3B0PA

Trna-dihydrouridine synthase from thermus thermophilus
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
317
structure length
307
Chain Sequence
LDPRLSVAPMVDRTDRHFRFLVRQVSLGVRLYTEMTVDQAVLRGNRERLLAFRPEEHPIALQLAGSDPKSLAEAARIGEAFGYDEINLNLGCPSEKAQEGGYGACLLLDLARVREILKAMGEAVRVPVTVKMRLGLEGKETYRGLAQSVEAMAEAGVKVFVVHARSALIPPLRHDWVHRLKGDFPQLTFVTNGGIRSLEEALFHLKRVDGVMLGRAVYEDPFVLEEADRRVFGLPRRPSRLEVARRMRAYLEEEVLKGTPPWAVLRHMLNLFRGRPKGRLWRRLLSEGRSLQALDRALRLMEEEVGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis of dihydrouridine formation on tRNA
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
molecule keywords tRNA-dihydrouridine synthase
total genus 116
structure length 307
sequence length 317
chains with identical sequence B
ec nomenclature ec 1.3.1.91: tRNA-dihydrouridine(20) synthase (NAD(P)(+)).
pdb deposition date 2011-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01207 Dus Dihydrouridine synthase (Dus)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1460 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3b0pA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3b0pA01
5HWMA 1W3TA 3E96A 1UUOA 2VEIA 3F4WA 3MUXA 4R34A 4RJEA 1K02A 4O10A 3LV6A 4JTSA 1O95A 1QPQA 1N55A 3WK2A 3PWAA 1FX6A 5F2GA 5EKYA 3TAKA 1TQJA 3DFOA 3P60A 3Q2DA 2NUXA 3SECA 3ZR4A 1D3HA 1NSJA 3QQ0A 1KFCA 4O50A 4MOZA 2A5HA 3ABSA 4DXVA 3W88A 2YR1A 3Q37A 1WYIA 4JTFA 3TKFA 1F76A 3BLEA 3DFSA 1QFEA 3PUDA 5D09A 3W1RA 2E68A 4JYEA 4UMCA 3RF9A 3PB2A 3W7PA 3EXRA 4EF9A 3DGRA 4RLIA 4AF0A 3FKKA 2DP3A 3UWWA 3G0SA 3A9IA 1H1YA 1LP6A 2YYUA 2V81A 2DZTA 2FQIA 4O52A 2PRHA 3NQMA 4NJJA 3CTLA 1XI3A 3LHTA 4CLMA 3CU2A 2C14A 4JTLA 4W9TA 3EWUA 1F6PA 5I3JA 3NVTA 3LCHA 1DL3A 3O6DA 3DBPA 4BWLA 1DJNA 2NX3A 4UTWC 4ORMA 4UTHA 2VEMA 2OCZA 1TPWA 5BW6A 4CCEA 1SW7A 4IMDA 1LCOA 3OHIA 4MY8A 4NU7A 3NZ1A 4FX6M 4XWUA 4UFLA 1ZCOA 1P5BA 3BGGA 3P81A 4ZZ9A 3HQ1A 4N6FA 1XBXA 2DJXA 2V2HA 3G1FA 4Z0JA 2ATMA 2NXIA 2E6AA 3STEA 1TV5A 4DF1A 1QWGA 4QITA 4BF9A 5DCBA 1VZWA 4NJGA 3PVFA 3W1AA 3HGSA 5LNRA 4Y90A 1TV7A 5GVJA 3MP4A 2A1YA 4WUIA 4FHAA 2HMCA 1UB3A 3GYEA 4LT9A 3W7CA 4PL2A 1JCJA 2YZRA 2QEZA 3T7VA 3QH2A 4MZ8A 1TREA 4Y6GA 3DKJA 3N14A 5D30A 5D38A 2ZRUA 4XZ9A 4TMBA 4A2RA 5FEPA 2GQ8A 2ISWA 3PBUA 3SGZA 4AH7A 3NGJA 4JD4A 1WOBA 1AW5A 4IMEA 4RR4A 3NL3A 3LRKA 1Q6QA 3W85A 1K7EA 1ME8A 3BG3A 3HGOA 3HO8A 3HPXA 2RFGA 4HPXA 3GK0A 5J5RA 3PUEA 1QOPA 1BKSA 4ICNA 1GT8A 3W72A 5D32A 3QJAA 2VFEA 4CNOA 3ATZA 4ALDA 3TA6A 2GVLA 4YL2A 1FDZA 3NQ8A 4O1DA 3LB0A 3F1QA 4XBSA 2QCEA 1QOQA 1W54A 2R8WA 3U6WA 1BTMA 3NQDA 3KFTA 1X8FA 2I14A 1YDNA 1O94A 3UWUA 4CCCA 2ZZ1A 3P82A 1Z41A 3W1NA 3UZ5A 3G1AA 2Y63A 1DQWA 3G22A 3USBA 3W7HA 1ONRA 4QIUA 3C4UA 3M9YA 4CQ9A 4Q32A 3N34A 5TIMA 2Y88A 3CPRA 1EX5A 3I7SA 4WOZA 3QSRA 1LOLA 4O11A 1JCLA 3M5VA 5F1UA 2WQPA 1JR1A 1YXCA 1PE1A 4QNWA 1JCXA 1FWWA 1EWEA 2DZWA 1LOSA 2IQTA 3L9CA 1OX4A 3G1YA 3GKAA 3T4CA 3GR7A 3STCA 4UNLA 2QJHA 1A5SA 3HMJG 3C2RA 4KFNA 5I3GA 2JKPA 3EEGA 1FWNA 3UPWA 2VFGA 1OX4B 4GNJA 4OU1A 4DO6A 5CKSA 3LHUA 3UWVA 4NJIA 4DPQA 4JTGA 4EIVA 2E77A 5K9DA 1VYSX 3LHWA 1QAPA 5ABTA 3FA5A 1QCWA 4WY0B 5HINA 5DCDA 4PA8A 3STGA 3UPBA 3BV4A 4A29A 4JIPA 5F4WA 4S1FA 1LBFA 2OZ0A 3GXPA 4NVTA 2YW3A 2NUWA 1J4EA 1B57A 1B4KA 1EWDA 4BI6A 3M16A 3NNTA 1ZAIA 3SR7A 4UR7A 2WKJA 4JY8A 4MJMA 4NJKA 3FJ6A 3LLFA 2QCCA 4HIBA 2LLEA 1R2SA 4QNEA 1YPFA 3MI2A 1P4CA 2HTMA 1YADA 4IPJA 4NJHA 3UZJA 1X6UA 4LW7A 3PSVA 4ZQMA 3DFNA 4ORIA 2Y6ZA 1XUUA 3QQ1A 5E93A 3C8FA 4NXSA 4WXZA 1Z44A 4AHQA 1SUXA 2QKFA 3W1LA 3FFSA 3PUOA 2NXHA 5SWUA 1XFBA 3W2NA 3OVPA 4TMCA 1KTNA 3W1PA 3W7MA 1HG3A 4EVZA 2WO5A 2J24A 3NDOA 3UWQA 2A85A 3IGUA 4CQAA 3W1XA 3W86A 3HF3A 4AF0B 1EA0A 3B06A 3NPVA 4GUJA 3G3MA 1KFJA 1J5TA 2E5BA 2NX1A 3TJXA 2VEPA 3GIYA 4AAJA 4PCFA 2ZRZA 1SW3A 2CFFA 2R14A 3S1UA 4YCPA 2CU0A 3LBMA 2GJLA 1MXSA 4KFOA 5D2WA 1YDOA 3G0UA 3HB9A 2BSLA 3ZS4A 4O28A 1UJPA 1VYPX 3FLUA 1W8SA 3BPWA 3S9YA 1YXYA 3FIGA 5T26A 3W70A 3TQKA 2PURA 2RDWA 4A2SA 1NF7A 1L9WA 1VQTA 2ZZ7A 2V8ZA 1GVOA 2V5BA 1PV8A 4JTUA 1QO5A 1OJXA 2V0TA 5LGZA 3O6YX 1EB3A 2Z6IA 4GWEA 4R53A 2R91A 1OFOA 5F2LA 2QCDB 3W7DA 1DQXA 1ML1A 2RHGA 2CLHA 3M0ZA 3HG2A 3M6YA 2FIQA 4ZL1A 3MWAA 5G2HA 3KHJA 3W71A 1W0MA 1ZENA 2YDAA 4ZQOA 3STFA 4K7VA 1SZEA 1VLIA 3LERA 3G18A 4WY0A 4FF7A 5DY2A 2FB3A 4RK8A 2C0AA 3GAKA 1SW0A 1RZMA 4L4LA 2QCMA 4RZ5A 2FPYA 3LTPA 5H2ZA 3TQVA 3LTYA 3GLCA 1DBTA 4DEFA 1M5WA 1EIXA 3NL2A 4E2BA 1A5CA 3KRUA 1P0KA 1U83A 2QUTA 3IIPA 1H1ZA 3QM3A 1A5BA 3OVRA 4FNUA 4N2YA 1XXXA 1WQ5A 1OFBA 2J9XA 1GWJA 2DZPA 3NQ2A 2TSYA 2BWGA 3NL6A 3TAOA 4MLJA 1OYCA 1TRDA 1I8JA 1X7FA 2X1UA 1UBSA 3NOEA 1H61A 1YXDA 3WJZA 3PG8A 1R2TA 1IIHA 5FF2A 3Q94A 2I9EA 4JDYA 4HNNA 5CZ0A 3NQ7A 6ALDA 1GVRA 2OT1A 3P5ZA 4NNCA 1K7XA 5AYYA 4PFMA 2JK2A 5A5WA 3TSDA 5AYZA 1F74A 3BW3A 4EF8A 1TTQA 3M41A 2D73A 3SW6A 3KVMA 3HGRA 3W2LA 2CZEA 1C29A 1LLZA 3KRZA 2YX0A 3MMTA 5AHLA 3L0KA 4ZMGA 4TU1A 4O13A 4XTDA 2X1SA 2VFHA 3NPUA 2TMDA 4WXYA 2NX9A 1JRCA 2NWSA 4LVGA 4O8RA 3SSJA 1BEUA 1K3UA 3S1XA 5KZEA 4JX4A 1JCMP 5CGQA 2W0UA 2G97A 1FWSA 4AVFA 1G6CA 5TQLA 5F2IA 2YPIA 3N73A 1KTBA 3C2VA 1Q6LA 3LHVA 3P8JA 3G1SA 4OV9A 1SZNA 