3B0PA

Trna-dihydrouridine synthase from thermus thermophilus
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
317
structure length
307
Chain Sequence
LDPRLSVAPMVDRTDRHFRFLVRQVSLGVRLYTEMTVDQAVLRGNRERLLAFRPEEHPIALQLAGSDPKSLAEAARIGEAFGYDEINLNLGCPSEKAQEGGYGACLLLDLARVREILKAMGEAVRVPVTVKMRLGLEGKETYRGLAQSVEAMAEAGVKVFVVHARSALIPPLRHDWVHRLKGDFPQLTFVTNGGIRSLEEALFHLKRVDGVMLGRAVYEDPFVLEEADRRVFGLPRRPSRLEVARRMRAYLEEEVLKGTPPWAVLRHMLNLFRGRPKGRLWRRLLSEGRSLQALDRALRLMEEEVGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis of dihydrouridine formation on tRNA
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
molecule keywords tRNA-dihydrouridine synthase
total genus 116
structure length 307
sequence length 317
chains with identical sequence B
ec nomenclature ec 1.3.1.91: tRNA-dihydrouridine(20) synthase (NAD(P)(+)).
pdb deposition date 2011-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01207 Dus Dihydrouridine synthase (Dus)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1460 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3b0pA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3b0pA01
4JD4A 1TCDA 3L65A 4W9TA 5D02A 2FQIA 5LGZA 4IWWA 1QWGA 4S1FA 1TMHA 4DF0A 4BI7A 3RLUA 4O53A 4YWIA 4B5NA 3I65A 2GUUA 1QPRA 3IEBA 3V1PA 3BW2A 1DJQA 3A5FA 3W87A 4X3ZA 1R2SA 3E02A 4ZMGA 3I7QA 1AMKA 3G1FA 5G1YA 2QCDB 3IVSA 3HPZA 1KTBA 3R8RA 4JX4A 2F84A 3OA3A 4N2YA 4EF9A 3CM4A 3BLIA 2AAMA 3EKZA 3N3MA 3S5ZA 2VFGA 3UY7A 3EWBX 3GK0A 1LORA 2X1UA 3G24A 3W7RA 3P81A 3UWWA 3NL5A 4RV8A 4NJGA 1TPDA 3NQ8A 2QCLA 4I9AA 4UNLA 5D2YA 1DL3A 3IIZA 1JJKA 2ZRVA 1F76A 2ZA3A 3LTSA 2NXGA 4FX8A 1H7XA 3IV3A 5C6MA 3BLFA 4KWWA 1C9DA 2WNZA 5D2VA 2JKPA 4NZJA 1OK4A 3PG8A 3UPWA 3GDKA 1OX6A 3BO9A 3W7JA 4IMEA 4PH6A 2Y63A 1LBMA 4HNTA 3CEUA 1EEPA 3TK7A 2WKJA 1XM3A 5C2XA 4UTIA 4UFMA 4FB7A 1DKWA 2H6RA 4WOQA 2VFIA 4P2VA 3N9SA 4RZ5A 5AHEA 1VPXA 1DJNA 3LCLA 3W23A 4GC4A 1THFD 2PCQA 5FEXA 1LLWA 3UZ5A 5DXXA 3ZR4A 3TJXA 2ZZ2A 1TB3A 4NQ1A 2WV8A 1R30A 3LHWA 4MYAA 1WBHA 3HO8A 2A21A 4NNBA 1KFEA 4Y8FA 4K8EA 1ICPA 4FNPA 3B0PA 4HN4A 3FYOA 3QMTA 4Y9AA 3TC6A 3GZ3A 2DORA 1LCOA 3BGGA 4FXSA 3BW3A 3QQ1A 3LLFA 4K37A 4JX6A 4PODA 1I45A 3NPUA 3O07A 4TX9A 2ZRXA 1LRNA 5H2ZA 4WY0B 3LB0A 3HG4A 3B05A 5I3JA 4Z0JA 3M6YA 3CT7A 3LCIA 5EY5A 4E2DA 4QJ1A 3GNDA 2BSLA 3E9AA 2Y7EA 2ZRYA 1RV8A 4WXYA 1NSJA 3VCRA 3C56A 3B0UX 5CSRA 1Z41A 3TV8A 1TYGA 5KMYA 1AL7A 2QAFA 4RXGA 4U4MA 3H54A 2CWNA 1LZOA 4O17A 4OQVA 1K8YA 1LLZA 1OFBA 2E6FA 4JNMA 4MJMA 4UFKA 4FF7A 2CZEA 1OFAA 4UUIA 3G1AA 1VC4A 2DZTA 1Q6OA 4ONVA 3BLEA 4ZVJA 2XN1A 1SO6A 3TW6A 4C1LA 5E93A 4TU1A 4MY9A 4AVFA 3HGRA 3WK2A 1U5JA 1I4NA 1VCFA 3NYZA 3VKJA 4JYEA 3DXIA 2ATMA 3TU9A 2Z0IA 3GDRA 2W6RA 3DAQA 2Z6JA 3W7KA 4D2JA 1HFBA 1SSDA 1Z48A 2ZZ5A 4UMAA 1SSGA 3G1YA 3L2IA 4M7TA 2ZZ3A 1TV8A 2E6DA 1FQ0A 3A21A 3P5ZA 1SO4A 3W7LA 1OFQA 1TSIA 3TMLA 3KVKA 2EF9A 3LV6A 1KM0A 5D38A 3IVTA 3MMTA 1AW1A 4KKXA 3HF3A 1T99A 3BGJA 2OJPA 3TIMA 2C1HA 1FUYA 1LBLA 3W6YA 4WXZA 2YPIA 3PVFA 3TQVA 5LNVA 4UTHA 4UFIA 1KTCA 4ALDA 3I6RA 3O6CA 2QCDA 4A2RA 1GJPA 1FCUA 2YDAA 1XI3A 5EYWA 2YR1A 1K7EA 2ZRUA 5K3VA 3M16A 4JY8A 1G4EA 2B7PA 1VHNA 2OZ0A 4AH7A 1W0MA 4JTHA 4TMBA 3QSTA 4J9JA 1OJXA 3DI0A 3O6DA 3STGA 2FB3A 3C2VA 4UTLA 3LCFA 2J9ZA 1KLYA 4LUJA 1R2TA 5EA9A 3CHVA 1QR7A 5CZTA 4XUGA 2X1TA 1TQXA 2CZ5A 2HS8A 1ZHAA 3NR0A 3T44A 3WJSA 1JCMP 4O12A 3RU6A 3L21A 4LT9A 1GVFA 1HG3A 1XKYA 6ALDA 1H63A 2ABBA 2Y85A 5F4SA 5FF7A 4NJKA 3FLUA 4O0ZA 2I14A 3DGRA 3WJYA 1WXJA 3L67A 3WK0A 4E38A 2CLOA 1G4PA 2OCZA 5IBXA 1QO5A 1DVJA 3LCXA 2CLFA 3P74A 4LC8A 4GUIA 1W3TA 1KM3A 1QAPA 3LRMA 3O1NA 3N2XA 4UTMA 1S5VA 2YFOA 4XZ9A 4WOZA 1K02A 2E6YA 2E09A 2VEKA 1KLZA 2ISWA 3FA5A 3G1SA 2NV1A 3G22A 3SGZA 2DU2A 5FF3A 3QMRA 2X16A 3H53A 5AOUA 2HMCA 2Y70A 5F2IA 4JIPA 1VS1A 2TSYA 3U2OA 1YDOA 3Q58A 2Y7DA 4I7VA 6TIMA 2B4GA 1F6PA 1K7XA 4LS1A 1LROA 2DJLA 3DENA 3KXQA 3SECA 5DXYA 4CQAA 3N73A 3FIGA 2OT0A 3P80A 1YTEA 3NL2A 1KA9F 1VCGA 1UBSA 4JS3A 2QCEA 2QF7A 3IGUA 1N8FA 1JUEA 4HSNA 4JY9A 1RQBA 2J9YA 3GXTA 1P4CA 4QQ3A 4JR5A 2O7QA 2WQPA 1L6YA 5G4WA 1O4UA 1YDVA 3P8JA 1P1XA 2HSAA 3MWAA 4PA8A 3JRKA 3O8AA 4O19A 3FJ6A 2GVLA 4MUZA 3P8IA 2BLEA 3F4NA 2QAPA 1KV5A 5CKSA 3UWYA 1D9EA 1W3IA 3P61A 4FNSA 3G18A 5AB3A 3PBWA 5BMXA 1XL9A 3C0JA 1U83A 1H7PA 1TPVA 3LERA 4GXMA 3HGSA 3AO0A 3TKFA 1S3HA 3KX6A 3GNNA 4UFJA 1H62A 4WY0F 1FBAA 1DV7A 2YYTA 1YXYA 2X1RA 1V5XA 4NJHA 3PUDA 1RR2A 2ISVA 1VQTA 3S8HA 4N9DA 3P84A 1YADA 4FNUA 4QNWA 1XDLA 3M7WA 2WSRA 3G8RA 4IGHA 5ABTA 3BG5A 1DOSA 2BZNA 3NQCA 1T96A 3DHDA 5EMUA 4UIOA 3PB0A 4QIUA 1QFEA 3SR7A 2YW4A 1YPFA 5EL1A 1R2RA 1B4KA 1A53A 4KWVA 1WDWA 2RFGA 2V2DA 4MKNA 1A5AA 3DH7A 1G7UA 2A4AA 1ZFJA 4DO5A 2A5HA 5C55A 3F03K 2QR6A 3QQ0A 4LUIA 5KITA 3SW6A 3DHFA 4OHQA 1WOAA 1FDYA 3NXFA 1KM2A 3M0ZA 3S1VA 4WD0A 7TIMA 3C52A 2CLMA 3LBMA 3W22A 3IGSA 1YTKA 2Y89A 2YX0A 3NM3A 3FS2A 4EWND 5HJLA 2GPTA 4POCA 3UWQA 3GR8A 2NZLA 1HO1A 4Z1BA 3NQGA 4PL2A 2YW3A 4UXDA 1PL9A 1TJRA 3QJAA 3G0SA 4OV4A 3TNOA 1W5PA 4ZQNA 1Y0EA 5BW6A 4O54A 3C8FA 2VFHA 2ZZ1A 5HR7A 1TPH1 3HPXA 4M19A 4O4WA 5CGQA 2VEPA 2KZHA 5HUPA 3TAKA 2NUXA 1X1ZA 5EPDA 3NGJA 1RD5A 1TTIA 