3K5XA 1J11A 4IQEA 3VGDA 3E2QA 3AXMA 3EWXA 4GYJA 4WIWA 3CL6A 1M6TA 1B4KA 2DDXA 4AX7A 5AVHA 3DOPA 4AL0A 1KBKA 4TMCA 2R24A 1J0IA 3LPGA 3MO7A 1CX9A 2ZFAA 3DMDA 2H7VC 4NNBA 2H3DA 4KRUA 2GFTA 5D8ZA 3M7SA 1CPQA 5G4HC 2J25A 3KTCA 4QHRA 3PM6A 2XGIA 1A0DA 4BQ5A 4DOZA 4Q7NA 3CV1A 256BA 3LB0A 4DWSB 3VM5A 1QUMA 1FOBA 4ORMA 4IJJA 4O79A 1P43A 5K0IA 3TE9A 2MNRA 3W26A 2E5DA 3RHGA 2CXGA 3L1MA 1S2TA 2GUYA 2R02A 1ZU4A 4RLIA 2J79A 3ZVHA 2Q02A 4QFUA 4Y8FA 1W2WA 1DE5A 2YYTA 1VLSA 2DT0A 1EO5A 3TOPA 3GAYA 2NSOA 5LSMA 4F40A 4H8UA 2PLKA 3H21A 4GQ0A 2ZXWC 4XIAA 4DUXA 1S5TA 1UR1A 1XLHA 1KV5A 1Q3NA 2XIJA 4GBDA 4Z9HA 3EA3A 2TAAA 2DPEA 1EB3A 3VOIA 3W7KA 3POHA 5AGFA 1EZ2A 4KI2A 2ACUA 2PF0A 1VK5A 4GY7A 2V5LA 2EPHA 2OSWA 1BSIA 2CETA 3SCOA 4JL2A 1OKKD 4ATDA 1OT2A 3BLKA 4JN6A 1XGZA 2UZ9A 1XLDA 4GWEA 2E4TA 4KS0A 2J77A 2PDXA 4B2DD 3G6MA 1AUSL 4TVUA 4P7NA 4OD4A 1XLJA 4HMNA 1YE4A 3UZJA 3TW7A 4OJYA 5JBFA 1FMVA 5DQPA 4ZOCA 3CPUA 1KKRA 4YHGA 4XKYB 4FOUA 4Z2LA 2GGGA 4W85A 1Q0GA 1RMVA 3ABQA 5DS5A 3VMOA 4M56A 3LERA 2A69F 1X39A 1Z41A 1DEDA 4MJ2A 2A79A 3OEXA 2OB3A 4WKAA 5CLWA 2GYIA 2BY0A 3KRSA 2JD3A 1EQPA 2VELA 5DN1A 4ZODA 1T5OA 1PV8A 5JXQA 3UT0A 3J06A 3STEA 1HN1A 1SQ7A 1XPYA 4J2PA 3IGUA 4DNMA 2TODA 2FDSA 3N15A 1TQJA 4HPHA 3FAWA 3POCA 1FUYA 3RR4A 1EA9C 1A7DA 2UY5A 4C6MA 6REQB 4B3KA 2PDBA 4U5GA 3ASNC 3V5XA 4XSMA 4YIWA 4P7OA 1QKRA 4TUFA 1YPFA 2C0HA 1CGYA 3RLHA 3RU6A 5FAGA 3WNPA 5FZTA 1Q6RA 2F61A 1VFSA 2X2GA 5E3CA 4JHOA 3LMZA 1H62A 4RK8A 1NF7A 2YXGA 4C6KA 3UWEA 1F3TA 1I4YA 4NZ3A 4X60A 4QCEA 4O8AA 2CNWA 4LBSA 2OZ8A 4C6BA 1XJBA 1GQAA 4GOAA 3T42A 1NFBA 3MTWA 5AYYA 3ZLFA 2ZE3A 3N2XA 3RVYA 3L8IA 1T40A 5AB3A 3U3FA 2J7FA 4GG9A 4PA8A 1NSJA 1PHQA 4FMVA 4H7CA 5CZJA 2ZOXA 4B91A 1R0MA 3DCPA 2CGEA 4JCHA 4YVPA 1CGOA 2VEIA 3NM3A 5A6BD 4Q8PA 4G1NA 3VU2A 3WQ5A 2BXYA 2FJUB 3ZTZA 3IJIA 2I5QA 2YB4A 3YPIA 1JAEA 3WF4A 2BP1A 2PAJA 4A2RA 5H1WA 3QBUA 2DH3A 4C6DA 3P14A 4EF9A 2GJXA 3C86A 3MJMA 2DQWA 1XBXA 1CXHA 3W7GA 1PSCA 1TRDA 4IL0A 2NUWA 1US2A 2GZXA 4Z2GA 3NRHA 3KAOA 1SZIA 4K7BA 4J35A 2FH6A 3RPDA 4JHZA 2INZA 3G77A 4NAEA 1L6FA 2XUCA 3RQFA 2D24A 2C1HA 3FVMA 4MS2A 4ACYA 1HMDA 1XHGA 5C9RA 5B3IA 1F07A 4XWUA 2Z26A 4L6RA 1PZ2A 2WHKA 1K7EA 3EA1A 3NM1A 3UPMA 1ZENA 3G8EA 2LK4A 4CVUA 3F46A 3NDYA 4CIPA 3EMCA 2LSEA 1I1WA 4I1OB 1MQPA 1X6NA 1FHDA 2BHYA 4UOJA 4E5TA 3VF0A 3EKZA 3S1UA 2J7GA 5MKGA 4TVDA 3WQFA 4FO4A 1H4PA 2HRWA 1IXOA 1M41A 2Y5SA 3LMYA 2BWGA 1E43A 3HQPA 2NT1A 1QCWA 3BOLA 3Q65A 1H11A 1QU4A 3H7VA 5EMKA 4LUTB 1TWSA 4C6QA 1FWCC 1RD6A 3AOUA 2E5CA 2VFIA 1T6QA 1J9YA 1B54A 1RK6A 4IIHA 1S05A 2W9MA 4NASA 4ZEPA 4O18A 4LDKA 2YLIA 1RH9A 1GHSA 4GXWA 4JJFA 4MPKA 1G1YA 1MXGA 4LYRA 2REQA 3OODA 5G1YA 4K7YA 1U1UA 1XM3A 1OX5A 1KD0A 2OX1A 2GFHA 4U33A 3GNPA 3HJZA 5U4NA 5BXSA 5C8BB 4GGHA 1LG1A 4DZAA 3NL3A 4DF1A 2ICSA 4A05A 2X1IA 2ONEA 3DKAA 2Y8KA 1HE1A 2NQJA 4M0XA 1AH3A 2FZMA 1KWKA 2R9RA 3SR7A 3DFTA 1JDEA 1OIMA 3DAQA 5I7GA 2D20A 4HBKA 2NLIA 4I3MA 3VNDA 4W8KA 