3B0PA

Trna-dihydrouridine synthase from thermus thermophilus
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
317
structure length
307
Chain Sequence
b'LDPRLSVAPMVDRTDRHFRFLVRQVSLGVRLYTEMTVDQAVLRGNRERLLAFRPEEHPIALQLAGSDPKSLAEAARIGEAFGYDEINLNLGCPSEKAQEGGYGACLLLDLARVREILKAMGEAVRVPVTVKMRLGLEGKETYRGLAQSVEAMAEAGVKVFVVHARSALIPPLRHDWVHRLKGDFPQLTFVTNGGIRSLEEALFHLKRVDGVMLGRAVYEDPFVLEEADRRVFGLPRRPSRLEVARRMRAYLEEEVLKGTPPWAVLRHMLNLFRGRPKGRLWRRLLSEGRSLQALDRALRLMEEEVGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA-dihydrouridine synthase
publication title Molecular basis of dihydrouridine formation on tRNA
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
total genus 116
structure length 307
sequence length 317
chains with identical sequence B
ec nomenclature ec 1.3.1.91: tRNA-dihydrouridine(20) synthase (NAD(P)(+)).
pdb deposition date 2011-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01207 Dus Dihydrouridine synthase (Dus)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1460 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3b0pA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3b0pA01
3DBPA 4O54A 5LGZA 1EIXA 1UB3A 2VEIA 3DI0A 3LCLA 1RPXA 4OV9A 2H8XA 4N4PA 2ISSA 1TPWA 2BLEA 5AYYA 5F2GA 3HGOA 1K8ZA 3W2KA 1HFBA 1M7OA 4XTIA 2ZZ2A 1O5XA 4XQ6A 4AH7A 1XFBA 1B9BA 4JIQA 1OX4A 1K03A 2YFNA 4JTKA 2AQWA 3B8DA 5U7SA 4MYAA 3R2GA 1W3NA 2QEZA 4MPQA 5F4SA 5KINA 3N73A 5D32A 1SU5A 1S5VA 2CWNA 3O8AA 5AHNA 3U2OA 2GJNA 4JYFA 2DZSA 1BWLA 3P61A 2Z2UA 2Z0IA 1EP1A 1F2JA 1KFCA 2ALDA 1F5ZA 1FXQA 3FLUA 4AF0A 5CKSA 4FF7A 1ZAHA 3STGA 1O4UA 3UY7A 1F73A 1OFPA 1I2RA 3FJLA 3M5VA 3LI1A 3FYPA 3T4CA 4GXMA 3LRLA 4JYEA 5CSSA 3P60A 1VHNA 3HG5A 4HSOA 2A0NA 3NEVA 4GE8A 3IV3A 1SR9A 4UIOA 2VFEA 3JRKA 1KFJA 3UY8A 3W1RA 1J5TA 1QNVA 3A5FA 5AC7A 1TPH1 1OF6A 1Z44A 4NXKA 2NX1A 1TPFA 3HBLA 5EL1A 4O12A 2PC4A 4P61A 3HG2A 3DKJA 3EX4A 3ATYA 2G97A 4FNRA 3IIVA 1P4CA 2WNQA 2YDAA 4PODA 4GFSA 4TMCA 2EGZA 3QMTA 3V75A 2C13A 2P0OA 1YXYA 1H1YA 3LERA 3TIMA 3G24A 1JULA 2C0AA 1CI1A 1W56A 2YSWA 1L6SA 3DENA 2NXGA 1PE1A 3IIZA 3EXTA 4MOZA 4GNJA 3G18A 1AW5A 3EKLA 3GNNA 1VCVA 4AWTA 3PAJA 1YDOA 1EP3A 2QCHA 4LRTA 1DORA 3WJZA 2VFGA 4NX0A 3KRUA 4NUWA 5G2IA 1Y0EA 3LLFA 4NNAA 3KRSA 3KVMA 2R8WA 1QO2A 2GVJA 4FNSA 1OFRA 3USBA 5I3FA 4K39A 1KLZA 5C54A 1UBSA 1MXSA 2BXVA 4QJ1A 1GG0A 4KWWA 1A5AA 2QUUA 2Y88A 2ZFAA 4ALDA 1DVJA 3W86A 3IIOA 2P10A 4ZQRA 3RMJA 5D2XA 3L2IA 5EYWA 1OFAA 3KVLA 2B7QA 2Y63A 3LCIA 4JTUA 2Q8LA 4UTHA 5BW6A 1U83A 4UR8A 1OFQA 3E49A 1GT8A 2CLHA 3PBWA 1SPQA 2Z6JA 4L4MA 2OCZA 2B7PA 4FX7A 1WX0A 3MBFA 4M6VA 3OBKA 1JUBA 4X9SA 3G0XA 1TPVA 3FOKA 3BLEA 2AGKA 4E2BA 1EWEA 2NWRA 1H7OA 3IVTA 5KITA 5AHFA 3B0PA 5LHFA 4LWWA 4CCEA 3O05A 3BGJA 1VR6A 1CX9A 2WJZA 3GXPA 2QR6A 4ONVA 4UNKA 1H7NA 4UTKA 3W7MA 3LCWA 1GYLA 4JN6A 1UASA 1O94A 4HNNA 1DOSA 1DQXA 1G4TA 4DO4A 5HWNA 3LDVA 1FQ0A 3GDMA 2FLIA 3I7RA 3TV8A 4TX9A 2ZZ7A 1ICQA 3LHTA 5CZSA 2CFFA 4LVFA 4UR7A 5D05A 1GTHA 2FPTA 1GTEA 3CHVA 5LNRA 4JEQA 1K7XA 3LXBA 2QCGA 2G95A 2ZDRA 4TR9A 5G4EA 3NR0A 1LYXA 5C2XA 2CZ5A 1RQBA 3UWWA 5LNSA 1LOLA 1I2OA 2V30A 3JR2A 1QR7A 1NVMA 4Z0SA 5EKYA 5HUOA 1DQWA 3UWUA 2ZZ6A 5C5YA 1OVDA 3CEUA 3NQFA 3UWVA 3W7LA 2ATSA 2JGQA 1VZWA 3L5MA 1XBXA 3HO8A 5I3IA 1WBJA 4H3DA 3TJLA 4KFNA 2GOUA 1RD5A 3LBMA 1L9WA 3MP4A 2YGYA 1FCVA 3N34A 2W6RA 3INPA 3QEZA 3PG9A 2E5DA 2JKPA 1QWGA 1SO3A 1YTDA 2E09A 1NF7A 4QSHA 1P0KA 3G1XA 5E0KA 3ZFHA 4LVBA 1X6UA 1W31A 4U28A 3STFA 4WOZA 3B04A 3NG3A 1FBAA 4FXRA 5E1QA 4Y6GA 1QO5A 3C2FA 2ZA2A 3SY5A 2GQ8A 3BK0A 4PTNA 2OJPA 2V2DA 3GKAA 4IGHA 4ADSA 3LBCA 4KFPA 2A5HA 1H63A 1ZENA 3SJ3A 4JTSA 4O1AA 3QSTA 3LV5A 1J2WA 5C55A 3L68A 4ICNA 5HR6A 1GZGA 2VEPA 2RH9A 3GR8A 4O13A 3JS3A 4N9DA 5AHLA 1LBMA 4MY8A 1VGAA 2J24A 1GJPA 1SW7A 4Z1BA 2Y89A 2E1DA 3QPYA 4WY0F 2OT1A 3LCFA 3TSBA 2LLEA 4NJKA 3BG9A 3GIYA 5IBXA 3KAOA 4GC4A 4L4LA 2YZRA 3FIGA 5DBTA 4WUIA 4YWIA 2V82A 1KM2A 1GWJA 5F4XA 3MYPA 1FCUA 3L65A 4O52A 3LCHA 1QPNA 2QCEA 3GNDA 3TAOA 2R94A 4FO4A 1BKSA 3M9YA 2Y7EA 3NQCA 1XM3A 1SQ7A 1R47A 3P7YA 3ELFA 1KM5A 4JTJA 3TA6A 3M5YA 1KTNA 4JD4A 3NL6A 1I2PA 2VFDA 1XDMA 3NQDA 4K8EA 3NPXA 4MFDA 1B57A 3MHGA 3CWOX 1OFBA 3S0CA 5LSMA 3KOFA 4YL2A 4AMAA 3HMJG 3LTPA 3ABSA 1JCJA 2QUTA 4JTEA 3GAYA 3EXRA 1G67A 1HO4A 1I45A 4QNEA 5DCEA 3S6DA 1TPEA 2CLMA 3DFNA 4U4MA 3E96A 3W71A 4NZJA 3WJXA 1XKYA 3NQGA 4HNTA 2YCEA 4BI6A 3I7SA 3B06A 3HOJA 1AG1O 4XKYB 5AFDA 1KA9F 2E6FA 3DFQA 2EPHA 2ZRUA 3G1YA 1X1OA 3LGEA 1KFEA 4POCA 2V0TA 3S1WA 1WQ5A 4XTDA 4R53A 4WJEA 4O11A 5D37A 4FNPA 3C2EA 3C4UA 4WY0A 3W2JA 3N14A 3CT7A 4D2JA 3O07A 1Z48A 3FKKA 1GVSA 1PHQA 4JXCA 5EBUA 1FX6A 3M41A 3EX3A 4K37A 3R8RA 3WK3A 3F4NA 3BVJA 4HIBA 3QSRA 4GJ1A 3NL5A 2PCQA 4GWEA 5KZEA 4PL2A 4QITA 2JK2A 1N7KA 3F4WA 4NXSA 4Q4KA 4I7VA 1DJNA 1PCWA 3FJ6A 4ZQMA 5DY2A 3Q2DA 4Q32A 4N4QA 3TCEA 2RDWA 2J27A 4YCOA 1QPQA 1JR1A 2NZLA 3G1DA 1T0OA 4K38A 3T78A 3IRDA 4IJBA 4JY9A 1WDWA 4C1LA 3TNOA 5ABTA 4IX2A 1VCGA 4IPIA 5T26A 4S2CA 4CQ9A 1NF0A 2X1SA 3TW7A 3PBYA 4RZ4A 4K7YA 2Y61A 2A6LA 1KM3A 4NU7A 5HINA 4M5PA 2I1OA 4RR4A 1DV7A 4IWWA 2DZTA 6TIMA 1PHWA 1YYAA 1F6KA 2PE4A 1YPIA 1W5OA 4M7TA 3NZRA 