3ZWSA 3P8IA 3RLVA 1TPVA 4JTIA 2QCFA 5L6UA 1SQ7A 3MJYA 4KKXA 1H50A 3QC3A 2V5LA 2J9YA 3GDKA 5HULA 3NYZA 3A23A 1KFBA 5C55A 1LROA 4S2BA 3W07A 3TSBA 5HR6A 2FB2A 1S5TA 3R13A 3B4UA 3GNNA 5KZDA 2CW6A 1VGAA 4RCXA 5DXYA 2RKXA 5D33A 4M6PA 1RV8A 1KFKA 4Y9AA 2Y7FA 1WBHA 1XDLA 1QNVA 1FUYA 5C6MA 4X3ZA 1TSIA 1Q6OA 1XKYA 3L2IA 2GVJA 1EP2A 1OX5A 5G4WA 3HG4A 2Z2UA 4MYAA 1YTKA 5AN7A 3W23A 4X2RA 4NX5A 3A21A 1PHQA 1XL9A 4E0CA 4HN4A 1VPXA 4Z08A 2VOMA 3G1HA 3E12A 4IMFA 1M6JA 3LLDA 5F4SA 3T44A 2C15A 3BG5A 3MHFA 1FCBA 4I7WA 1G4EA 3O16A 2Y70A 1W5OA 2OMAA 2ZRVA 1SU5A 4WZHA 2CLFA 3IIZA 5CZJA 5I3IA 1KLZA 3S5NA 4EWND 3W2MA 4O53A 4LU0A 4MY1A 1A5AA 4UFHA 3CEUA 3PBVA 4M7SA 4FB7A 3C56A 4BK9A 1KBJA 1OFAA 4MY9A 4AXKA 5C5YA 4XBKA 4HNVA 2QCNA 1G4TA 1TPC1 4JTHA 4GRSA 3I7QA 3G1XA 4CNPA 3SI9A 2WNQA 3U2OA 3TW6A 1QO2A 7TIMA 3N2XA 2X2GA 3OEXA 3LGEA 1EP1A 1NAL1 3W7IA 4FEZA 1F6KA 1BWLA 4UFJA 3W7RA 3P74A 3ZFHA 2WSQA 3EWWA 3LCLA 4BFAA 2ZRWA 5J5DA 4GE8A 1THFD 1W5NA 3O1NA 2QF7A 1FDJA 1MZHA 3NQAA 3QYQA 1GVFA 4IOTA 2H90A 3QPZA 5D04C 1H5YA 4ADUA 4FNSA 4OGZA 4LS1A 2FLIA 1ZJIA 4LS0A 3S6DA 2R94A 3RMJA 4UTTA 3UWYA 1H7XA 1QDSA 1LBLA 4UIOA 1Z48A 3IVSA 2JKAA 4UTTC 3TXVA 3W7QA 2XFWA 5E0KA 4A21A 2H6RA 3VKJA 3UXAA 3W1QA 3V1PA 4JTEA 4NZJA 3W76A 4JTTA 2JGQA 3MYOA 3F03K 5C54A 2QCDA 3M5YA 5AYXA 1KV8A 2Y85A 4Z1BA 1R2RA 3PG9A 4IMCA 3S1VA 3S42A 3EWYA 3JS3A 2QJGA 1JUEA 3DHDA 1MEHA 4LC8A 3KRSA 2A6NA 3E0IA 4MVAA 5AC6A 4UTJA 3M1ZA 4OV4A 2WOQA 4EOUA 2NUYA 4LWWA 2VXNA 3W3OA 2Y7GA 3GX9A 3PULA 4CCDA 3VE9A 3G8EA 2WPBA 5FF3A 3T40A 3UD6A 3MBFA 4JXCA 5LHFA 3UY7A 3W7NA 2JGYA 1L6WA 4XKYA 5K4XA 3W22A 3A24A 2B7NA 2C16A 3EKZA 4IQLA 5G2IA 2E5CA 3KVLA 3QPYA 5HWJA 5G1YA 2ZA3A 1VCGA 4H6KA 3W2KA 4DO5A 5LGXA 1M7PA 3R89A 4Z1DA 1QPOA 1WV2A 5EPDA 1JUKA 2A6LA 3BGJA 2ZTJA 4UFKA 3PC0A 3NQEA 2OT0A 1LRNA 3NM3A 5FEWA 3MHGA 1TPB1 2DZUA 1GJPA 2DU2A 1B4EA 3EWXA 1PL9A 2WJZA 4MLRA 1IXNA 3Q58A 2E1DA 1KA9F 3WK0A 3B03A 3HOJA 4UFMA 5LSMA 3CIXA 4O18A 4RX0A 4ONVA 1QPNA 4DBDA 5AFDA 4GUFA 3W74A 3R2GA 4UC5A 4C1LA 4LTSA 5FI8A 3EX1A 3L21A 4UR8A 2WV8A 2P10A 1KM1A 4FO4A 3TR2A 1ICPA 5IBXC 5U4NA 3C2OA 4PH6A 5DXXA 5D02A 3IIOA 2RDUA 1LM1A 1AK5A 4OBTA 2VFFA 3R12A 3NM1A 2ZZ4A 4KWVA 3KX6A 4MUZA 5AOUA 4YLWA 4AWUA 5EBUA 1G4SA 3S5YA 3O06A 3UXDA 4K39A 4UCGA 2H3BA 2ZRXA 1LBMA 3NZRA 2PRMA 3WFAA 1X1ZA 5DCEA 5BOOA 1JRBA 3KOFA 5HNRA 1P1XA 3INPA 4QSHA 2QAPA 2Y62A 3CIWA 4E38A 1AG1O 3U8GA 1IF2A 3GDLA 4X9SA 4DELA 4I7UA 3P62A 5CPLA 4K36A 3GXTA 4IWWA 4O57A 3AO0A 4N02A 1AW1A 1G69A 4UNKA 4POCA 2C6QA 3NO5A 2NXGA 4FIRA 1CX9A 2Y7DA 1F73A 6TIMA 2HS6A 1W5MA 1SSGA 4M6QA 5D05A 1OFPA 5K3VA 1SZGA 3MP5A 4HKPA 1XBZA 1KM2A 1W37A 2VEKA 1S3HA 2YW4A 2EKCA 4UUIA 1WOAA 2QAFA 4IUOA 4L4MA 3IIVA 2GPTA 2ZZ5A 2ALDA 3NQ6A 4O17A 5K4ZA 2WSYA 3IGSA 1TJRA 1AMKA 4NX0A 3BARA 4P61A 4JEQA 3UYCA 3VFLA 1J2WA 1JCNA 3V75A 3IRDA 1VJIA 1P0NA 3CQ0A 3SY5A 3NEVA 3P7YA 2Q3RA 1FXQA 1SSDA 1KM6A 3LRMA 2VELA 3CHVA 3TUUA 4LC6A 3BW4A 2GQ9A 4GFSA 2C13A 1RD5A 1OYBA 4ZQCA 3GDMA 3PF3A 2A7RA 1EPXA 3NQCA 3ABOA 5FF4A 2AQWA 3MI3A 1OFQA 3FOKA 3FS2A 4I9AA 3TH6A 3PY2A 5C2XA 2V82A 1GTHA 3QW4B 5DLCA 3L65A 2YXGA 3H54A 3MO7A 4LVFA 5AHMA 4GUIA 1A53A 1CI1A 5D2XA 4JDBA 2ZZ6A 4FNPA 2YYTA 3CM4A 1G4PA 4JYFA 3MW7A 2CZDA 1DV7A 1OVDA 5CPNA 3E02A 3S0CA 4NNAA 3HBLA 4QISA 1JQXA 3RLUA 2BXVA 1H62A 1WXJA 4YXGA 1TRIA 3BG9A 3WK3A 1F2JA 3MHUA 3S8HA 4AHOA 3GDRA 4M6VA 3TC7A 5CZSA 1V7YA 3FYPA 2ZRYA 1W31A 4DPPA 1KM0A 3O63A 3P5YA 3CB8A 2J9ZA 4JS3A 1I2OA 2EF9A 1NVMA 2X1TA 3N9SA 1HO1A 4PTNA 3M44A 3DZ1A 2J88A 1HUVA 2C1HA 4JIQA 1PIIA 1G67A 1U5JA 1UUMA 4OE7A 4LVAA 4WOQA 4TX9A 1KFEA 5K9XA 1DOSA 2XN0A 3OIXA 5CPMA 1O4UA 1ZHAA 1SO4A 3I65A 4MZ1A 2OX1A 4MFDA 3SZ8A 3L67A 1FQ0A 1Y0EA 2ZFAA 3W87A 1DORA 4ADSA 3NXFA 5K7JA 4LY8A 1AL7A 1LYXA 3EX4A 1S5WA 4GXMA 2Z0IA 1JJKA 2W79A 3EX2A 1QPRA 1W5PA 1FWTA 1XCFA 4RZ6A 2E6YA 1SFLA 1GOXA 3K30A 3L5AA 5K9CA 3RFAA 3EXSA 2B7QA 3YPIA 4ZQNA 3TX9A 5IM51 2CZFA 4Z1CA 2B7PA 1Z42A 2BTMA 1OK4A 2Q8LA 3W7EA 1HFBA 3LXBA 3G0XA 5HQEA 2RH9A 3DENA 4O4WA 3R5EA 1TIMA 4TR9A 2CLLA 4K8EA 1K7FA 2TYSA 4KWWA 2E6DA 3H55A 4IPIA 3PAJA 3LCXA 2E5DA 2V2CA 1RVGA 1PS9A 2WNZA 4N4PA 3W2UA 3B0VC 1XM3A 1DJQA 3W2JA 1JULA 4N9CA 2DZSA 3S5OA 1TYGA 1LORA 3HG3A 2WNNA 3BW2A 4JX6A 3M7WA 1SFJA 4WY0F 1SPQA 5HJLA 2VKZG 3QMSA 4LS2A 1NFBA 4TO8A 4N9DA 2G5WA 3BVJA 5IBXA 4WX2A 3DAQA 5EY5A 4NUWA 1VR6A 2O7QA 4O4VA 4K38A 3G8RA 3QF0A 5F2MA 4HHPA 3TK7A 2W6RA 3C61A 3O6CA 2DZVA 4MKNA 4UMBA 3N19B 5CSSA 3MP3A 3QW3A 2OJPA 1XDMA 2GUUA 4K6AA 4RKAA 4H4IA 3O8AA 2Z1BA 4MFEA 2J6XA 1DKWA 1LZOA 3B0UX 1I2PA 4O0ZA 3THQA 4KFPA 3TC6A 3GNDA 1JQVA 4NXKA 5I3HA 2NZLA 4ZVJA 1GYNA 4DQWA 4HSOA 4YMZA 1B3OA 4RXFA 5D2TA 4M5PA 3I6RA 3HPSA 3C2FA 2WSRA 3AJXA 1ZNNA 2VENA 4HSNA 2VFDA 1FDYA 1L2UA 2BX7A 1FCVA 4BWLC 4WJEA 4TIMA 1DHPA 3TJLA 5LHEA 4H3DA 4DBEA 2CZ5A 1WX0A 5E1QA 3BK0A 3LHYA 4O54A 1OYAA 3LCWA 2G95A 3PB0A 3P80A 5I3FA 1SO3A 4G1KA 3TMLA 5DBUA 4NT0A 4U28A 3DKLA 1WAUA 1ICSA 1T96A 4FX8A 2FDSA 1TJPA 1RR2A 4CQ8A 3VE7A 3IVUA 1JCYA 2J27A 5D37A 3D0CA 1YYAA 4PODA 1W1ZA 3CWOX 3EX6A 2JKEA 5F1VA 1QMLA 4Q33A 2CWNA 4GBUA 2TPSA 3I68A 4LV9A 1ALDA 5LKYA 1EUNA 1RQBA 5AHEA 4FNRA 4X22A 3FYOA 1ICQA 1PVNA 