2HDJA 3JU2A 1QNQA 1NELA 3EWBX 4ZA0A 3WH8A 2G96A 3W85A 4NZFA 1TPUA 1LI7A 3L4YA 2C04A 2G41A 1OX4B 3WL1A 2UY4A 5CGTA 4XISA 2ZRWA 1Q0KA 4CD7A 1NJJA 3BOFA 2VCBA 5I24A 4HMEA 4GO8A 4NJJA 4UR7A 1ZW2A 4MKSA 2NZLA 5HQEA 3HPFA 3CBWA 4QG6A 3MUIA 4CQ8A 1AEPA 1JZ4A 1DPMA 4C7GA 2VENA 4TU1A 2P53A 1UWRA 3N2CA 2QCLA 5CI9A 1F73A 2DI3A 2UY3A 1XW8A 4ER9A 3H12A 2Y3BA 4O50A 1Q2RA 4WRHA 3DXIA 1NIUA 1GVSA 3BURA 3T8LA 3W1QA 1GQKA 3DYMA 1VC4A 5CQ1A 2C03A 5REQB 1RAKA 5D92A 1SFLA 2DFAA 1XYZA 1BWKA 4HGXA 2V67A 5L6UA 4OTKA 1ISVA 2VGFA 4O15A 5BWAA 1QI0A 3H65A 3F4VA 4LB4A 4WY0A 2PU1A 1JR1A 5DBUA 4E0HA 4NIRA 3MT1A 4H6QA 4R5EA 1I2PA 1VHCA 5DY3A 4M6UA 5GJNA 5JP7A 5ECVA 3M9YA 4GNVA 3W23A 2FMOA 1UH3A 4HPNA 3LNMA 2YFOA 4ZBCA 1WWPA 1EZWA 3WNKA 3H2FA 4EHPA 2YL6A 3SY5A 1T01A 3W87A 3ZWIA 4LERA 1FCBA 2X2YA 4JTDB 3FVDA 3NQBA 3RJYA 3WUFA 4JTKA 4FI4A 1CGUA 3BL3A 1QHOA 2ZUVA 1LOSA 2JQXA 1AQ0A 2PTXA 2KSFA 3P8JA 1POKA 4GYPC 2DH2A 1ESWA 3IJ9A 1LROA 2IXUA 1PPIA 2PC8A 4HNTA 1RP8A 4CS9A 1WQ5A 3U7VA 3L0NA 3DFHA 4ERIA 4CS8C 4YL0A 1HY5A 4QJ5B 1UWSA 1NWSA 4B9YA 1MNZA 2ODOA 1Q7QA 4QBXA 4BCEA 4XZLX 2XLVA 2V68A 2I57A 3FHAA 1QPKA 3W7EA 3JTLO 2GQ8A 3LBCA 3LQGA 1TQXA 1DWGM 2P76A 4PUUA 4BJ1A 2O9OA 1WP6A 5AC7A 1C90A 1S7ZA 2P0NA 2WQPA 4PACA 1O60A 3DFNA 2WZMA 2Z6IA 1U5VA 3TN6A 3ZWTA 2D5RB 4JIEA 3R25A 5E3AA 3FHQA 2PWDA 3IQ5A 4KWWA 3LG3A 3SNHA 5BMXA 1ONWA 1AZ2A 2L5HA 3T0DA 1R9YA 3ARZA 4JEAA 2YEVA 4OINF 4WJEA 3MMUA 2P0IA 2HPMA 1ENUA 2G37A 4LALA 3UA4A 1V8EA 4TOQA 3O15A 3TCEA 4MTGA 1UD2A 1TV5A 3E96A 3WJSA 3ZOAA 1M01A 1XLFA 4M6PA 4BEJA 4H9TA 5FCZA 2I14A 2W3ZA 2DSUA 1RA5A 3GG8A 2VRKA 5HULA 5B1BC 3UZYA 4GYKA 1NLXA 1W9BM 1H0IA 2Y62A 3EMQA 2HISA 2B0JA 2WC3A 1FHLA 4B90A 3P2VA 2QEZA 4ADSA 3OGRA 4WKFA 3WF0A 3JRMO 4MVAA 2H6RA 1NDYA 3U5YA 4BF5A 1FA2A 1SUXA 3QR0A 1FWEC 4KT2A 4U5IA 5D2YA 1V02A 3MS8A 3LHVA 2J0XA 1ADDA 4PTXA 1B9BA 2R7UA 1WXJA 3EZ4A 3T07A 1KFLA 1BGAA 4ES4A 3WQWA 2I7GA 2Q71A 3NXFA 5I09A 4JQAA 3S1VA 4KERA 2RHGA 4KMQA 1P48A 4WDUA 3ABLC 4PBFA 5IXEA 4XBJA 1WBJA 5T1DB 2W66A 5AZ1A 4N6HA 4C6LA 4A3RA 4JGDA 4H83A 4WHBA 4X22A 3MYPA 2YVKA 4L56A 1Z3NA 2OR2A 3KRZA 4ZR8A 1O12A 2Q7RA 1GTHA 3KYJA 2DVUA 2EGZA 2QVNA 3MKCA 3FA4A 2OXNA 1E0XA 2PTWA 2F6KA 3MBDA 3ECSA 3BE7A 5KZMA 2D2OA 3WLOA 1VKFA 2DZAA 2R1MA 2J8FA 3UZ5A 2VDHA 2PEVA 3SUSA 7XIMA 5DT7A 1D3GA 3P61A 1L6WA 3AJ7A 2EO7A 3S9YA 1ITCA 1RSCA 5CZTA 1GZGA 3GU2A 1ME9A 4ATLA 1B0IA 4KFNA 2AGTA 1G69A 3SXMA 3CEUA 4DRHB 4XD5A 4MKVA 5HJLA 4MVZA 3LZ5A 2IPWA 2YL3A 1EWDA 3VCCA 6XIAA 2ISFA 3CMFA 2R14A 4EKJA 3BEHA 1NM9A 5TNVA 1E6QM 2E1DA 3KVJA 4PZVA 4X9YA 3HTKC 1WASA 3SCRA 5C2XA 4WOQA 1H2JA 1CPUA 1MMGA 3Q7LA 4Y9MA 3FYOA 4UNKA 4MVRA 4PUKA 3OB8A 3V35A 1KO0A 2VOMA 3A5FA 4UUIA 5BUOA 2E6YA 3WNNA 3TXZA 3OA1A 3CL7A 1LT8A 2XM1A 3HGJA 2L6FA 4YWSA 1CGVA 1I75A 3NWRA 1GQJA 3THAA 4AXNA 2QJGA 2Z27A 2V26A 1JUEA 4V1XA 5AYXA 1VPQA 5HJXA 1LBFA 3WYZA 1SPQA 4LEFA 1WDWA 4S3FA 1UWTA 3VD7A 1OG6A 3QMRA 2J7EA 5A6JA 3OQEA 3IIPA 4FAMA 3PTMA 