2E77A 3HOJA 4MJZA 1IF2A 3LCWA 4RCXA 3S6DA 1TPFA 1TTQA 2YXGA 4OV9A 1G6CA 5SWUA 4YCPA 3TCEA 1LBFA 2ZRWA 4JTLA 5K4XA 1H1YA 3M41A 4K7YA 1JCNA 4ORIA 5DCDA 4O18A 1LRTA 2W79A 3S5OA 1GQNA 5D33A 2PC4A 1M5WA 5FEPA 1BWLA 3DI1A 3A23A 4N9CA 5K4ZA 1SZNA 4MFEA 4JTGA 4ZZ9A 3OEXA 1RQHA 2ZTJA 4IJBA 4NNCA 3S1XA 5LNRA 1FX6A 4NX0A 1WAUA 1EX5A 1W56A 4R7JA 4UFLA 1ZAIA 5I3IA 1SQ7A 3NG3A 3TDFA 5H91A 4DBEA 2FLIA 3TUUA 2O7SA 4OBTA 4XTDA 4JEQA 4RX0A 1EA0A 1SZGA 2CW6A 4QM1A 3SZ8A 3B8DA 1YDNA 2WNQA 4AHQA 2TYSA 1KM5A 4JICA 1TTPA 2V0TA 4WQ6A 2QUTA 3KFTA 4PFMA 4RZ6A 3TH6A 3PULA 4I7WA 2OT1A 3B03A 3CLMA 4PL1A 2HS6A 2F7FA 1J5TA 4RK8A 3TFCA 5F4WA 3PBYA 3F4WA 1FDJA 4O52A 4LW7A 4GRSA 2PE4A 3MYOA 3IIPA 3NDOA 2C0AA 3R89A 2DZXA 4UCGA 3CEPA 1QOQA 4M6VA 1OF6A 3IIXA 4IQLA 1Z44A 3GIYA 2VOMA 2Y7GA 1M6JA 3INPA 1XBVA 2H90A 3GKFA 4U28A 4OE7A 1P5BA 3NQMA 3WJWA 3EB2A 2FPTA 5K7JA 3G3MA 1WA3A 3G1XA 1CW2A 2C19A 2I1OA 3NPXA 3SSJA 4CNOA 5HR6A 1B9BA 3LHZA 1GOXA 3VE9A 3LCHA 4PEKA 3UY8A 4MY8A 4HHPA 5AHLA 2ZA2A 4GBUA 1AW2A 2CU0A 4ADTA 4ZQOA 4NJJA 4RLIA 3M43A 3OIXA 3I7SA 1NVMA 3O6YX 4K8HA 3FKKA 3QPZA 5KZEA 4Y6GA 3LHTA 3BG9A 1TQJA 1QPNA 3HG3A 3NQDA 4JDBA 1AW5A 3QZEA 4NNAA 4NZFA 4RJEA 2V82A 2JGQA 1KFCA 4XKYB 3QH2A 1JCLA 4IPIA 1TRDA 3NVTA 3GDLA 4WJEA 1VCVA 2EKCA 4Z0SA 1LRQA 4FXRA 5CSSA 5LNUA 5DLCA 4BWLC 1EUNA 3FYPA 5FI8A 4BFAA 3MYPA 4K39A 1BEUA 1QPOA 3QPYA 3SGUA 2EAWA 1ICQA 2DP3A 4MY1A 2V30A 2B0MA 4LC6A 4PTNA 4MLJA 3GDTA 1SO5A 3ABOA 1OK6A 4S2BA 4Z08A 3UWUA 1LM1A 1SU5A 4CCEA 5C54A 3PR2A 1NEYA 1QPQA 4O57A 4UTTC 2CLIA 2G97A 1H7WA 3GX9A 3LX9A 2D73A 4BR1A 4JX5A 5I3HA 3DFTA 1PS9A 4ADUA 3S0CA 1A5SA 3W1TA 1MEIA 3VI2A 4ORMA 3TE9A 1T0OA 1OG0A 3EX6A 4E0CA 1JCXA 4ZQCA 3FOKA 2Z2UA 3PSVA 1UUOA 3M5YA 3EWYA 3JR2A 3TSBA 3LI1A 2ZQ0A 3F1QA 3QSRA 3SIZA 4S2CA 4AB4A 3W85A 1TPUA 3TC7A 1ZY9A 3TROA 2DZUA 3CQ0A 4BK9A 1W5QA 2JKEA 1KTNA 2NXHA 5LSMA 4JGDA 1ZAHA 3THQA 2V5LA 3W7IA 3W1MA 3PS7A 4MOZA 3HJZA 2HTMA 2WOQA 3NQ6A 3EXSA 3L66A 2QCGA 3MUXA 5LHEA 3PBUA 4NT0A 3W9ZA 3CWOX 1K03A 4N4QA 5HNRA 2WNNA 1UCWA 5AFDA 3NA8A 4N6FA 5EBUA 2QDHA 2J6XA 5CZSA 1EUAA 2V8ZA 1KM1A 1SFLA 3DU0A 5AHMA 1X7FA 5HINA 4YL2A 4IMFA 1LP6A 5DCBA 2P1FA 2I9EA 3MHUA 4BF9A 3EXTA 4WY0A 1VJIA 2QJHA 3W1QA 3KHJA 4AAJA 4HPXA 2ZDRA 4MPQA 2P10A 5D2TA 2IQTA 4JN6A 3TQ0A 3R2GA 3C6CA 1GG1A 3W1LA 3W1RA 4K7VA 3IGXA 3M47A 4MZ8A 3Q2DA 1Q3NA 2QJGA 4MFDA 4FX7A 5AC7A 4O14A 3KOFA 1PHWA 2R91A 1FXPA 1GZGA 3ABRA 1X1OA 1YXCA 2Y88A 3MI3A 3SFKA 3TAOA 1MZHA 3NQ2A 1TV7A 3W1NA 3TSMA 5DY2A 4ZQMA 3W2KA 4CCDA 4HNUA 4HPJA 3MO7A 4FHAA 3PF3A 5CPLA 1AG1O 1GVSA 3OVRA 3ATYA 1ZCOA 4BI5A 4IX2A 1ONRA 1A5BA 1JR1A 3S9YA 1FDZA 5K9CA 1KW1A 1W1ZA 1XC4A 1WYIA 3DFPA 3LRLA 3UWZA 2Q3RA 5HWNA 4CQ9A 2TPSA 4NXKA 4DF2A 2FFCA 1I8JA 3JS3A 1AK5A 4LTSA 2FB2A 3S1WA 4LNYA 3GDMA 3ZFHA 3RMJA 3ELFA 1HUVA 1I2QA 1WOBA 4NX5A 4UNKA 2ZRZA 3RLVA 3RNDA 3OHIA 5AYZA 1H51A 4MVAA 1ICSA 3MP5A 3PAJA 5BNKA 4GUFA 3LTYA 3W88A 2A7NA 1SZFA 4UTUA 4JTTA 2PRLA 3Q37A 4UR7A 4UTJA 2J27A 2ZZ4A 1O60A 2QEZA 1F2JA 3KVJA 5HUOA 4RZ4A 3PUOA 1OFEA 1KM6A 1LOSA 1EB3A 3QM3A 1LYXA 4LU0A 3VE7A 1PCWA 3VFLA 2AGKA 3I68A 4FEZA 4Q4KA 4PC8A 5BMWA 1H7NA 4QNEA 3I7RA 3T78A 4TR9A 3STFA 3G1VA 3V75A 3ZS4A 4UTWC 1FWNA 3P62A 3BV4A 1W8SA 2RHGA 3A22A 3DFNA 2PRMA 3W84A 3B04A 5EKYA 1MEWA 3UQNA 2Y61A 1NFBA 1OFDA 5D05A 4O8RA 1SR9A 3LXBA 4LVFA 1JULA 2V2CA 2YCEA 1SW0A 4QSHA 4AXKA 5AHIA 1G69A 4OU1A 1G7VA 3ABSA 2RDWA 4PCFA 1OFRA 3NNTA 1VGAA 5K9DA 4LVAA 1D3HA 4IUOA 5AYYA 2H3BA 5KSWA 1W5MA 4NXSA 3O63A 3PG9A 3EX4A 1FY6A 1TO3A 4JTEA 1FCVA 2YYUA 1OABA 4K36A 2VFDA 4IOTA 4O1DA 3UXAA 4AWSA 1PIIA 2NWSA 1L6WA 1W31A 2EHHA 2J88A 4LWWA 1QCWA 2QKFA 5F4XA 3BW4A 2V9DA 4UMCA 4JTSA 1EP2A 1O5XA 3LDVA 3P60A 2ABAA 3IVUA 2A1YA 5D30A 3UD6A 3HMJG 3AJXA 4GE8A 1MSSA 3O15A 3DZ1A 3UPBA 3BK0A 2BXVA 2A6NA 2YGYA 3GLCA 4GUJA 1HL2A 3U6WA 1Q45A 1W5NA 4GJ1A 3B0VC 5AHNA 3G3DA 4HT3A 3DKLA 3T55A 2CZFA 1S5WA 3LI0A 2X1SA 1W3NA 1IXQA 2R94A 3N14A 1UUMA 4FO4A 3M5ZA 2Z6IA 1EP3A 4YXGA 5G5IA 2ISSA 3M9YA 2VFFA 1UB3A 3Q94A 5BOOA 4GUGA 1RQEA 5U4NA 4ZQRA 2ZFAA 1V7YA 4UTWA 2CZDA 3K30A 2ATSA 1TPEA 4NUWA 1F73A 3NPWA 3M44A 4JXCA 4JTKA 1A5CA 1A50A 3MBFA 3L5MA 2NUYA 1QNVA 2X2GA 1DHPA 3L9CA 3GYEA 1B3OA 1TJPA 3N19B 3PB2A 4LRSA 2G96A 2UV8G 5T26A 2DZPA 3UZJA 4AWTA 2VEMA 1E51A 3TJLA 4MIMA 3EWUA 1GYLA 1M7OA 1FWSA 1UASA 3MHFA 3WFAA 2ZTKA 1IIGA 5J5RA 1VYPX 3NQVA 5F2MA 1YXDA 5FEZA 4N02A 3S42A 1PV8A 2B7OA 3DBPA 3ANYA 5G1TA 1HTIA 3MP3A 2E5CA 3PBVA 3QEZA 3QRHA 4DPQA 1R46A 4H4IA 2QCCA 1GTHA 2XN0A 3WK1A 3WK3A 1XBXA 5DBTA 3UWVA 3VNDA 3GB6A 5LZLA 1KFKA 1GVOA 2WPBA 3T4CA 1P0KA 2C18A 3P7YA 4IMDA 1FCBA 1K8ZA 1PE1A 1SO3A 1KBIA 4DQWA 4A21A 3SI9A 3W2UA 4AMAA 5LGXA 5L6UA 1DQXA 2VKZG 1H60A 3LRKA 5CG7A 2NWRA 4MZYA 3W1PA 1WX0A 1JQXA 4H6KA 2AQWA 1SPQA 4M5PA 4N6EA 1IXOA 2EPHA 2WO5A 2R8WA 4ZQPA 2PRHA 2VEIA 3QYQA 3FEMA 1NAL1 1KV8A 4DBDA 3ATZA 1GTEA 3L5LA 4M7SA 3E96A 4UC5A 2VXNA 4YMZA 1MXSA 1MO0A 1GVRA 3R13A 2YZRA 2Y6ZA 3KRUA 2C13A 4A2SA 3N9RA 2NUWA 4A22A 4XBKA 4O1BA 3HPSA 5TIMA 4JTFA 3W7PA 5D04C 1BKSA 3EWXA 1R47A 1KBJA 3W2LA 2CLHA 4OWGA 3NOEA 2QCHA 1I2PA 4GUHA 3W1AA 3B06A 2GQAA 2GVJA 4AF0A 1ZJIA 1I2NA 3W86A 3BG3A 1VHCA 1F05A 2YSWA 