3EWXA 3IIPA 2QCDA 2QCDB 4S2BA 2ZRYA 1U5JA 3QMSA 5CGQA 3C2RA 1L6WA 4UXDA 5AC6A 4X3ZA 4LVDA 3GVGA 1FDJA 4FX6M 4MFEA 4RZ5A 4RLIA 4JTTA 4UC5A 1SZFA 2B7OA 3DGRA 3EEGA 2ZZ3A 4UTWA 1JCMP 2C16A 1P0NA 1YXDA 4DXVA 4MLRA 3N2MA 3STEA 3W76A 4WOQA 2C6QA 1IXPA 3M5XA 4O0ZA 1VQTA 4S1FA 4PH6A 1N8FA 1TTJA 4HPJA 1PS9A 3LHVA 4PC8A 1QAPA 3NQ6A 1W3IA 2V9DA 3L5LA 3IEBA 3TH6A 3TSMA 1YDNA 3S9YA 4YCPA 1F76A 3A22A 1H7WA 2X16A 3DAQA 2YX0A 5FEPA 3ZS4A 4YXGA 3L9CA 3KRZA 4JS3A 4OHQA 2UV8G 3WK0A 2WNZA 3TROA 1XUUA 2J88A 1H61A 1K7FA 1LRQA 1TJPA 2GQAA 2H8ZA 3C52A 1B4EA 4LC6A 2NXHA 1KTBA 2GQ9A 4RK8A 2H90A 3DKLA 2A7PA 2J6XA 3LI0A 2NUWA 1X1ZA 1C8VA 5D2YA 3LHZA 4LVAA 1TPC1 5EY5A 1EA0A 1ICSA 3L21A 3N3MA 4BI7A 2DZXA 2G96A 3FA5A 4ZQPA 4IXHA 3OHIA 3W72A 5D09A 3LOTA 5L9FA 1XUZA 3RLVA 4ADTA 2H3DA 1YTKA 2YFOA 4JTGA 4EOUA 2C19A 3CWNA 3NQ8A 4DBDA 1YTEA 3R5EA 5HQEA 1MEWA 1O60A 3O15A 4UTTC 2Y7FA 1ZAJA 2XN0A 1TTPA 3TC6A 5L6UA 1XBZA 1GVQA 2Y6ZA 1FWWA 3TR2A 1VYRA 4OWGA 3G8EA 4N9CA 2VFFA 3IGUA 1VS1A 1XI3A 2FIQA 2WSYA 2DP3A 1I4NA 3PG8A 1VRDA 3QQ0A 1MZHA 3P74A 4ZQOA 3A24A 5E93A 5AHIA 5K9XA 3W7OA 1KBIA 4ML9A 3BW4A 5F2LA 3EKZA 1QMLA 1Q6RA 5G4WA 4DPQA 1TTQA 2Z1BA 3C6CA 4HPXA 1AW2A 3W22A 3L67A 3PULA 4GBUA 4UTJA 5TBOA 3THAA 1JCYA 1KW1A 3W7GA 1WV2A 1G4PA 5HULA 1TMHA 3F03K 1MEIA 4NVTA 3W70A 4UTUA 3NA8A 1Q6OA 1SO6A 2BTMA 4WZHA 3SSJA 3C56A 2CLLA 3HPSA 3BGGA 4O57A 3ABRA 5HUPA 5LNWA 3TQKA 5AHMA 3NM3A 5D38A 1ONRA 3P80A 2EKCA 4K36A 1IIGA 5AC8A 3LLDA 4CQ8A 4N9EA 1DHPA 3MI3A 4LOCA 5A5WA 2A21A 3M6YA 4AEOA 4TMBA 1GOXA 4IQLA 3S5OA 4OU1A 1SZEA 3I65A 1TJRA 5KZDA 1WXJA 3DH7A 3S1UA 2WOQA 1OFEA 4J9JA 4H4IA 3BLFA 3IGXA 4O14A 2A1YA 3LTSA 1WOAA 1ZJIA 2C18A 1KFBA 4OV4A 3UPBA 4N02A 1TV5A 3R89A 5CPOA 5FF0A 2F84A 4LUJA 4K7VA 3EX6A 1I2NA 4O28A 5LKYA 4K6AA 1LM1A 3SZ8A 4E0CA 3TK7A 1VCFA 4MLJA 2V5BA 5F2MA 3KHJA 1XL9A 2QAPA 1YXCA 1JUKA 1QFEA 1W0MA 5DCDA 5I3GA 3TC7A 3CIXA 4M6QA 4RJEA 4M7SA 3CB8A 4QIUA 3MP3A 2FB2A 3KXQA 2RDTA 1Q45A 1C9DA 2TRSA 4Z1CA 1Q3NA 4LRSA 3GB6A 3W74A 1TTIA 3N9RA 1UCWA 3WJYA 3SI9A 1LTDA 4MZ8A 4MYXA 4YLWA 1OFDA 3W87A 4EVZA 1GPWA 1A50A 2GJLA 1JCXA 3NL2A 2B7NA 3PB0A 3QW3A 2ZRZA 1OHLA 4EF9A 1N55A 4LS2A 2CZEA 5KZMA 1X7FA 3E9AA 2A6NA 4LVGA 4CNNA 2E6DA 3LHYA 3HB9A 4O1DA 4UFHA 3QPZA 1A53A 2CW6A 3TSDA 1MEHA 4RXGA 4P2VA 4TO8A 3SGZA 3P8IA 3T44A 2ZRWA 1ICPA 3HJZA 2A2IA 4OBTA 5GVJA 5FI8A 1IGSA 3W07A 4A2RA 3KFTA 1WBHA 1RQHA 4ADUA 1VLWA 3MI6A 4XZ9A 2C14A 3B0VC 3MYOA 2ZZ5A 3N9SA 2NUXA 3W2NA 1NEYA 1R2TA 3BG5A 3FEMA 1FWSA 3DFOA 4JX4A 4PFMA 4Z08A 5D02A 2E68A 2F7FA 5BMWA 4WD0A 5DXXA 4O17A 4UFIA 2O7QA 3IVSA 3P62A 4FIRA 4RZ6A 1NSJA 1QOQA 3ZR4A 1LBFA 3W75A 2B4GA 4QISA 3OVRA 2EF9A 2FFCA 1JCLA 1T96A 3G8RA 4FB7A 3PUEA 3M47A 3P84A 3QRHA 2DJLA 1R2SA 2RDUA 4IPJA 3PBUA 1KTCA 4IUOA 4BWLA 1G4EA 5J5DA 1G4SA 4W9TA 3S1XA 1R30A 3G1HA 3A21A 3HPXA 4JIPA 1K8YA 3PSVA 1AMKA 3NPWA 4UUIA 4LS1A 1TCDA 4AB4A 4NJGA 3UYCA 2X2GA 3LM7A 5AYZA 1OYAA 3LRMA 3DFSA 3PUOA 4N9BA 3EB2A 4XUGA 1EB3A 4LU0A 4UMAA 5IM51 5LNVA 3W2UA 4N6FA 4HT3A 3VCRA 3SFKA 4FHAA 1L6YA 1DL3A 3NDOA 1F05A 4UTIA 1X8FA 1W5QA 1JRBA 4PEKA 4JYDA 1JVNA 1NAL1 3LHWA 3B0UX 1LOSA 3CQ0A 2DJXA 5FEZA 1PVNA 1GVFA 3NQAA 1RZMA 3ABQA 8TIMA 4CQAA 2GPTA 1HG3A 2ZYFA 4WXYA 4UFLA 4DQWA 1ZHAA 2CLKA 4CNOA 3QC3A 2JKEA 3L66A 3S5YA 2TYSA 4HHPA 1JRCA 1ZAIA 4FNUA 3Q94A 3GAKA 2J9YA 1T99A 4E38A 2BZNA 2Y70A 4HSNA 1JUEA 3MP5A 4JDYA 3D0CA 4OGZA 1K3UA 4CLMA 1OX5A 4MVAA 1FWTA 3VI2A 5AOUA 4K8HA 2VEMA 2QUVA 1LROA 2WV8A 3LCGA 4NNBA 3W7JA 3GR7A 2OT0A 4O4VA 3L5AA 3W2LA 3DU0A 4NX5A 2W79A 1D9EA 3QQ1A 2ABBA 1UUMA 1TYGA 2Z6IA 3R13A 3M7WA 1EPXA 5AN7A 1W5PA 2O7SA 4O4WA 3P81A 1PL9A 1JQXA 4GRSA 1W54A 4UFKA 4XKYA 2W0UA 4EIVA 3W7CA 4QNWA 3P5ZA 3VFLA 2Q3OA 3M0ZA 1FXPA 3GX9A 5CZ0A 3G1VA 2ZZ1A 5K9DA 3OIXA 3W3OA 4A3UA 1TPDA 1SW0A 3TQVA 1TB3A 3GDRA 4KWVA 3OA3A 3I68A 1TPUA 4MUZA 4NJIA 5CSRA 1M6JA 1BWKA 2GVGA 4CCCA 2VFIA 5DLCA 4ZQNA 2JBMA 3TFXA 1C29A 3QW4B 5K9CA 1LOQA 1UUOA 4MJZA 2XFWA 3F1QA 4FXSA 5EPDA 3ZWSA 5HWJA 2C15A 3FFSA 1K7EA 3HGRA 3L0NA 1TSIA 4OQVA 4MKNA 5HWMA 3C61A 3HQ1A 3PS7A 4O16A 4ZL1A 5D2TA 2Y62A 1KM6A 2A7NA 5K2ZA 1GYNA 1TRIA 4LC8A 3OVPA 5F2IA 1G69A 1DJQA 1H62A 2ISWA 1EEPA 2H6RA 1W5NA 2VOMA 4GUHA 5SWUA 3B03A 4DO6A 2VELA 1WAUA 1OABA 2FQIA 4RV8A 2A4AA 2VENA 2JKAA 3SIZA 2YYUA 3U6WA 1SFJA 5CPNA 1ME9A 2NWSA 4TU1A 3GYEA 2V2CA 3P82A 1CW2A 3GLCA 2FTPA 2GUUA 2JGYA 2QCFA 1S3HA 4HNUA 1SO4A 3T7VA 3ATZA 4NJJA 1VLIA 4AXKA 1THFD 4IMEA 3W7HA 1RV8A 4AVFA 4WXZA 3DXIA 5HJLA 3LCXA 3WJWA 5G2HA 1F7BA 4A21A 3MW7A 3W6YA 1XXXA 3QMRA 1T8XA 3UD6A 2DU2A 4G1KA 3VNDA 5CPMA 3W1TA 3WFAA 3THQA 1VH7A 4DEFA 3I7QA 3W1LA 2QJHA 5I3KA 4FX8A 5U4NA 3I6RA 1IF2A 2YXGA 4XBKA 3TU9A 4LV9A 4Y96A 4X22A 2QKFA 5DBUA 3C2VA 1LZOA 4GUJA 2QDHA 1SUXA 3GK0A 1ME7A 4DPPA 1KV8A 2RKXA 2Y85A 3K30A 3U8GA 3W7NA 4UMCA 4O1CA 3MJYA 4Q33A 3ZWTA 1ZCOA 1W37A 5LZLA 1YLVA 2QCNA 4A2SA 3PB2A 4AAJA 3LTYA 1HTIA 3EXSA 3CC1A 3BG3A 3CEPA 3W88A 1H7RA 2HMCA 4FNQA 5G2WA 4O18A 3AJXA 4Y9AA 3UNDA 3W7DA 3GDKA 2CZDA 1M7PA 3AO0A 3W1PA 2YR1A 1F74A 5CZJA 2HS6A 3OEXA 3W7IA 1TRDA 1L2UA 4UCGA 4X2RA 1KLYA 5KSWA 2HTMA 3O6CA 5CPLA 4ZZ9A 1UJPA 4MY9A 3LV6A 3QH2A 4HN4A 3S5ZA 1TV7A 1W1ZA 