1Z44A 1NOUA 3KXQA 4BZYA 1K4HA 2AQOA 4FNTA 1ITQA 1DJHA 3W8HA 5ABHA 4YN5A 4Z0JA 1K77A 2PBEA 1EDQA 1IV8A 3QFWA 2VO5A 1LTDA 3B0XA 4B5WA 1VYSX 1KXTA 3LLXA 1XIHA 1P6CA 4L4LA 1OYAA 1NWUA 3F2DA 2ZZ5A 2J7DA 3KEHA 3UWYA 1JF6A 3P0WA 1EOKA 3G6LA 1JDDA 3H53A 1PHWA 2PWUA 5CKSA 3UG4A 3M5YA 1OGBA 1X38A 7A3HA 4GPNA 1KM0A 3NYLA 3HG5A 4I5UA 2ABAA 1D7KA 1X6LA 2L6GA 2OYLA 3VAYA 2GA0A 5GQBA 4YVXA 3AXXA 5K4XA 4CS8A 4XK2A 3WLKX 4TX9A 2CHNA 3Q37A 4WK9A 5KYWB 1XP3A 5F2LA 1M3UA 2ATSA 3AYVA 2WVQA 4HE8D 3VNLA 3E6EA 1G0CA 4O7GA 3AIVA 3PPFA 3C4UA 2AQWA 3JSEO 4GUIA 4LBUA 3FNDA 3GEEA 1NU9C 2DVTA 1L2UA 4K1OA 2BB0A 2HMQA 2BVTA 3C18A 2ISSA 1JCJA 1J5TA 1JR8A 4LUYA 3IJ6A 3W7DA 1R38A 1KU2A 2ZXDA 3PS7A 1Z6KA 2Y6ZA 1Z7Qc 2W91A 3PAOA 2A3HA 3I65A 3QVQA 4K6AA 9CGTA 1IT8A 1R3VA 4A3UA 2RDTA 3TAKA 4B5NA 1ZBKA 1RQHA 3RYLA 1UH2A 3SCPA 2HZGA 1ORJA 3UR5A 1J18A 3GIYA 4EP8C 1US3A 3IUHA 5AY7A 4UQ9A 2QJJA 2G3KA 1S2WA 4QDMA 4CJGA 2JEQA 3H54A 4Q4MA 2A6LA 1KM2A 2WHMA 3THUA 3I5QA 2ZUWA 2WZFA 3SEOA 3UCCA 4JHMA 2ICWG 1JZ8A 3ZSTA 4LDRA 4KGJA 5DY2A 1VBGA 2JPUA 4KEUA 3DJNB 1FWSA 2A6HF 4MB3A 4N06A 1XH1A 2W9YA 4EACA 4DJED 1M6JA 3Q58A 5A8MA 4W5ZA 2CU0A 1DJNA 3AJMA 1W5PA 3A4WA 4WOZA 4U28A 3W2WA 2OZ0A 3PP7A 2HWGA 3SFWA 3W74A 1OY0A 4NAFB 1IIGA 1RKCA 1LF1A 2A5HA 4UWMA 1XGDA 5EMMA 3N73A 2XVNA 2OLAA 2TSYA 1H0GA 3C0SA 2F22A 1KXQA 1PBGA 4RE4A 3HF3A 1FWHC 3P5ZA 2MANA 3N19B 3DFQA 2HV7A 1GORA 5HQLA 5ABTA 1FWAC 1WV2A 3MHFA 3EGJA 3KBWA 1O95A 1XC6A 3V5OA 3EB3A 1XRVA 3A3HA 4QEHA 4ZTYA 4MGGA 4MZ8A 4Q4ZF 1J96A 3LXCA 2WVVA 1V6YA 4LAZA 4B2DA 2XFFA 2GL5A 2P8BA 2O9XA 5K3VA 4IL2A 4Z2JA 3MUCA 4ICMA 2OEMA 4M6VA 1MQRA 2PB1A 1N8IA 4EIVA 1QNPA 3BTNA 4CN6A 1V79A 5FJTA 4A21A 5FL1A 4RE3A 4DM2A 3EDFA 3RU8X 3DN5A 1HL9A 4ZXLA 4CU8A 5K2ZA 3W2NA 3SRFA 4MVMA 1IZKA 1O1HA 4EBKA 3A5VA 3V0SA 2CZVA 3AWNA 4FF5A 2YZ5A 1N7KA 1RPXA 2ZXRA 4RD9A 1E9LA 1ZJAA 9XIMA 4LPCA 3D5HA 1OXKA 3NO3A 4S2CA 4PBEA 2OCZA 2BL2A 1YIXA 3VE9A 3VXGA 1LQ0A 3REQB 4GQBA 4MTFA 4D6CA 1WATA 4C90A 5F5HA 4GY0A 4GUGA 1LL7A 3BV7A 3C61A 1X97A 3A13A 1E40A 3WLLA 4MF4A 4IUGA 1IXQA 2V5CA 2P1AA 3AS3A 4XIMA 3BLPX 4IJBA 2OJED 3P80A 1XXXA 3V0UA 1PKYA 3J7HA 1J0YA 4O0KA 2PE4A 5LXXA 1DKWA 4YJ5A 1TPB1 3B0PA 3WMCA 2ZWYA 1JI1A 3UD6A 4D2JA 2NT0A 3D0CA 4ZE4A 3NQAA 1VZWA 2Q00A 3FJNA 4LVDA 3SRDA 4UTUA 1VRXA 5C9ZA 4RPPA 1VTMP 2HK0A 1M68A 1ECQA 3RM8A 3IEEA 1EF2A 3TQVA 1EGMA 5TJ5E 3B0VC 1HW6A 1A3WA 4PTWA 1RJQA 2NQLA 5C2GA 3OIXA 4NZ5A 4WJXA 4QLKA 2WV8A 3GLCA 4JKMA 4MOZA 1DJGA 1OFRA 5HJYA 3PZQA 2HZ8A 3VZYA 1DBTA 4HA3A 3LI1A 2ZUUA 2BY3A 4NX0A 4M5PA 1ONEA 3L4WA 4NP7A 1ZW3A 1OCBA 4YT2A 1CBGA 2FLIA 3TK7A 1LRQA 3W25A 4RR4A 3K4AA 1ISZA 3R7CA 4HYVA 3OLEA 5EMYA 2Z1KA 3R1ZA 2J45A 2DZSA 4YTUA 4KEVA 2VNCA 3UYIA 1G4EA 2CLPA 4ZQNA 4FXRA 4RV3A 5TD4A 1BKHA 3T40A 4ALDA 3LTYA 3PFRA 1ISXA 3B9QA 2WMFA 4L4OA 3I7QA 3RIPA 2QXWA 4EVZA 3BLLA 4IISA 3VGEA 1OCNA 3CT7A 2E28A 3L8JA 2OT0A 3RJXA 1EEXA 4G1KA 3UXKA 1RKEA 4K0DA 2FZ8A 2I1OA 4IGMA 2GSEA 4TV5A 