2DZWA 1GVQA 1F5ZA 3HGOA 1EIXA 3E12A 5C5YA 1SZEA 1G4TA 2BX7A 4G1KA 3LGEA 2FPVA 2EGZA 3LHUA 2G5WA 3LOTA 1ZENA 3EXRA 1TV5A 1QMLA 4OGZA 3O05A 2ZA1A 4TIMA 4IPJA 5CPNA 5HWMA 1PCKA 4R53A 1O5KA 3MBDA 2OX1A 4XBSA 3M5XA 4C1KA 3WJXA 4KFPA 2TRSA 3IIVA 3E0IA 2E5DA 1IGSA 1JUKA 1GT8A 5HULA 2WSYA 1OF8A 4AHPA 1ME8A 4RR4A 3W1UA 3W74A 3PSWA 1YLVA 3C3NA 3LXCA 5G2WA 3HIJA 1WBJA 4O1CA 4WZHA 4Y96A 1Q6RA 2RDUA 1K8XA 3EX2A 4UTKA 5D2WA 5K2ZA 4HIBA 4BI6A 5KINA 2GJNA 1XXXA 1DQWA 3NL6A 3CIWA 2ZZ6A 3S5YA 1G67A 4XQ6A 5G4EA 5I3KA 1TPC1 1YTDA 3TW7A 2E1DA 5DBUA 3W2NA 2NX9A 2VELA 4AWUA 3CTLA 1F6KA 5FEWA 3CB8A 4LVDA 3UYCA 1ME9A 1VYSX 1XBYA 1XFBA 3U8GA 3DFQA 4N9BA 3RF9A 4EOUA 3SJ3A 2C16A 3EWZA 5AN7A 3C4UA 4UFHA 5F2LA 1KFLA 5E1QA 3EKLA 4NVTA 5KTLA 3W07A 3TMQA 1EP1A 4EIVA 1H50A 1HO4A 1TPB1 3G1DA 4M6QA 3LV5A 1EPXA 5AC6A 2BTMA 3LLDA 4Z1CA 2DZSA 2ALDA 3HG5A 2V81A 5DY3A 3C2RA 4XKYA 1XUZA 1DBTA 4HSOA 3C61A 2GVGA 1IIHA 1WQ5A 2A7RA 3HG2A 3DKJA 3DFOA 3C2FA 1F7BA 5LNWA 4A3UA 1SFJA 3CPRA 5DN1A 2Q8ZA 5E0KA 5F2GA 4KFOA 3P67A 3TSDA 4LV4A 4JIQA 3OVPA 3QC3A 3KRZA 4RXFA 5AC8A 4LOCA 1LTDA 3LM7A 4XTIA 4OT7A 2LLEA 2DJXA 1VH7A 3RK8A 3CWNA 3W2MA 2NLIA 4TMCA 1VZWA 3MI6A 3W3OA 3GAKA 4A29A 1WV2A 4FNQA 4NJIA 1H61A 5TBOA 3QF0A 1TREA 5K9XA 3OVQA 4LY8A 3FKRA 3H55A 3NZ1A 3PM6A 5G2HA 2E6AA 4JTUA 3QW3A 3OG3A 5AYXA 1YPIA 5I3GA 4JYDA 3TX9A 2FIQA 1C8VA 1ZALA 5HQEA 1ME7A 5MHBA 2A6LA 2VFEA 1CI1A 1N55A 1JUBA 1M7PA 1H5YA 1BWKA 2V5BA 5A5WA 4MLRA 1AL8A 4AF0B 3HBLA 4IMCA 3LTPA 3M1ZA 2QCFA 5LKYA 3NZRA 1Q6QA 4I7UA 3FFSA 4ZL1A 4Y90A 2GOUA 1RVGA 3W1XA 3HB9A 1NF0A 4O0KA 3NM1A 1H7RA 2ZCGA 4DF1A 2Y7FA 3TR2A 2QCMA 4O13A 5L9FA 2RH9A 3NQAA 4N9EA 2H3DA 1CX9A 5TQLA 2NX1A 5HWJA 3PY2A 4X9SA 1GG0A 3NQEA 3W75A 2CLLA 4L4LA 3HGJA 5D37A 5F1UA 1DORA 1H1ZA 3TFXA 4R34A 1IXNA 1H7OA 3S5NA 3SY5A 3L0NA 3STEA 1VR6A 1FWRA 2C15A 3R12A 2GJLA 3LCGA 3BVJA 2BWGA 3G8EA 3NQ7A 3HQ1A 1FWTA 2J24A 1KFJA 4K6AA 1SW3A 4TO8A 4QISA 2B7QA 1JCYA 3DFSA 4CQ8A 4E2BA 1Z42A 4DO6A 1OYCA 3QW4B 4DELA 4O1AA 5U7SA 3FJLA 4M6PA 5D03A 4DPPA 3B4UA 3MHGA 1OX5A 3L68A 1L2UA 4O50A 4QAIA 4O4VA 3BPWA 1W5OA 4DXVA 2Q8LA 1P0NA 2H8ZA 1SW7A 5FF0A 3W2JA 2C14A 2H8XA 5IM51 2P0OA 3W7QA 2ZZ7A 3NEVA 1ADOA 3KVLA 1GEQA 4Q33A 4MZ1A 1J2WA 1KM4A 3PWAA 1B4EA 2VC6A 3KAOA 3NAVA 2DZVA 2QCNA 1OYBA 1G4SA 1K7FA 4XWUA 1FCQA 1PVNA 3NPVA 1EWDA 1LOQA 4H3DA 3ZWSA 3CIXA 4UTTA 3GAYA 4ICNA 4AEOA 1C29A 5KZDA 3C2EA 4EVZA 1ZNNA 3IIOA 2QUUA 3C2OA 4FX6M 2E5BA 4JTJA 3NL3A 1TTJA 4LVGA 4Q32A 5AHFA 4CNPA 1GPWA 3GKAA 1L6SA 1RZMA 1YYAA 2CLKA 4IXHA 4QITA 3W83A 1FWWA 4JYFA 3W7NA 4FIRA 4IMGA 2A0NA 5LHFA 4CNNA 3UXDA 3W70A 1GYNA 1K3UA 1QO2A 1FXQA 5I3FA 3MJYA 3G0UA 5CZJA 3ZWTA 1VLIA 5KZMA 4LS2A 4LS0A 4UMBA 4NU7A 2FTPA 3USBA 1OFOA 1OX4A 2W0UA 4LV9A 1BTMA 2C3ZA 1LDCA 3W7MA 2Z1BA 3TXVA 4GNJA 2Y62A 4O16A 3W7OA 1QOPA 4LRTA 3LHVA 1Q6LA 1VLWA 4DEFA 4JDYA 5FF4A 4ADSA 3MP4A 2JGYA 3PUEA 4Z1AA 3L0KA 1F74A 1O95A 3TQKA 1TPWA 3W7DA 5F1VA 1RPXA 5GVJA 1S5TA 3P82A 4O11A 3W71A 1KFBA 3A24A 3KVMA 1OYAA 2WSQA 2WJZA 2ZBTA 3NQFA 3TXZA 1O94A 4K38A 5A8GA 1OVDA 2RDTA 3GVGA 1VRDA 2A2IA 1N7KA 2FJKA 5CZ0A 3A9IA 3NO5A 1SUXA 2FPYA 5G2IA 1W54A 1X8FA 5D09A 2A85A 4UR8A 1TIMA 4YCOA 5DELA 2RKXA 3G0XA 4GWEA 2VENA 2V2HA 3A5VA 4N4PA 3TA6A 4O10A 3N2MA 1LOLA 3OBKA 3EWWA 2OMAA 4CLMA 3CC1A 3W73A 3N34A 1X6UA 3CU2A 2C6QA 1NF7A 3GXPA 1ZAJA 4AHOA 3W72A 5BRBA 3LBCA 4KFNA 4O15A 3YPIA 3STCA 1JCJA 1XUUA 2X30A 1I2RA 3E49A 4WUIA 2CLEA 3BARA 5D32A 2B7NA 3T7VA 2TMDA 1J4EA 1D3GA 3IRDA 3ABQA 1JRCA 3W7GA 2J9XA 5IBXC 3PC0A 3W76A 1B57A 2XN2A 3EX3A 4FNTA 1GWJA 4IX0A 2QDGA 1EWEA 3QMSA 4Z1DA 1XBZA 2XFWA 2Q3OA 4P61A 2R14A 2JBMA 1ALDA 4HNNA 4MYXA 3RFAA 8TIMA 2JK2A 1OX4B 4FIQA 1JVNA 3M5VA 3S1UA 3EEGA 1MEHA 4CCCA 2QJIA 4ML9A 3KRSA 5LNSA 3GXNA 2ZYFA 4BWLA 3THAA 3G1HA 1OFPA 2JKAA 4RKAA 1JQVA 3LXAA 1W37A 1XCFA 4HKPA 5DCEA 5D2XA 4JTIA 2E68A 1PHQA 3L0GA 3T40A 3W7CA 4L4MA 5CPOA 4EF8A 1TRIA 2PURA 4IXXA 3W7EA 2A7PA 2QUVA 2NXIA 3O06A 3R5EA 1L9WA 1T8XA 4X22A 3W7HA 1XDMA 1VYRA 3QFEA 2FDSA 1ML1A 3GR7A 4HNVA 1IXPA 2GQ9A 4X2RA 5HMSA 5FESA 3MI2A 3D0CA 4GFSA 5J5DA 2GQ8A 3MW7A 5FF2A 2NX3A 2YFNA 4LVBA 1I2OA 4FNRA 4WX2A 1JRBA 3O16A 4DO4A 1UJPA 3WJZA 3L5AA 1QDSA 3P5YA 2NV2A 4O28A 1OHLA 4YLWA 2G95A 3UNDA 3LHYA 2CFFA 3EX1A 5CPMA 4R33A
chains in the Genus database with same CATH superfamily
4JD4A 4NZCA 1XRTA 4IMAA 2XINA 4JE9A 2BB0A 1UZHA 4B5NA 1EC9A 3T0TA 3UJSA 2QV4A 5AVNA 3X2QC 5JSLA 3DD7A 3A5FA 4AEFA 4WEVX 3CUXA 4EPEC 3PZIA 3TWBA 1P43A 1KGUA 2Q71A 3PAOA 4GFIA 2MANA 3CM4A 3EB3A 1S7ZA 1OZQA 2YLAA 5CCZA 3KOXA 1FMWA 4PBGA 1OKKA 3UY7A 2JF6A 3MSDA 3OWTA 2GSEA 3SQMA 2NT0A 3R79A 3G24A 1MUMA 1AUEA 3N17A 3NL5A 3QXBA 4ILSA 2FFHA 3NQ8A 4I9AA 1LUCB 3IIZA 4ZGYA 1GQIA 4J7TA 1OD0A 2BODX 3ZDLA 2NXGA 2PC8A 4FX8A 3GIQA 4MVRA 3WN6A 1Z69A 3SCVA 2WMKA 1XP3A 1WZAA 1ZHTA 5FA5A 1C9DA 4PCPA 1LL7A 2JKPA 4WGHA 4NZJA 4ER9A 3IPMO 2V69A 3BO9A 3W7JA 4C6MA 4C6OA 4IMEA 1Y5WA 1LBMA 2GWGA 4QG6A 3TK7A 1XW8A 1LG2A 3HPAA 3OW1A 4ZO7A 2ZADA 4UTIA 2BXZA 1Z9AA 4FB7A 1KO0A 1YBQA 2E8ZA 1NOWA 3E2SA 4MJ2A 1VJSA 3N9SA 3VA8A 3EFOA 1D7FA 4LAKA 4GQRA 1VPXA 3EYPA 3KUMA 3WLRA 1L0PA 1XH1A 3SCRA 3CYJA 4GC4A 1FH7A 3MKCA 