3LB0A 3EX2A 4BI5A 1KM4A 4UTWC 1O5KA 4EWND 1AW1A 1OX4B 3BPWA 2DORA 4AHQA 4LTSA 4Z1DA 4DO5A 2WO5A 2NX3A 2FDSA 5FESA 2A7RA 3NPVA 1TQXA 2WPBA 3T40A 3O6YX 1S5WA 3NQ7A 3MUXA 1H60A 4FEZA 2V5LA 3P8JA 5CG7A 1LBLA 4B5NA 3W7QA 2WKJA 5I3JA 3DFPA 3QJAA 5EMUA 2QJIA 4PA8A 3HIJA 5EA9A 3DFTA 1SFLA 3Q58A 3A9IA 4ORIA 1W5MA 4Y8FA 4AF0B 4KKXA 5G1YA 5BMXA 3NNTA 2NUYA 2NX9A 2EHHA 5DCBA 4JGDA 1GVOA 2G5WA 1M5WA 2X30A 3FKRA 4O1BA 4DELA 4JR5A 1JCNA 2CLOA 3MI2A 2A85A 4GUIA 1VHCA 1OYBA 4E2DA 3W7PA 3VKJA 2WQPA 2QCCA 3TMLA 5G5IA 4A22A 3KVKA 3UZJA 2Q8ZA 1LLWA 1V5XA 5DELA 1ZY9A 3EWBX 2QAFA 1Q6LA 3UWQA 5KMYA 4DF1A 4OT7A 1ALDA 3W9ZA 3H53A 3G0SA 5LNUA 4MIMA 1LRTA 3UXDA 3S42A 1VPXA 3PM6A 1OFOA 5D33A 4BK9A 3R12A 2YPIA 3CM4A 4YMZA 1EX5A 1A5CA 4QM1A 5BNKA 1OG0A 2VXNA 3E0IA 3UPWA 4FNTA 4JDBA 1BTMA 3B05A 1IXNA 1SW3A 4FIQA 1VJIA 1WOBA 3O1NA 1BEUA 4AWUA 2D73A 4GUFA 3H54A 3G1FA 1Z42A 1ML1A 1VYSX 1JJKA 1OX6A 3G3MA 4O50A 2YYTA 4IMFA 3SW6A 4XWUA 3PSWA 3GKFA 1QPOA 3TXVA 2CLEA 2NV2A 2ZTKA 1OK4A 1WYIA 3ABOA 5F1UA 3GDTA 3QYQA 2OZ0A 3STCA 2VFHA 3OG3A 2ZQ0A 1E51A 5KTLA 1TREA 3CIWA 2QF7A 2E77A 3C0JA 1IXOA 3EWWA 3NQ2A 1SZNA 3TJXA 1FWRA 3LRKA 4JNMA 4AHPA 4N2YA 2J9XA 5A8GA 1H7PA 3W1AA 3N2XA 2ZRVA 3BW2A 1OK6A 4JTFA 5BOOA 1H50A 1B4KA 1FY6A 3SR7A 1RVGA 1EWDA 4O8RA 4NZFA 2BSLA 2FB3A 3G1AA 1GG1A 2E5CA 4WX2A 2ISVA 4PL1A 5C6MA 2ZTJA 4NT0A 3WJSA 3TX9A 1QOPA 1HUVA 1XBYA 1KM1A 2BWGA 2YW3A 1R46A 1W3TA 3NOEA 7TIMA 4JY8A 2DZWA 3E12A 3SECA 4JTHA 3M43A 1OJXA 3HG3A 4R7JA 2Y7DA 5AHEA 3TUUA 2ZZ4A 4IX0A 3TKFA 1ADOA 2QCMA 4LS0A 3VE9A 3KVJA 3CU2A 3MMTA 3OVQA 4O53A 4WQ6A 1HO1A 5D2WA 3TMQA 1MO0A 5FF7A 1AL8A 5K4XA 3P67A 5H2ZA 3EWYA 1G6CA 3SGUA 2R91A 2I14A 4MZ1A 1TV8A 4O0KA 3M1ZA 3NL3A 3P5YA 1HL2A 2DZUA 2AAMA 4LNYA 1Q6QA 3PBVA 1H7XA 3YPIA 2FJKA 3W7EA 1D3HA 4JICA 4RX0A 3PF3A 3HF3A 3VE7A 3IVUA 1R2RA 4M19A 4MZYA 3M44A 1VYPX 5AB3A 4DF2A 2BX7A 3NGJA 3W85A 3MWAA 4UFMA 2PRHA 4NJHA 4O15A 5D2VA 4PCFA 3W23A 2XN2A 5CZTA 2PURA 3G1SA 3BLIA 5HR7A 4CNPA 3W1QA 5FEXA 3UZ5A 3M16A 1ZFJA 2VKZG 3A5VA 4R34A 3NZ1A 3RNDA 4JTLA 3NPUA 2CLFA 3W84A 4LY8A 1ZALA 4Z0JA 5HNRA 4BF9A 3NQVA 3W1NA 3DI1A 1B3OA 1KBJA 2GVLA 4TIMA 3QM3A 4EF8A 3NQEA 4GUGA 5I3HA 4ZVJA 3TDFA 2RHGA 3RU6A 4ZQCA 2B0MA 4M6PA 3GDLA 3DHDA 3IGSA 2ZBTA 3LX9A 1XC4A 3W73A 1VC4A 2EAWA 3CPRA 2J9ZA 1LDCA 2Y7GA 1XCFA 1EP2A 1XBVA 3O6DA 1GQNA 3N19B 3C8FA 2ZA3A 4UFJA 1FCQA 5DXYA 2HS8A 2TMDA 2TSYA 4NNCA 4Z1AA 6ALDA 1PCKA 1YDVA 1EUNA 1FWNA 3W1UA 4QAIA 2ZCGA 1W8SA 3EX1A 4I7UA 3G0UA 3TQ0A 5D30A 3BV4A 4LUIA 3RLUA 2WNNA 4BWLC 1PIIA 4BFAA 3IIXA 4UMBA 3S1VA 1KFKA 3GXTA 2WSQA 1TPB1 2PRLA 3WK2A 4UTMA 1P1XA 4JX6A 3LHUA 3KX6A 4BR1A 3ANYA 1ZNNA 3GXNA 1G7UA 3H55A 3PUDA 3QZEA 2CZFA 3MHFA 1FUYA 2H3BA 3MO7A 3PC0A 5F1VA 1QCWA 4MJMA 3C3NA 5D04C 5DN1A 1TQJA 2WSRA 4C1KA 5FF4A 3UWZA 1LRNA 3MBDA 3WK1A 2X1TA 3QFEA 3S8HA 1LORA 4RXFA 3NO5A 4AWSA 3GZ3A 3PWAA 1YPFA 4H6KA 1OF8A 1H1ZA 4RKAA 2X1UA 1H5YA 3NAVA 1IIHA 2NLIA 5IBXC 3HGSA 2DZVA 3E02A 3QF0A 1FCBA 2VEKA 4R33A 3FYOA 1DBTA 1QPRA 4RCXA 4LV4A 3NM1A 3M5ZA 4O19A 3BO9A 2CLIA 5K7JA 3TW6A 3G22A 4Y90A 1QDSA 4LW7A 1GVRA 3MHUA 5J5RA 1F6PA 3TFCA 1KFLA 2QCLA 3W1MA 2VC6A 3RK8A 5DY3A 3C2OA 1YADA 5TQLA 3NVTA 5BRBA 1KV5A 4IMCA 1H51A 2PRMA 3EWZA 4WY0B 3NYZA 3O16A 1FDYA 5F4WA 3L0GA 4OE7A 3BW3A 1A5SA 2C3ZA 2NXIA 4NQ1A 1Z41A 5LGXA 4O10A 1J4EA 1MSSA 4HKPA 2QDGA 1ME8A 2TPSA 3RFAA 1XDLA 4QQ3A 4A29A 4AHOA 4XBSA 1SSGA 2FPYA 1D3GA 5G1TA 3DHFA 1I8JA 3HG4A 3NQMA 2IQTA 5K4ZA 1IXQA 3LXCA 2CU0A 1TIMA 4IMGA 1LP6A 5HMSA 3W1XA 3NXFA 2ABAA 4UNLA 3B4UA 2E6YA 3DZ1A 3PVFA 1G7VA 1PV8A 1LLZA 3CTLA 2RFGA 4IMDA 1LCOA 4ZMGA 1NFBA 2DZPA 1K8XA 3UWYA 3W2MA 4N6EA 3FS2A 2ATMA 2YW4A 2Q3RA 1RQEA 4IOTA 1KM0A 3EWUA 4HNVA 5AYXA 2I9EA 4IXXA 2NV1A 3TE9A 1K02A 4DF0A 1AL7A 1P5BA 4ORMA 5K3VA 3PR2A 3UQNA 1AK5A 2V8ZA 2R14A 4LT9A 1OYCA 3W7RA 2ZA1A 3L0KA 1FDZA 3Q37A 4MY1A 5MHBA 2P1FA 5H91A 5D03A 1TO3A 5TIMA 2X1RA 3LXAA 2E6AA 3A23A 4UTLA 3W83A 3BARA 2ZRXA 5FEWA 3PY2A 1JQVA 1S5TA 3G3DA 3TAKA 1V7YA 2OMAA 2XN1A 3S5NA 1DKWA 3O63A 1O95A 2E5BA 4UTTA 2QJGA 5LHEA 4CCDA 2OX1A 4JTIA 2KZHA 2FPVA 4I7WA 4DBEA 2V81A 1WA3A 4I9AA 1GEQA 4KFOA 1I2QA 1RR2A 2C1HA 3CLMA 3V1PA 3TXZA 3W7KA 3T55A 3HGJA 5FF2A 1SZGA 3O06A 1A5BA 5FF3A 3HPZA 2V2HA 1SO5A 3RF9A 1EUAA 4JX5A 2HSAA 1SSDA 3UXAA
chains in the Genus database with same CATH superfamily
1JDAA 4B5VA 2VEIA 1MDLA 1GW9A 3LCLA 4OV9A 1ZJHA 1WO2A 1HT6A 4GY1A 3T4WA 2WZTA 1TPWA 2BLEA 2FAPB 1K8ZA 3R2PA 2Q4FA 1HFBA 1PSCA 2RSEB 1O5XA 1ZHWA 4XD4A 1B9BA 3RUBL 1H0IA 2YFNA 4K2SA 1CPUA 3VOJA 3B8DA 3S1GA 1DJIA 1LL6A 1C3FA 3R43A 4KH2A 1E0TA 2QEZA 4C1NA 1JZ7A 3C2YA 2GFHA 4HEAJ 1BR4A 5KINA 3IS4A 2ACRA 2WHJA 1SU5A 2CWNA 4ES4A 3DE9A 1VTMP 3FDQA 3PTMA 2GJNA 1ZW2A 1EP1A 4J3VA 1I1XA 2ZXOA 2WVTA 3OB8A 1F5ZA 4QDPA 2NSXA 3SCUA 4O8AA 1WWPA 5CKSA 4YN0B 1ZAHA 4FF7A 4LAKA 3T6GB 5A6JA 1O4UA 3FJLA 3T0TA 3LI1A 3GG7A 4GXMA 4I3GA 1ISVA 1WZMA 4CQCA 5F28E 3EYPA 3NG1A 4X60A 5D9OA 3ARVA 3TOYA 4UIOA 4C91A 1NFPA 4S3BA 2VFEA 3JRKA 1KFJA 4H8NA 2TMVP 2R1PA 1XYZA 2JEPA 3CYVA 3FDKA 3SCWA 1S2CA 1FH8A 3MUY1 3A5FA 1NFOA 2GA0A 1C7TA 2NQ9A 3AG3C 3T0DA 4HNOA 1R6WA 3VD3A 1TPFA 4O12A 2PC4A 1QI0A 3OLGA 2R7UA 1EJUC 