2QDHA 5LNUA 1WA3A 3LDVA 4R33A 3W83A 4JR5A 4UXDA 1IXOA 1TPEA 4LRSA 1FCUA 3EKLA 5EMUA 1O5KA 2H3DA 3DH7A 1V5XA 1K03A 2AAMA 2V9DA 4YWIA 4GJ1A 3TFXA 3DHFA 3WJWA 1SO5A 4A3UA 3QMTA 1EEPA 5KITA 4LRTA 1T0OA 5HMSA 1B9BA 3A5VA 2EPHA 4LVBA 4Z1AA 3DXIA 1R30A 1TB3A 2O7SA 3FJLA 1H7NA 3L5MA 3G1DA 1S5VA 1KV5A 1HL2A 3C6CA 1WBJA 1GPWA 1KFLA 3B04A 5HR7A 3CLMA 4LUIA 3RU6A 4LV4A 3TMQA 1OF8A 3B05A 2Y89A 2TRSA 3TSMA 3N3MA 1H7WA 4XQ6A 1XC4A 2CLKA 2DORA 2C18A 4FNTA 3W1MA 4GC4A 4JGDA 4BI7A 1KM5A 4UMAA 3SJ3A 3HJZA 5LZLA 4FNQA 3TQ0A 2XN1A 2FPTA 5BMWA 3HIJA 3NR0A 3W1TA 1ZFJA 1F05A 2ZTKA 4XKYB 1ME7A 3TDFA 3BLIA 2Z6JA 4NNBA 3W9ZA 4Y8FA 1TPUA 2A7PA 5G1TA 4IX2A 3R8RA 3LRLA 3QSTA 3W7LA 4YCOA 4IJBA 2ISSA 1D9EA 4ZQPA 4N6EA 3MYPA 4RV8A 2EAWA 3VNDA 1VS1A 3W7GA 4IXXA 1FCQA 3NQVA 1GZGA 4O1AA 2ZZ2A 2F84A 3NG3A 3LBCA 3M5XA 1VYRA 2FJKA 1AW2A 1TPDA 3MBDA 3NA8A 3M47A 3BLFA 3PR2A 1MEIA 1D3GA 2BZNA 3E49A 3ANYA 4LVDA 1SR9A 5HWNA 3G24A 4PEKA 4JY9A 1W3IA 2VC6A 1PCWA 1YPIA 1I45A 3C3NA 1UCWA 1EUAA 1RQEA 2QUVA 2Y61A 2B0MA 4A22A 1I4NA 3IVTA 2X16A 3F4NA 5AC7A 5DN1A 1KM4A 1LTDA 3A22A 4DF0A 2Q8ZA 1GQNA 2GVGA 1KTCA 2A0NA 4MIMA 1LDCA 4R7JA 5MHBA 1PHWA 3O15A 2QUUA 2X30A 5EYWA 1FBAA 5FEXA 3GVGA 3TIMA 1F5ZA 1TV8A 1C8VA 4OT7A 4ADTA 2G96A 1YTDA 2H8ZA 5DY3A 5AHNA 1OFEA 4DO4A 3WJXA 3LXAA 2V30A 2GQAA 1YTEA 4O16A 3KVJA 2V2DA 3UNDA 3N9RA 2X1RA 1SO6A 1H51A 5AC8A 1YLVA 1OG0A 1I2RA 4NQ1A 3SIZA 3PBYA 1OK6A 4MZYA 1X1OA 2ZBTA 4PL1A 2UV8G 4J9JA 3ABRA 1GG1A 3JRKA 4AMAA 2PRLA 3G3DA 1IGSA 1BWKA 4N4QA 5H91A 4UFIA 4AWSA 5EL1A 2Y7EA 3EX3A 3E9AA 3QMRA 4IMGA 3WK1A 1K8ZA 3KXQA 3B8DA 4D2JA 2A2IA 4JYDA 1L6YA 1VH7A 2PC4A 3P61A 2F7FA 4RXGA 3W84A 4JX5A 4JN6A 1KLYA 2QR6A 1AL8A 1HO4A 4QJ1A 3RK8A 5AHFA 3GXNA 4UTMA 3HPZA 4FIQA 4HPJA 4Z0SA 3W7JA 1H7RA 3S5ZA 2ATSA 3LCFA 1ME9A 1O5XA 2DZXA 1ZAJA 2ZDRA 5CZTA 4GUHA 5DBTA 1KW1A 3CT7A 3NQFA 3L68A 5D03A 3TNOA 1GTEA 5TBOA 3FEMA 4LOCA 2QDGA 4OQVA 5U7SA 3GAYA 3RNDA 1K8XA 4FXRA 3SFKA 3C52A 2ZA1A 1LLWA 4K8HA 1RPXA 1LRQA 1TTIA 3QEZA 4MJZA 2QCGA 4QQ3A 4WQ6A 5BMXA 3TW7A 2HSAA 4AHPA 2ABBA 1H60A 3OG3A 2A7NA 1OFRA 2AGKA 4UTUA 3SGUA 3TXZA 3GB6A 3T78A 4I7VA 4UTIA 5AB3A 4O14A 1EP3A 3KAOA 5DELA 4O12A 4XTIA 5FF0A 1DVJA 1VCVA 1Q6RA 3TCEA 3TV8A 1IXPA 1N8FA 3P84A 5L9FA 4MPQA 3TROA 1G7VA 1I2QA 3LCIA 3EXTA 3NL5A 1VLWA 3L66A 3EWZA 3N2MA 1TTPA 1GVSA 4AEOA 3ELFA 2VFIA 3S1WA 4B5NA 3IIXA 3IEBA 3GR8A 3W6YA 3LX9A 4NZFA 5KINA 4Y96A 1CW2A 1OF6A 1W5QA 2ZA2A 5LNSA 4AWTA 3KVKA 2ZQ0A 4U4MA 2B4GA 3FKRA 1VRDA 1GVQA 3EB2A 1UASA 3NQGA 1GEQA 2DJLA 3LXCA 1O60A 8TIMA 2YFOA 3L5LA 5FEZA 3C0JA 3LI1A 1C9DA 1Q45A 1TTJA 2QJIA 4C1KA 3OBKA 2RDTA 1R46A 5KMYA 5CPOA 2BLEA 1MSSA 2YGYA 3ABQA 4O1CA 5I3KA 1OX6A 3PS7A 5HUPA 1JVNA 1TMHA 4OWGA 3PSWA 2ZCGA 4UTLA 1E51A 1LOQA 3TFCA 1OHLA 3DI0A 4JICA 3VCRA 1H63A 4XUGA 2GJNA 1Q3NA 1TQXA 1SZFA 1PCKA 2I1OA 1W3NA 4FX7A 2PCQA 3GZ3A 3LV5A 4JTJA 3H53A 2FPVA 3CC1A 4GUGA 3A5FA 3L0GA 4P2VA 4S2CA 3LTSA 5KSWA 4O15A 1TO3A 3JR2A 1TCDA 4MYXA 3TU9A 1IXQA 3QFEA 1RQHA 1F7BA 4Q4KA 2ZZ3A 3LOTA 3IGXA 3L0NA 1NEYA 2ZYFA 3GKFA 3W75A 2P0OA 3ATYA 4LNYA 1L6SA 2B7OA 2E09A 3LM7A 1KM3A 5CG7A 3NPWA 4K7YA 2E6FA 3C2EA 4JNMA 5D2YA 3DFQA 3THAA 5F4XA 3GDTA 1NF0A 1MO0A 4LUJA 1ZY9A 1H7PA 1VC4A 2ISVA 3CEPA 1H7OA 2GOUA 1HTIA 2A21A 1OFDA 4QAIA 4HNTA 5FESA 3DFTA 3DFPA 3WJYA 4OHQA 2KZHA 1ZAHA 4M19A 1GG0A 4ML9A 4N9BA 5LNVA 1FXPA 5KTLA 2ABAA 2QCHA 2Q3OA 2QCLA 1VHNA 1XUZA 2H8XA 2YCEA 4PC8A 3BO9A 3W7OA 5CSRA 2NWRA 4ZQRA 3LHZA 1W56A 3NPXA 4K37A 4AB4A 3HGJA 1FWRA 2YSWA 5FF7A 3UWZA 3HG5A 3EWBX 2EHHA 3QZEA 4RZ4A 5KZMA 3OA3A 5G5IA 1TPH1 1R47A 1XBVA 2FTPA 3UQNA 3B0PA 1WDWA 3CWNA 2YFNA 3M43A 3IV3A 5G2WA 1K8YA 2P1FA 2NLIA 5BNKA 4BR1A 5BRBA 5G4EA 3W73A 1VCFA 5EA9A 3OVQA 3NAVA 2A4AA 1OABA 4O1BA 1T99A 4QM1A 3O05A 4E2DA 4IGHA 3ZWTA 3T55A 4JTKA 4HT3A 1GYLA 2NV2A 3W7KA 1YDVA 1I2NA 1A50A 4M7TA 3P67A 3G1VA 4IX0A 1N7KA 3TE9A 2CLMA 3QRHA 1LRTA 2EGZA 1JUBA 3LCGA 1FY6A 3DI1A 1TPFA 4O19A 4DF2A 1M7OA 4WD0A 2PE4A 5LNWA 1ZALA 1XBYA 1KBIA 3MI6A 3PM6A 4UTKA 2XN2A 3DU0A 5A8GA 2C3ZA 5HUOA 4CNNA 1T8XA 2HS8A 5AHIA 4FXSA 3W1UA 1G7UA 1IIGA 3LI0A 2NV1A 4HNUA 3I7RA 4O0KA 1MEWA 5K2ZA 1ADOA 2FFCA 3O07A 4IXHA 1VHCA 3PBWA 3UY8A 2CLIA 2CLEA 4BI5A 3WJSA 2C19A 4UTWA 2CLOA 3M5ZA 3VI2A 5D2VA 1QR7A 4N9EA 2JBMA
chains in the Genus database with same CATH superfamily
4WVXA 5HWMA 1W3TA 3E96A 1JNEA 1UUOA 3T08A 4BJ6C 3F4WA 3GVRA 4GI9A 4RJEA 4O10A 5E2QA 2DQXA 2E40A 4I9TA 1OC7A 3FSTA 1FFHA 2NUXA 3SECA 1JXJA 1OKKA 2A5HA 3ABSA 2YR1A 4PFOA 3ABLC 3W1RA 3OW1A 4UMCA 4RBNA 5DRCA 4OIQF 1O7AA 1Y65A 3NSMA 4EF9A 1JPJA 3KOYA 5CC7A 3LJBA 4LBSA 2INFA 3RF3A 5ABFA 4F8XA 5BRPA 2DZTA 4IG2B 2XL6A 3VIGA 1Y5WA 3CTLA 1JMWA 4CLMA 2J7FA 4W9TA 3EWUA 2HBXA 3UJ2A 2UWFA 4BWLA 2NX3A 3OPSA 3U7BA 4ORMA 1ONWA 1OCJA 4E18A 4C1NB 3CV6A 1SW7A 3FNDA 4OZOA 4RDYA 1UZDA 2FDMA 3OHIA 4NU7A 2QLYA 4BJ1A 4F0KA 3GG0A 4HFFB 4IP4A 1ZCOA 3P81A 4ZZ9A 3HQ1A 3VABA 4A4AA 4EX4A 2V2HA 2XVGA 4L1GA 4I6KA 3F47A 3SUSA 1DXEA 4MAZA 1QWGA 4QITA 4X60A 1VZWA 4NJGA 3PVFA 3PTDA 3JVAA 4BJ6A 5LNRA 2XH0A 5GVJA 4RV3A 1UB3A 3CWHA 3L4XA 1JCJA 3T7VA 2WVVA 1PX4A 4GZJA 1NBBA 3TP4A 1KRAC 4LYRA 1TREA 1Q6EA 3DKJA 5AC4A 3N2TA 