1EGMA 5DXXA 1LT7A 3WQCA 4DJEA 1XCXA 3TJXA 4U5BE 4KCUA 3AG1C 3OTRA 1R30A 1EIBA 5D9NA 5KYUB 4MPKA 5C7VA 1KFEA 5BQHA 2VURA 4DRSA 4P6IC 1GOMA 3QMTA 2HISA 4H00A 4PUJA 2DORA 3BW3A 2P76A 2DUZA 2AOSA 1W8GA 4K37A 1OIFA 4JX6A 1I45A 1PDZA 3O07A 3QR3A 2ZRXA 4Q4OA 3W27A 4WY0B 1MMDA 3MY9A 3HG4A 3B05A 4DWDA 5I3JA 1B54A 3M6YA 4F79A 2OGJA 3LCIA 1DTUA 4QJ1A 4G9PA 3GNDA 4W8AA 4ERIA 2P1AA 2OZTA 1OQFA 3C56A 2VZTA 5CSRA 5L0JA 1FAPB 2XPKA 3K33A 4KERA 1TYGA 3UETA 2QAFA 4U4MA 4OBSA 4BF7A 2E6FA 2GK1A 4CU7A 4O7GA 2R7XA 4D6HA 4OIQF 3ZSTA 2DZTA 3GM8A 2YBUA 4ZVJA 2XN1A 2D20A 2VR5A 4C1LA 5E93A 1BBHA 5JH2A 3RILA 3WK2A 3ENLA 3RO8A 4JYEA 2D0GA 3TU9A 2HZGA 1IWAA 3W7KA 1SSDA 1Z48A 5A2AA 5REQB 4DRIB 1SSGA 3G1YA 2FHBA 1FQ0A 3A21A 3QZAA 2XVNA 4JQ4A 4IQDA 3W7LA 1E3XA 4MB3A 3SZRA 3LV6A 2XUCA 3AHXA 4GH1A 1HJXA 3IVTA 1NJJA 1E9YB 2C03A 1J0KA 3HF3A 5JXQA 1E0TA 5KYUA 4IGGA 1FTXA 4JFWA 5LNVA 4FXJA 1MMAA 3O6CA 4EK7A 3MT1A 3AHYA 4A2RA 4Z9JA 1GJPA 3WD3A 3AGUA 4NSBA 3VIOA 3WG6A 2YR1A 4XD4A 4DO7A 1K7EA 4JHZA 2PDBA 3M16A 2OZ0A 4AIOA 3ZLFA 1RKEA 2POTA 3VDHA 3KE0A 4B5VA 4ENLA 3STGA 5H8PA 2P5NA 3OBEA 3PBMA 2R05A 4WSKA 1ZU5A 2H9AB 4XPYA 5DX7A 3QTHA 1TMLA 4ERAA 2OPJA 1QR7A 3KCOA 3POVA 3AHTA 2V5JA 2X1TA 2CZ5A 1ZHAA 2WW5A 4PUDA 3RU6A 2R7SA 3UXLA 4H8VA 4GQQA 1H63A 1U33A 2ABBA 3KYJA 2QNEA 4B3KA 4O0ZA 3PFMA 1KRCC 1WXJA 4KRTA 2CLOA 2QUNA 3ARXA 2OCZA 3H70A 1REQB 4H9XA 1QO5A 1CBGA 3P74A 1XQKA 2GVEA 4EAYA 1KM3A 4E8CA 3LRMA 3IJ8A 4E2VA 2YFOA 4AD0A 4O0QA 4ZFCA 5CPTA 2YB4A 1Q4NX 3WD1A 1KLZA 4JIOA 3SGZA 1J79A 2CNCA 3VD7A 2X09A 2HMCA 2Y70A 3PJXA 4I7VA 4W89A 6TIMA 1F6PA 3ZVHB 1B31A 4NYYA 3LNRA 2DQWA 4G7EB 3C0LA 4EXAA 5HBFA 5E2QA 2X0CA 4RZBA 3GC2A 5E33A 3N73A 3FIGA 4B3ZA 2ZWZA 3A4JA 4JS3A 3WQ8A 1N8FA 3LAYA 2GDCA 4HPNA 4PACA 1JUEA 2CHOA 4HSNA 1RQBA 5IDZA 1GW9A 3GXTA 4NAFA 4S3DA 1LS4A 1L6YA 4P8XA 1LVKA 1BYBA 4PA8A 3CL6A 4J2MA 4O19A 2XS8A 2J7DA 1XLLA 3RF3A 1XYZA 5C9XA 2GVLA 2A6HF 3PZQA 2O56A 4E0IA 5BQGA 3CUHA 2IPGA 2BLEA 1BVWA 1QI5A 2OOCA 1D9EA 3P61A 4H6EA 4WJ8A 5BMXA 1XL9A 3C0JA 2W5FA 3VGEA 1H7PA 2E9MA 5E09A 2FHFA 3LERA 4GXMA 1S3HA 1T7LA 1B5TA 4P7RA 1S2TA 3QGKC 2X1RA 3MB9A 2YL5A 2ZUSA 1I0BA 5C8BB 5JUAA 3DXJF 4PMZA 1YADA 3NDZA 1JYXA 1XDLA 3TTSA 5ABTA 2QLAA 3NQCA 1YDIA 3BEHA 4D6IA 2WVNA 3DHDA 4UIOA 3PB0A 1Q6GA 3HNLA 2J62A 3LYEA 4MVUA 3U2ZA 4HOXA 1YPFA 3P14A 1OKKD 3GG0A 5DRIA 1A53A 2C04A 2X7WA 1V02A 2V2DA 3BSHA 2A4AA 1E4LA 5C55A 2BS9A 1XIBA 1VTMP 2QR6A 3VNLA 3C8GB 4C6NA 1UP2A 5EMMA 3AQBA 2Z00A 3B8TA 2RAGA 5A6LA 1T5AA 2F38A 1KM2A 1IEVA 1E0UA 1I1WA 2AQOA 5FAJA 4JIHA 3EJNA 3C52A 256BA 3LBMA 1V02E 3OYZA 1EZ2A 2HJ3A 1M3UA 4HD5A 5T91A 3BSGA 4AIUA 2WKGA 2DDXA 3GR8A 1HO1A 3OZMA 4PL2A 4R7WA 4UXDA 2C91A 3O2LA 4RNFA 4CS8C 4O1FA 4ZQNA 3IJ9A 3MDUA 4MVQA 4O54A 4ACYA 5HR7A 2G3JA 1TPH1 2EJ1A 3MUCA 4M19A 5CGQA 1E73M 3W29A 1S2UA 2AKZA 5EPDA 1U30A 2IQ0A 4DVOA 4DUVA 1W1YA 4MJZA 1IF2A 4RCXA 3H21A 3K8LA 3QHMA 1TTQA 4OV9A 4DJEC 4HHHA 1G6CA 3RYLA 5SWUA 1P0DA 4S23A 2WLZA 1Z23A 1FKXA 2ZRWA 2EIKC 5K4XA 1H1YA 3M41A 4K7YA 1JCNA 5DCDA 1LRTA 3QVZA 5FJRA 1E71M 4QE4A 5E5CA 1M5WA 1FWCC 3DI1A 4Z2JA 5K4ZA 1SZNA 1VFFA 3C0QA 5LNRA 2ZTJA 2R25A 1TR9A 3LPFA 4P8UA 2D4UA 1FX6A 2BFGA 4CDYA 2HEJA 4GI9A 1SMDA 1WB0A 3TDFA 5H91A 4Q8NA 2Z24A 3N18A 3TUUA 4OBTA 4JEQA 2W62A 3T08A 3SZ8A 4S3JA 2XXAA 1YDNA 2XM0A 1VIZA 2TYSA 1TTPA 1MNDA 2V0TA 2QUTA 4PFMA 3HQNA 4RZ6A 4J4KA 4JVSA 2PI6A 3PULA 2OT1A 1VFTA 4RK8A 3TFCA 2HPIA 3QPEA 4LW7A 4AC1X 4GRSA 3CUFA 3SURA 4ICCX 2H9AA 3CEPA 1OF6A 4IQLA 4TXEA 3RPDA 4AY8A 4IISA 1LS1A 2IBFA 5C71A 2VOMA 1M65A 3ITYA 4JTRA 1M6JA 2H90A 3GKFA 3PZUA 3N4AA 4OE7A 1GQAA 4GYTA 1E4MM 1P5BA 8A3HA 3WJWA 5K7JA 5ABHA 1QKRA 4GEHA 1HVQA 1GKPA 2VGGA 2WC7A 4JQAA 3VOGA 3DGBA 1H1NA 4H8HA 3TTEA 1REQA 2B81A 1B9BA 1GOXA 4XVEA 1RJ9B 3VE9A 5AHLA 4RDZA 5BU6A 2FYMA 3K4AA 3GHRA 4RLIA 3OIXA 4U31A 1EQCA 1NVMA 1CXLA 1PD1A 1P48A 3FKKA 4K8HA 3QPZA 1MWOA 5KZEA 4Y6GA 1NWTA 3C8NA 2LSEA 3KKBA 3NQDA 4JDBA 2O9XA 2NV9A 2L5HA 4NZFA 2JGQA 1J01A 3WBYA 3S28A 1WUFA 4KEMA 4Z0SA 1MUCA 2CHNA 4FXRA 2IXNA 5CSSA 3T09A 3AU6A 3EOUA 4J3WA 3R2PA 3ES7A 1W1IE 4QR6A 1BEUA 1ONXA 2DP3A 4HBKA 2V30A 4OECA 2B0MA 1DE5A 2DIKA 4PTNA 1SO5A 3ABOA 1OK6A 1AH0A 4DXWA 3L12A 4G7FA 4UZUA 4B5UA 2YBVA 3IQCA 1PKYA 1NEYA 2OQYA 4Z1YA 2A3HA 1NP2A 4HFFB 4HYWA 3LX9A 1R4TA 3OODA 2A3CA 4RV3A 3S0CA 4DVYP 3I10A 3C8GD 2ICWG 1A5SA 3W1TA 2V38A 3TE9A 2NW0A 1F3XA 2Z2UA 1H0GA 1WCGA 4D6DA 3TN3A 2ZX7A 3EWYA 4W86A 4NTFA 3ANVA 4IP4A 4DJED 3GU2A 1YA7O 5DQZA 2J25A 1AD1A 3SIZA 4S2CA 4AB4A 3W85A 1TPUA 1GEHA 4CU8A 4UQBA 1ZY9A 1V4YA 3ITVA 4W5ZA 1W5QA 2OYLA 2NXHA 5LSMA 4F3HA 5BOEA 2NUTA 5A6SA 2G3FA 2IPJA 2V5LA 3KBWA 3UGOA 3HJZA 4O1EA 4H7CA 3NQ6A 1JI2A 3ABXA 2BY1A 4FR6A 4YNGA 4GBDA 2JALA 4XZBA 1B3XA 1Q8AA 1K03A 2FMOA 1ZU4A 2PCEA 5DEZA 5CZSA 3CV1A 1DWHM 2V8ZA 1KM1A 2JPUA 3DU0A 4C6IA 5BWAA 4XV0A 4CIPA 1IR2A 4QS6A 2XIIA 2P1FA 3MHUA 2GUYA 5XIMA 3GBEA 2DVXA 3TOYA 1AVOB 2DY3A 3CSKA 4BQ4A 2GAQA 4GYKA 1HJUA 4HPXA 4URIA 2ZDRA 3VKCA 4C91A 2AWYA 2IQTA 2IXUA 3DERA 1W2WA 4E7ZA 1EJXC 3ZSSA 2G4FA 5I0DA 1Q3NA 4E8DA 4FX7A 1FWJC 3KOFA 1PHWA 3RFYA 2WMHA 3LBOA 1K1DA 4RDYA 4DI9A 1ORYA 3J06A 6XIAA 3EGJA 1TV7A 3EDDA 1E6PA 