3UR8A 3DKJA 4XLPF 4GH1A 2IOQA 1T41A 1LL4A 1YBQB 1EJTC 3ITXA 3EB4A 4QS5A 4FNRA 3A12A 4Z2JA 2NSOA 2XLDA 1KGUA 1PKNA 1V4AA 2EGZA 4Z17A 3QMTA 1QZXA 1NTHA 1PV3A 2PCEA 7ENLA 4FLOA 2C0AA 1CI1A 1BTCA 4K3ZA 2O9TA 4MOZA 4GNJA 1V0LA 2YDSA 1AW5A 2PWGA 2HNEA 4AWTA 1MYRA 3W28A 1O5RA 3G6MA 2QCHA 1XYMA 4LRTA 4S3GA 4BJ5A 4NX0A 2IQDA 1Y0EA 9XIAA 1Q4NX 1RH9A 2R8WA 3KBJA 5HNUA 4CCZA 4ANJA 2AL2B 3MB9A 1DWIM 3V5FA 1EPVA 4B15A 3QXBA 2QUUA 3MKCA 1O5HA 3IIOA 4GJJA 2P10A 1V0MA 5D2XA 3E5PA 4E0HA 1OFAA 3KVLA 2HZGA 2Q8LA 4O0QA 4EWJA 5BW6A 1U83A 3R0DA 4UR8A 1POKA 3E49A 2CLHA 2Z6JA 4S3AA 2B7PA 4MNLA 3MU7A 4FX7A 2Z26A 1JPDX 3CWHA 4D8AA 1BF2A 3OBKA 5EFDA 2OYKA 2CESA 3G0XA 2YIHA 4AIUA 3NKDA 1AH0A 3S6OA 2AGKA 4E2BA 3WBYA 1EBHA 5CZKA 1IW7F 4Q8TA 1H7OA 3VAVA 3ENLA 4REQA 3ABLC 3IWPA 4REQB 5KITA 3WHNA 1Y8BA 5A6LA 3T2OA 2MYSA 3AS2A 4JPGA 5I02A 4ONVA 1S1PA 2EG8A 4IQJA 3E2VA 4IGNA 3B8VA 3LCWA 4G7OF 3CAXA 4JN6A 2QLYA 4HNNA 1G4TA 5HWNA 2AKZA 3KUMA 3I7RA 4TX9A 4WGYA 4Z2IA 1P6CA 5D05A 2FPTA 1GTEA 5LNRA 2Q00A 4TR9A 2G95A 5G4EA 3NR0A 1LYXA 5LIUX 1M01A 2CZ5A 2Q9BA 1C93A 2OCCC 5EKYA 2ZZ6A 4DBRA 3NQFA 3W7LA 2W4MA 1AVOB 4O1FA 2PDQA 2JGQA 1KQYA 3IJ6A 1KGXA 2IQ0A 2WLYA 3L1MA 3D5HA 3B9AA 2GOUA 1RD5A 1LE4A 3LBMA 1BRLA 1L9WA 3MP4A 2R7RA 3LPGA 4DBUA 3L7RA 5A6TC 3BSHA 3QEZA 3I3BA 2JKPA 4QSHA 2PWDA 3WQ6A 4I44A 4Z2KA 2AP3A 1X6UA 4ZOBA 4B2DA 3VABA 3NG3A 1FBAA 4DJDC 5F5FA 2ZA2A 4DZHA 3SY5A 3UF9A 2DSZA 1JG9A 2ZX7A 3BK0A 2VCAA 4CD8A 4RDZA 1OCRC 2V2DA 4Z9HA 4LAZA 4ADSA 3LBCA 4KFPA 1JZ8A 4ZGYA 4NILA 3QSTA 3L4XA 3CYJA 4B3LA 1WCGA 4J3XA 3SFWA 1XGZA 3NCOA 1PTGA 5HR6A 1FNTc 2RH9A 2O4QA 2C7FA 3JS3A 3WG7C 1WXZA 4U5HA 3UFYA 2I5IA 1XGEA 4C6NA 4B90A 2PB1A 1RJ9A 1RJ9B 1GJPA 1SW7A 4Z1BA 2Y89A 4GHRA 3PMRA 1XINA 2LLEA 3BG9A 3KAOA 4GC4A 4L4LA 2YZRA 2IPJA 5BWFA 5DBTA 4WUIA 2I5GA 1SGJA 2CCRA 4FO4A 1BKSA 3M9YA 4NG3A 3HV9A 1W1B1 4I90A 3VIIA 1SYTA 1R47A 3S9ZA 2J46A 1KM5A 4JTJA 2GYIA 1KTNA 1E85A 1H9TA 4JD4A 3NL6A 1OZMA 4MVRA 3NPXA 1B57A 4Q8UA 2IW0A 3PAOA 1TE1A 2OG2A 2J7BA 3X1OA 1BGAA 3KOFA 5CIVA 3ABSA 5FL1A 4JTEA 3LSBA 1I45A 5DCEA 1VFMA 3QFWA 1NDVA 2CLMA 1N8IA 4R7OA 2XH7A 2TAAA 3N29A 4A8LA 4PJJA 4CBEA 5A6AA 3N12A 1YEYA 3NTYA 2YCEA 2PTZA 1X98A 4PB5A 3CSKA 4HE8D 2W4XA 2OQHA 3I7SA 1SR2A 3HOJA 1KA9F 4MWAB 3DFQA 2EPHA 2ZRUA 3W8HA 3W2VA 2C8NA 4V1XA 2W9MA 2PF8A 2WZEA 3OZOA 3V18A 1CB2A 1FRBA 3CH9A 4O11A 5D37A 1ZUAX 3EPOA 4U2YA 3N14A 1UWRA 3WNNA 4A3YA 5L0CA 1OBAA 4CD4A 3EX3A 1AZ1A 4HHMA 3JTLO 1EJSC 3KBSA 2H7VC 1OGSA 3OYXA 3AJ7A 4G7HF 2VX5A 2I5QA 1YYJA 2PMQA 2MNRA 4NXSA 1PCWA 3FJ6A 3S5SA 2VVSA 4YYCA 5H6HA 2WHLA 4I8DA 4W93A 4Q32A 3RPMA 2L6GA 4QCFA 3IUIA 2NZLA 3G1DA 4EP8C 1T0OA 3N6HA 5JBFA 1XX1A 2J45A 4KWUA 3IRDA 3VDAA 1WDWA 4V15A 3TNOA 3ZWIA 4RDVA 4IX2A 3FNDA 1VCGA 5T26A 4H00A 3XINA 1G9HA 4E4UA 2P7VA 1XYBA 1YJGA 3V0SA 1OM0A 1CGUA 2A6LA 2GSEA 3CEXA 3ARYA 2W63A 2I1OA 3GM2A 3CZGA 1ZHZA 4IWWA 6TIMA 3ID7A 4F2BA 1U22A 4JW1A 3BJSA 3L4WA 3NZRA 4H6QA 2I15A 4S2BA 2QCDA 2QCDB 4D6IA 1U5JA 4IFOA 3RCYA 1UH3A 4CEXC 3K8KA 3PBMA 5CGQA 3VA8A 5AC6A 4LVDA 4TVDA 1V0KA 4QJ3B 3VDBA 3NZGA 3LZ5A 4RLIA 3SUSA 3SN1A 3IK2A 1LPEA 1WOLA 1BWVA 1G0CA 2NVCA 2OEXA 4UTWA 1JCMP 2CNCA 1JNEA 1UP2A 4MLRA 4EUKB 3BWWA 3STEA 5A3HA 1PWMA 1LS1A 3ES8A 4YU1A 1VQTA 4PH6A 1PKYA 5AZ0A 4YHEA 3GNXA 1BBHA 4ZB5A 2VT0A 1UOZA 3ALGA 3IEBA 1YDNA 2VTFA 4HK6A 3GBEA 5B7YA 2FGBA 3NMJA 3DAQA 2YL8A 4YXGA 1HKVA 2NUTB 4J2MA 1ENUA 4YTRA 3B9QA 3TROA 1K9TA 4GZIA 4GKTA 3MBGA 3RITA 4ZCWA 3REQB 1R7OA 4D6DA 3U48A 2H8ZA 4LDRA 2GQ9A 1PIGA 3DKLA 2H90A 3MLGA 2IXPA 4D8LA 3V7OA 3FEQA 4LVAA 3WMBA 1EA0A 3J7HA 4C7OB 1R87A 1LT7A 4QCEA 5L9FA 2WJFA 3GM1A 2H3DA 3WZ0E 5FSDC 2YFOA 3Q67A 4EOUA 2XIIA 2BS9A 3EDEA 5B3SC 4RUBA 5C2CA 3OIHA 4DBDA 4U9EA 3ZQYA 2J0WA 5HQEA 4IP7A 1X6NA 1E4MM 2XN0A 1ZGDA 1XBZA 1GVQA 3P0WA 4ZB2A 5C0QA 1VYRA 3QMKA 4LLEA 1UR8A 4WDTA 4HK5A 4IWBA 2Y3HA 1VS1A 2PGRA 1SYQA 2WSYA 2Q9CA 3K5XA 4WRHA 5CJNA 4IT1A 3L4TA 5GJNA 3IQCA 4WLCA 3IARA 4AW7A 5E93A 2V69A 2YXOA 1QI3A 3OZMA 1QK0A 1N1CA 2DH3A 3BMWA 1Q6RA 3EOOA 5G4WA 1TFKB 1Z3IX 1FR0A 4GBUA 4UTJA 3IAQA 2XXAB 3P3BA 3SCQA 3THAA 1XLJA 1KW1A 1LUCB 3W7GA 1OW6A 4FS9A 4FOJA 4FESA 3DGBA 1G4PA 5HULA 3W70A 3K1DA 3WQ5A 3C18A 4F0LA 2BTMA 4WZHA 3HPSA 3TQKA 5CCZA 1C90A 3NM3A 3QYSA 5AC8A 1IIGA 3GC2A 4CQ8A 1VPYA 1KWKA 3U5SA 2A21A 5ABHA 1K4GA 4NYUA 2WSPA 3CAKA 2MANA 2MUCA 4GINA 3UJRA 4O14A 3R25A 2A1YA 2C18A 3UPBA 4N02A 3EFOA 5CPOA 3UESA 2F84A 2ISFA 4Q6XA 1REQB 4LUJA 3EX6A 2JEQA 1ST6A 2XIJA 3VOGA 3SYNA 1V77A 1LG2A 5T9BG 1HY5A 5LKYA 1XSJA 2L7AA 4E0CA 1NWSA 4PMQA 5DFAA 3HURA 4MNMA 4HFFB 5IOBA 3UR7A 4IPLA 4G0HA 1YXCA 3C0QA 3AQBA 2E0PA 1OCNA 4XK2A 2QTVA 2G3JA 1VK5A 1NOWA 2CYGA 5D9PA 4C6IA 2FB2A 1UA7A 3KXQA 4EK7A 2G50A 2UY3A 1Q45A 3WLOA 3VM7A 4A6GA 1E73M 1Q65A 2VO5A 3GB6A 3M4CA 1TTIA 2OFJA 1HJVA 2DW7A 1EEXA 1Z6KA 4C3BA 3SI9A 1Z9AA 4PE8A 4U9DA 4MYXA 4XLNF 1ECQA 2JFEX 5E2QA 2GJLA 4EF9A 5JBDA 2XTKA 1OR2A 1N55A 3EGXB 2CZEA 2PDFA 2I56A 2A6NA 1ZU4A 4MB1A 2YL0A 3JRMO 5A8MA 1ZHTA 4UFHA 3I6EA 1V7AA 1TWAA 4RXGA 2ZX9A 3P8IA 1R3TA 3T44A 4ONSA 1O12A 1R38A 3F47A 3HJZA 3EJNA 1Y5WA 3D46A 3K8LA 3N6JA 4E8CA 1OKKD 1J01A 3MA8A 2XL4A 1QU4A 1VLWA 3MI6A 2YCJA 