2XISA 4YWQA 3QGAC 4J3XA 4Q4OA 3JYYA 4JYEA 2OFJA 4KESA 4YTQA 3VNMA 1NG1A 2CBJA 4BK9A 5T3WA 1LBMA 3H8AA 1L8PA 3NDOA 3TNBA 4EPDC 3V5ZA 4S38A 4FK9A 3NEVA 2E8ZA 3GB6A 3KP0A 3QOKA 1C8VA 3DHFA 4HA0A 2IMRA 3QLLA 4RDZA 2XH0A 4MAZA 1J01A 3M47A 1R2SA 3DC8A 3EPOA 1Q63A 4FNQA 2A1YA 4G7FA 5HINA 1TFOB 2FYMA 2YL0A 1ZALA 1QWGA 3LHWA 4ZB2A 4AZHA 5EU9A 5A8NA 4HZ7A 1W1TA 3WQ4A 2QJHA 4CU7A 5IBXC 1FFQA 3GWNA 4WUIA 1IIHA 4U9DA 2ZCGA 1BYAA 3WLRA 6CGTA 5AHLA 4PMVA 3BMWA 3IK4A 4N6FA 3FEQA 2ZX8A 1W1VA 1VYIA 2HEJA 3LM7A 4YL3A 2OJPA 4ZQOA 5BZAA 2PP1A 2FVLA 4MLRA 1DIOA 3QTGA 3PZVA 2A68F 1SYQA 2E87A 1UKQA 2CBUA 3F4NA 4IFKB 3F1QA 1A49A 2D73A 1RBAA 1TPVA 3C3UA 3G2GA 3HV9A 1V6WA 4E0CA 4U5DE 3JZUA 1ISWA 3GNRA 3RCMA 2EXOA 1EXPA 1E1CB 3BMVA 3R12A 2J8WA 3GRIA 3RKOF 3UR2A 3E38A 2PDIA 2WJFA 4DUWA 3VAVA 2WHLA 3CT2A 4GGBA 1FXPA 3R2GA 3U5SA 2NUXA 1F7BA 3WENA 1LLZA 5AN7A 2O9PA 1I0DA 3AAMA 3G50A 4UZSA 4IWWA 4A22A 4BJ6C 4JS3A 5LNSA 3N18A 1ITXA 1TJ0A 2KK1A 1FDZA 3HZ3A 4HZ8A 3TJIA 2CLFA 3KVMA 2NUYA 2Y1HA 1W6TA 4NJIA 3HNLA 2YA2A 4MAVA 3PZNA 4RW5A 3WH5A 2XL8A 1W2VA 2AKMA 1VIZA 3QEZA 4LU0A 5IFTA 1XRSA 3SY1A 2YQYA 3IJ8A 4KEMA 1F6YA 1MMNA 3DENA 2ZRZA 1FFRA 1O5RA 1ZHAA 2VR4A 3AXKA 1A53A 2EIMC 3NG1A 3CAVA 3VUSA 1YZCA 4AE4B 4PUJA 3OU8A 4HJFA 4W7UA 5ABFA 2IYLD 1CXKA 1UIPA 4PCNA 3GTXA 1L2QA 5D33A 3K6BA 1H63A 1QQ3A 5HA7A 4XWJA 3ZJKA 4F66A 4ZL1A 5CPMA 4EPEC 2XSBA 2V30A 1QPNA 1MZRA 4GNKB 3HQOA 1SO3A 3VNJA 1MEWA 2O4MA 1W9XA 2YPIA 1JF5A 4U2ZA 1OD8A 2OU4A 4U5FE 3WBXA 2CKRA 2H8AA 1KRMA 3EFOB 1KFCA 3L5LA 1M7XA 1IQ8A 1HJXA 2HS5A 4L7ZA 2HTMA 1C7TA 1JXJA 2VC7A 4REQB 1OW7A 3NG3A 1W31A 1EF3A 1GTEA 3QW0A 4JTAA 4DXWA 4B5VA 2OWWA 3Q7GA 3GDKA 4CQAA 1AQFA 4QTGA 2XLWA 5A6SA 1NZEA 1UQYA 1W32A 3LTSA 1VF8A 5LIUX 5E09A 2E3ZA 4A3YA 5F2MA 3MU7A 1M56C 2FTYA 4AWSA 4O19A 1PV3A 3RX3A 2C8NA 1ST6A 3T8QA 4L6HA 3RQEA 3VYLA 3U0CA 1G01A 4RNIA 1HO4A 2R7SA 5CXPA 1WE5A 3OA3A 4LV9A 3W28A 3MI3A 3WBAA 1JCMP 4LS2A 2LQGA 2P50A 4R88A 2O4QA 2EPMX 1RBOB 4Q7IA 4C7DA 3DERA 1XCFA 3W2LA 2R82A 5KINA 4JKLA 4BR1A 2XIQA 2DZBA 3PNUA 4I1MA 4GJIA 1BXNA 3C63A 1Y6DA 3JZ0A 3ZMRA 4LCSA 1UP3A 4EBBA 1W56A 1OK4A 4HMDA 4PCFA 4LAUA 2OX4A 4JTHA 3T6BA 4FNSA 2W45A 4QX4A 5CGMA 3USBA 4W8BA 2WBKA 4KCTA 3TWAA 4A6GA 4NRSA 1Q6OA 3KDNA 3N1AA 3MP3A 3ENLA 3BJSA 1QO2A 3F5KA 1QNOA 5I0DA 2PLMA 3GKAA 2V5JA 1XLKA 2WZIA 1V3IA 3S4TA 4AEEA 3UXLA 2ZX6A 2PMQA 3NKDA 3LSBA 1QPUA 4HCDA 2ZRXA 4OOUA 4MHBA 2BZNA 1E6PA 1HKJA 2YKKA 4H01A 5LYRA 2VZOA 1UBPC 1W3KA 3S3GA 3M15A 4XD4A 4GLEA 4DN1A 1VPXA 2L7AA 5BROA 5I5RA 3BC9A 1VFLA 3SB0A 2YDAA 1UR0A 2WSPA 5H2ZA 3CUXA 1SW7A 3NQEA 5JMUA 1SZFA 3GU1A 4B16A 1B3XA 5A6AA 4MYAA 4F0SA 4F0RA 2JKAA 3SZRA 2QPUA 4DRJB 3VKAA 1A5BA 5J04A 4D6HA 3P82A 3QJAA 5C9XA 4PEKA 3ABKC 3ABSA 2Z00A 2Y4SA 4MNKA 4DZIA 1IF2A 3E0FA 3L4ZA 4H1ZA 1TJRA 2FMNA 2Y0FA 1B3VA 1E4LA 1UYQA 3CAKA 1D1CA 4XUYA 5HBFA 1KGUA 3PZGA 3W81A 1WZLA 4Z2KA 4Z42C 3A47A 3VM6A 4E6MA 2A3AA 3A4XA 1BF6A 5FF2A 4FXSA 1UQZA 4JAWA 