1MMGA 1A5NC 4ZQMA 3W2KA 1KNYA 1TQGA 1KU2A 4GYJA 5H8UA 1WKDA 5CPLA 1M6TA 1GVSA 3UT0A 2XVGA 1A5BA 4L9XA 1FDZA 1NU5A 3TEVA 2MWQA 3VGFA 1XX1A 2BMBA 3LS9A 5B1AC 6A3HA 4DF2A 1S5MA 1I8JA 2FFCA 2ACQA 3MU7A 3Q7LA 2WB7A 4QLLA 1A4MA 4UNKA 2ZRZA 3QLDA 1P6BA 2UZ9A 1S5NA 3IJQA 2EPOA 1WASA 4IPNB 2FH6A 1ELSA 1SGJA 1ICSA 3WQFA 3PAJA 1XIJA 1Y4CA 2J9BA 3ARTA 3LTYA 2A7NA 2WVQA 4PRTA 1X6LA 2LQGA 3E1F1 5LXXA 3BQ6A 1YYJA 1PUDA 3OIHA 4UTJA 2QEZA 1F2JA 1TE6A 5G1MA 3G4XA 4PB3A 4DB7A 4MTVA 3CQIA 3MKKA 4MB1A 3W8HA 5HUOA 2IPFA 1FWDC 1V79A 2AGKA 2MHRA 3WCZA 1RK5A 3BMVA 1JZ5A 5C2GA 4RE3A 5CBIA 3G1VA 4UTWC 4BA0A 4LYPA 3ARSA 4C6QA 4MVOA 4ECLA 1LPEA 2KSFA 1Q85A 3HTKC 5D05A 3KZSA 2Y4SA 1KRMA 1JULA 3TQOA 4QSHA 1JYWA 4IF2A 2ADAA 4OU1A 3ABSA 4K8GA 2RDWA 4PCFA 4C6DA 2SFPA 2QIWA 3N29A 3PG9A 3QVQA 3KDNA 1FY6A 1TO3A 3DZAA 2HXUA 4ZXOA 4DAFA 4K36A 3N6JA 4IOTA 3UXAA 4GOAA 1AQFA 2EHHA 3LPOA 2PDKA 4EHPA 3F4VA 1QCWA 1OSEA 2PTXA 4JTDB 3BW4A 3GM2A 2WHKA 3HNJA 1VLTA 2V9DA 3LDVA 1BZ4A 3KL4A 3NYMA 4C5ZA 3AMKA 2V3DA 2VVSA 2CETA 3C63A 4LAZA 4NZ5A 3DZ1A 3LESA 2BXVA 2A6NA 4P7LA 4KT2A 4YTRA 2XDFA 4AX2A 3GNPA 4N4WA 3B0VC 5AHNA 3G3DA 4HT3A 2CBJA 2J8TA 3NYJA 4OJYA 2GGJA 1S5WA 3UEQA 4TOQA 1OGBA 1XGDA 1FVPA 1RALA 1T5OA 3PHAA 4MNKA 4M29A 2R94A 3NKEA 1U5VA 2E67A 4FO4A 1AMYA 2Z6IA 2DW7A 5FL1A 1V3JA 2Q01A 5CZKA 2PDGA 3R4IA 4YXGA 2W67A 3NKDA 2EBNA 2VGBA 2D3NA 3GH5A 1Q0KA 3KTXA 1XRVA 1OCQA 2CPUA 1QNPA 2HV5A 2CZDA 4QX4A 3I3EA 1F73A 1PZ2A 2ZE0A 3M44A 1O87A 2YOCA 3L5MA 2X2GA 3FMSA 1QNVA 2XVKA 4ULVA 1TJPA 3N12A 4GJJA 1TVLA 4JW1A 1D1AA 3UZJA 2VEMA 5DRCA 2RJGA 3O0KA 3NVDA 3ZVRA 5HK4A 1M7OA 4HK6A 1M9HA 5I2UA 5GJPA 1IIGA 5J5RA 1VD6A 3NQVA 3R94A 5F2MA 1EKOA 1C93A 1E6QM 1PV8A 4NRSA 3I6TA 3IEEA 1CXFA 3ANYA 4DWSD 2B31A 2WWDA 1H9TA 4L1GA 3LQLA 2NVAA 1TKKA 3MP3A 3CV2A 3QQWA 1R46A 4J30B 3ALGA 4ZENA 3P6LA 3WK1A 4U9DA 1VP5A 4RD9A 5A6AA 2FKPA 1XBXA 5DBTA 3UWVA 3GUWA 4Q4QA 3VNDA 3V1HA 2ZXRA 3GB6A 3ZVIA 3BUVA 1OGGA 3T4CA 1E56A 4I8DA 1IHIA 4EP8C 1PE1A 1KBIA 4ML4A 4HYRA 5I03A 3T9OA 1B3WA 4AMAA 3BCDA 4MZYA 4JRZA 3S9OA 7A3HA 3VDBA 2XVLA 1JQXA 1SPQA 3U3FA 2E28A 5H1WA 2OQLA 1ONWA 5BCAA 1CPRA 3WUBA 4ZQPA 4H9UA 4CSAA 2VEIA 3QYQA 3FEMA 4M82A 4M7SA 3V35A 2PLMA 2NQ5A 4L80A 4CS9A 3N9KA 2BOGX 1IGWA 5DMLA 2NUWA 3DYOA 4XBKA 4DWSB 5TIMA 4JNZA 1TA3B 3TOPA 5D04C 4QBXA 2HV7A 4S3BA 1DEDA 3W8IA 3OLEA 2CW0F 3Q45A 4KESA 1EDTA 4NILA 3AXHA 3TK0A 5MF5A 3BCFA 1TFOB 1I2PA 4AF0A 2PP4A 2GGIA 1DXEA 3IACA 1KRAC 3BG3A 1VHCA 1MUWA 1EKYA 1U5HA 2XH0A 4GI4A 2YL1A 2FFIA 1JIBA 3N3TA 3HGOA 5C5YA 1DOVA 1JL8A 4G1KA 1JZ3A 5L0GA 3H2OA 3IRSA 3ZQVA 3LHUA 3CZ8A 3CPGA 4GYPA 4XISA 1LQ0A 3EXRA 3WBEA 4JZ5A 1JI1A 3O05A 2YHSA 1YNQA 3U9MA 3WHNA 3MKVA 2Z1SA 1D7KA 3WF3A 1DYSA 3MC5A 4OUIA 3OBAA 2QPSA 5D9OA 4U3CA 2E5DA 1KKRA 1IGSA 1JUKA 5HULA 1T8QA 3T8QA 3HZ3A 3LXCA 1EQPA 4O1CA 4WZHA 4Y96A 1M2VA 3W38A 3OGVA 3NSMA 4G6CA 3GVRA 3HQPA 2RDUA 5CJMA 4HIBA 4BI6A 5E3AA 1NG1A 5D91A 1UIPA 1DQWA 2OEKA 3AU2A 4H7VA 1NBBA 2ZZ6A 3S5YA 1G67A 4J32B 5I3KA 2J79A 4Q8MA 1YTDA 2ISFA 3TW7A 2WCAA 4KCWA 4UOJA 3TN4A 2NX9A 3W2NA 2FZMA 2ZC1A 2J7PD 3VMOA 3CTLA 3CB8A 1GCYA 1ME9A 1K9DA 2R03A 3DFQA 4DLFA 3HPFA 3CUJA 3ASNC 3RF9A 3S3GA 5AN7A 3PJWA 2WMJA 4NHVA 4UFHA 5EK0A 2HPMA 2Y3HA 1L6GA 5E1QA 1FHUA 3RX4A 3GUGA 3EKLA 3EZ4A 3EWCA 3CT2A 1HO4A 1LQ2A 1TPB1 1JMWA 4GVGA 3G1DA 4CQDA 4Q8OA 2BTMA 4Z1CA 4HZMA 2V81A 4CN1A 2CEQA 3C2RA 3ORWA 3ZJ7A 1DBTA 1TWIA 1IIHA 5D8WA 3GIPA 3AYTA 5LNWA 2WB5A 4A3UA 3TZFA 2J6VA 5F2GA 1TUFA 2EG6A 1Y7VA 4HE8D 3P67A 4DN1A 1NH6A 1BLIA 2VDIA 4RXFA 1ITXA 3O6AA 2ZUTA 4Z9HA 2LLEA 5MKGB 3CWNA 2NLIA 2G3VA 4PJNA 2D1ZA 5C7HA 3IANA 4HCLA 4B9YA 5JBFA 1OGSA 4XKMA 3I3BA 4LACB 1KD0A 2R1MA 3D47A 5CC7A 2GJPA 3PZTA 3GW0A 3WD0A 1D3CA 1HW1A 1EQ1A 3VX1A 3WLMA 3TX9A 2FIQA 1C8VA 1ZALA 5HQEA 3ZT5A 1TR2A 3DYPA 4PMQA 3A13A 1JPHA 1NFGA 4AZIA 1RY0A 3VAVA 1BWKA 1FWEC 4W8PA 1G4WR 4EBKA 4C6FA 2Y69C 4ROPA 4TX6A 4IMCA 3W24A 2OU6A 4L1XA 4HGXA 1OBAA 4B5TA 3KBNA 3H22A 1Q6QA 1JXJA 3WEZA 4Y90A 1B68A 4DWSC 3QV8A 2WC4A 2E3ZA 1RVGA 1NF0A 1FHVA 2WZHA 4O0KA 4PFHA 4ZOAA 3UJRA 2I16A 3NQAA 1VBGA 2RH9A 2OGYA 3BJSA 2H3DA 1CX9A 5TQLA 2DZAA 5HWJA 4X9SA 1KKOA 3V7OA 1GG0A 1DOWA 3H12A 4GYFA 3QC0A 3ANUA 4OOUA 3DUGA 3WDPP 1DWJM 4DOZA 4HNOA 4JPGA 4PBFA 4IHCA 4ANJA 1UKSA 1CYGA 3TFXA 1NWUA 3R43A 3L0NA 2HVOA 1VR6A 1ZW2A 3LEVA 1HL8A 3WIJA 4DM1A 3L8IA 3RJYA 1A41A 4ZEPA 4BJ5A 1RXQA 1ZL1A 3ARRA 1RCOB 2VCBA 2B7QA 1GYMA 3AIRA 3AJ7A 1R8LA 4HU0A 4W87A 1BGAA 5U7SA 4K0DA 4N06A 4DWSA 4E0HA 3VD3A 2Q8LA 3KCJA 3B9QA 3L2LA 5FF0A 4CIHA 2Y3GA 2NPUA 5IM51 4C6LA 2YXXA 4XAZA 3KVLA 1UWIA 4FXFA 4AMCA 1MVYA 2Y5JA 1J2WA 3AHZA 3PWAA 3EOSA 4HMEA 3URBA 5FSDC 3NAVA 2DZVA 2VHLA 1OYBA 1G4SA 2YCKX 1Q8JA 5BU9A 1A3HA 3QW0A 2J7PA 4H3DA 3VUPA 4UTTA 3GAYA 2DH2A 3D6NA 4HJFA 1QTWA 1C29A 7PTDA 3QVYA 2XGBA 3IIOA 1TJ2A 2QNLA 3W26A 1JDFA 1TTJA 4LVGA 4Q32A 3HU7A 2DQXA 2CLKA 3VABA 1EI7A 4QITA 1R3VA 3SXMA 1FWWA 3POCA 3PUGA 4AY7A 4C60A 4ONSA 3SCNA 4IMGA 2A0NA 5LHFA 4CNNA 3UXDA 4S3EA 3W70A 1ZZPA 5ENLA 2PDFA 5A1AA 2JEPA 4UWMA 3T0BA 5A6JA 3AUJA 3DDMA 5I3FA 3G0UA 5JRAA 1U2YA 4LS2A 2L6FA 4LS0A 3O3RA 3ZR5A 4NU7A 3USBA 2V5KA 4IP7A 3NYDA 3WNMA 2W0UA 4LV9A 2AVKA 1BTMA 