4OOZA 3GO2A 1A3WA 4BJ6C 1MNSA 1R2TA 1FWSA 2F7FA 3S90A 1TWWA 1XLHA 1MQRA 1ISYA 1TJ1A 4UFIA 1GZJA 4AYGA 1J96A 1NSJA 1SJBA 3IPMO 4S3KA 4H01A 1W3KA 4FK9A 2WBKA 3W75A 1CXIA 3OVRA 4AIOA 2FFCA 4ERGA 2XH0A 3LPPA 3RM4A 4AD3A 1E3ZA 1GYMA 4XIMA 3QRHA 4AZBA 1R2SA 2RDUA 1XZQA 1KTCA 2HROA 1G4EA 1GVIA 1G4SA 1QASA 5J5DA 1A0DA 4JIPA 4LFYA 4MB5A 5E0FA 4AISA 3FMSA 3UYCA 1Q2SA 1DP0A 2X2GA 3LM7A 3CASA 2VI0A 2R7SA 5HPCA 4DOZA 3EDFA 4IIDA 4UMAA 5HXMA 5DF0A 4HT3A 4KEZA 3GG0A 1ZBVA 1UQZA 4FHAA 4PMYA 2Q71A 3K7DA 2PLKA 4YTQA 4GYTA 4I3MA 2Z1WA 3SSZA 1JVNA 1NAL1 4PMRA 5FEZA 4U2ZA 5FAGA 1ZVZA 1A47A 2VYOA 1VPQA 4FAPB 2Y4SA 4ZE4A 2BVWA 3U3BA 1I9CB 3UR3C 4XPYA 2ZYFA 4UFLA 3D3AA 2CLKA 2HRWA 4CNOA 1UR1A 3SIMA 5E33A 2JKEA 3LQGA 4JNZA 3AIVA 3R4IA 1JRCA 2OEKA 2CYDA 5CBJA 4M0XA 1ZAIA 4UOQA 3Q94A 3F4DA 1EC9A 4N42A 2EO7A 3DHPA 3GAKA 4C6LA 1ZB5A 1T99A 3KS5A 2Y70A 1XG3A 1G94A 4JDYA 1JOGA 2HE5A 3CMGA 3M0XA 8XIAA 3HN3A 4LAOA 2EG7A 4EHPA 2YHSA 3VI2A 4K8HA 2VEMA 3WX7A 1VEPA 1S2AA 3SCTA 2OGYA 4LH8A 3OA1A 2C91A 5FCZA 2YZSA 2CETA 3L5AA 1JGIA 4LYKA 3DU0A 2NQJA 1D9EA 4JFUA 3IK4A 1UUMA 2Z6IA 3PPCA 5EFFA 5LIKX 2VVNA 4MB3A 4G5DA 5AN7A 3VC6A 1XHGA 1X39A 5M17A 3P81A 4Z2HA 4PR9A 3C8GB 3QOKA 4XKYA 4OD5A 4GQ0A 4J35A 4NZ1A 1JDCA 2ACSA 3CLWA 2Q3OA 3AU2A 2ZZ1A 3O6XA 1P0EA 4MTFA 3GW0A 4A3UA 1KKRA 2BBFA 2W61A 3TQVA 2P8BA 1VFHA 4L1GA 3EGDB 4KT2A 1CXLA 1TPUA 4KCUA 2PTXA 5CSRA 2Z15A 2PUZA 4MTGA 1OCOC 1Q13A 4W8PA 2J8TA 2P53A 4F0HA 5EMLA 3TFXA 2PDXA 4HHHA 4MJZA 3DHUA 1CBGA 4IIBA 4AZ5A 4QEHA 3FFSA 1K7EA 3SCNA 2PDBA 4DBWA 3OW1A 3C61A 3HQ1A 4JQ2A 5D2TA 4FSAA 2A7NA 4GC3A 2OPJA 4E8DA 2YQYA 3HTKC 5DX7A 1DE6A 1IEIA 3GH5A 4ZODA 1H62A 3VIOA 3TJIA 4E7ZA 1QPUA 1IE7C 1W5NA 3B03A 4PR4A 4DO6A 2QVHA 4GO9A 3U6WA 4PFPA 1Y4CA 3NOYA 5JSLA 3IANA 3T42A 4H54A 4GCAA 4TU1A 2B81A 3P82A 3ES7A 2QCFA 2BGQA 2Z00A 3T0CA 1S3HA 5HOSA 1SO4A 2LP4A 5JQ9A 4P7NA 1MQVA 1SJAA 3WD1A 2QULA 4AXKA 4YTSA 5T91A 1RV8A 1UKPA 4WXZA 5G2HA 1MW3A 4M51A 3VIFA 4CN6A 3F5JA 3LGGA 3B3DA 2GGIA 3L4ZA 1FHLA 3AQUA 1E0UA 1WASA 5CPMA 3W1TA 2E9LA 1L2QA 3EAUA 1VH7A 4DEFA 3I7QA 1JPIA 3V5ZA 4M56A 3UERA 5I3KA 2GQ3A 1DJYA 4Y96A 1ITQA 5JLIA 1IZCA 5DBUA 3U2ZA 2ADAA 3VZXA 2QDHA 3GK0A 1ZBKA 2FZDA 4L56A 2RKXA 1HL9A 3MC5A 1Q0KA 4NF7A 4CSAC 2P3EA 4D1IA 4UMCA 3ARRA 3ZWTA 3LK6A 4AZ7A 1W37A 2V5CA 1DWHM 3VC5A 1CGVA 1CPRA 3AOUA 4QG9A 4K1OA 3CBWA 4MTVA 4JNYA 1Z63A 2J7DA 3B71A 5B1BC 4O18A 2HXTA 3RILA 2QUMA 2XINA 3HQNA 2CZDA 2CBJA 4IB4A 2OWCA 4GG9A 1S3TC 2Z28A 3KTSA 3LUTA 3OEXA 1DTUA 2QJJA 2DSWA 1RJRA 1GGQA 3ZJ7A 5KSWA 6REQA 4C3EA 1M2VA 3O6CA 3PZGA 1ZRQA 4U33A 3ZM8A 5DS6A 3AYTA 2O0TA 5DEZA 2P6VA 1UYQA 3AYVA 3GU2A 1AW1A 2FGLA 3SURA 4AHQA 1XC6A 3GC5A 2EIMC 2WO5A 5M2FX 1B2YA 3IJIA 2FDSA 3M46A 4QROA 2A7RA 1E9YB 4LBUA 1H4PA 3T40A 2HV7A 3O6YX 4PMUA 1EJRC 3I3DA 4H04A 3OODA 4FEZA 1CECA 2V5LA 1E9IA 4CN1A 3DWWA 2EKGA 4RDYA 3W4YA 3W7QA 2Z7GA 4QE1A 3QHNA 3HIJA 5EA9A 4GKLA 1SFLA 3MZ2A 3WH7A 1W5MA 5BMXA 1LKXA 4CS7A 2EHHA 1F8MA 5I03A 1X96A 2DT0A 1E5JA 1M5WA 2L9JA 2NG1A 5A8QA 1NJJA 4DELA 4FOUA 1CDGA 5EMKA 3MI2A 3GANA 1GCYA 1HW2A 3CV7A 1TWIA 3H7VA 4HZ8A 3VKJA 3T6BA 3TLLA 5BWAA 3UGRA 4U3CA 4K68A 4KCTA 4U5KA 2BDQA 2V67A 5HATA 2Q8ZA 4KESA 2X0CA 3SRKA 1VBRA 2YKKA 1ZJBA 3M7SA 4Q6JA 3VMOA 4DF1A 1ZBWA 1ALDA 3CQKA 2DUZA 3AG4C 4O6NA 2OOGA 4MIMA 5IFTA 3MMUA 1Z32X 3PM6A 4Y9MA 3S42A 3R12A 4G9PA 1D7KA 3FOOA 5DQPA 1SW3A 1E0XA 1HZYA 4MUPA 4DWSD 1WZAA 3O1NA 4BCEA 1CNVA 3G50A 5I2UA 4ZOCA 5EMJA 2ONEA 2YA0A 4WSJA 1JJKA 2REQB 1B31A 3SW6A 3PSWA 1EDGA 4IJRA 5HMEA 3GHUA 1MVYA 5CC3A 3S9IA 2XLMA 3CUJA 1WYIA 3II1A 2OZ0A 2VFHA 2VQTA 1KBLA 3OG3A 2ZQ0A 5CBIA 3WF3A 5KTLA 4RNFA 1TREA 4HGXA 3ITFA 4LUTA 1IXOA 1SMAA 1J6OA 2HBVA 1EQCA 1V74B 1PTAA 3JYHA 2JE8A 2INZA 3FGCB 1HVQA 3BW2A 3GVWA 1OK6A 5I7GA 2W62A 2AOSA 4LACB 1EWDA 3RQGA 4BKNA 1EC8A 1E4LA 3K66A 2GSJA 4XD3A 2HZ8A 3G1AA 5A94A 4WX2A 2ISVA 4F0RA 3WQPA 4PMXA 4X0RA 2ZTJA 5C71A 4S38A 4Q4RA 1EC7A 1D8CA 4HCHA 4PMZA 4GXWA 3EQLF 1KM1A 4U5DE 2YW3A 1R46A 1W3TA 1L0PA 1L8PA 1NOUA 5D4YA 2PSNA 4C7DA 3WCZA 4Z2GA 1VEMA 5DRCA 5B3IA 1WKEA 3M43A 4YN5A 1WTYA 3WLSA 4MF4A 4RNHA 4OUIA 1C7SA 1QHOA 2XS1A 2JALA 3BC9A 4DNMA 4D4XA 4JL1A 4IPNB 4DJDA 1NARA 3OVQA 2OZ3A 3E2QA 4B91A 5FF7A 1AL8A 1OWQA 2OLHA 1RA0A 2F2KA 5H2ZA 3GUGA 1G6CA 4NL1A 3MS8A 2G3VA 1Q6DA 1HJWA 4IJJA 4O0KA 1XLIA 3NL3A 3PBVA 1YX1A 1HKMA 3KBVA 4ZXOA 2OU4A 4P5UA 4QI0A 3HF3A 3NYLA 2KX9A 4MZYA 1O3UA 3UZZA 4DF2A 2BX7A 3NGJA 3W85A 1M57C 5D2VA 2R82A 5CQ1A 4LUSB 3RH3A 5HR7A 3O10A 5FEXA 4OIPF 1V6TA 3M16A 1O1ZA 2INFA 2VKZG 3A5VA 2D2GA 2BOGX 3GR4A 4Z0JA 5LIWX 4BF9A 1B3OA 4JCLA 2B31A 3ANUA 4EF8A 5F7UA 1AA1B 3U9JA 3NQEA 3IAPA 2XFYA 3MDWA 3SN0A 3MCOA 4L1WA 1KXQA 3M1CB 3WEZA 4HSHA 1C8XA 3ZVHA 3B40A 3KTCA 3PCVA 5DXYA 2Q3TA 2TMDA 6ALDA 4E5TA 1GOIA 1CYGA 3R6IA 3W1UA 4YL3A 3THCA 4P7LA 3UXIA 2QDEA 4IGMA 4I8YA 3CGTA 4CKQA 2PPGA 1W8SA 3EX1A 3RIPA 3TQ0A 2IXMA 4QRNA 5JUAA 1Y5XA 2WNNA 2PLJA 4NZ5A 3UT0A 3GXTA 4DRHB 2WSQA 2OG9A 3WLNA 3WK2A 4NKCA 3WQFA 1M7XA 1P1XA 2IXNA 3L2LA 1KBBA 2OOCA 4BJ1A 3TJ4A 3KX6A 3QW0A 1ZNNA 1B9ZA 1BG4A 3ARXA 1B3XA 3QZEA 3GW3A 3RRAA 4E3VA 4HPGA 2CZFA 4DXXA 5HANA 3MHFA 2H3BA 5FOOA 1JF6A 3C3NA 3VCNA 1TQJA 4OBRA 