4OOZA 3W88A 3CEPA 3RW0A 4UCFA 2J9UA 3K66A 2IPFA 5D4YA 3GZ3A 3OPSA 1T8QA 5HQMA 2GJLA 2FH8A 3W1PA 5IBXA 2XU2A 4HPJA 1GQIA 1PVNA 2R94A 2XPKA 4GISA 4LUSA 5DVWA 5A2CA 3BGGA 4MPQA 4UFLA 1EX5A 4ZQPA 4C7OB 4IB4A 3T1GA 4Z0SA 2GQ3A 5B1AC 3SGUA 4N7QA 7REQA 4QP0A 3OA5A 3ASOC 4JNYA 2HKVA 2R6OA 4NY2A 4C60A 4FOJA 2I15A 3T08A 5HPOA 4DO4A 3S6TA 2OTDA 2E6FA 3M0IA 3VNKA 3W38A 2XXAB 4X3ZA 1A5OC 3ZT5A 2ZRYA 4JTTA 2J0WA 1GJPA 2HSBA 4CNPA 2GVYA 1TTQA 4RL3A 3WD0A 2WMGA 1HP4A 1D0XA 2M4EA 1IEWA 3BW4A 4D6FA 4HA1A 3WD1A 2JKEA 4D6JA 2ZXOA 4GQRA 1W1ZA 1UD3A 4ZOBA 4DBQA 3GE7A 3U4FA 2ZRVA 1Q0DA 3ITYA 1RQEA 1QI5A 3FIGA 5KYUA 4BJ6A 1HL2A 1WZMA 3BLEA 3C8GB 4IG2B 1HX0A 4Q33A 3IRSA 1F3EA 4IFRA 3W1RA 2VC5A 5CBJA 4MVUA 3M4BA 1IZCA 3CTTA 4Y9PA 2DV0A 4DO7A 3M79A 1HJWA 3DZAA 1HVQA 2Y5EA 1MMFA 1DYSA 4YMZA 1D8CA 1U0BB 1JZ3A 1JYWA 3I4KA 7TIMA 3W29A 1JNEA 1QNRA 3K1HA 1YEYA 4CX9A 1LM1A 1YADA 2TYSA 3OLDA 1WPCA 3WZ0E 4JL1A 4HMCA 3ICJA 2FJKA 3QZCA 4J7TA 1PO9A 3H2MA 2BASA 4S23A 1ZVZA 5U7SA 3NMJA 3SEPA 3L5AA 4DPQA 3UG3A 4TTGA 2NSXA 1TVLA 4DF2A 1LCOA 1I1XA 4Q4SA 3BV4A 1RZMA 1XUZA 2WYSA 5LA1A 4XEKA 5EGYA 4JEQA 4P8VA 4HNUA 3BG9A 1EQCA 3IV8A 1E4IA 3C3NA 4RZ5A 3HTWA 4CBEA 4QCFA 3DE9A 3PBWA 2ZUTA 1DWIM 1ZHZA 2DIKA 2HPIA 1BQCA 5EMLA 2VC9A 1E4MM 1X8FA 5EBAA 4ERAA 3EDJA 4ENLA 2PSNA 4AY8A 4L9ZA 4H8VA 3WBEA 5BXPA 4LYPA 1C8XA 3BCFA 1LPEA 2VR5A 4C3DA 3KHJA 1ZBVA 4AHPA 4O1FA 4PMJA 3UXDA 1GYLA 3APGA 3UWWA 3KOFA 3EX1A 4R3UA 3TN3A 3W01A 3VIJA 5BMWA 1LJYA 1Z32X 4D9PA 1H50A 3NPXA 1VGAA 2DUAA 1TRIA 2DT1A 3ZSSA 1ZAHA 3UGPA 2AVKA 2A4AA 4P6IC 1BG9A 1XIDA 4PRWA 2PDHA 3PUOA 3VZXA 3SUVA 1GVIA 4O8RA 3SI9A 1R7OA 2GJPA 1EP2A 3TYAA 5D9NA 3SUTA 1ZRQA 3U0HA 3G1YA 3WMSA 1E4NA 4HCLA 3TNOA 1MMAA 1NBBA 2PU0A 2XSXA 1UA3A 4ULVA 4XTDA 2PC4A 4D6IA 4YS1A 3UMIA 3ONCA 4H6RA 4LSBA 4JFTA 1SZEA 5AHNA 5D2XA 3HG2A 3GTNA 3RLVA 3HO8A 1OZMA 1BKSA 1W9DM 2H7OA 2EEXA 4B5TA 1C29A 3ZQYA 4TX8A 4PUNA 2J7PA 2L6HA 3NSNA 1ODUA 3WLJA 1P0BA 2DJXA 5HNUA 3MZNA 3TW6A 2XFWA 1LWHA 4WVXA 3DM5A 4LWWA 1ZBWA 3BH4A 1S38A 1E83A 3T78A 2BHZA 2XL4A 3TH6A 4FR6A 3A22A 3VC6A 3NQ7A 1DJXA 3GHUA 1A41A 5DEZA 3S83A 3S2CA 4N02A 3BXWA 3AHZA 1H6GA 3B0YA 5C9WA 4N6CA 2MYSA 3KX6A 2C18A 1K9TA 3VE7A 2OYMA 4JVSA 1I60A 2QJMA 3TAOA 4Z1YA 3FFSA 3TLQA 3B29A 1W3JA 2QY9A 3FAXA 4OU1A 4FA3A 4UTWC 2E6AA 3O0KA 1EOMA 4LACB 3C2VA 3GWQA 3QMTA 2Q9CA 3MPGA 4OE7A 1M2VB 1B31A 3N6JA 3S42A 3MVTA 2HJPA 1AW2A 1MDRA 3ZT7A 1Y65A 3HA1A 3C2FA 3IAPA 1H7IA 2HJ3A 3DJUB 3DG7A 5RUBA 1FWGC 4A29A 1TE1A 1LRTA 5TQLA 1J93A 4RE2A 3E49A 4ZE5A 2ZZ4A 3EKLA 3TSMA 5ENLA 4QI2A 5KZDA 5DFAA 4CGTA 4JFSA 3EDKA 4NX5A 2Y3DA 1TKNA 4IX2A 3HPAA 1C02A 3GNNA 3JZEA 1LLWA 4AW7A 3H24A 4GQHA 2OQMA 1HKIA 2VMFA 3C62A 4RDVA 4UFHA 2PZ0A 4YCOA 2YLGA 1CGXA 1OW6A 2FTPA 4AD5A 3NZQA 4C6EA 3OGVA 3LTPA 2JGQA 1X1NA 3WX7A 2RH9A 5A8PA 1G6CA 2W4BA 4J1OA 3SIMA 4GHRA 4AHQA 3E70C 8XIMA 3G24A 4PMZA 2OKUA 3RM4A 1GG0A 3SADA 4FIRA 3VOFA 1S2UA 4OHQA 3UNGC 3XINA 1WO2A 3N6HA 2GDCA 1OCZC 