3S2NA 2Z1BA 5BOFA 3PNZA 4GNJA 1GOWA 1N82A 3AUOA 3LHVA 4M81A 1NM9A 1UKTA 1CT5A 5FF4A 1Q4WA 4XAYA 3PUEA 1U1JA 3WLKX 4AZCB 3TQKA 3T4WA 1TPWA 2QQ6A 3C0SA 1JG9A 4JQ1A 3NWRA 4MADA 5C9ZA 4HMNA 4D6GA 4GC3A 5CBBA 3KVMA 1IW7F 3S2CA 4LNCA 2HVMA 1KXQA 3WSUA 4K38A 2RDTA 2A2IA 2OJED 1ECQA 3NO5A 4HOZA 3VCNA 3U2EA 2P88A 2QS8A 1CGOA 2WKLA 2R6OA 2VL4A 1M7JA 1WDDA 2J7HA 2J74A 1Z6KA 3WUGA 2VX4A 3G0XA 4AYSA 3A5VA 1TFKB 3TA6A 3S29A 1LOLA 3EWWA 1UH2A 4DHGA 4HPGA 2Z26A 2C6QA 3DAGA 4E4FA 4AHOA 3GANA 3MSGA 3KOWA 4JKLA 4XD5A 4QDMA 3F47A 2VRQA 2R7TA 3YPIA 2J9VA 1LT8A 2CYGA 1JCJA 2DVTA 3FEQA 3S2MA 3STCA 5ABFA 3VM5A 3HTWA 3VTRA 3DBNA 4GK8A 3SCSA 4PUEA 1JYNA 3RR1A 2OOGA 2B7NA 5D32A 2TMDA 3IRDA 3ABQA 3RG6A 3SRHA 2YLDA 1YIXA 3W7GA 3EDFA 3W76A 1B57A 3FAPB 2XN2A 4QRNA 1UMLA 4WK9A 3CL7A 4ATDA 4XX6A 3VYWA 1EWEA 3F4CA 4Y9MA 2PGFA 2WHJA 1XBZA 1KFWA 3DI5A 1ALDA 4CD8A 4MYXA 3RFAA 1NFNA 1AH4A 4GGBA 3VOFA 2QJIA 1MMNA 3M0JA 2IS7A 3GXNA 2X42A 5LNSA 8CGTA 4U10A 2WZTA 3LXAA 1TE1A 1UOZA 2BVYA 1T6QA 5D2XA 4IB4A 2E68A 2R7UA 2X2YA 4BQ5A 1TRIA 3SXKA 4IAOA 3KLKA 5EMYA 3SYNA 1R5ID 5I6SA 2J7EA 3RGTA 3O06A 3M0HA 3TR9A 1XDMA 1VBHA 1R3QA 4CS7A 3OLIA 4X2RA 3D0CA 4GFSA 4Z17A 3Q65A 3WBAA 3O16A 1W9BM 4DO4A 3FK4A 5D9PA 4R88A 3WJZA 4HN8A 2V5CA 4AVNA 3M6DA 4F4BA 4YTQA 1G9HA 3DJUB 1QDSA 4AZ7A 5JS5A 4O28A 1OHLA 2G95A 2HK1A 3TN6A 2DVUA 3L65A 5D02A 2FQIA 3NUKA 1CGVA 1TMHA 4DF0A 1EX1A 4BI7A 3ABLC 3RLUA 4O53A 1ZP4A 3I65A 4L56A 5C9UA 1UR1A 1DJQA 4U2ZA 1BD0A 1XD0A 4X3ZA 1WN0A 3LS0A 1R2SA 4ZMGA 3SEOA 3ZVHA 2WVVB 1AMKA 3HPZA 3S46A 4AK9A 1E9LA 4N2YA 2F84A 3V16A 3CB3A 2PGEA 3LUTB 4UZSA 3N3MA 3S5ZA 5AC5A 5FJJA 1LORA 3WLJA 4LLCA 3UJ2A 4CKQA 3L23A 4E3TA 2EIMC 3DWWA 3CWHA 4C65A 1Q66A 5D2YA 4QDLA 5KYWB 1TWHA 1JJKA 3WH8A 2QDDA 2GUBA 2ZA3A 1E1EA 2X41A 3CZGA 3NURA 5C6MA 3VCCA 2WWCA 4KWWA 3WDJA 1TCMA 4OZOA 1Y6DA 3T6JA 2OLAA 1A7DA 4O6NA 3MWCA 3PG8A 3UPWA 1VOMA 4I90A 1C7TA 5KYXB 2XVPA 4PH6A 3EAUA 2Y63A 3R8GA 4HNTA 4O6MA 2H7BA 1DWFM 2VQUA 3V5ZA 4X60A 1CWYA 4U5DE 4DXKA 2OVLA 3FNDA 2ZXBA 1V6WA 3B9NA 4UFMA 5LA1A 2FHCA 1DKWA 2H6RA 4IIGA 2VFIA 4P2VA 3U57A 4HMDA 4J3XA 2QMKA 3VIFA 1D0ZA 4KRZA 1THFD 4BY3A 5BXSA 3QY8A 2PTYA 2GL5A 4E4PA 3WKZA 1E6SM 1TB3A 1BGGA 1WBHA 3W37A 2HRWA 5L0HA 1VB5A 5D9MA 4K8EA 1QHZA 1TV4A 2CKSA 4FNPA 4YJ5A 5JVEA 4HN4A 4M1RA 2DGAA 5DT7A 5IXEA 1LCOA 3GG1A 3L2MA 3LLFA 1TWZA 3ITLA 3MV01 4YT4A 3UPMA 2WNWA 4TX9A 5H2ZA 3H24A 1WUEA 3LB0A 1M03A 4XB3A 4AX7A 1QHPA 4PSRA 3GVWA 2VZSA 4YVXA 2QY9A 3AAMA 3AFBA 1M41A 4E2DA 4YWQA 2BSLA 3E9AA 2Y7EA 2ZRYA 1QI2A 5CAHA 1US2A 3B0UX 4C7GA 3LM3A 1IR1A 1Q0FA 2Q6ZA 2OKUA 2VUYA 3NDBB 3H54A 4KCTA 2J7GA 1K8YA 2R7VA 3ME3A 4JNMA 4C1NA 3T2QA 4AZGA 1DP0A 3TLQA 4W8BA 2DIEA 3BAJA 4UUIA 3G1AA 2PDWA 1Q6OA 4ONVA 3BLEA 3TW6A 4MKSA 2NSOA 1DJYA 2PNOA 4ACZB 4ATLA 4QSFA 4A2NB 2Q00A 3HGRA 1OCCC 3VKJA 5GPGB 5JLIA 3GDRA 2Z6JA 1Q5MA 3HV9A 2ZZ5A 1PZ3A 4W7WA 3L2IA 1R0MA 4M7TA 5T9BG 3OU8A 1AODA 1TV8A 3MQTA 4AC7C 2V63A 4M80A 1SO4A 1TSIA 1W2PA 3VGGA 4C3DA 1WTYA 1KM0A 2PTDA 4KKXA 1XIMA 4AQLA 4YYFA 3KPHA 4W5UA 1LBLA 2YPIA 3TQVA 1T01A 1B9ZA 4UFIA 1MI3A 2FVLA 1FMVA 3W2WA 4ALDA 2V26A 3V0TA 3DESA 1XI3A 1FP9A 3M0XA 4Z2LA 3EHNA 5T3WA 1PSCA 4IM4A 2XXAB 2G4JA 5K3VA 1G4EA 3H65A 1VHNA 2B7PA 3GNOA 2OLSA 4JTHA 4TMBA 4H04A 4GINA 3DKAA 3VD9A 4PMUA 3B4YA 3O6DA 1Z7AA 3W53A 2O9RA 2V68A 3S9ZA 2GDQA 2HNEA 5AY7A 2OZ8A 2J9ZA 3SADA 3MDWA 3M0YA 2G3NA 4R5EA 4XUGA 3UGVA 1TQXA 3AXMA 1R85A 3WJSA 4KRUA 4O12A 2HROA 4JKKA 4LT9A 1HG3A 3SP1A 1FWAC 3WNLA 1XKYA 6ALDA 1SF8A 1UWQA 3T2OA 1YBQB 3VGBA 4BQ3A 4S3GA 4DJFA 3FLUA 2VMFA 1XLHA 3LK6A 3L67A 4G1NA 4FESA 3WK0A 1ONEA 2GLKA 5IBXA 1BSLA 2XWDA 4QS5A 5REQA 2CLFA 1RJPA 1YNYA 4LC8A 1EXBA 4GUIA 4OOZA 4Q4SA 3W4RA 1SMAA 4U9EA 1A0DA 3N2XA 4P7OA 4GXPA 1S5VA 4UCFA 1TELA 4WOZA 1JAEA 1K02A 2QUPA 2VEKA 2PBGA 4F2TA 3G22A 2DU2A 3BOLA 1NELA 3OLDA 5F7UA 1VEPA 4JIPA 1VS1A 3KM8A 3ITOA 1QXLA 1XIFA 1K7XA 1LROA 4IIBA 1XH0A 4HTBA 3WUFA 4CQAA 3JRTA 3N04A 5CJ5A 2OEXA 3NL2A 1UBSA 4Q8PA 4HU8A 3V36A 2QCEA 3IGUA 3ARUA 3P93A 3LPGA 2EPMX 2EKGA 3IJ7A 2KAUC 1XG3A 5IFPA 3DG6A 3E2VA 1Q65A 1ST6A 1YDVA 4DJFD 1UW9A 3JRKA 3FJ6A 1KGXA 2ZKMX 4HJWA 1S2VA 4MUZA 3P8IA 3U2LA 1R7OA 2CXGA 4TQTA 4LDRA 1KV5A 2VVNA 2ZXDA 4NY2A 3G18A 1KCZA 3VXGA 3PZNA 1XYMA 1TPVA 3ARVA 3PCVA 1NU7D 1V3HA 4UFJA 2PDXA 1FBAA 1YXYA 4S3FA 2QGYA 4NJHA 2X8RA 3PUDA 4MTGA 1RR2A 2BASA 4F2BA 4N9DA 4GKLA 3U3BA 3G8RA 3S6OA 2OO0A 4INFA 3K1DA 1E6RA 1NP0A 5EMUA 1VEMA 4C6BA 2AU5A 4Q6JA 1NDYA 1VRXA 9XIMA 3RAOA 1E40A 5EL1A 4HTYA 1Q7ZA 4G2DA 1B4KA 1HKIA 3MCMA 1WDWA 2WMIA 4B2DD 3ARQA 1A5AA 1G7UA 1ZFJA 4DO5A 3A9CA 4UQEA 4CJOA 3KEHA 1CXHA 2QGHA 4PFPA 4L61A 2HMZA 4KIRA 1FDYA 2Y2WA 4XO6A 3LLIA 3M0ZA 1N1CA 4WD0A 4GY7A 2VB6A 7TIMA 2YCIX 2CLMA 3CAXA 3SN4A 3K13A 2Y89A 4DY1A 3E2RA 5A8OA 5KYYB 1UD4A 3RHGA 2X51A 1QJWA 4EWND 5HJLA 3SO7A 5CGTA 1XR2A 2BVTA 4Z1BA 3EGXB 3EPVA 4EKJA 2PX3A 1TJRA 3QJAA 3G0SA 1V08A 3TNOA 1J11A 3WBWA 3FSTA 1W5PA 1UHVA 3C8FA 4R9OA 1E0XA 4BEUA 5ABGA 2KZHA 3TAKA 1X1ZA 4GCXA 3NGJA 3RJXA 1TTIA 2WJDA 1B3VA 2NSGA 1X97A 3LCWA 5T3TA 3S6DA 1TPFA 3ZSUA 1EHNA 3H2MA 1HGWA 1J6PA 3N6HA 4QDWA 3LQGA 1LBFA 3WLQA 3T0CA 4JTLA 1HMOA 3L4TA 1X39A 4CD4A 