3ZXWA 4C1KA 1LRNA 3BEHA 1DIOA 4DB7A 3KDOA 2J62A 2V5JA 2J8WA 4DUWA 2KC3A 3NO5A 3PWAA 3AGTA 5J04A 2BXZA 5M5DA 4H6KA 4RKAA 1H5YA 3NAVA 3DE8A 4JQAA 1P43A 3KE0A 1FCBA 1XJBA 4RE4A 2DSVA 1QPRA 4GYKA 5K0IA 4DIAA 2IKIA 1OC6A 2WVOA 3ORWA 3TTQA 2XWEA 1AMYA 4Y90A 3V5XA 1ESWA 1QDSA 3S4TA 5J5RA 1FWAC 2VC6A 1C9WA 3WLMA 3MY9A 3I4UA 2WXDM 3NVTA 3HMCA 3DX5A 3W2WA 2F6XA 1KB3A 3DECA 4IMCA 1QNRA 3U9IA 3EWZA 3NYZA 5F4WA 4YS1A 4N6CA 3FW6A 1A5SA 3EA2A 4WF7A 2OSWA 5DS5A 1RALA 4U31A 5BOEA 4GJIA 3CXOA 4KIRA 3ZC4A 1M41A 2TPSA 4W7WA 1ZYRF 4XBSA 3GXIA 3SUVA 3K2GA 4S23A 2IQTA 4N6HA 3M07A 2XVPA 3SXZA 2FH8A 3CUGA 3LXCA 3AWNA 2PP4A 2GK1B 3IJQA 3RCNA 1E83A 1RLDA 3G5EA 4PMDA 4INFA 2E6YA 4S3FA 2V63A 3ARPA 4JIEA 3PVFA 1PV8A 1HE9A 1HJQA 3HTWA 1Z5ZA 2RFGA 2YB1A 4MVQA 4GVHA 3N4AA 3I4EA 4I1OB 4ZMGA 1NFBA 5EMMA 4JE9A 1V6VA 3U57A 1C03A 3H22A 1ZPTA 2OELA 3CJPA 2C0HA 2IMRA 2D0HA 4KBLA 1KR0A 4DF0A 1P5BA 4Q4OA 4QLJA 4C6QA 2D0GA 3O0FA 3UQNA 1AK5A 5KYYA 2R14A 4I5RA 1XQLA 4LT9A 2ZA1A 3W01A 5XINA 3Q37A 4MY1A 1VBJA 6PTDA 3NO3A 2HJPA 3F5LA 3H2VA 2J7CA 4ULVA 4ZTYA 4PRWA 3PPFA 4JRZA 1FWHC 2ZRXA 1VMAA 2QLAA 3TAKA 3WQCA 4J3TA 4JOMA 4MGGA 3S5NA 1A7VA 1DKWA 2QJGA 3OBAA 1OD0A 4GYFA 5EBAA 2FPVA 4DBEA 2V81A 2CHRA 4ZO8A 2DSUA 1F6YA 1UR4A 4B4FA 4HZMA 1SZGA 2V2HA 3DIPA 1EUAA 4GOAA 1W9XA 3WD2A 4PB3A 4W8BA 3VKCA 3UXAA 3DBPA 2IKJA 1EIXA 1EOMA 1RPXA 2H8XA 5FSEC 5D9MA 2FHCA 1APCA 4PCPA 5AYYA 5IXEA 1M7OA 1UJQA 1JFXA 4XTIA 2DSKA 4ATLA 2E4TA 2P61A 4XQ6A 1XFBA 4GPNA 4ACYA 5FJIA 2AQVA 1I4ZA 2R9RA 5U7SA 3R2GA 4EPKA 1KFWA 5F4SA 2VDHA 4HMNA 2VR2A 3VGBA 5D32A 1S5VA 1NZEA 4TVUA 4DO7A 2PLMA 2OGJA 1XISA 3H26A 3U5YA 4PUMA 4CD7A 2Z2UA 3RKOF 1F2JA 1KFCA 3VXGA 1T9KA 2ALDA 3A47A 1UP3A 5JBEA 1FXQA 4HU0A 4NIRA 4HA1A 4JN8A 1JNDA 2DIJA 4FXFA 1QW8A 3UY7A 4N0RA 2WZHA 1MMAA 1YZCA 1F73A 4FF5A 3Q45A 1FTSA 4JYEA 5CSSA 1RCPA 3ABMC 3P60A 4HSOA 2A0NA 3EPNA 2D4UA 3ECSA 3HNKA 3LNPA 4RDAA 2HV5A 3A64A 3GTFA 1S2VA 4KF1A 1IWAA 2PU0A 1OSEA 4JTDB 5A6KA 1OF6A 2CCYA 3B4YA 1D1AA 4BQ2A 3VKBA 3PPHA 2DZBA 2XZ9A 4YT5A 5CG0A 1NOFA 1LL7A 1EOKA 2VP8A 2OODA 4MSSA 2GAQA 4D6JA 3EX4A 3IIVA 4KIEA 4XTKA 1E6XM 3SCRA 4EIYA 1X38A 1RKEB 2ZWZA 3EEZA 4PODA 4CU6A 5JS5A 2VZTA 3GXDA 2C13A 2P0OA 1YXYA 3ME3A 1S05A 4HN8A 1IZMA 3V35A 3JRTA 3G24A 1JULA 1FWDC 3MSRA 5REQA 4MDOA 1LQAA 3IIZA 2FZNA 5DQTA 1F61A 4UZSA 1AD4A 5BXRA 4LEQA 1T6UA 2VFGA 3KS6A 4FNSA 1OFRA 3M79A 1XIHA 1T5OA 2C04A 1KLZA 3SRFA 3SBFA 5C54A 3GQYA 4MQ9F 2YLDA 1BQCA 2ICSA 3KKBA 2BXVA 1E70M 2YA2A 4TQTA 3QV6A 3WH6A 3U0HA 2ZFAA 3AI0A 1AD1A 4Y9PA 1ZCCA 3CZKA 1EZ2A 5EYWA 2B7QA 2Y63A 4JTUA 3AJMA 4BJ6A 3LNMA 3PBWA 5FIPA 4L4MA 2OCZA 5CLWA 3IACA 1LQ2A 3GIQA 4M6VA 1Z23A 4XAFA 3TOPA 4X9SA 4TXEA 1J9YA 1BXNA 1TR9A 2FJUB 1TA3A 2R1KA 1UD5A 1EWEA 1WDQA 1I0BA 2X8RA 4OKDA 5AHFA 4LWWA 4QHRA 3O05A 4IAQA 3M0JA 4DZIA 1VR6A 1JPNA 3UJSA 3GXPA 3WDQA 3MV11 4IGSA 4UNKA 2FGYA 5CC6A 4UTKA 5XIMA 3W7MA 4Q22A 3KEHA 4F8XA 1UASA 3LY0A 1WUEA 1DOSA 2VD9A 4DO4A 2PX0A 4P9FA 2H9AA 1A4MA 3GDMA 4E3TA 1M53A 2BY0A 1ICQA 2XLOA 3LHTA 1YW1A 1UW9A 2QDDA 4LVFA 1O5QA 5JH1A 3CHVA 4HB7A 1TV3A 2OYLA 3LXBA 4I5XA 1US3A 5C2XA 1UA3A 3UWWA 1GQLA 1LOLA 5H8MA 4IQEA 1E6SM 1R8LA 4QBXA 3W00A 3KLKA 3JR2A 1QR7A 2PF4E 4GH3A 4IL2A 8XIMA 4JKVA 4MWAE 3CEUA 3UWVA 2Z2AA 1VZWA 2YA1A 3L5MA 4GZ7A 2PDCA 2QV4A 1BSIA 1AJZA 2BL2A 4H3DA 3TJLA 2QGYA 3UG3A 4L9ZA 4MWAD 3T8LA 1TWGA 2QNLA 5T3WA 2YGYA 4BJHA 2W6RA 1E6QM 3INPA 4HJWA 1SO3A 5CXPA 1YTDA 1NF7A 2Z29A 5I3DA 3GFYA 4UOZA 1Q0GA 1CLXA 1F8IA 3BQ6A 1W31A 3C0SA 3STFA 4F2TA 4DY1A 4DHGA 3OWTA 4RW5A 4FXRA 4Y6GA 1MI3A 4IJCA 3NIYA 2FHFA 1LQ0A 2XFRA 4JCHA 3ITTA 2OJPA 3GKAA 4UWMA 2DIEA 2NVAA 1ZENA 2OQLA 2PS2A 4XEFA 2OB3A 3LV5A 2WWDA 5E70A 3L68A 1HIZA 5I5RA 4F0KA 2EILC 2VEPA 3M0MA 4N9DA 3QTGA 5I23A 1X97A 3QPYA 2E1DA 4WY0F 5CEWA 2OT1A 4K8GA 2AWCA 4NJKA 4V27A 1W17A 2VOTA 1WXYA 2ZE3A 4YWIA 1GWJA 5F4XA 4Z9JA 1AJ2A 3MYPA 1RY0A 3L65A 3LG3A 5EK0A 1QPNA 2PLCA 2J77A 3GNDA 3BH4A 4LF2A 4QTGA 3MYIA 3IUHA 2BB0A 4XAGA 4PULA 4QE5A 3P7YA 4NTAA 1Z3NA 3S2LA 3ARTA 1U5HA 1ONXA 4QXIA 3GBDA 3GFXA 4E8GA 1VJZA 3MHGA 1IEVA 3S0CA 4YL2A 3JUGA 2VZVA 1G67A 1HO4A 3AWOA 3NVDA 3S6DA 2DFAA 3LBOA 3GU9A 1DJHA 4NZJA 1Z6AA 2WW5A 4HNTA 2ZKMX 3T0BA 3AIWA 5C7VA 1BF6A 3JSEO 1QJWA 3B06A 2E28A 3FXHA 4ER9A 1VLTA 5DT7A 1V93A 5HNTA 4WDWA 2PWVA 1U30A 4C6MA 3EG9B 1XS2A 4AVNA 3A4JA 4NAFA 1KFEA 4YVXA 1TZZA 3U5UA 4FNPA 3MFNA 4U10A 4WY0A 3VO0A 3N04A 1Z48A 3VMPA 3LNRA 1W9BM 3K33A 3M41A 4K37A 1K6WA 3R8RA 1E1CA 3F4NA 6CGTA 4HIBA 1EO7A 4NAEA 1Q2RA 2FYMA 2DW6A 4GJ1A 1JD9A 3RJXA 5KZEA 2XLWA 4JHOA 1A3XA 1MW0A 5F5HA 3I5PA 4Q4KA 2VJXA 1ORYA 1DXEA 3SQLA 1XIMA 3ITVA 4LYRA 4F3HA 5DY2A 4LERA 3OP2A 3Q2DA 4PBEA 2J27A 1QPQA 1JR1A 1BKHA 5D8WA 2PODA 4Y8EA 1UMLA 3S27A 4KCWA 5E9XA 1IT0A 1W9DM 2FFIA 1EQ1A 4CQ9A 4S2CA 3ZJ8A 2WMFA 2E9BA 1NF0A 2VRQA 2X1SA 4GVGA 1ADSA 3CUXA 4WCJA 3HPFA 1I0DA 4BEUA 4CSAA 1JR8A 4RZ4A 4K7YA 1SZRA 3VGGA 3RLGA 4NU7A 5LIXX 1TKKA 3CB3A 1A5KC 4M5PA 2DI3A 1S1RA 4RR4A 2AU5A 1P7TB 2OR2A 1YYAA 3H8AA 3RW0A 2PE4A 4OD4A 1W5OA 2RGMA 4M7TA 4XD6A 4D8ZA 3EWXA 1K9EA 2GJXA 3RR4A 2Z1VA 4MS2A 3OG2A 4IIEA 4UXDA 4JVSA 4HYWA 2E8ZA 4JBRA 5BRPA 4RZ5A 4Q4MA 1SZFA 3SJNA 1FH9A 