5D38A 4A2RA 3H6OA 4ZOCA 4C65A 2YLAA 2GQ8A 5H1WA 5HJYA 1OQCA 4AW7A 4JD4A 1ZHWA 3C86A 1AW5A 4AZCA 3NL3A 1OCOC 4J3WA 3STPA 4LEFA 2DZBA 4M82A 4G7HF 3BG3A 1WASA 1OINA 2RFGA 4XLNF 4HPXA 4G5DA 1UG7A 1QOPA 2FGLA 2PZ0A 1GS9A 1W1YA 2ZADA 1BKSA 1D0YA 3K5XA 3NIYA 1GT8A 5D32A 2VFEA 4ALDA 2EQDA 3NQ8A 5PTDA 5DMLA 3LPGA 4B5UA 1ISZA 3BZJA 2QGYA 3PN8A 1W54A 2R8WA 2F38A 1X8FA 2I14A 4W85A 3SEPA 1TUXA 4HBKA 3P82A 2J0XA 2PS2A 4XB3A 1RALA 3MB9A 1OXBA 3VGHA 1DQWA 2DSZA 3G22A 2HQAA 1Q0MA 4PBEA 1ONRA 4QIUA 1RD6A 7ENLA 3M9YA 3U4AA 5TIMA 3K1HA 3CPRA 3I7SA 3LESA 5L3QA 3W6MA 1JCLA 3RN6A 3H7VA 1J01A 1JR1A 4C7OA 1TE1A 1NARA 3I4UA 2HNEA 1OIFA 1ZJHA 5GNXA 4CNTA 4YVXA 2IQTA 4PR9A 3RH3A 1E73M 3GSMA 1ST6A 3HLZA 3T4CA 4UNLA 1Q6CA 2QJHA 3BJFA 5DMYA 2VC5A 2CKRA 1JL8A 5I3GA 3D46A 4ECLA 3HNKA 4WHBA 2JKPA 1P0EA 5JUAA 2INZA 3KEHA 2VFGA 1OX4B 3VFCA 3K4AA 1BBHA 2IXPA 1TWHA 1SGJA 4NJIA 1EHNA 4JTGA 4EIVA 3CH0A 2QY9A 2KSFA 1XQKA 4D8AA 3DJUB 3KTSA 3RAOA 2YB4A 3LPOA 7PTDA 1W3HA 3HNIA 4U33A 5DCDA 5B7YA 1QNQA 3STGA 4AE4B 4HYVA 4PGLA 3UR5A 1P0DA 5I00A 4NVTA 3X2QC 4GISA 1J4EA 2H7BA 4JIIX 4PBFA 2W67A 1ZAIA 3SR7A 4UR7A 1J18A 3U9JA 1LKXA 3DYOA 4NJKA 3FJ6A 2FFHA 2PBGA 1JF6A 4WSJA 4HIBA 1YADA 1X6UA 4C6JA 2XWDA 4JZAA 4M1RA 3U9IA 1JI1A 3QQ1A 3C8FA 4YS1A 1KQYA 1Z44A 1KRBC 4PSPA 3WF1A 1GVIA 1LLOA 2PDJA 4S3AA 4H7ZA 4IGGA 1R4TA 2PF8A 2WMIB 4IP5A 3W1PA 2G50A 4FMVA 2R7UA 1I0DA 3IGUA 4CQAA 3CUXA 3SUTA 3W1XA 1EA0A 3CASA 3LYEA 1OGGA 4QJ4B 1RCXB 4H19A 3BMXA 4XO7A 1CLXA 4PCFA 2ZRZA 3S1UA 1FH9A 2GDQA 2PDNA 2WC7A 2GJLA 1MXSA 3VILA 5MKGB 1WB0A 3N12A 4H41A 5TNVA 1CWYA 4F2BA 4O28A 2IKJA 4Z2IA 2VZTA 3EPMA 1V6UA 3S9YA 2VM8A 3FIGA 4QJ5B 5T26A 4PMRA 3TQKA 2DVXA 1W1IE 2FVMA 5I24A 1RLDA 4CCZA 2V5BA 1EJWC 1VP5A 4AY7A 1QO5A 3O6YX 2NQJA 3W7DA 4I1OB 2QCDB 1DQXA 4D8LA 1M9HA 4XISA 3M6YA 3AIVA 3WUFA 5FD0A 4D6FA 4MWAC 4F4RA 4EP8C 4L1WA 2AL1A 1XCXA 3IARA 4R3UA 4Z9JA 2IXUA 4WY0A 4FF7A 2FB3A 2C0AA 3M4BA 4J40A 1XIJA 1SW0A 1RZMA 2IQDA 2QCMA 3QOKA 5H2ZA 4XX6A 3T81A 1UWTA 3CHEA 3WF3A 1O5QA 4HN8A 4MJ2A 1UP3A 3GLCA 3TN3A 3S84A 3NL2A 4E2BA 3GFZA 3GH7A 3R4IA 1H1ZA 2GWGA 4FNUA 4N2YA 1VYKA 1WQ5A 1C3FA 4QE4A 3TLLA 3CZJA 1RUSA 3AXHA 1FFRA 5JXQA 4MLJA 2XM0A 1OYCA 3NOEA 2HPIA 1YXDA 5XINA 4E3VA 5FF2A 1J93A 4GYPA 2UUHA 4PTMA 4B92A 1AEPA 3NOYA 5CZ0A 3COTA 3C62A 1A80A 1GVRA 2OT1A 1KBBA 4J30B 2PP0A 3L8IA 3TSDA 1F74A 1NWSA 4EF8A 3GNXA 1TTQA 3WQGA 1BR4A 2D73A 2Y8KA 5FA5A 4BEMJ 3HGRA 3W2LA 4GXPA 3VIMA 4TV6A 3V36A 6REQB 2YX0A 3N2ZB 3AGUA 3L0KA 3D6NA 4O13A 1TVPA 4YTUA 3CAVA 3AROA 1NELA 4I3GA 3N11A 4NC3A 2NWSA 4CS7A 3MKCA 4LVGA 4O8RA 2ZXRA 1BEUA 1K3UA 2ZXAA 1JCMP 2CHRA 4LANA 5CGQA 2D2OA 2G97A 4JE9A 5D8WA 2H9AA 1FWSA 4AVFA 2OVLA 3N73A 4LUSA 3LHVA 3MC5A 4HK5A 1J0KA 1TPVA 4REQB 4OUIA 3MJYA 1H50A 3QC3A 2V5LA 3KLLA 3WZ0E 5C55A 4S2BA 3TSBA 5A8PA 2BOEX 3R13A 3BV7A 4KCVA 2WXDM 3CMGA 5KZDA 2PDFA 4J28A 3I3DA 5DXYA 2Q4FA 1JEZA 2ZE3A 4JHMA 1GVEA 4YPJA 3ARXA 3X1OA 5EB8A 2Y7FA 1WBHA 3G6MA 1QNVA 1RKEB 2BODX 3GHSA 1D2KA 3PANA 4FI4A 1Z69A 1XKYA 4ZOAA 3U8VA 2CKSA 1OX5A 4ASTA 3WH6A 4IZGA 1DJXA 4MYAA 3W23A 3WCZA 5HMDA 2HV5A 4JKKA 3U0CA 1ZW3A 1U1JA 1E56A 3GRIA 1RKCA 2VOMA 2PDXA 1R9ZA 4WDWA 1QTWA 4IMFA 5F4SA 1XHGA 1HT6A 3T44A 4KH2A 1B3WA 1Z5ZA 2I17A 3QC0A 3S2MA 1M7XA 2Y70A 2ZRVA 1W5OA 2L81A 2OMAA 4WZHA 3SCRA 2PD9A 3QLLA 1EDQA 5B7ZA 4MY1A 3SCNA 3C56A 1OFAA 4MY9A 5C5YA 2C7FA 4PMZA 1TFOB 5DFAA 1ZHTA 1D7KA 3I7QA 4DAIA 3SI9A 4Z9IA 1OGBA 3ECSA 1MRQA 2YXOA 1QO2A 4ATWA 3DYMA 3FOPA 3H2FA 2P5NA 2PWDA 3OEXA 4F3HA 3LGEA 1N82A 1NAL1 2HK1A 3W7IA 4FEZA 3DE9A 4AD1A 4LERA 2A3LA 2WJDA 1QVXA 5CSUA 2YEVA 3URNA 3ZFHA 2CBVA 1RHCA 4QG9A 1EZWA 3TULA 2DVTA 2PWFA 3LCLA 5I0DA 1UP2A 2ZRWA 2OB3A 2XG9A 8CGTA 3T4RA 1FKWA 3O1NA 2O92A 1MZHA 1E3ZA 1TMLA 3QY7A 4ZR8A 1GVFA 1YHTA 4YT2A 2F22A 2IPFA 2WMJA 2AQVA 4GBDA 2Z1VA 3OA5A 4HTYA 2FLIA 3QN3A 3S6DA 5BROA 1MMAA 1LBLA 3KTXA 4QDWA 1GJUA 4F40A 5A1AA 4XD4A 1EBGA 4UTTC 3TXVA 2XFWA 3M07A 2IM8A 3JTLO 5JIPA 4JCMA 1JR8A 3KUMA 4KGJA 2HVNA 2GUBA 3S3GA 3EMQA 1A0DA 5AYXA 2R24A 4Z17A 4HU8A 2VGBA 3IK2A 4IMCA 3S1VA 3S46A 4XEKA 4A8IA 2ZVIA 5TAOA 1JUEA 4IJCA 5HNNA 3ARPA 4JL1A 1JPDX 2ZUMA 4KEUA 1UG6A 5L0GA 1DWAM 2A6NA 2NVAA 3E0IA 1C8XA 4MVAA 4OV4A 2WOQA 3TOMA 1MDLA 3VCCA 2OZ8A 2NUYA 1VK5A 4LWWA 3VGFA 3GX9A 4GIRA 3PULA 1PXGA 3LK6A 4ZODA 2WPBA 3THDA 2Z2AA 3CL7A 4JXCA 3WLQA 5LHFA 3GTIA 2M4EA 4XKMA 2DVUA 1I1XA 4P8WA 2VGIA 2WBGA 4XD5A 2Q6ZA 3H8AA 3A24A 2B7NA 2C16A 4AZIA 1KU2A 2YCIX 4IQLA 5G2IA 3H2OA 3E2QA 5G1YA 1LUCB 3WLIA 2PTZA 2WZLA 1R5ID 3GXFA 2QS8A 3R89A 4XAPA 4EWJA 5D9OA 1VRXA 1WV2A 5EPDA 4A3YA 1V02E 2PTXA 2X2YA 4UFKA 4LDQA 3T05A 3PC0A 3ABZA 2O9PA 2XINA 4UBPC 3NQEA 3WMBA 1BYCA 1RPKA 3VC5A 4GMEA 1PWMA 1B4EA 1T5OA 1PL9A 2ZVRA 3B0XA 2WJZA 4MLRA 5L0IA 1HE9A 3Q58A 4QSFA 3B03A 4B2DD 2HBVA 4W89A 3NZGA 5LSMA 4R32A 3QTPA 3AIBA 3AS1A 4PZVA 3ALFA 2GYIA 3VMNA 3LAYA 4GUFA 3T42A 4C1NA 4XQ1A 1PKLA 3HNLA 3JUGA 3LMYA 4LTSA 2RGLA 4UR8A 3WH7A 1VLTA 3GVVA 4FO4A 3RR4A 1ICPA 1ZLPA 1XD1A 3KL4A 3IIOA 4QGCA 3NM1A 2PDPA 1WE5A 3CUIA 4MUZA 1I0BA 4GH1A 1XYLA 4AWUA 5EBUA 3S5YA 4JKLA 5D4YA 1NWRA 3S9IA 3UXDA 1ZPTA 4UCGA 2H3BA 5FJOA 3VZYA 3W25A 4AWEA 2ZRXA 3NZRA 1DIEA 