4Q32A 3PZMA 3EG9B 1E72M 3ZG1A 1M65A 2FB3A 4IPPA 4UMBA 3F2BA 4IGSA 4FLOA 4JNMA 4CCCA 1O7AA 4IMDA 3TR9A 4XZHA 3DD7A 3NYJA 2QGHA 3M16A 4PODA 1JGIA 4PJJA 4RDYA 1DTNA 4Q3MA 3WEMA 1TV2A 2XSAA 3PN8A 1WTYA 1YNQA 1JDFA 3OZMA 2MUCA 1GVYA 5HUPA 1J2WA 3ARRA 3P6LA 4LLEA 1LUCA 5D8WA 5HANA 1B1YA 2GPTA 2IPGA 3TZFA 4E17A 4U3AA 3MCNA 5BOOA 3S90A 1E85A 2VWSA 3L2LA 3QHNA 5JBDA 3RGTA 4GNJA 5D05A 6REQA 1G94A 3H6OA 3URNA 2YLAA 1M5WA 1M57C 3F4CA 3V7OA 1Q7ZA 1UJQA 4C1NA 4PMOA 1YW1A 1YTEA 3TTOA 4FSAA 4ZLCA 1HMOA 2AAAA 5E0FA 4HU8A 4DZ5A 4P9FA 3L4VA 1MXDA 4DB7A 4GH1A 2E9BA 3W7HA 4WEVX 3IGXA 3OZOA 4Z2HA 3WQOA 2WQDA 1VBUA 3WLQA 1JRAA 1S46A 1R9XA 4PE8A 1UR4A 1FY6A 2ABBA 2ON3A 3K1DA 4U9EA 3KTXA 1GOKA 1Q4WA 4AC1X 3UF9A 5EMUA 2P3ZA 3LM3A 3EAUA 1HO1A 4K36A 1P0KA 1LWIA 4NUWA 2HNEA 4DXVA 3TSDA 3S1XA 4FALA 4QEEA 4J3VA 3W2VA 3IJ7A 1K02A 4JRZA 1TWCA 5E93A 4GCXA 1D3HA 4JURI 1B4EA 2CBVA 4GFSA 2FB2A 3WODF 4P8XA 4CD6A 2QCDB 3N2OA 2VWTA 3PTQA 5AYIA 3HLZA 4NXSA 3ECQA 4S3KA 3I4EA 4HYWA 1V02E 3WLMA 3WNOA 2QCGA 3VX1A 4F0LA 3AC0A 3L34A 3W8IA 3MWCA 1P0NA 1V3HA 3MBFA 1Z63A 1HVXA 1I4ZA 4YLWA 5F2GA 5CJNA 1E2XA 4LRSA 4XZWA 2VQUA 2ZE0A 4L4PA 3USZA 1ZAJA 3GXPA 3RIKA 1J4EA 1ME8A 2AL1A 3W71A 4WY0F 2AAMA 2E0PA 4V1YA 1KKOA 1BBHA 1OFQA 3GO2A 3II1A 3U7BA 1T5AA 4O1CA 5DLJA 4GZIA 2D2HA 4DVOA 3W37A 4XG1A 3ATPA 3US6A 1K03A 2GOUA 1IGWA 3NR0A 1OBAA 1JPMA 3AXIA 3EWDA 2F7FA 1V3KA 5D9PA 4DWDA 3N12A 3WDRA 1S39A 1R5ID 1X96A 4C6OA 2A21A 2J62A 4IP4A 4FOKA 2DZTA 2VDIA 1XIJA 3N0TA 2HMCA 1C9DA 3SXKA 3IAQA 4H2HA 1EYWA 5CZ0A 5KITA 2FFIA 2WXDM 1AMYA 2GQ9A 3AYRA 1BRLA 1YDNA 3K13A 3LYEA 4WQ6A 3ZVHB 4ACZB 2AMGA 3QRHA 4LUTA 4UQBA 5E2QA 1TQGA 1ADOA 2AL2B 1ZJHA 3AMDA 2F2KA 1F9CA 4TVCA 1GYNA 1RHCA 1E1FA 2DGJA 3W1XA 1PUDA 4CN1A 3I6TA 3OBKA 3HPSA 3NDZA 3CHCA 2PDLA 1ZPTA 3L12A 3CHVA 2ALRA 4X2RA 1WZKA 1NP0A 1BZ4A 4FR1A 5E0CA 1ZL1A 1RLCL 3KBMA 3SXYA 1JYXA 1KM4A 4CQBA 2GK1B 2VURA 3EGDA 4OGZA 2YSWA 3PWGA 4O13A 4YXGA 3QTPA 4YTSA 1GM5A 3B9DA 1VFFA 3B4YA 1LS4A 4IAQA 2XIMA 5D03A 4NTBA 1ODZA 2GJNA 3X1OA 3IIZA 3E5PA 2OG2A 1O1ZA 2G3NA 3ZT6A 4J3TA 1G4US 3WDPP 3Q67A 3BAYA 1XYLA 1E71M 1E0VA 2Y8UA 5DCDA 4Y9OA 1C03A 4CEUC 3HGOA 1MNSA 3VUPA 2BY1A 3ANYA 5EB8A 3I10A 2EINC 3N3MA 2WSKA 3MYOA 1GPFA 3C2YA 1X1ZA 4Y96A 2JF6A 5MF5A 4P7LA 1MW1A 3O05A 4H9MA 3CZEA 4JZ5A 3VD5A 3UJEA 4PSPA 1YXCA 2CZ5A 4S3AA 3LCWA 3I4UA 1MNEA 3I5PA 3DAGA 1AVAA 4D8AA 2CZDA 1OX4A 2WNZA 2QZRA 1W5OA 1WN0A 2PA6A 2ALDA 2ZA2A 1FVPA 2FHCA 3T6GB 1YBQB 4IMGA 4M1BA 3STPA 3ZJ8A 2DZVA 4HOZA 4B3ZA 1TG7A 4FAPB 2OO6A 2VX4A 4M82A 5LGXA 2X40A 1O87A 3SQSA 4HK5A 2VGIA 2VEMA 4MB4A 1ZUAX 2WM1A 1ZNNA 1K6WA 4PR4A 2XGBA 1UW9A 4GVFA 4FXJA 1XISA 1TREA 3EEGA 1FP8A 4BF7A 4UNLA 1CCWB 2KZHA 3VA8A 2WPBA 4CKQA 1OF8A 1PTGA 3LX9A 3ES7A 3QY7A 2YDQA 1PKLA 4DQWA 1PIGA 1GW9A 1NDZA 3UCDA 3QYQA 3HU7A 4PUWA 4C6NA 3MSGA 2OKTA 2AP3A 1MRQA 2E25A 1OF6A 1BF2A 1MO0A 1IR2A 3E0WA 3UETA 3G22A 2HNHA 1SO4A 1EEPA 4GUJA 2PURA 4FIQA 2BNJA 4WDWA 2JKPA 