2B7OA 4J28A 1HJUA 3DGRA 3EEGA 4HCDA 5PTDA 2C16A 1VB9A 3MVIA 3WDRA 1JZ5A 2PNOA 3N2MA 3SN4A 1MMNA 3AIUA 2FZ9A 4MADA 5JMUA 4XKMA 1XP3A 4JFWA 2VM8A 1Q0FA 4HPJA 2Y3DA 1TTJA 2J4GA 3WBXA 4ZTXA 3GODA 3NQ6A 3DMDA 1EO5A 3TH6A 3K1HA 2PBGA 3ISIX 3GG1A 5FEPA 1Q6EA 3UGVA 2IXUA 2YL7A 3KRZA 4XSLA 1FKXA 1M2OA 2V5KA 4ZSTA 4HOWA 3MKVA 3DJUB 2J88A 1SVDA 1LRQA 2GQAA 1B4EA 3GNRA 2A7PA 3LI0A 1TZ7A 4G6CA 3TJ5A 4MW8A 4O7GA 5D2YA 1RCXB 2WJDA 3L21A 3N3MA 4G2DA 2DZXA 3IQ5A 4X63A 1A0CA 4ZQPA 4DI9A 4PMJA 2HNHA 3OJGA 1UD4A 5D09A 3T1GA 1XUZA 3RLVA 4ADTA 1EJWC 1YTKA 4JTGA 5DMLA 3CWNA 4LEFA 3RMEA 3QV8A 1MQPA 3QKZA 1ZAJA 3TC6A 4W5ZA 1VP5A 2QMKA 4JEJA 4JTCA 4BHYA 4MNKA 1UH4A 1DE5A 4F2UA 1S5MA 2VFFA 3IGUA 4N9CA 3ZLGA 2WZFA 1QBAA 4KWOA 2NSGA 4UR9A 4DYKA 1C8QA 3SCVA 5FJJA 1XI3A 4GGHA 2VGBA 1E84A 1L6FA 3TULA 1TR2A 1I4NA 2HVMA 3PG8A 3QQ0A 4ZQOA 4PUKA 3Q6NA 5K9XA 3RF3A 2OWWA 1KBIA 4G8TA 4ML9A 5F2LA 3TYCA 1N82A 4Q7IA 3ZOAA 1P1MA 4GEHA 4IH3A 4HPXA 1AODA 4X0VA 4XIAA 3L67A 1YIXA 2IUZA 3N17A 2VX4A 1NDYA 4H2HA 1HNYA 4YJ5A 4DAIA 1HN1A 4R88A 3ZTZA 5BUOA 1GOWA 1UD2A 1V3JA 4UTUA 2ODOA 3SSJA 4K7BA 3ABRA 5LNWA 2F2HA 3BZJA 2V3EA 3P80A 5FA5A 3LLDA 3VVGA 2UUHA 3WEOA 3MI3A 3ONBA 4LOCA 1RHCA 2D22A 4M63A 1VAHA 2QS8A 4AY1A 1BYAA 4TMBA 1GOXA 3GVRA 3ITGA 4OU1A 3RM8A 1SZEA 3I65A 5KZDA 5FZTA 3RO6A 1WXJA 3S1UA 4GK8A 4BY3A 1O87A 3NYDA 1JPJA 3AIEA 4DBQA 3LTSA 5T3TA 3U3HA 3H70A 4OV4A 2RUSA 2X09A 2W9YA 5FF0A 3MJMA 3MUIA 3K1IC 4TX6A 1L3PA 4YJWA 1I2NA 3AAMA 5BXTA 1LM1A 1U0BB 1KRBC 5DRIA 3F4CA 2AGTA 4EXBA 3ALFA 5I79A 4MLJA 3R79A 3LLXA 5JIPA 3FVDA 1KCLA 2QAPA 1XL9A 1MXDA 1QFEA 1W9PA 5DCDA 1E43A 1Y65A 4D6HA 4FA3A 4M6QA 4FAMA 4M7SA 2LFFA 3MP3A 4AU0A 4M1RA 2RDTA 1C9DA 2VR5A 3IJLA 3RFYA 4Z1CA 3A6OA 3FY1A 1FMWA 3UWEA 4B4HA 3W74A 4HZ7A 2L6HA 2J47A 4ASTA 3WJYA 3PZNA 3NO1A 1LTDA 3ASNC 4MZ8A 1OCZC 5JH2A 3W24A 3AHVA 3W87A 1A50A 1JCXA 5I24A 4RZBA 2ZRZA 1OHLA 4F0MA 2KW3C 2DV0A 3UMKA 3ZVRA 4LS2A 3M64A 2VASA 1X7FA 3GD6A 2I57A 1HP4A 2J7EA 2E6DA 4BJTA 3PHAA 2UUIA 1FWJC 3TN6A 3ZYZA 3QC0A 1ICPA 1T40A 4XAPA 4HA3A 3RO8A 4OBTA 2YCIX 3MKKA 1LLOA 1WBHA 4G7EA 4UQBA 1E72M 1UUQA 4E2OA 1HW1A 2CXEA 3BOXA 1UZ4A 4DX3A 2NUXA 3TA9A 4PFMA 5MF5A 3ECQA 4Z08A 3OQEA 4Z2LA 5C9WA 1KCKA 4ICMA 4WD0A 3S2CA 3L4YA 2YLIA 3UNGC 3IVSA 4EKWA 2GL5A 4KRZA 2EPMX 3C8GD 1QOQA 5C7HA 1WGWA 5E6ZA 4CEUC 4DI8A 4WKFA 3ZR4A 5JU6A 1XSKA 2B4GA 4IUGA 1US2A 1ELSA 4DWSB 1T96A 4C90A 5BYWA 2EPLX 3G8RA 3PWIA 4FB7A 1F4HA 1XIFA 4IPJA 2DY3A 3G1HA 2OSXA 3OZPA 3PSVA 1AFSA 4UUIA 1TCDA 4AB4A 3UU0A 3US6A 2VEFA 4ACZA 3HFTA 5AVHA 2VCBA 1E0WA 1OYAA 3LRMA 3ZIBA 1HKJA 4XUGA 4LU0A 3AS3A 5A6BD 4CJOA 3VCRA 5A6SA 1DL3A 1F9CA 1UKTA 3NDOA 4UTIA 1X8FA 2IM8A 3W8IA 3MCNA 3QQWA 1V0NA 1H49A 1YNQA 3LHWA 3SXYA 2DJXA 3T9PA 3B9OA 3O3RA 1RZMA 2G41A 2ZICA 4XEVA 1I5NA 2PDUA 4PBFA 1W6TA 4JKMA 2G3KA 4CQAA 2X42A 5HJYA 4J30B 5CSUA 1I6NA 4LYQA 3DC8A 7TAAA 4KETA 1DHKA 3BJTA 1IYXA 4WSHA 3P6LA 2HMZA 4J7RA 3MMDA 4Q8WA 4XZMX 4OGZA 1YAUO 1OX5A 1K4HA 5FL0A 1GOQA 3GTNA 1FKWA 5CLTA 5KYWA 5KYWB 3RDKA 4AZCA 2QUVA 2WV8A 1V4YA 1L8NA 2F22A 3EHNA 3SP1A 5RUBA 3PFRA 3M0YA 3W2LA 2W4BA 4NX5A 5A6MA 8CGTA 4QJ4B 1IZKA 1AUSL 1TYGA 1GONA 3R13A 3M7WA 4J3UA 1W5PA 2XIBA 3KLLA 4O4WA 4R9XA 3KWXA 3GIPA 2XHYA 3V5YA 1JQXA 1W1YA 5ECVA 2CHOA 4UFKA 3G1RA 4WSKA 3TC3A 1Z89A 2W0UA 2XH4A 5HK4A 3P5ZA 4YWSA 3M0ZA 1FXPA 2WL8A 3GX9A 5CZ0A 3G1VA 1KRMA 5LYRA 1Q7MA 4ILSA 5ABFB 1ITUA 2ZXAA 2RD9A 4PK4A 5KZ6A 3GDRA 1QPKA 2VHLA 5HMDA 4ATDA 1FOBA 4MUZA 2FGZA 3BANA 3ABXA 1BWKA 4C7FA 4CCCA 2VFIA 1ZBCA 5DLCA 4L4OA 2XFWA 2ZWYA 5HWJA 2C15A 3K4WA 4G7ZF 2WVVB 1V02E 4E6MA 4ZL1A 1NWTA 4ML4A 5I06A 4XAYA 3RAOA 3K8MA 1TRIA 2ZXBA 3OVPA 1PO9A 4GVIA 4W8LA 1DJQA 1V08A 2QE9A 4O6YA 2ISWA 3KMIA 3WMLA 4JIHA 4QEEA 1PYFA 5SWUA 4GUHA 4W4QA 2YVKA 2VELA 3WLQA 1WAUA 3SADA 4RV8A 1W3LA 2BE5F 2CNWD 4JQ4A 1ME9A 2XFFA 3B29A 2PBEA 4CS8A 2PDYA 1B3YA 3M0VA 2VZOA 1XLFA 4PUDA 1XF0A 2PDKA 3GVQA 1KXHA 3BOFA 4NTBA 1CW2A 1EJXC 4QS6A 1T8QA 3AMLA 1XYCA 3GWQA 3K13A 2RJGA 1OGGA 3T7VA 3WQDA 2E3ZA 5HAOA 2NV9A 5BU9A 5E6YA 3PANA 3W7HA 4NSBA 4L1XA 4PCSA 3AS0A 3DXIA 5HJLA 3K4DA 1F7BA 7XIMA 2AMXA 3CQIA 5HPOA 4IICA 3W6YA 2GGHA 4XSMA 4DVZA 1T8XA 1GHRA 8RUCA 4G1KA 1NFNA 2HWGA 5CGMA 2VEGA 4ICCX 3W1LA 5CI9A 3JCUQ 4DZ5A 1G5AA 5HMFA 2HXUA 5L3QA 5U4NA 4XBKA 3TU9A 2QKFA 3RGTA 2W3ZA 1QLEC 2WB7A 3C2VA 4DPPA 1KV8A 1DWFM 3EB3A 1F1MA 2XISA 2Y85A 3K30A 3U8GA 3GEEA 1QSPA 3EGJA 4O1CA 4UQ9A 1EIBA 4R9OA 3AISA 3Q4DA 5LZLA 1YLVA 3JW7A 1A5MC 3LTYA 3AIBA 1EX1A 2X7WA 2M4EA 5CPQA 3RXZA 4XPWA 4Q4QA 3M6DA 4LUYA 4IG2A 1RP9A 4DUOA 1F74A 5CZJA 3VMNA 1KXVA 2QV5A 4X2RA 3EZIA 2HTMA 1UJPA 3CV6A 3LV6A 3UCQA 2VDIA 5C9ZA 1W1ZA 3LB0A 4JTAA 4BI5A 4IPPA 4CIHA 4GGBA 2DORA 3KYIA 4LTSA 4Z1DA 2NX3A 2H7OA 4QDLA 1Y5VA 4C1NB 1EA8A 5COMA 2WVNA 3EWDA 3PJXA 4WEVX 4AE4A 1TQXA 5EHHA 2WPBA 2Q7RA 1S5WA 3NQ7A 4JL2A 1M56C 3MVTA 2DZAA 2GJRA 4GQQA 2ZUNA 5EU9A 2WKJA 5I3JA 5COFA 3ZT6A 3TYZA 4ORIA 4Y8FA 3RIKA 2BY2A 1ZU5A 3NNTA 1PEZA 4BA0A 3APGA 1A5OC 4JGDA 4O1BA 4C6JA 2J6VA 3OVGA 5DMNA 4KGJA 1ODUA 1QUMA 1OYBA 1TG7A 1ISXA 5AVNA 3VF0A 3E6EA 2KJGA 2QCCA 2B0HA 1NWUA 5G5IA 2YL1A 2QIWA 2PDMA 3KVKA 3UZJA 1CPQA 4F66A 2OZTA 3EWBX 2QAFA 