2KC3A 1X1ZA 3QZAA 4PRRA 5DCEA 1FKXA 5CLTA 1ZSXA 4E38A 1AG1O 3P0WA 3FAJA 3KCOA 3GDLA 1CT5A 4X9SA 3P62A 5CPLA 1PTDA 3MDWA 2H8AA 5HMEA 3C3UA 4JEAA 1AW1A 1UA3A 4GHRA 3W02A 4FIRA 4CD4A 4GA8A 1T9KA 1F73A 2DSWA 5HOSA 4NAEB 3DN5A 2PSNA 3UXLA 5AZ1A 1JYWA 3MKKA 2R7RA 2Z1SA 1OFPA 3ZR6A 1RY8A 1XBZA 1KM2A 2UY5A 4W86A 2X7VA 4LUSB 1ZQ5A 4N6CA 4UUIA 1WOAA 2CDQA 3IIVA 2ZZ5A 3C0QA 3H4GA 4ZA0A 4IGNA 5K4ZA 1KGUA 1V93A 2ZWYA 3RM8A 5A2AA 1AMKA 3BARA 3QHNA 4DWDA 5I5RA 4JEQA 3UYCA 2Y3BA 3MV11 3NYDA 3IRDA 1E72M 3SY5A 3CQ0A 3AZTA 4PUEA 3NEVA 5C9XA 1JYVA 2Y3DA 4XV0A 4ER9A 2Q3RA 2CITA 2VELA 3P0XA 1YQ2A 4PB3A 1BPLB 3BW4A 1OYBA 2A7RA 3G2GA 4PRTA 5JS5A 2AU5A 1OFQA 2O55A 1TWSA 3FS2A 3H2EA 4I9AA 5DLCA 1HQTA 4LAKA 3KYJA 2EINC 3UESA 4DRJB 2L9JA 5D2XA 2ZZ6A 3IUDA 2ZD9A 3CM4A 4UOQA 3M15A 1ITUA 4JYFA 3MW7A 5CXPA 1R9XA 2OSYA 2W3ZA 4XEVA 1VPQA 2GQ3A 2BY1A 2G3IA 3S0CA 4GLEA 4BPMA 3VM6A 4ERAA 4QISA 1V3HA 3GTXA 1JQXA 1TWAA 3KL5A 2YZSA 4E6MA 4EPBC 3CSKA 4G78A 3S8HA 5KYYB 1GQLA 3GDRA 2EPMX 3FYPA 2ZRYA 4DPPA 2YCLB 4GABA 1GKRA 1I2OA 5FL1A 2YA2A 4AZ7A 1EGMA 3DZ1A 2CXEA 2Y69C 2C1HA 3KMIA 3N3TA 3VX1A 1A0BA 3ZT6A 1G67A 1WDPA 4OE7A 3TVAA 1F3XA 4BZYA 4KCWA 4B5TA 4LVAA 5K9XA 5A6MA 3U2LA 1S1RA 4US5D 2J25A 3EMCA 3TOLA 3F4VA 2OX1A 5LYRA 1KCZA 5M03A 4ZCWA 1FQ0A 3W87A 4C6QA 8XIAA 4DJEC 3EX4A 4GIAA 4AZHA 3AAMA 4J3TA 1U5HA 3N04A 1JJKA 2Z7GA 4S3CA 2OEXA 1W5PA 3CO4A 2BY3A 1XCFA 4U5CE 1OY0A 3UETA 1SFLA 1WKDA 4YU1A 1CEOA 5K9CA 2C71A 4E8CA 5IM51 4ZO6A 4EACA 2CZFA 3M64A 4ICMA 4Z1CA 1Z42A 4FR1A 1JDDA 3WLLA 3W7EA 2RUSA 3DAGA 3UGPA 3R5EA 3EA3A 1TIMA 3T0DA 2HRWA 4JTDA 1BYAA 3ECQA 3PAJA 3LCXA 4JFTA 2AQOA 1KB3A 2V2CA 3UW6A 2D0HA 4QG8A 4ZTYA 4UQBA 1X7IA 2J78A 2ICSA 4HP5A 1XM3A 3IJ9A 1N1CA 1TKNA 4JEBA 1Z7Qc 2E8ZA 2DZSA 4CN4A 1V0MA 3A9CA 1TYGA 1EGZA 1YARO 3HG3A 3GXDA 3KOZA 3PNZA 4MTOA 1GNXA 3EDDA 3Q7LA 4XPYA 2PDQA 4AYSA 4IISA 3GC2A 4EPKA 3N24A 4NUWA 3AQBA 2YA1A 4UZUA 4V33A 3L34A 2W6RA 3PBMA 4MKNA 3Q6NA 3GORA 2C03A 2GLKA 1PYFA 3MP3A 1UWIA 2OJPA 5JUVA 4LLCA 2GK1A 1XLJA 2GUUA 4KT2A 1H11A 3R8GA 3ARTA 1DE6A 3O39A 2Z1BA 4MFEA 2J6XA 1DKWA 1OB0A 4GIEA 4M63A 3L2MA 1LZOA 1UR3M 2X0HA 4O0ZA 2YB1A 3GNDA 2J7DA 1JQVA 1OCZC 3J06A 1QI3A 4ZVJA 3OIHA 3KYIA 4DOZA 3GXMA 4HSOA 4BQ4A 4YMZA 2VEGA 3FDKA 4RXFA 4Q8TA 3A47A 3HPSA 3VMOA 3C2FA 1FP8A 1KQZA 1FHDA 2OODA 2WSRA 4DNHA 1ZNNA 4D6CA 2BX7A 1L2UA 2CNCA 1FCVA 4BWLC 4AZ6A 2VQTA 3AUOA 3ARUA 3TJLA 5LHEA 2HJ3A 4CEXC 4QLJA 3OODA 2QV5A 3FXYA 3LCWA 5HSWA 1OADA 3KBNA 4ACZB 3VC6A 4RNHA 1SMYF 3OWTA 3MUCA 4NT0A 4U28A 4PTXA 4FX8A 1C93A 1TJPA 2UY3A 3W4YA 5FAJA 1MUWA 3SAZA 3VE7A 1M68A 5DX7A 2BGSA 3WBYA 4PODA 3F5LA 3EZ4A 3ITLA 1GQKA 4MB3A 3WQ5A 3EX6A 5F1VA 2MYSA 1PTAA 2CHOA 2TPSA 1RQBA 2YLLA 5AHEA 4H1ZA 1M2VB 4X22A 1IWBA 4IPNB 1NIUA 4O0QA 4S39A 3UNTA 4U3AA 3HTWA 3LDVA 4UXDA 1QI2A 2ZXBA 2J9UA 3ERPA 1UKOA 4QRNA 1V5XA 4IL0A 2AAMA 4DRHB 4K0DA 5KYXA 2EBNA 1TWGA 4H83A 3OZOA 1VYIA 4TUFA 5AYIA 4A3UA 2CCYA 4CS8C 3B71A 2J7BA 2EPHA 4HZ6A 3DXIA 3QHMA 4CDVA 1A3HA 3NYLA 3B8VA 3DERA 3B9QA 1R3QA 1EJ7L 3DFHA 3E70C 3RU8X 4FK9A 1HL2A 1BHGA 3GANA 1XG4A 2BHYA 1ZP4A 3KL0A 1T41A 3U5YA 3B05A 2Y89A 4U9EA 3LS0A 3S1GA 1IV8A 4WEVX 4EUKB 1V6VA 2DORA 2CLKA 2XFRA 1HIZA 2C18A 4LB4A 8A3HA 4CN6A 5GJMA 2Q01A 2GGIA 4BI7A 4W87A 4FOKA 4AVNA 4B4HA 4PTDA 5BMWA 3W1TA 1ZFJA 3B8WA 2PDUA 3GUWA 3TDFA 3AQCA 2Z6JA 4E4UA 2DPEA 4ZXOA 1TJ2A 2XFFA 1MFVA 3LRLA 2PDLA 3W7LA 3IHUA 4QAWA 4YCOA 3S2NA 5IDZA 4JQ4A 2ANUA 3MCMA 2W45A 3K13A 4J2PA 3MYPA 3QLDA 1M65A 3WBXA 3EGXA 1PPIA 3K46A 3CUGA 2W91A 3B4YA 2ZZ2A 3CZEA 2FHFA 1U5VA 3NG3A 4TTUA 3LBCA 3M5XA 2WK2A 4KRUA 2VWSA 1TPDA 2XL8A 4EAYA 4DLFA 3E9VA 3NA8A 3M47A 3PCVA 4DI9A 1D3GA 3E49A 2JF6A 3ANYA 4ZOEA 2GDCA 4ENLA 1PCWA 2WJFA 1YPIA 3SXYA 4BA0A 2Q71A 4JC7A 2ZC8A 4WDUA 4B3KA 3UEQA 4GYKA 3MKVA 3F4NA 5AC7A 1XG3A 2X7WA 1TKKA 1LTDA 4AD0A 4PMJA 2Q8ZA 3LGDA 4J7RA 2GVGA 3PZTA 1KTCA 4R7JA 3C0SA 3CHFA 3ABXA 3QGKC 1QWKA 5EYWA 1A41A 4DZ5A 5D9MA 1K1DA 4BS0A 1QNRA 4C7DA 4MPKA 3WUEA 3WJXA 2GAQA 3A11A 2ASRA 1PAMA 3QGAC 4L6OA 3KVJA 2V5DA 4NRSA 1LWJA 3RKOF 1V3JA 1SO6A 4NQ1A 1A5NC 1E9ZB 4MZYA 3FGCA 3TEVA 4XTKA 2BY2A 5E9AA 1JGIA 3G3DA 2QHAA 4ONSA 4JJFA 4PCSA 1IQ8A 4MVUA 3TYUA 4IMGA 1BRLA 1TCMA 4D2JA 2XUCA 1L6YA 5CAHA 1W9BM 4HEAJ 1VH7A 3UZZA 4E8GA 3P61A 1RAKA 1HO4A 3QZCA 2VX6A 4FIQA 4Z0SA 1H7RA 3MZ2A 2CYDA 4ZLDA 3S5ZA 2ATSA 3LCFA 4IT1A 4W93A 5HATA 3ZIBA 1O5XA 4GUHA 4KNWA 3NQFA 4PEEA 5D03A 1GTEA 4PMXA 2QDGA 5CBIA 1R6WA 1ZZPA 4BJHA 1ZJAA 4GZEA 1LLWA 1LRQA 3AJMA 4Q6XA 2ZIDA 4WQ6A 2J47A 4TX6A 3K8MA 4FOJA 1BVZA 1YNPA 4N4WA 1DJZA 2HSAA 4K2SA 1T01A 3URQA 3ES8A 1WUEA 3EH2A 2R05A 3GR4A 3TXZA 3T78A 3JRTA 4O14A 5DELA 1QK2A 3EPNA 4C6IA 3R7CA 1NTHA 1IZMA 3DCPA 3TCEA 2OPJA 4GI6A 3LPFA 4RW3A 4I5XA 4GI8A 1I2QA 4HPNA 2XSBA 3R0UA 3EXTA 2B81A 3BAKA 1VLWA 1ZJBA 4AEOA 4GX9A 3S1WA 7A3HA 4B5NA 5HDRA 1WATA 3BDKA 2J45A 1QBAA 3BLLA 3IEBA 3GR8A 5HK4A 3NCOA 1OF6A 3IJ6A 1W5QA 3OBAA 1V6WA 5LNSA 2ZDSA 3Q67A 3SQSA 1GVQA 3EB2A 5M2FX 4JTRA 5J04A 1AD4A 3N2OA 8TIMA 3L5LA 4H8UA 1Q45A 1TTJA 4Y8EA 2VUNA 1G94A 3ONBA 3OBKA 2IW0A 1R46A 1VJSA 4BQ2A 2HPMA 4J1OA 5KMYA 3G6LA 2BLEA 4YVPA 3D3AA 1Y5XA 2FGZA 2YGYA 3ABQA 1WWPA 4FLOA 4H2CA 2OWXA 