1LT7A 3ZC4A 3N2MA 4JTDA 2ZZ7A 3GBEA 3W7MA 4QGCA 3UWZA 2HUJA 3W7QA 1IHIA 1SU5A 3Q2DA 2V69A 3P3BA 1V08A 4FZIA 8A3HA 1EA0A 1VLTA 4EBJA 3FW6A 4XQ6A 5LNWA 3ARUA 3AIRA 3GR8A 4N9EA 3EX2A 7PTDA 3HNKA 4JIOA 1R4TA 3O6YX 1ML1A 2MWQA 1Q4NX 3SW6A 3P81A 1NFGA 3MQTA 2BMBA 4J5NA 1SFTA 2CBIA 1XPGA 4LDQA 5KYYB 4UTJA 1JMWA 1T8XA 1CIUA 2Y63A 4YL2A 5D37A 3W2UA 3P60A 1XYMA 5C2CA 2ACRA 4GX8A 5DMLA 4YT5A 1FWWA 1ZSXA 4GH3A 1ZJIA 3KH2A 4C6PA 1LWJA 1UZHA 1YVIA 3IQ6A 4QSFA 1JPNA 2XWDA 4MB5A 2FKPA 3WFAA 4FF7A 4V2XA 3M0YA 1AZ1A 2WMJA 3TTYA 4Y8EA 3ARXA 3PZIA 4GVIA 5TAOA 1XLEA 3ZR4A 5BQIA 3B40A 2F9RA 3GBDA 2CC0A 2X1RA 1NOWA 5F5FA 3UR8A 5AHMA 4Z08A 1VCFA 4PMRA 5I00A 1R2RA 1TKKA 4UZUA 5FKYA 3U8PA 5DF0A 1C9WA 4EUKB 1UPMB 3NYMA 3IGHX 5CSUA 3S0CA 4P7RA 5AHIA 2B31A 1GEHA 2WJDA 1WA3A 1E56A 2A1DD 7ODCA 5K7JA 4N42A 3B4UA 1G4WR 4JNZA 1FWFC 3A3XA 4QROA 4GUFA 4B4FA 1ORYA 4GRSA 4GMEA 1K4GA 4G6CA 2YW4A 4DXKA 4D72A 2FZ9A 3SCWA 3TN4A 4WSKA 4G2DA 5FOOA 5JIWA 4OIFA 1FWNA 4IGHA 1GGOA 3EH1A 4QRNA 2BC5A 3L4UA 3UJRA 2FIQA 4F2BA 4S3CA 5D38A 1OABA 3VDBA 1HJQA 3FDKA 4LVAA 2CLMA 2P1FA 2Q8ZA 1V54C 1B5TA 2R1KA 2DUXA 4UTLA 4K68A 4JX6A 4LB3A 3M4CA 2E8YA 2HSAA 2PZNA 3LN3A 3ZIBA 4FXFA 1JRBA 1F61A 3BWWA 5IDIA 1TPWA 2J9XA 5CEWA 2R9RB 2AGKA 4HP5A 3Q6MA 1YRRA 2L81A 2YR1A 3PR2A 3G18A 3O8AA 1UWAA 3GANA 4GABA 4PRRA 2EKGA 5C7VA 5KSWA 3I3BA 1D1BA 3A9IA 3CTLA 1US0A 1F74A 4NU7A 4N2YA 1UOZA 3FJLA 3HQ1A 1TWGA 3BSGA 3NKEA 5HPCA 2PWHA 1H60A 2C71A 4RXGA 2IXOA 4G0HA 3G3DA 2A6NA 1SR0A 3H55A 3W53A 1HKVA 4DVZA 4XO7A 4U5CE 2XLHA 5DRCA 3DFYA 3ARTA 2WC7A 1CTNA 3DG3A 3KRUA 5CIVA 2NUPB 1OYCA 2VZSA 4E2OA 3T6JA 1V7AA 1BWVA 2QUTA 4XZIA 3IQCA 2PDMA 2X05A 3LOTA 3RO8A 2XVPA 4HNVA 2RGMA 5DMNA 4BEUA 3C8GD 3TUUA 2CEQA 5PTDA 1NFOA 4WZHA 3M0HA 5C55A 4MNMA 1JUKA 2ZUNA 1QI4A 3W4RA 3I3DA 4RJEA 4DRIB 1E6RA 2GJRA 2G4FA 3CGTA 5EY5A 2YBTA 5L0IA 3EGXB 4DJDD 2R7RA 3O63A 2XLDA 5F1UA 1TPFA 1SMYF 1EP3A 4ANJA 4I6KA 1JD9A 3QPZA 3CPRA 3H26A 4UTTA 4BS0A 1NU5A 1GGQA 4N6EA 3W82A 4IP5A 3UG5A 3EOOA 4NYUA 3KTSA 3BZGA 4QNWA 3EDDA 4IIFA 3O3RA 1TMQA 4NKCA 1XYAA 2KNHA 3OQ8A 3PAJA 2DUZA 2Q6ZA 2OOCA 5COFA 3M6DA 2ACQA 4O6YA 3ZR5A 1Y0EA 3M7WA 5CG7A 4G78A 3FXYA 4IGGA 3WH6A 4L6DA 3JRTA 1AH0A 4LX4A 2UV8G 3TMLA 3VCRA 3WF3A 2DY3A 4YK5A 2ZKMX 1ZAIA 2OZ3A 1TMLA 3M0LA 2PLJA 5I07A 1AK5A 3HM7A 3H2OA 3SXZA 1QFEA 3P7YA 4S3DA 4GZEA 5A6KA 1RVKA 5FJIA 4KW2A 3EX6A 4C7FA 1MVYA 1V74B 2ASRA 2YHSA 4QSHA 4CSAC 3GR7A 3O2LA 4UR8A 4Q8WA 3HKKA 3QF0A 1XH2A 2VB6A 1JUBA 4RE0A 3LU2A 4RNHA 5I3KA 4DYKA 1JYNA 3MDWA 2KJGA 2CWNA 3VX0A 2PI6A 4QG8A 3NL2A 3WO8A 3G8RA 3TSBA 4LOCA 2YX0A 3UXAA 4OZOA 4GC3A 5HXMA 1UZ1A 4Y90A 3OVGA 3UNTA 1HJVA 2WKJA 4JTEA 1XSIA 1F6KA 1H7NA 3M0XA 2WPGA 3CAWA 3AS1A 5KYWA 3A9BA 3LNRA 4C3BA 2X8RA 4JYDA 2EG7A 1P0EA 2XGZA 3WQDA 4H4KC 3R6IA 1G5ZA 1TWAA 1ZYRF 4TMBA 3T44A 3M1ZA 3IWPA 4WGYA 3W7LA 4A8NA 1T6MA 4GI6A 2HVNA 3VTRA 3GC4A 2VC6A 3QLDA 4IJRA 1IT0A 2QVHA 3SSZA 3CAXA 2BOFX 2EIJC 4AK9A 4A2NB 2XDFA 