4O18A 1JXKA 5T9CE 3S5OA 5L3VA 2PC4A 4IICA 2ZX5A 1BWLA 5L0CA 1EC7A 4MFEA 4JTGA 1YDYA 3OEXA 1RQHA 3UA4A 4XBJA 1C8YA 4JC7A 1UJQA 1GOQA 4UFLA 1ZAIA 1LKXA 3PN8A 1SQ7A 4QLKA 5I3IA 3NG3A 3T2PA 3GDBA 4W7UA 2O7SA 4XTDA 1T6UA 1AUSL 1C3FA 1VKFA 2CW6A 3NZGA 4QM1A 1RKCA 2Q3TA 2ZUNA 4TVDA 2GOKA 2EO7A 4MF4A 1V6TA 1ITUA 3QOKA 1EJRC 3JYHA 4PL1A 3CLMA 3SUVA 1QI4A 5F4WA 3APYA 2QDEA 3BTNA 3R10A 4JNYA 4KI2A 4R9XA 3QYSA 2BE5F 3NDOA 2HSBA 2C0AA 2ZUWA 4M6VA 2HWGA 3T0AA 1YVIA 4EBJA 4XPXA 1BHGA 3GIYA 3M0IA 4EAMA 1AZ2A 2Y7GA 5LIYX 3INPA 1XBVA 4QCFA 4RE0A 3IARA 3KMIA 3FGCA 3P3BA 1IYXA 2DV0A 3G3MA 3WELA 4DJDD 3B8WA 3M64A 4CD6A 4HOWA 1WXZA 1J18A 2I1OA 3IK4A 4A8LA 4G56A 1UP3A 3LHZA 3EHMA 1ZBCA 1NFOA 3RLGA 4HHPA 4J27A 2CU0A 3CQKA 3T05A 1GOIA 4ZQOA 3WG7C 3QLLA 1RH9A 3RITA 4RL3A 3DC0A 3I7SA 1RA0A 4KNWA 3WENA 1CB7B 2YL7A 1RP9A 3QKZA 4IFKB 2PX0A 1VIWA 5BRPA 4RJEA 2FZBA 1QNRA 3VZXA 4PZVA 3CMJA 3FAJA 1MQRA 3NVTA 4WJEA 3U3HA 4JKVA 5CSUA 1QI3A 4KCVA 4BWLC 1EDGA 1EUNA 4GNKB 3MYPA 1IEXA 1AZ1A 4H54A 3II1A 3QPYA 2X7VA 1JEZA 2EAWA 1X96A 2CWXA 4MLJA 3GXIA 3KL5A 4S2BA 3NSNA 3PR2A 3WLNA 4H8UA 4O57A 2DB4A 5LYRA 1PWLA 2VJXA 2MUCA 5E6ZA 1KXHA 3QGVA 4H2CA 1PS9A 4ADUA 4A8RA 1WDQA 1JCTA 3VI2A 1KCKA 1T0OA 3AS1A 3UWEA 4ZQCA 2PU0A 1LQAA 2WZGA 3S0XA 2QVHA 1UH3A 3PSVA 3W81A 2UUHA 1OT1A 1PWMA 3M5YA 1XIIA 3CH0A 3TTYA 3JR2A 1VYIA 1DIKA 3VNJA 2VASA 2Z15A 9XIAA 1WKEA 3P0XA 2W27A 4F9JA 4H4KC 3U5SA 4BK9A 1OW7A 4OIRF 3VKBA 1SZIA 1ZAHA 3PZGA 1RJ9A 3AS0A 1CXKA 2IXMA 2ZXWC 4NIRA 2IXOA 4RE4A 3N4EA 3EXSA 1GJWA 4MHBA 2A6EF 4PTDA 4N4QA 3AOUA 4GVFA 5B7YA 4NL1A 3ZOAA 5E6YA 4N6FA 4K7BA 4F4RA 2QV5A 2EPLX 5F5FA 1X7FA 3ONCA 4Q4ZF 5F28E 4YL2A 2YL6A 5DCBA 3FDKA 4HZ8A 4Q22A 1H41A 4BF9A 1A7EA 3R25A 2PLJA 4WY0A 1VJIA 2X1IA 4ZCWA 1NWSA 3W1QA 3KHJA 4I9JA 4FA3A 4JCHA 1JFXA 1N8IA 1RP8A 1V74B 1XRSA 4U5GA 5D2TA 3ZT6A 1PXGA 1D8CA 3R2GA 3C6CA 1GG1A 3W1LA 1CB2A 1UR4A 4K7VA 1XPYA 3IGXA 3RCNA 3M47A 1R3YA 2QJGA 2WAGA 3ABRA 2CCYA 1X1OA 4NAEA 1HXJA 3S90A 1LWIA 2GK1B 3SFKA 1UR0A 2OSXA 1MZHA 1V51A 2NQZA 2VT0A 3RXZA 4PMNA 4P9FA 3MO7A 2VX6A 1I0DA 1W1B1 4X63A 4BI5A 4IX2A 5DQPA 2A0UA 1RBOB 1OCNA 1UC4A 1XC4A 1WYIA 2PFHA 2VWSA 4NXKA 4YT5A 3CHCA 3JS3A 1PIGA 1AK5A 4LTSA 2DZBA 2OR2A 3OZPA 1ZUAX 3ZFHA 1HUVA 2P53A 1N2VA 3H4WA 2QVNA 4NX5A 4U5FE 3RLVA 2P3EA 4ZSUA 1I6NA 5AYZA 3UF9A 3UG5A 1H51A 1ISXA 2ALRA 1EF2A 2GA0A 1QPUA 1RCXB 4W88A 3K66A 3MO4A 3O7UA 3W88A 3F7JA 1P0EA 3L7RA 4V1YA 4UTUA 1R9YA 2DW6A 4RDAA 2PRLA 3IV8A 3SN0A 3GTNA 4HPHA 4M24A 4PJJA 2OEMA 1O60A 5CPQA 2WC3A 1UPMB 4DNMA 3PUOA 4OVXA 1EB3A 3AXIA 3VE7A 1EOMA 3VFLA 4JHOA 3I68A 2BGSA 3VC5A 4Q4KA 4PC8A 4Y9PA 1H7NA 1E9IA 3T78A 4TR9A 3ITFA 1MMFA 1RY8A 3STFA 4L6DA 3V75A 1BRLB 1QATA 3P62A 2HS5A 3B04A 3WQ5A 4AYGA 3UQNA 2Y61A 4N42A 1YX1A 3USZA 5HSWA 1C9WA 1OFDA 4IIDA 3HNKA 3B8VA 4LVFA 6PTDA 3GH4A 4EX4A 1V4AA 5CC5A 1SW0A 3NO3A 4M0XA 5CJNA 4B92A 3DECA 1VGAA 3ZYZA 5K9DA 1XIHA 5A6KA 4AZCA 1XDJA 3HV8A 3WNNA 5DO8A 3JRMO 4NXSA 2L81A 3C18A 1TA3A 4EWJA 4NASA 2NSFA 1I9CB 4JTEA 2XM2A 1OABA 2J4GA 2VD8A 4AWSA 3VZYA 2NWSA 1L6WA 1EGVA 3S2JA 3UR5A 2UY4A 2J88A 2ZIDA 3F5JA 4H41A 2Y3BA 3TWAA 1NIUA 4LWWA 3LN3A 4H9MA 2OCCC 2VYOA 2YXOA 2WYSA 3VIMA 1O5XA 4QTGA 4HA0A 3KS5A 4EANA 1BR1A 3IQ6A 2FMNA 3UD6A 2XLMA 3AJXA 3K7DA 1V3LA 4MKVA 1MSSA 3RMEA 4JEAA 4D6CA 2Z25A 2YGYA 3SRKA 4YT2A 2FDMA 2EJAA 1Q45A 4GX9A 4GJ1A 1FH9A 4FMVA 1PD0A 2F6XA 3T55A 1QPKA 2OFJA 4JOMA 2GGGA 4L1WA 3RRAA 4HFKB 4MNDA 3LI0A 4U5IA 1I5NA 3EDJA 1H4PA 2QT3A 2UY3A 3N14A 3M5ZA 5T1DB 5HATA 5G5IA 3SJNA 3M9YA 3DE9A 4PTVA 3H6OA 1RQEA 1T6MA 2Z1KA 4ZQRA 2TAAA 4PR9A 3FYYA 4AE4B 4NUWA 4H8NA 5A2BA 4V1XA 3NPWA 1C02A 4XIMA 3MBFA 2NUYA 4YL1A 3N19B 3WLTA 3EPNA 3V5XA 1EZWA 1Z3NA 2G96A 2JEQA 3T6GB 2UV8G 1EA9C 5T26A 1RD6A 3E0WA 3OA1A 4QDPA 4MIMA 2PB1A 3E5PA 2XZ9A 3PK7A 1GYLA 1FWSA 3EG9B 5DS6A 5M2FX 1GKRA 4KBXA 1CDGA 4P9TA 1YXDA 5FEZA 3S42A 4FX5A 5HAOA 4MQ9F 4D9PA 1LE2A 1GUVA 2VP8A 1LG1A 5G1TA 2YB1A 2O9PA 4JTDA 3WNKA 4ZB2A 2ICSA 1HTIA 2E5CA 3PBVA 2XSAA 1S3TC 4UNIA 5AYBA 3S27A 4XK2A 4H4IA 2XN0A 5T8GA 1OCJA 1FFRA 1PTAA 2V3EA 1Q6FA 3FXGA 3FA3A 5RUBA 3UR8A 5LZLA 1DXFA 1KFKA 2WPBA 1P0KA 1BF6A 3FHDA 3P7YA 4IMDA 1FCBA 1TZ9A 1K8ZA 3EPMA 2XH2A 9CGTA 1GZJA 3UR7A 4WJXA 5CH9A 4BZYA 3AOFA 3GO2A 3JZUA 3WLLA 3RCYA 5CG7A 4M5PA 4H6KA 4H1ZA 2I56A 2DSUA 3UYIA 1IXOA 1Z32X 2YRFA 2VZVA 2R8WA 4RNJA 3C5QA 1ZP3A 1L8PA 3W82A 2HSQA 3GTHA 3ATZA 1GTEA 3L5LA 3E96A 2VNCA 1YYXA 4YMZA 2HBXA 1MXSA 3BSMA 1GVRA 1JDDA 3KRUA 2FAPB 1WXYA 3TYDA 3N9RA 2VRKA 2LCHA 2P0NA 4O1BA 1J0JA 6ENLA 3A47A 5FL0A 4JTFA 2VQTA 1ZYRF 4RDWA 1RPKA 1R47A 1G1YA 1KBJA 1XISA 3TYZA 4QJ5B 5E9AA 4EXBA 1OADA 2HKVA 1J8YF 4F0LA 4GQBA 4XAGA 3W1AA 3B06A 4DZAA 3BWWA 3FJ4A 2UY5A 3D5HA 2YSWA 2OWCA 2JIEA 2D3LA 2DZWA 5AECA 1F5ZA 3ARZA 5EMKA 4MNMA 1EIXA 3E12A 1PPIA 1SZEA 3EA3A 2FTYA 2G5WA 2EIJC 1FTSA 5GQBA 1ZENA 3SCTA 1QMLA 1BTCA 4H19A 4I5UA 4LEFA 1DJZA 1EJTC 2PBEA 4MMWA 5EB8A 5HWMA 3JYYA 4S3AA 5B7ZA 1K4GA 3W4YA 1V0KA 3MBDA 4XBSA 3M5XA 4MWAB 4C1KA 1A49A 1JZ4A 1BYCA 4KFPA 1LJYA 3IIVA 4PTMA 3E0IA 1APCA 4LCSA 3CZ6A 3ERPA 3L34A 4AW7A 1OF8A 4JFVA 1PO9A 1G5AA 1ME8A 3CUGA 3W1UA 4F0RA 3QKEA 3A3HA 3OQEA 1WBJA 2RUSA 1Q6RA 