1Q6LA 3UWQA 5KMYA 1RXOB 3G0SA 3VGEA 5LNUA 3QTHA 1SJDA 2ZOXA 3KRBA 1VPXA 2ZVRA 5D33A 4BK9A 2BNJA 3KCJA 3CM4A 2QPXA 4YMZA 1EX5A 1H3GA 3W0KA 5BNKA 1OG0A 3NMKA 4JDBA 3TN3A 2YXXA 2XVNA 2M64A 3GU1A 3KOWA 3KOYA 4GUFA 3WD0A 3G1FA 4IM4A 1ML1A 5HV9A 3SRDA 3G3MA 1Z7Qc 2YYTA 2FTWA 1BQGA 2BHZA 3PDMP 4L6OA 4PTXA 4XZNX 3OBEA 3R8GA 4GABA 3SZRA 2CBVA 2W91A 1JIBA 1QWKA 4HMCA 2A6HF 3STCA 1F07A 1A3HA 4JIRA 5AC5A 1HMOA 3AHTA 4NZ3A 3MWCA 2ON3A 3ONCA 2E77A 3UZWA 3PTDA 1SZNA 1BZ4A 3V7PA 3LRKA 1XLAA 3RR1A 2ZUSA 1V8EA 3W1AA 3N2XA 4JTFA 1KRAC 5BOOA 2VWTA 5T8GA 1B4KA 4R7WA 1CB7B 4YPJA 3EA3A 2BSLA 5XIAA 2E5CA 1H9GA 3WD4A 3T08A 1JI1A 4L65A 3UA3A 2EPKX 3AZRA 1J0IA 1QOPA 4JURI 1OZQA 2VC5A 2O9XA 3CV2A 3Q7LA 2HBXA 2YWAA 4L6HA 1V3KA 2DZWA 3C8NA 1Z7AA 4EAMA 4TTGA 3SECA 5JXQA 5C2GA 4R7JA 4AD1A 2Y7DA 5AHEA 3C86A 4CGTA 4IX0A 3TKFA 6TAAA 4PCNA 4C6KA 4AL1A 4I9MA 4HU8A 2VRKA 1LWJA 1VBHA 3UVIA 3KVJA 3CU2A 4C6FA 4O53A 4WQ6A 1HO1A 3DCPA 3TMQA 4J40A 1SFTA 3TR9A 3PWGA 3EWYA 4GX8A 2PZ0A 3M1ZA 3OGVA 2HISA 3PZMA 4ROPA 4LNYA 1SFSA 3SXMA 4ZOAA 2FJKA 3W7EA 3EA1A 4TOQA 2XWDA 3VE7A 2QHAA 3IVUA 1R2RA 3BZGA 3AZTA 4DYEA 2YLLA 3M44A 3N2TA 5AB3A 1QNQA 3KPHA 4UFMA 3BURA 4O15A 4JHMA 3I3EA 3W23A 1MXGA 3L4UA 1TQGA 1EGVA 1S2WA 1W9UA 1JPMA 4CNPA 2WC4A 3H2EA 1CGXA 1IEWA 2R1NA 1BRLB 3KZSA 4R34A 3NZ1A 3RNDA 4JTLA 3NPUA 3W84A 4LY8A 1ZALA 1M04A 2AWYA 1OGBA 1KBJA 1C8YA 1NY1A 1H1NA 4XQ1A 2FHBA 4UTFA 2GVLA 4TTUA 2FKPA 5TAOA 1EDTA 5AC4A 3GRIA 1GKQA 3RU6A 2B0MA 4WVXA 1J0JA 4HA4A 3GWLA 1R3SA 1BYCA 2DT2A 2YLGA 2EAWA 3CPRA 1WNOA 2Y7GA 3E70C 1EP2A 1MNDA 4CD5A 3N19B 3KDNA 3LPFA 3L2MA 2HS8A 4P7RA 1XIBA 1FWNA 4QAIA 5COGA 1EZWA 4AG0A 4F9JA 1MUCA 4ZR8A 4F40A 3N3TA 3BDKA 4LUIA 3WF1A 4BWLC 1UD6A 4BFAA 4QLKA 4UMBA 1B3ZA 2HE8A 2PRLA 2YCKX 4UTMA 1CGTA 3FSTA 4JX6A 2CDQA 4L9XA 1LI5A 1EI7A 4GBDA 2P8CA 3VNLA 3P93A 3AGUA 2ETSA 1JI2A 1E6RA 4UCFA 3S29A 4MPKA 3MQTA 1OKKA 1QCWA 2YL9A 1ITCA 1W32A 1TUXA 4XAZA 3UCDA 4GVFA 3POCA 2WSRA 1EFZA 2WK2A 3UWZA 3VDHA 3WK1A 4LQ1A 1RXQA 3RHGA 1XIEA 4GY0A 3S8HA 1MDRA 3COTA 1J12A 1MUMA 4IGGA 1JDEA 1HKIA 4M80A 1ZW3A 4ZBCA 1KXTA 2P3ZA 2X1UA 4HFKB 3S6TA 3QF0A 2VEKA 4MMWA 3FYOA 1XR2A 3DZAA 4RCXA 1GJUA 1MFVA 1KWGA 4JKKA 2CLIA 3VDCA 2Z25A 1TFVA 5K7JA 1TWSA 3TW6A 2ZXQA 3H12A 1F6PA 3TFCA 1KFLA 3W1MA 3H23A 2QF8A 4XZLX 4C60A 1ZP3A 1YADA 4PMNA 5TQLA 1H09A 4GLEA 2G8ZA 3TZFA 1DPMA 4HOZA 3KBNA 1DTNA 1GJWA 1KV5A 1AH3A 1BLIA 1J0ZA 3WF2A 2PRMA 2YBUA 3ITYA 1QATA 3O16A 4DM1A 1VFOA 2O4MA 4D71A 1S5NA 1MMFA 2C3ZA 4DAFA 3JT1A 3OYZA 5IHSA 1B1YA 1R85A 4H1ZA 4A29A 2WKGA 1XCWA 3CAQA 4PUUA 3DAGA 3UCCA 1M9HA 1D3GA 2KYHA 3B8TA 2TODA 1I8JA 1HP5A 4BG0A 5K4ZA 2Z24A 3C8ZA 4MWAC 2E9MA 3TOLA 1TIMA 4PEEA 5HMSA 3W1XA 3VNYA 2ABAA 2Q6ZA 2J7GA 3DZ1A 1G7VA 1AJ0A 1A0BA 1UG6A 1QHZA 3KZPA 4CDVA 3ZLHA 1JPKA 1X7IA 5KYUA 2DZPA 3L12A 3GTHA 1K8XA 3PP7A 4N6EA 4RL3A 5BZAA 1KM0A 2AL1A 3EWUA 3WLIA 1JD7A 3AMKA 4IFKA 1E86A 1PAMA 3TE9A 3ANVA 4DM2A 1K02A 4AYSA 3BLKA 3UXKA 1QW7A 1G4WR 3F2DA 3PR2A 3KYJA 1JXKA 1FWIC 1OYCA 2CC0A 3UMHA 2LQGA 2VD8A 1BYBA 2ZX8A 3FX4A 1WATA 4XZIA 3PNUA 2PDPA 5TIMA 3A23A 4UTLA 1S46A 1YYXA 4LALA 3W83A 3BARA 1XPYA 1OW7A 1ZU8A 2PD5A 1JQVA 1S5TA 1FWFC 3G3DA 4CD6A 3AG2C 1QI4A 3RM9A 2YDQA 4UQAA 1O95A 3LESA 2E5BA 4LF1A 4OOUA 4DJFC 1ISZA 3TYDA 3SY8A 2OX1A 5I77A 4I7WA 3KCLA 3SCOA 4AD0A 4WDUA 1HW6A 4KFOA 5E5CA 4M8UA 1R5ID 1J0HA 1RR2A 4L5ZA 3W7KA 3T55A 3HGJA 2BFGA 1A7DA 3EH1A 5FF2A 4US5A 2WVQA 5FF3A 3DESA 1E15A 3DOPA 3RF9A 5HQLA 3CHDA 4JX5A 2HUJA 3IJ7A 3HKKA 1MRQA 3ZSUA 4O54A 1UB3A 3GTXA 4C3DA 1JDFA 1OT2A 5F2GA 1W2VA 1RA5A 2PP3A 2Y5EA 3W2KA 2WMIA 4XZWA 2ZXWC 3WELA 2A0BA 3D3FA 3QY7A 4AH7A 1OX4A 3BSMA 3TD7A 4JTKA 2AQWA 3VPLA 4D6CA 5AY7A 1M3UA 4JJGA 2E1WA 3CK5A 3RCMA 3U2OA 1JZ3A 3TEVA 4RE0A 3QW1A 4OIFA 4JYFA 5FJTA 2OQMA 2DZSA 1BWLA 4QX4A 3WBAA 4YYFA 4AF0A 3MDUA 1TIWA 2UY2A 3NJ3A 3WD3A 3M5VA 3FYPA 3T4CA 4WKAA 1RBLA 1VHNA 3HG5A 3NEVA 3IV3A 1VFTA 3RVYA 1SR9A 1HKKA 3WMCA 2D23A 3L4VA 2IPFA 2JF6A 1B5TA 1TPH1 5FAJA 1Z44A 4PTMA 4PZVA 4NXKA 1RBAA 2NX1A 3HBLA 2PTYA 4IMAA 4ERAA 3VIHA 3SAZA 1XDJA 3HG2A 1XRVA 2YL6A 5B1AC 3I10A 3CO4A 3ATYA 3QR1A 4EANA 2YRFA 3ABZA 1P4CA 1XRTA 3JU2A 3FAPB 2WNQA 3HNIA 3BGAA 3AYRA 4GFSA 4TMCA 1U2YA 2BMBA 4P8UA 3GH4A 1E9LA 2ASRA 1EKYA 2VB6A 1HQTA 3VNKA 1H1YA 1Q66A 1F4AA 4YHGA 1W56A 3MTWA 5DMYA 3RQFA 3H65A 1U6HA 3DENA 4GNVA 2NXGA 1JZ4A 4J2PA 3E38A 2XVLA 3GNNA 1VCVA 3D6NA 1QKRA 1A4LA 1UD8A 3N24A 1UMYA 3CZJA 4A2NB 3EFOB 3SEOA 1EP3A 1DORA 5G2IA 4NNAA 4OUEA 3KRSA 2GVJA 2PWHA 4HPNA 1GZ1A 1HX0A 4Q7NA 4UQEA 1UBSA 1T6MA 1E40A 2FMOA 5D8ZA 2G3NA 1B3WA 4NQFA 4QJ1A 1GG0A 4KWWA 4OJYA 4NI8A 1A5AA 2LSEA 4ALDA 5M03A 1JFHA 3W86A 1RSCA 3RMJA 3L2IA 5LA1A 3LCIA 4UTHA 1OFQA 1VD6A 2J66A 2J8GA 5I09A 3VKKA 1QNSA 3MBFA 4MNJA 3T6CA 3WG6A 2YCLA 1O7AA 1GHSA 1T5AA 1W9VA 4W7UA 4AWEA 3FOKA 4G1NA 1W8GA 1W1TA 2NWRA 3VNJA 1HF6A 1M6TA 3SB0A 3B0PA 1GOMA 4NRRA 5LHFA 4CCEA 1NSGB 4J27A 3WIJA 1M1BA 3BGJA 2WJZA 2J0XA 5LXXA 4RBNA 1QOXA 4EE9A 5CAHA 1F3XA 1GYLA 3VIPA 4LB4A 1DQXA 2ZC1A 2KSFA 3LDVA 2PDLA 1FQ0A 4H6EA 2FLIA 2Z1XA 2MHRA 3HA1A 3VINA 3WFLA 3IJ9A 4UR7A 1TWCA 1GTHA 3ZJKA 3ZO9A 2WNWA 3RX2A 3BCDA 2B0JA 3AHZA 4B6IA 1K7XA 3H2MA 4GA8A