3ZJ7A 2CHOA 4KCVA 2B7PA 3CYVA 2FZDA 4S3BA 1ZP3A 1IEQA 3VD9A 2X0SA 3TX9A 3TLLA 4HHLA 4H6KA 2DZPA 3AU2A 3E0VA 2ETSA 3W83A 1O4UA 2HK1A 3TTEA 2G4JA 3OIHA 1Y5XA 3UJSA 1MW3A 2OMAA 1OC5A 4B9ZA 3UY7A 3W73A 3W76A 2EPNA 2VUYA 3CK5A 3QZEA 1W3TA 2WNNA 1XD1A 3KCLA 3DX5A 3U9JA 2V3GA 3B06A 3QSTA 3SSJA 1FXQA 2DW7A 3NQ2A 4DEFA 3ARYA 3Q45A 5J5RA 2QJIA 2PS2A 5T8GA 4GUHA 4YTRA 1B30A 2IBFA 1VH7A 4ZFCA 3WHNA 4V15A 3E9VA 4KIEA 1YYXA 3D6NA 3T2OA 4W84A 1E6ZA 3LJBA 2W79A 1BVWA 1F76A 1UHVA 3AFBA 3IQTA 1MUWA 3CB8A 1HL8A 4LH8A 2ADAA 5HSWA 5BOEA 3K8KA 2WMHA 2BY2A 3A24A 4WSHA 4ICNA 3IGSA 3IK2A 1O66A 4C6JA 2OODA 3TJLA 2Z4GA 4IOTA 3W84A 3R5EA 1H5YA 3N4EA 4LCQA 2CDQA 1O6IA 5E1QA 3QHOA 4KCWA 1JJKA 3ME3A 1TELA 1K8YA 3BG3A 3ES8A 1J12A 4QM1A 1J0ZA 5LNVA 3LHZA 2BGNE 2DIJA 1JCYA 2XZ7A 3OG3A 2ZVRA 2I8BA 1R5YA 2NPUA 2FAPB 4JQ1A 2ZC1A 2V82A 3HJCA 3C8FA 4J3SA 1FKWA 3KCOA 2V63A 4UMAA 3IJDA 2IKGA 2M64A 3TYDA 2Z1VA 4AZ6A 1CGNA 3AHVA 4JBRA 3VIOA 1E55A 3OLIA 1DJIA 1ZU5A 1FKXA 4LVFA 3NQVA 5T91A 2V5DA 4FLQA 2PD9A 1SJAA 4KIRA 1JAFA 1EJUC 5L3QA 4ATWA 3OTRA 1Z89A 1RP9A 4L64A 4JIIX 5HMEA 5TBOA 1XV8A 4XZBA 1F1MA 1D0YA 5DCBA 1VFHA 2EG8A 3EXTA 3SN0A 2GAQA 2W67A 5HMDA 5C9UA 1T41A 1PKNA 5G1MA 3GXDA 1YTDA 4XLPF 4ONSA 3RR1A 1I5NA 4LNCA 3DFSA 3REQA 1R3TA 1SZRA 2TMDA 4QJ4B 1WKDA 1XGEA 4N9BA 3LXBA 4H9UA 1E1EA 3EXSA 4ILSA 4IARA 3C56A 3U2MA 1Q6GA 3RK8A 5FESA 1L0PA 1SR9A 2CZFA 1UMYA 3DXJF 4WABA 4BEQA 1QW9A 4MY1A 6TIMA 2QAFA 3P5YA 1NY1A 2NXIA 4LFYA 1R8LA 1D0ZA 2OU6A 1Q6FA 3MY9A 3WKZA 3ZYZA 3BW3A 1Z3IX 2QDEA 3ATZA 4GI4A 3D47A 2QDDA 3VNZA 3V3WA 1FWIC 1O5HA 1N8WA 5FEXA 2R1NA 3HFTA 2YL9A 4WD0A 1J0JA 1A5AA 1UCWA 2VH3A 3TDFA 1W8GA 3P0XA 3S5NA 1XLAA 3POVA 4TIMA 4ZCWA 2YOCA 2PDKA 4Z1DA 2VL4A 3GVGA 3HPZA 1SJCA 2JIWA 2E77A 3UJ2A 7TAAA 1EC8A 5AC6A 1TJPA 3WDIA 1HW1A 2IXNA 2PFHA 1Y8BA 2E67A 3BLOA 2BVDA 1SMDA 4BHYA 1E0WA 5LIWX 1R3RA 7ENLA 1UC5A 2FGLA 5DX7A 3MKKA 3OWTA 1QLEC 2W6RA 4PJNA 1G7VA 2OWCA 5E33A 2XVKA 3LPPA 3WH7A 5J5DA 2YL1A 4LW7A 3F7JA 2D0HA 1I6NA 1B3YA 4AD2A 4CSAA 4QDLA 2OVLA 4W9TA 1E3ZA 4HHHA 2ZYFA 1RJ9A 4QXIA 2OKOA 1SR2A 3T05A 4ZGYA 4HFKB 4QNEA 1AQMA 3AMKA 3AG2C 5M17A 1BQGA 2BBFA 1CB7B 1V4YA 3IANA 5I77A 1V51A 4EKWA 3T0CA 3C7JA 3WQ8A 4JCMA 6TAAA 2ZZ1A 3L21A 3GDLA 4CQCA 1WXYA 1T0OA 2R91A 3UNDA 1XIFA 2H3BA 3N24A 4KFOA 1ME7A 5I23A 1VYKA 1YJGA 4CS9C 4JTCA 3WDHA 3C2EA 2WCAA 1PYFA 2GLKA 2OJQA 1IEXA 2ZXBA 2BVWA 1H7WA 3N4FA 1RY8A 4Z2IA 5DXYA 1W17A 3S2LA 2DORA 1HT6A 1I0BA 4IPNB 1CZ1A 3GTFA 3KOXA 3E2SA 1ZHTA 3LXAA 1BEUA 2VXNA 2VRJA 1FWTA 1MXSA 1S1PA 3OZYA 3EZIA 4AY7A 1N8FA 2YB1A 2WMIB 4EF8A 3NYDA 4RPQA 5A8OA 3FMSA 4A8LA 4GXPA 2VQTA 2VD9A 3HIJA 1YQ2A 3KPHA 4FLRA 3WG7C 3EZHA 1ZGDA 1FX6A 2XH7A 3EOLA 2PDCA 5CPOA 3FYYA 3WUBA 4F79A 4F0HA 4GVGA 1G8XA 2VCAA 3S84A 3GDBA 4KNWA 5F7UA 3C5QA 1OQFA 3RRAA 3DECA 4O4VA 4XAGA 3LBOA 3OVPA 1QZXA 3VO0A 3LCGA 2OLHA 1CGTA 4IFKA 3VOGA 4UQDA 3K4WA 3UR3C 4HPGA 2D0GA 1XINA 4EXQA 3NZPA 4H3DA 1H9TA 1KQYA 3A3WA 2BOGX 3BSHA