3BLKA 3EA1A 3FDGA 3T6CA 5HUPA 4XZBA 1GOMA 3PSWA 4Q7IA 2ZCGA 1S46A 4W5UA 5E0CA 1GCYA 4A35A 3LQGA 3LS1A 3W6LA 1H63A 4XUGA 2GA0A 1PZ1A 1NY1A 2VDHA 1R0MA 3TTYA 1PCKA 3DM5A 5IRPA 1W3NA 4ZB2A 2PCQA 3C5QA 3VDBA 1KBKA 1A3XA 2G3KA 4NHVA 1RJ9B 4ULVA 2FPVA 3EQLF 5FCLA 4IWBA 3KTCA 1TWWA 4B5XA 3I6TA 4XZLX 4Z1YA 1UZ4A 1TCDA 4XAYA 1CGME 1MVYA 3TU9A 3Q4DA 3US6A 5M3WA 5EFDA 3M1CB 3H26A 2OKUA 1NEYA 2P76A 2BG5A 3T8LA 2OEKA 3W75A 5TJ5E 6A3HA 2B7OA 5F7UA 2E09A 1R86A 2I9UA 3WHNA 4K7YA 2VC7A 3B8IA 4NIRA 3FDQA 5F4XA 1BVNP 4ACZA 4DVOA 1QI0A 1E70M 3REQA 4HJFA 5F5FA 1VC4A 1XRTA 7REQB 2ISVA 3CEPA 3VZXA 1H7OA 5JQ9A 1MW3A 2A21A 3TWBA 1XSIA 3WD4A 4Z2LA 2F2HA 3FGCB 4S3DA 4LACB 2KZHA 2QIWA 4DZAA 1TVNA 1GG0A 3RRXA 4J3VA 1FXPA 4OINF 1SFSA 2QCHA 1B31A 2GUYA 2Q3OA 3VOCA 2YCEA 4BEQA 1E6SM 2J6VA 4RE4A 4FXJA 1CGNA 1LVKA 4ZQRA 1AQ0A 3LHZA 4W8LA 1EL3A 1D7FA 2VCAA 2PDBA 3UWZA 2DY3A 3EWBX 3F7JA 5CJNA 4XLPF 1ISXA 3MSRA 3OA3A 1TPH1 1R47A 4NL1A 2VUYA 1GYMA 2FTPA 3EOUA 1WDWA 2ADAA 3CWNA 4XG1A 2P3ZA 3RCNA 2VVNA 3PZUA 3ZQVA 4BR1A 5BRBA 2KGOA 2A4AA 1T99A 5AVHA 2YLDA 3AG3C 4E2DA 4IGHA 4M81A 1VB5A 4HT3A 1YDVA 1CGUA 3VIOA 4IX0A 3GFYA 4I8DA 4GNVA 4MKVA 3MMDA 2PEVA 2V67A 1C92A 4FESA 2H7VC 1YIXA 2V3FA 1FY6A 1TPFA 4E2OA 1BR2A 4O19A 4DF2A 1Q66A 4WD0A 2PE4A 2D0GA 1XBYA 3AOFA 1LQAA 3MI6A 2XN2A 2B0HA 5A8GA 1E1EA 2C3ZA 1W9UA 1R38A 4CNNA 2ZXQA 4ZE5A 4O6YA 4I9MA 2W9MA 1ODUA 1IIGA 5JRAA 2EJ1A 2REQA 4HNUA 2OYMA 3UMKA 1CB7B 2FFCA 1UR0A 3WLMA 4Q4ZF 2CLEA 3UZXA 1Z6KA 1VFOA 3UWEA 2VX5A 3VNYA 1QRQA 1PKNA 4HYWA 1DWFM 3O6AA 3ZJ8A 3AMKA 4N9EA 4P7LA 2JBMA 3JCUQ 2OZTA 1DPMA 4NF7A 3IPMO 2Q9AA 3CB3A 3UR3C 3VD4A 3ME3A 3MUXA 4R34A 4HU3A 5ENLA 1IHIA 1L8PA 4ZXLA 3LV6A 4JTSA 1IT7A 3WK2A 3A4AA 4QX4A 3ZYZA 4TXEA 3DFOA 4WF7A 4Z2KA 3Q2DA 1GK8A 2R1MA 3ZR4A 1D3HA 1NSJA 2CERA 2GJRA 3FHDA 1XLFA 4MOZA 1E4IA 2EJAA 3W88A 4JTFA 4CDYA 1F76A 3BLEA 5D91A 1QFEA 3DFSA 5D09A 2BASA 4JYEA 3PB2A 3W7PA 3CO8A 3JZEA 3DGRA 3A4WA 4AF0A 3FKKA 2DP3A 1F4HA 3JYYA 1LP6A 3BSHA 1I60A 3C0LA 4KBXA 1Q5MA 3U8PA 4BJ5C 4KRTA 2PDMA 2CGEA 4YT4A 2O4QA 4JTLA 1PEZA 1F6PA 2GJXB 1AQHA 4K68A 2IXMA 1DL3A 2GSEA 3O6DA 4MQ9F 3CV1A 4UTWC 4IMDA 1PV3A 4C6NA 1E4LA 3ZWIA 4MB4A 5EU9A 1XLGA 5HXMA 4CIHA 3AG2C 1F4AA 3BAJA 5JVEA 3G1FA 2ATMA 2WC3A 3R6IA 2QV4A 2ZUNA 2EPLX 1C90A 1TV5A 4DF1A 5I6SA 1W32A 1US3A 4BF9A 3K4DA 1OCRC 3RHGA 2NQZA 3WQ6A 3CAQA 4D9PA 2A1DD 2GGGA 4MW3A 2HMCA 4PUJA 3GYEA 5DEZA 4LT9A 3VXGA 4LH8A 4PL2A 3QH2A 2BVWA 4TV5A 3W37A 4MVSA 1FH8A 5FSDC 1K9FA 3R8HA 4LUTB 3SGZA 3PBUA 5ABEA 3RCYA 2D1ZA 1G5ZA 2FZ9A 3DUGA 1XLCA 3EFOA 3I3EA 3JSZA 1U30A 4HZ7A 3LRKA 1PIFA 4NQFA 4ZO8A 3HGOA 3HO8A 1CYGA 2YIHA 3B8TA 1KWGA 3GK0A 1MUMA 1TV4A 2PPGA 2HCVA 3EH1A 1X8CA 3W72A 3IJ7A 1HKJA 1JPMA 1XYBA 3ATZA 4GZ7A 1KKOA 2PODA 4F4BA 2WANA 2QCEA 1QOQA 4NTFA 3SDOA 1CXFA 3U6WA 1HJWA 3NQDA 1CLKA 5BQGA 4XPXA 2WQDA 1O94A 5L0CA 2Z00A 3UWUA 2Z4GA 3PPGA 3G5EA 5HA7A 3W1NA 1O6IA 2Y63A 5J8LA 4D4XA 3NRHA 3WELA 4Q32A 1P7TB 1ZU4A 3QSRA 1CDGA 5F1UA 1CXHA 2WQPA 4F66A 3BOFA 1YXCA 4MM1A 4QNWA 1FWWA 1EWEA 3UFYA 1UR2A 4C6EA 5BZAA 3R2PA 3E0LA 1H9TA 1LOSA 4PUKA 3G1YA 3E3HA 3GKAA 5AC5A 3ID7A 2HSBA 1V0KA 4L6RA 3C2RA 4AEFA 1A7DA 1JFHA 3SRDA 3SRFA 4AX6A 4QDPA 2YL1A 4DO6A 4GQ0A 4M24A 2DH3A 5CPQA 2OCCC 5I06A 1FP9A 4C7OB 2E77A 5K9DA 3MUAA 3LHWA 2J7HA 3W2WA 3A4XA 1QCWA 4CD6A 2R03A 2WWDA 1PIGA 1ONEA 3VOHA 4PCTA 2YCJA 1M6TA 1J0YA 3UPBA 4LEQA 2OFJA 1CXEA 3NWRA 4A29A 4JIPA 1POJA 4S1FA 1W1B1 3GXPA 1AQFA 1W3LA 2YW3A 1NDYA 3GM8A 2ODOA 3ZJ7A 1NU9C 3GM3A 4BI6A 2WKJA 4JY8A 4MJMA 3L23A 2J75A 4W7VA 3IQCA 2QCCA 4IRUA 2LLEA 4LSBA 5BXRA 1YPFA 2HTMA 4HYRA 4IPJA 1EC7A 1VTMP 1C91A 1JD7A 1UYQA 3DFNA 4ORIA 1PSCA 1ITQA 4L56A 4Q22A 4FS9A 4W88A 2Y6ZA 4QTGA 1XUUA 1B3XA 3SGGA 4IARA 4NXSA 3FAXA 5CBJA 4WXZA 2DDXA 4MSSA 3CZ8A 2PFHA 3W1LA 1GHSA 2NXHA 3FHAA 3W2NA 3HFYA 1TELA 4V1XA 3TJIA 4TMCA 4UWMA 5HMFA 5A69A 2P53A 4C6FA 3CAKA 2XLHA 4R88A 2A85A 4UQAA 1Q85A 4RZBA 3QPEA 3RX4A 3G3MA 1KFJA 1EF3A 2E5BA 1DWHM 4EIYA 3ZR5A 4AAJA 3WEMA 1SW3A 2CFFA 2R14A 5KYUB 3LNPA 1OCQA 2BSLA 1PDZA 4K7BA 3SCTA 1VYPX 3P3BA 2VC9A 1K4HA 1MFUA 3B9OA 4R9OA 3W70A 3K1IC 2RDWA 1NF7A 2J46A 5CGMA 4UQDA 5HAOA 5KYYA 1FNTc 4JTUA 1IYXA 1OJXA 4UOJA 3Q65A 1HP5A 2Z6IA 4Q8MA 1OFOA 4G7FA 5F2LA 1ZBWA 5C9ZA 2RHGA 1E4NA 2CLHA 3M0ZA 3VKBA 1J10A 4YJWA 3GH5A 3GODA 4ZL1A 5G2HA 4DJ9A 4ZQOA 5CJMA 4C3BA 4HNCA 1XLMA 3LERA 4OKDA 4DBQA 5DY2A 1R85A 3WNOA 3NYMA 4D6HA 4GD0A 1F61A 2OYKA 2AMGA 1XS2A 4DEFA 4DYEA 4HOZA 1EIXA 1DE5A 4ZFMA 3AYSA 3QVYA 3TYZA 3KRUA 2QUTA 3IIPA 1A5BA 1HKMA 3MJMA 4S23A 5LXXA 1XXXA 1QI4A 1E1FA 2HJMA 2J9XA 2Z2BA 1GWJA 2BWGA 3C7JA 4IFRA 1LPEA 3WD0A 1UBSA 5GPRA 1H61A 1RKEA 1R2TA 1IIHA 1SF8A 3ZLFA 1TZ7A 2YL6A 3MQTA 1PX3A 3DYPA 4HNNA 2YKKA 5I7GA 4CJGA 2DYRC 2VB6A 3NQ7A 4G0HA 3RJYA 1V3IA 3DOPA 9XIMA 4GY0A 3SN4A 5AYYA 2F6XA 2RAGA 1V51A 2VX7A 1YDIA 3SW6A 1RP8A 5KYWA 1C29A 1JOGA 1LLZA 3VNMA 3T9PA 2OJQA 2HKVA 4U9DA 3MMTA 1E6NA 5DS4A 2X1SA 2VFHA 5BOEA 4HA4A 3BE7A 1L8NA 4EANA 5KZEA 3GUGA 1VMAA 1FWHC 3CJPA 3B29A 2PGFA 1KTBA 4PBGA 3BRJA 2BVDA 3FVDA 2A6EF 2QCFA 1OG6A 1SQ7A 3VDAA 3DJNB 1JZ4A 4C60A 1EYWA 2J9YA 3NYZA 1WKYA 1R87A 1RH9A 4M8UA 5CJ5A 1AVOB 3RLHA 1EBHA 