1O5RA 1RK6A 3EX2A 4YL3A 4UTKA 4OFCA 2GSHA 4JIRA 4G5DA 3LGGA 3NQBA 4JN7A 4XLNF 4ZTYA 3R0KA 3ZTZA 4N0RA 3PP7A 5DBUA 3AIQA 2VELA 3WL0A 4CDAA 1NTHA 3CS2A 1TR1A 1HT6A 1F6KA 1X38A 3UYCA 2POZA 4MGGA 1E1CA 3U8GA 3KYIA 3H4GA 1OXKA 1KGWA 1EJUC 2PFDA 2BDQA 3F4DA 1W3LA 5DT5A 4EOUA 3D3AA 3SJ3A 7TAAA 4FLOA 2D24A 6REQA 2GWWA 1C8XA 1QK0A 1EOKA 1WKFA 2G8ZA 2REQA 4DYJA 3WLSA 4EIVA 4C7DA 4YWSA 2HV6A 3LV5A 5FKYA 5AC6A 1ZJHA 3LLDA 3HG5A 2ALDA 3CNYA 5DY3A 4C6CA 4XKYA 3UNTA 1F9CA 3O9NA 1E2XA 1Z8AA 3C2FA 5DN1A 4Q7CA 2ZXAA 2Q8ZA 1Y65A 4F0SA 4IL2A 4LV4A 3VNYA 4HHLA 3IJDA 4TVUA 3GFYA 3LM7A 3FHAA 3QN3A 1SM9A 3LLKA 2CHRA 4C7OA 2Z2BA 3G6LA 3EB4A 1MDRA 3SDOA 1VZWA 1VENA 3GAKA 2QW5A 4NJIA 3EOOA 5TBOA 3QF0A 2NT1A 4BJ6A 3OVQA 4LY8A 1DIDA 3H55A 2G3IA 2E6AA 1OG6A 4AL0A 4BEMJ 5AYXA 1ECEA 3MA8A 1YPIA 5M17A 2CERA 4AL1A 1XGZA 1CPUA 3VKDA 3N0TA 1CXIA 2A6LA 4Q4RA 1CLKA 3G6MA 1SJDA 1K05A 2NUPB 1JUBA 1PX4A 2J7FA 1EHAA 3BZJA 1H5YA 4MJ4A 5M1TA 2V5BA 1R3TA 4AF0B 1OW6A 5HXMA 3KOYA 2R1KA 3C3UA 3LTPA 4AD5A 1VBUA 2XLEA 1HL9A 3M1ZA 3OLGA 4LAUA 1SR2A 3NZRA 2PDCA 3EDEA 5A94A 3CXOA 3HB9A 4JEBA 3PMRA 3GH7A 2OXNA 1H7RA 1K77A 2QCMA 4B9ZA 3AS2A 1HP4A 4O13A 3F5KA 3E5BA 1ISWA 1QW8A 3UCDA 2NX1A 3PY2A 1QI0A 3FW6A 4DVZA 1XQLA 3NQEA 3W75A 5D37A 1CGTA 3WLHA 5BXTA 4Q8VA 5F1UA 1DORA 4TV5A 4I5XA 2R7OA 3S5NA 2Y24A 3SY5A 3STEA 1FP8A 4E2OA 1FWRA 3CMFA 2P0IA 3RVYA 2GJLA 2BHYA 3AWNA 1FNTc 1OIMA 1K9FA 2JE8A 2OZ3A 3BVJA 2BWGA 3G8EA 1C17M 2XIQA 4XAPA 1C8QA 5ECUA 4C7OB 4EE9A 1FWTA 1A0CA 4J2PA 4NZ4A 5E9XA 4IZGA 2PDYA 1YW1A 1SJBA 4CQ8A 1W1TA 4E2BA 3TA9A 1LUCA 1SYQA 4KETA 3FJLA 3DX5A 5D03A 3HNIA 5CC3A 3S1GA 3MHGA 1JPJA 1OX5A 4GZJA 1L2UA 4QAIA 4O4VA 1A47A 1TIWA 5DANA 1P0NA 3WEMA 3WY1A 3J7HA 3GNXA 2WVSA 2R9RB 1O1HA 4HZ6A 2P0OA 3NEVA 1ADOA 1GEQA 4Q33A 4D6JA 3MSRA 1H2JA 3WUEA 4MZ1A 4HMCA 1B4EA 1QVBA 2C79A 2J7BA 2XLVA 2VC6A 4A3RA 1S2WA 2KK1A 3VX0A 1K7FA 3OP2A 1PVNA 2W4XA 1GGOA 3CIXA 3SCUA 3VC6A 1T41A 2D2GA 3KWSA 4WIWA 9RUBA 2E5BA 1SMYF 4WKAA 3NL3A 2JIWA 4JTQA 2C0HA 5KEZA 1OCBA 2W9YA 4XSMA 3GKAA 4GQGA 1YYAA 3BLPX 4WVXA 2AMGA 4Y9OA 1BF2A 1F8IA 4ZOEA 2O92A 4US6A 1QO2A 3JW7A 3MJYA 2I8BA 3NRHA 4N6HA 1VLIA 4GIRA 1ZVZA 5A95A 2DUAA 1XLCA 1J10A 3TJ5A 1OX4A 2INEA 3W7MA 8RUCA 2KX9A 2A3EA 1CGWA 4CVWA 4W85A 5A6MA 5L3QA 4LRTA 4IGNA 2CNWD 3RW0A 4DYEA 4JDYA 3QY7A 3CIVA 1HW6A 3MP4A 3KCLA 3L0KA 1F74A 5EFDA 2PEVA 2HBVA 3TYEA 3P82A 3W71A 3ZO9A 3VGHA 3UJFA 1OYAA 2FH8A 3H2NA 2WSQA 2V5DA 2J9UA 5A8GA 4ACZA 2J8FA 2V67A 3S2LA 3EZHA 4PTWA 3F2DA 2VX5A 2FPYA 3DIPA 3M4CA 1C7SA 2OSYA 4AY1A 1X8FA 2AL1A 2XZ7A 2IXVA 4W93A 1J12A 2WJEA 1JZ7A 2RKXA 4GWEA 2VENA 1PEZA 3SY1A 1H3GA 3JUGA 1WDSA 3GG7A 1KR1A 2A0BA 2H8AA 3W73A 4H6QA 1X6UA 4V15A 3TTQA 1IT7A 3GM3A 2Q9AA 2R02A 1XICA 3H26A 1IE7C 2VGIA 1RCPA 3W72A 3LBCA 3VDAA 3MZNA 1E5NA 1DJXA 2X30A 3AIEA 3MMDA 4B15A 4WUIA 4NTBA 3CTTA 2CLEA 3UZZA 3TCSA 3B9DA 5BROA 3K46A 5I00A 4F0KA 4DZ5A 3MTWA 5IBXC 2M64A 3APTA 4FNTA 4IX0A 5I06A 3DM5A 1PKNA 3EMCA 4D1IA 3QMSA 1OY0A 4X0RA 4P61A 4DZIA 1XLGA 4HNNA 2GDVA 2R7RA 3M5VA 3S1UA 1XIGA 2VDGA 3PWGA 2NVDA 3DN5A 5COMA 3VVGA 3THAA 3G1HA 4BWLA 3RH3A 4QG9A 3R1ZA 5B80A 4C1NB 4QI2A 1W37A 1PX3A 2YDSA 4HKPA 1IEWA 3SUUA 1PHQA 4GD0A 3W7CA 1XIEA 4EF8A 3PTQA 2C1GA 4IPLA 6TAAA 3NDYA 1QRQA 3VDGA 1KNWA 2QUVA 1L9WA 1T8XA 1HKJA 1VYRA 3EFOB 2GQ8A 2PF0A 3MW7A 3UXKA 3L4UA 5FF2A 1I2OA 3PHF2 2QYGA 1OZMA 1UJPA 1XYFA 3E2QA 4OIOF 2NV2A 1GS9A 1UWRA 1UG6A 2J8GA 4FOJA 1ZBKA 4B5WA 2OYMA 3EX1A 1QNQA 4WGYA 2VH3A 2HXTA 1XWJA 3GEHA 3ZQ9A 1TCDA 3DYMA 4GIYA 3VUSA 5HMEA 1QWGA 4IFKA 4S1FA 3AXXA 4XEFA 1E0VA 4YWIA 1VPQA 4B3LA 1QPRA 3IEBA 1A3WA 3BW2A 3W87A 2DEPA 2Q4FA 2HNHA 5BXRA 3I7QA 1HNYA 3BAYA 5G1YA 1PTGA 2QCDB 3IVSA 4L6OA 3Q6MA 4NCQA 3R6IA 4JX4A 4EF9A 3OA3A 4ZE5A 4G7OF 5J04A 3BLIA 3E6EA 1M01A 4UBPC 2VFGA 1YZCA 1WDRA 3GK0A 1ZW3A 1V03A 1OW8A 1CLXA 2X1UA 4C5YA 3W7RA 3P81A 3UWWA 1S2CA 4NJGA 4NTAA 1TPDA 4JCLA 2QCLA 4UNLA 4L4PA 4WR3A 1Z7Qc 2ZRVA 4QGCA 5FJUA 2PGWA 1B0IA 2YJQA 1H7XA 3IV3A 3U9JA 3WEOA 3BLFA 3A4XA 1GJUA 2F2HA 5FCLA 3RPTA 2WNZA 5D2VA 1EO7A 3GHSA 1U89A 3CZJA 1Q6DA 3GDKA 3LNMB 3GNRA 3QFWA 3RM9A 3CEUA 4X0VA 1O66A 1ZHXA 2WKJA 3VU2A 1XM3A 4Z2HA 5C2XA 3ONBA 1JPMA 1QWKA 2L6HA 2VZUA 2YCLB 5JQ9A 2PUZA 5TNVA 4CX9A 4WOQA 4A8NA 5FJOA 2VDHA 1GPFA 5AHEA 4FZIA 1XGEA 4LYRA 2ONEA 4J3VA 3W23A 3TYCA 5HOSA 3WMSA 4WJ0A 1LLWA 3UZ5A 3VIPA 4QJ4B 3CO4A 3F2BA 2J0WA 3ZR4A 5HV9A 1HF6A 3TTOA 2WV8A 4MYAA 3HO8A 2DYSC 4KWSA 1YPXA 4I3GA 2IYLD 4Y2WA 2VTFA 3RM8A 2F22A 1KRBC 4B16A 4WSHA 3TC6A 3GZ3A 1S1RA 3BGGA 3MJMA 4FXSA 3FY1A 3QQ1A 3KZPA 1XLBA 4OIPF 1PDYA 1AJZA 1LRNA 3ZR6A 4JN8A 2PPGA 3VMNA 1HJSA 3ECQA 3F5LA 5CPSA 4Z0JA 3GZAA 3CT7A 5EY5A 1RV8A 4GMEA 4Q7IA 2ZXPA 1NSJA 3CQJA 2HCVA 3ZG1A 3TV8A 4JIEA 1AL7A 5EGYA 2LIGA 4RXGA 3MANA 2CWNA 4LBSA 1LZOA 4O17A 1A7VA 1LLZA 1OFBA 4DZHA 2BOEX 1LIHA 2W61A 4FF7A 4HSHA 1OFAA 3JU2A 2DSZA 4NI3A 5HPCA 3H2AA 3WF1A 4ZLCA 4H9ZA 4YS1A 4AVFA 2ZE3A 5KYXA 1NDWA 2QUMA 1VCFA 3NYZA 1JZ8A 4PB4A 3E0LA 2Z0IA 2BHUA 1CGNA 1GHSA 1MQQA 1TWSA 2YZ5A 1PTDA 3GXFA 4D2JA 1HFBA 2ZD9A 1TV3A 3B9OA 3SIMA 3VNKA 2Q7RA 1KBKA 1KBBA 2ZZ3A 3TNBA 4M3PA 3P5ZA 1OFQA 1UKQA 2DGJA 3MMUA 3TMLA 3KVKA 4ASTA 2E25A