2V26A 4Y7EA 4BCEA 2NUTB 1GOKA 3B9NA 3M7SA 5KYNA 1H09A 4WKHA 3CEXA 4MVZA 3NDZA 4L9YA 2RKXA 4F9DA 4DJEA 4AE4A 3URBA 3QY6A 3KW3A 3M0VA 2L5HA 2EIMC 1U0BB 1KFKA 1TIWA 4Y9AA 1PX8A 2WLZA 1XDLA 2R7OA 2J7PD 5C6MA 4X3ZA 3QQWA 3C8GD 3R58A 1EP2A 3LMZA 1FWDC 5AN7A 1YTKA 1PTGA 3A21A 2PP1A 1PHQA 3OYXA 3ZTZA 4FLSA 1ESWA 4Z08A 1ORYA 2RD9A 4MB1A 3G1HA 3I4EA 1R3RA 2XVPA 1XLEA 2DIEA 3BG5A 4IFKB 1PZ0A 3IQ6A 2VMFA 5C2GA 4I7WA 2Z26A 3EDFA 4CSAA 1SU5A 2CHNA 2E0PA 5FACA 1MI3A 1KLZA 4CS9A 1CGXA 5IFTA 1JIBA 1NWTA 3CQKA 1K40A 1VOMA 3CTTA 4BK9A 3BEHA 4M29A 2MUCA 4JBRA 4HCHA 1KCKA 2WVNA 1VD6A 4XBKA 1D3CA 2QCNA 1S39A 4US5A 3ES7A 1YW1A 1MW1A 1TPC1 4JTHA 4GRSA 4LAMA 4YL3A 1XPYA 1UR9A 2WNQA 5G1MA 4Q8OA 2FKPA 2HV6A 3TW6A 3N2XA 2WNWA 3WUBA 4S3JA 1EP1A 4GXWA 1YMYA 4BEJA 1UQZA 4WLCA 4LALA 4LGXA 3SN1A 3QVZA 1BWLA 3VKCA 3P74A 2HZ8A 1XP3A 1BVWA 2VR4A 1P43A 4BFAA 3U48A 4GE8A 1O66A 1TVLA 4G7EB 3BAWA 1CZ1A 2XTKA 1TR9A 2H90A 3F2DA 3L4VA 5IDIA 3SCVA 3VIJA 1OGSA 1HF6A 2R94A 1H7XA 1VJZA 5JBDA 2PBEA 1NQ6A 3IVSA 4CU8A 3B8UA 5A3HA 5E0KA 1Q0KA 2X0CA 1S2CA 4QDLA 3ZMRA 4NZJA 4HU0A 4JTTA 4MS2A 3MYOA 5C54A 2Y85A 1WXYA 4ZB5A 4D6GA 1R2RA 3PG9A 4CEUC 1LL7A 3EWYA 3JS3A 2FH6A 3DGBA 5KZ6A 3CQHA 1MEHA 4UNIA 4LC8A 4YHEA 3BQ6A 3RXZA 3FA4A 4CGTA 3CYJA 3WQOA 3THUA 2JEPA 1KXVA 1IT0A 2BHZA 1IZJA 1JDFA 5CEWA 1UOZA 4EOUA 3F4DA 3W3OA 1V6TA 4ICCX 3H23A 5GNYA 3POCA 1E0VA 2EKGA 5FF3A 1M56C 3V7PA 2JF7A 3W7NA 2JGYA 5I02A 4C6KA 2NQ9A 5AYBA 1L6WA 4XWJA 1CB2A 1G01A 2YL0A 5I79A 2W66A 1DOWA 5BOFA 1B68A 3KVLA 3QPYA 5HWJA 2W61A 3KOWA 1XGZA 1RVKA 4DO5A 4DAFA 1K77A 5LGXA 4NTAA 1OWQA 2E87A 4Z1DA 3MDUA 2AP3A 4RL3A 1JPNA 4QQUA 1OM0A 2QT3A 5JU6A 4CU7A 4A3QA 2BGQA 2AWYA 2D0FA 5EMLA 2OT0A 1LRNA 3NM3A 5FEWA 4H01A 4IJRA 1DXFA 1TPB1 3KKBA 1ZHXA 5LIYX 3EWXA 3Q7GA 5LIUX 3J7HA 3WEOA 1JZ3A 3XISA 3VVGA 4GVFA 4WJXA 1ZVZA 1ITXA 1D0ZA 1O68A 4PMYA 1Y8BA 1JCTA 3UU0A 1RJPA 2BMBA 5A2BA 1CGOA 1HL8A 4IIEA 2WMHA 1W1A1 1JAFA 3R2GA 5FI8A 3LEPA 3L21A 2WV8A 5IHRA 4GYPC 3TR2A 1E6XM 3R1ZA 1UWAA 3RVZA 3VNIA 3CPUA 2RDUA 2WW5A 5BRQA 4OBTA 3MTWA 2ZZ4A 4EXAA 3UT0A 4K39A 2CESA 2YL7A 5FJRA 2F2KA 1DWGM 3MUIA 5BOOA 1JRBA 1P1XA 3INPA 1AMYA 1Q8AA 3W01A 3U8GA 1ZW2A 1P7TA 1J0HA 3E0VA 4DELA 2C04A 4N02A 1PWLA 3LA4A 2DUZA 2GGEA 4KWSA 2Y7DA 3FY1A 3FVYA 4GY7A 6TIMA 3W27A 1W5MA 4M6QA 1KGWA 2V5KA 5D05A 5K3VA 3MP5A 4I6VA 4WIWA 1M41A 4HKPA 1QOXA 2VEKA 3TJ4A 1MQPA 2EKCA 2QIIA 1KXQA 3EOLA 1UH2A 2G4JA 4JIRA 4O17A 3ABKC 3RPMA 1TJRA 3KRBA 4NX0A 1AFSA 3NEHA 4P61A 1E9IA 1JCNA 1VBJA 4Q4QA 3V75A 1VJIA 7CGTA 4H8NA 3U5SA 2F6KA 3VUPA 2VGGA 4DBWA 2DV0A 4EKJA 1FXQA 4GO9A 1SSDA 1KM6A 3BLPX 3LRMA 1CGYA 2HEJA 4GFSA 2C13A 3L4TA 1UJQA 2E3ZA 1XC6A 4ZQCA 3WQPA 4YL0A 3NQCA 3ABOA 4JN7A 5AZ0A 3MI3A 2P0IA 3VD5A 3TH6A 4A6GA 4EXQA 1HKIA 5H8PA 4LQ1A 1UKPA 3H54A 5AHMA 1NOFA 4JDBA 3UR7A 2DSKA 3GBEA 1E6PA 1OVDA 1E40A 1DTUA 3H2CA 1WN0A 3HBLA 1VBGA 3ZJKA 1H62A 1WXJA 1TRIA 3WK3A 3AMDA 1F3TA 1V7YA 4G9PA 1KM0A 3P5YA 1G8XA 3CB8A 1QI5A 4JS3A 2EF9A 1NVMA 2X1TA 5FCZA 2IXOA 3LSBA 1V08A 1UW9A 3M44A 1HVQA 3TN5A 4FX5A 4JIQA 1PIIA 4PN2A 4TVDA 1CLVA 1KFEA 4L6DA 1DOSA 3OIXA 4IFOA 1O4UA 1ZHAA 5ABHA 4KWUA 1W9PA 1XIBA 1HKWA 4MFDA 1ORJA 4ADSA 1DORA 3B9DA 2OQHA 3AFBA 1E85A 1MYRA 1Y7VA 3AIQA 3GHUA 4Q3MA 2Z7KA 3RQEA 4GXMA 2Z0IA 2GFHA 3RPDA 3SCWA 1US2A 3EX2A 4H9ZA 4RZ6A 2E6YA 4MTFA 1A7VA 2AOSA 2G3NA 1E1CA 3RFAA 4K1OA 4ILSA 3KCJA 3NMJA 4NZ4A 3LGGA 3NDBB 2BTMA 3BOLA 1G0CA 3GNRA 4F79A 3GZAA 2XH4A 4K8EA 4KWWA 2E6DA 1SJCA 1QNOA 4IPIA 4IICA 4AK9A 1DWIM 2WNZA 4N4PA 3II1A 3W2UA 1TA3A 1DJQA 3W2JA 3WG7C 3WFZA 2HMZA 2R7WA 1UH3A 4MKSA 2VQUA 3M7WA 3CQZA 3W2VA 3QMSA 1H5VA 1NFBA 3KBJA 4N9DA 2G5WA 3BVJA 1WKFA 3ZVRA 4GK8A 4XD6A 4DX3A 3GYCA 4GJJA 5COFA 3IJDA 1RY0A 2O7QA 2R02A 2A6HF 3MSYA 4K38A 4L6HA 5F2MA 4HHPA 3C61A 3TONA 2DZVA 3F5JA 3NZPA 3N19B 3QV6A 2QTVA 4IJJA 1APCA 4JOMA 1EQ1A 4RKAA 5ABFB 3TW9A 2G4FA 3WLKX 1QUMA 3SIMA 3L4WA 2J7EA 3AOUA 1N8WA 3B0UX 2CIPA 1I2PA 4EBBA 4HK6A 1K6AA 4KFPA 2LK4A 4C6BA 1YZCA 3GXIA 2NZLA 1GYNA 4DQWA 3IS4A 5FJUA 2FZ8A 1K9EA 3DWWA 2J7GA 3I6RA 1SFTA 3AJXA 2VENA 2NQHA 2XLMA 2VFDA 5A95A 3PZGA 4X63A 2VO5A 3BK0A 3LHYA 4O54A 3NTYA 3GU2A 5BQHA 3CQJA 2R7SA 4OBRA 5LIWX 4NZ5A 3EDEA 4NZ3A 4G1KA 1Q7MA 3EGDB 2I5GA 5FL0A 2IXNA 3DKLA 1HY5A 1XWJA 3A12A 1ICSA 3IJ8A 1V0LA 1UR1A 4CQ8A 4LBRA 2OU4A 5AECA 4R5EA 1EJTC 2Y0FA 2Y5JA 4JCLA 4GKLA 1W1ZA 5EFFA 1G4US 3K66A 3OLIA 1DQUA 4PYSA 2CWNA 4LV9A 2P0NA 2O9TA 5LKYA 2D69A 1J5SA 2J0WA 5A6TC 1ICQA 1XQLA 2HNHA 4P9FA 1CPRA 1PVNA 5LNUA 5MF5A 1WA3A 1E83A 4G56A 2CCRA 1RBOB 4DWSA 4DLMA 1TZZA 1TPEA 3NKEA 3L4YA 2G3MA 3WQWA 2BV9A 4LRSA 1O5KA 4XEFA 4EHPA 5FKYA 3DH7A 3GDBA 1K03A 2E4TA 3UR8A 2KAUC 4YWIA 2JFEX 2F9RA 5CC3A 4QROA 3DHFA 1SO5A 1PYMA 4G7OF 3SY1A 3B40A 3AYTA 1VFTA 1B9BA 3A5VA 4LVBA 4JQAA 4I1MA 4Z1AA 3QTHA 5A6BA 1SMDA 2O7SA 4J27A 3BLOA 1H7NA 3HNJA 4P5UA 4B3LA 1S5VA 3W0KA 1KV5A 3C6CA 1WBJA 4JNYA 3MU7A 3RU6A 3T0CA 3W00A 1MXDA 1T6UA 4XPWA 2XGZA 1BRLB 4GQQA 2PAJA 1LT7A 3O0KA 4MVMA 1H7WA 3PWIA 3PJTA 4H04A 1UIPA 3CIVA 1W1VA 2E9LA 1DP0A 4MAVA 3C8GA 4O8AA 1KM5A 2P3EA 3GHTA 5LZLA 2KNHA 2P8BA 1QATA 3LN3A 2EEXA 2FPTA 3AMGA 3HIJA 3SURA 4M80A 1F05A 2ZTKA 4GQRA 3E0FA 4GQBA 1JPHA 3DHPA 4NNBA 2QJNA 1XYZA 3OVGA 1JG9A 3R8RA 4PMNA 2A79A 1UKTA 4Y9PA 2ISSA 3KL3A 4QR6A 4RV8A 1QHOA 3VNDA 2GDVA 2QYGA 1IWAA 1P6BA 3K1GA 3GG8A 2VI0A 1XWYA 4H8VA 3NQVA 4FZIA 3RQGA 5DO8A 1DEDA 3DM9B 1JDEA 3VX0A 1XRSA 1V54C 2YBUA 2GSHA 3QVQA 1Q6FA 3MBDA 3BLFA 2R7XA 3PR2A 4PFHA 1VIZA 5C7HA 4LVDA 1SR9A 2IPJA 1L7CA 2PTWA 3UR2A 4US6A 1W3IA 4HMNA 2FHBA 1FWEC 5CI9A 2XXAB 4PSRA 2OU6A 1P6CA 1RQEA 2QUVA 2E9BA 2VZOA 2B0MA 3UP8A 4JCZA 3AHZA 4H6EA 5CPTA 4EE9A 2HVOA 5DN1A 3P93A 3WENA 1ZHYA 1KM4A 1V03A 1F8IA 1MWOA 1ADSA 1PZ2A 5MHBA 2XLOA 3O15A 4I8YA 4YYCA 3C63A 4Q4OA 3RUBL 3JT1A 1KCLA 1C8VA 4ADTA 1JZ6A 1QJWA 3DG6A 2G96A 2BXYA 4J2MA 5DY3A 3UGVA 5AHNA 1OFEA 1C7TA 3LXAA 3WDPP 4PB5A 4H6QA 1IR1A 4PB4A 3CH9A 3EDJA 2X1RA 3N6JA 5AC8A 1OG0A 1H49A 2YDQA 3SIZA 1T40A 3CV7A 4PTVA 1X1OA 2PWHA 3GTNA 4Q5SF 1IEWA 3ABRA 5M17A 4AMAA 1E5NA 2E1WA 2EXOA 3LBOA 1RXOB 3IJQA 1MZRA 4L80A 1BWKA 3IUIA 4N4QA 2IYLD 2D3NA 5H91A 3E38A 5EL1A 2VOTA 3WQ8A 1K05A 3VNJA 3QMRA 3L8JA 4PMQA 4HCLA 2VRKA 3B8DA 4JIHA 2A2IA 4JFVA 3CXOA 1BYDA 2PC4A 1GPFA 4H9TA 3RCMA 2F7FA 4MNJA 2VASA 2OQLA 1KLYA 2EO7A 2PDYA 2EPKX 4QJ1A 3POHA 1FOBA 4S3KA 2PMQA 5AHFA 2CZVA 3NZQA 1B5TA 4XZIA 3HPZA 3W7JA 4QXIA 3PDMP 2RDXA 3DFYA 4B6IA 1Q7ZA 1UROA 5DBTA 3TYCA 1XFCA 3LENA 3U0HA 3FEMA 4LYPA 3A3XA 3GAYA 1HW6A 1O3UA 1EXBA 4RNIA 3RNDA 2CEQA 3C52A 1QW7A 3B97A 1RPXA 2AL2B 3QEZA 4MJZA 3ZIZA 2QCGA 4QQ3A 5BMXA 2O9XA 1EFZA 3TW7A 3VU2A 2IPWA 1KKRA 5I77A 3G77A 3TJ5A 4AHPA 1A5UA 1XW8A 1H60A 4PUNA 4JTAB 1XH0A 2A7NA 3PZVA 3H12A 2AGKA 1QU4A 3QYSA 2BY0A 4I7VA 3UCQA 5AB3A 3UZYA 5FF0A 4O12A 1DVJA 2FMOA 5E33A 1Q6RA 4R27A 3OQEA 1EI7A 4IB4A 3WLOA 4MPQA 1Q8JA 1G7VA 2WVOA 2FZDA 4CNSA 2ZUUA 3ZM8A 3EWZA 2OLSA 1TTPA 1GVSA 3DKAA 3FA3A 3F4CA 2XPKA 2VFIA 3MY9A 1RK5A 2KK1A 4CDAA 1OW8A 2L7AA 1QXLA 5KINA 1CW2A 3KCLA 5JLIA 2ZA2A 3P2VA 2HE5A 1NQKA 4U4MA 3LM3A 1VRDA 2WZHA 1UASA 1LF1A 3BUVA 3CUZA 3NQGA 3SM0A 2Q00A 3T6GB 1E1CB 1V4YA 3AHVA 1O60A 3HA1A 2Q7RA 2HK0A 3NUKA 1S1PA 4LJ3A 1UQYA 1LM3B 1K9TA 3MT1A 2RDTA 3FOOA 3WMSA 4AD3A 4QCFA 4WSKA 1GW1A 1UKQA 2NV9A 2PA6A 4UOZA 5I3KA 4U10A 2WZMA 3WL0A 3PS7A 1TMHA 1HGYA 1EGVA 4JCHA 1E51A 3GVWA 3VIFA 3TFCA 3DI0A 4JICA 1ORSC 3VCRA 4F0LA 2GJNA 1T8QA 3OEOA 3UZWA 5DVWA 2RGMA 2WHJA 3EOOA 1NOUA 1TX2A 1J96A 3GZ3A 2I16A 4JRZA 2TAAA 4YIWA 4U5DE 3KP0A 1TWDA 4OIPF 1MUCA 3LTSA 1E6RA 3LLIA 1FRBA 8XIMA 4MYXA 3WQDA 1UFBA 3M0XA 1RQHA 2WHMA 4Q4KA 4AYGA 1U89A 1WGWA 3IGXA 3L0NA 2MWQA 3EDKA 3MX3A 4JKVA 4AMCA 4P7RA 3ATYA 3BAIA 4GYFA 4NTBA 1DHKA 2WVTA 1VBRA 1QKRA 4EKWA 5KYXB 5T3TA 2G62A 1IZCA 3BAYA 4LUJA 1ZY9A 2J8WA 1H7PA 3SYNA 1V02A 5BXSA 3RO8A 1HTIA 2CNWD 3I4KA 4JFWA 4QAIA 3KPHA 4HNTA 5FESA 4DIAA 2ZXWC 2WCSA 5HPCA 3DFTA 3DFPA 1IEIA 4AUBA 3WJYA 4OHQA 4KC9A 3ZXWA 2H9AB 2DT0A 5KTLA 5DS5A 3VGBA 2WMGA 1EXPA 1XUZA 4J7TA 1SYQA 5FAGA 3OO2A 2H8XA 4PC8A 2YL5A 4F2UA 4WR3A 3UG4A 3BO9A 3W7OA 5CSRA 3RQFA 3NPXA 4K37A 5CAKA 3N25A 1MNSA 4AB4A 3HGJA 1QLEC 3VM5A 1EX1A 1IE7C 4BQ3A 5I78A 3K6BA 3HG5A 2EHHA 3QZEA 4RZ4A 5GJNA 3ZSSA 1UH4A 1U6HA 3UQNA 3R7MA 5G2WA 2P1FA 9CGTA 3W73A 1QHPA 1VCFA 3SBFA 3OVQA 3NAVA 5TD4A 1CXLA 1E43A 4O1BA 4P7NA 3V5CA 4JTKA 1GYLA 2NV2A 4M7TA 3MMUA 1TFVA 3P67A 1FWJC 3G1VA 4OFCA 1XCWA 4JQ2A 1BDJB 3TE9A 3QRHA 2AWCA 1TA3B 1W17A 2GK1B 5EMJA 1JUBA 2ZPAA 1KGXA 1JYXA 2DIKA 1OT1A 1Q0FA 3SNHA 2VR5A 3CHCA 1X38A 4QLKA 3PPFA 4YTTA 5ECVA 1E84A 4HU4A 3ARSA 4GGBA 2OG9A 8RUCA 3QKZA 4WCJA 1XGDA 4UTKA 3DU0A 1VPYA 2I7GA 2FVLA 1T8XA 2HS8A 2IKIA 3UVIA 3S0XA 1AA1B 1EC9A 3TQPA 4TVUA 3JYHA 2AKZA 1RCOB 1WZKA 4KIEA 4O0KA 1MEWA 4FLRA 1BF6A 5K2ZA 3M0LA 4IXHA 1VHCA 3PBWA 2XXAA 2INEA 3SRKA 3IAPA 3WX7A 1DIKA 4MVRA 5E3AA 3JZ0A 4UTWA 2CLOA 3AZSA 3U7VA 4PCPA 4I44A 4QCEA 1EO7A 3E74A 1C7SA 2LSEA 4E3TA 2ZUVA 3RIPA 2D20A 4GYJA 1WTYA 3MFNA 4CS8A 4V28A 1K02A 1NLXA 2J79A 5L3VA 1QPQA 2JIEA 1J11A 3PWAA 5F2GA 5EKYA 3TAKA 1TQJA 3FAPB 4NG3A 3F5KA 3RMEA 1PKMA 4BG0A 3QQ0A 1SJDA 4DJFD 4N06A 4O50A 3CBWA 3AS2A 3H7UA 3Q37A 1WYIA 3PUDA 4AQLA 3O10A 2XVNA 3WF2A 3MBGA 1BG9A 4B5VA 4AZCB 1K9DA 2XU2A 3UWWA 3A9IA 3TNBA 1HKKA 1IZKA 2VL4A 2FQIA 2E9MA 4NJJA 2XH2A 5G4HC 1XI3A 5H6HA 3LHTA 3W82A 2P1AA 3CU2A 4NI3A 3EZIA 4S38A 1V0NA 4RNJA 3NVTA 3LCHA 4J3UA 3DBPA 1MQQA 1DJNA 4UTHA 2VEMA 3ZDLA 4WK9A 2FZNA 4HNLA 5DT7A 4GYTA 5BW6A 4MY8A 2NUPA 1DIOA 4L65A 1TX0A 4UFLA 3EB4A 2WPGA 4N6FA 1BGGA 1XBXA 1RLCL 4E5TA 2DJXA 4UTFA 2WM1A 5FOOA 3HV8A 2NXIA 4JFSA 3GHRA 5HJXA 1DIDA 4DM2A 3AYRA 5H8MA 5DCBA 3HTKC 2OELA 3F46A 4Y90A 4HA1A 2A1YA 4WUIA 1CIUA 5FJTA 3EGJA 4IMAA 2Y3HA 1EJUC 4HNOA 4DBRA 1EOMA 4QS6A 2YZRA 2QEZA 4MZ8A 4G7EA 3GY1A 3N14A 5D30A 5T3WA 1SR2A 1UP0A 1DJHA 4JTAA 4TMBA 5EBAA 3RM4A 1XZQA 3TYEA 2PD5A 3H2AA 3GE7A 4JKMA 4AH7A 1E0XA 1VKFA 3NGJA 4F48A 3UMHA 2Z25A 2DGAA 1BXNA 3VNZA 4Q6JA 6XIMA 1AH4A 4RR4A 3BWWA 2XVKA 4CUCA 3SCQA 1ZBKA 1Q6QA 1E4MM 9XIAA 1A5LC 3HPXA 1LT8A 1FH7A 3HPFA 5J5RA 1M53A 2V69A 3FMSA 4ICNA 1L0PA 4B15A 3TA6A 2GVLA 1EO5A 4YL2A 1FDZA 1YKWA 2J66A 4O1DA 3LB0A 3F1QA 4XBSA 2OYLA 4HMDA 5LIXX 1LS4A 3KWXA 2KQ9A 5JSLA 1BTMA 3H2UA 1Q0DA 4JAWA 2ALRA 5C9UA 1PD0A 5CSYA 3WQ4A 2XL4A 1JZ7A 3ASNC 4CCCA 1ZGDA 1TJ1A 5JH1A 4BEUA 3T2QA 3UZ5A 3VDCA 4FF5A 5EGYA 5COGA 4S3FA