4XPWA

Crystal structures of leu114f mutant
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
131
structure length
131
Chain Sequence
MALMTWTAAEFGTNVGFADDQHKTIFDMVNKLHDTAATGNRSEIGKQLDALIDYVVMHFKSEETEMQKKGYADFAAHKAEHDKLVGVCADLQKKFHAGEAEVNQDTTRFVRDWFVNHIPKVDKLYGPCLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxygen binding protein
molecule keywords Bacteriohemerythrin
publication title The bacteriohemerythrin from Methylococcus capsulatus (Bath): Crystal structures reveal that Leu114 regulates a water tunnel.
pubmed doi rcsb
total genus 58
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2015-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01814 Hemerythrin Hemerythrin HHE cation binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.50 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Hemerythrin-like 4xpwA00
3WAQA 4XPXA 4XPWA 4XPYA 1I4ZA 2MHRA 2AWYA 1HMDA 3AGUA 1A7EA 2AVKA 1HMOA 2HMQA 3WHNA 1I4YA 4XQ1A 2AWCA 2HMZA 3AGTA 1A7DA
chains in the Genus database with same CATH superfamily
3DI5A 4NTAA 1GM5A 4BG0A 1JMWA 4KBLA 1JPNA 3RQFA 5KYUB 1CPQA 4I1OB 4EHPA 1FAPB 3LESA 1LPEA 1ZVZA 5A6KA 2O9XA 3S9OA 1ORYA 2AU5A 2L6FA 2GAQA 1KU2A 2Q00A 4P9TA 5E3CA 3GM3A 2BE5F 4DRIB 2WVOA 3MFNA 4AE4A 3ZQVA 5A6BD 3MYFA 2HS5A 2A6HF 3DZAA 3EFOB 3DE8A 2NUPB 4IARA 4BJ5C 2LD6A 3DM5A 4E7ZA 3PCVA 1LKXA 1L7CA 4Z9JA 2D5RB 2I15A 2Y3HA 4E0HA 1A7DA 2QE9A 3NYMA 4C3EA 3HKKA 3K1HA 5E3AA 4U9EA 3B9QA 3EG9B 3GEEA 2DGJA 3WAQA 4CSAA 2PX3A 3I5QA 5EK0A 4OD4A 5A6JA 2R25A 3BRJA 4ULWA 1WWPA 2DYRC 2XM0A 3U3FA 3OEOA 1BR2A 4O6MA 3EH1A 3TQOA 3UGOA 5FCLA 3U8VA 4IWBA 2LQGA 3N0TA 2YLIA 4K0DA 1H7IA 3T4RA 4BPMA 4ANJA 1S7ZA 2PX0A 2FAPB 4I1MA 4PR9A 3RKOF 4BEMJ 4CJOA 2R7SA 4XEFA 3AQBA 2WB7A 2M4EA 3EGDB 4PJJA 5L0GA 2OU6A 4N6HA 1PCXA 3ATPA 1QSPA 4HFKB 3B0VC 1EKYA 3RH3A 1WN0A 2QUPA 4MVOA 3GM1A 1M2VA 3KYIA 3LEVA 4K1OA 1AVOB 4N4WA 3NG1A 2YVKA 2CW0F 2B0HA 3ZTZA 2A68F 2BL2A 4H4KC 2LP4A 1K05A 4IRUA 3M79A 5CI8A 1Z6AA 1BR4A 3FOPA 4FWVA 3LLIA 1I5NA 2VC9A 3DAGA 4OIPF 5B3IA 3LNMB 3IQTA 3IQCA 4MTGA 1Q0KA 4MS2A 4JW1A 3G4XA 4Z9HA 3TJ5A 4ZLCA 3TULA 2Y69C 3L1MA 2ETSA 4FAPB 1AEPA 2YL7A 4M63A 1SYQA 2PFDA 5JRAA 3S90A 1RMVA 5KYXA 3HNJA 4LLCA 2XS8A 4XWJA 4YT2A 1WASA 4LDKA 3K1IC 3EGXB 3DD7A 5KYYA 2EPOA 2MYSA 1JR8A 3ZWIA 2KQ9A 4J30B 4JJGA 3AGTA 2IXOA 2HSQA 3UMKA 2XRHA 2VCBA 5HV9A 1T6UA 2NSFA 3KH2A 3OWTA 1OCZC 2EIMC 4YL1A 4BJ5A 4A4AA 1H9TA 2HFIA 4OIOF 1ORJA 4PFPA 4E7SA 1Z63A 3GWNA 3K6BA 3HJCA 4KNVA 4NTBA 1C17M 1SMYF 4L6RA 1BBHA 3AQCA 2R7XA 3KL4A 1HMDA 2QNLA 3RF3A 2J0XA 4EBKA 3KKBA 5KYUA 2IXNA 1XZPA 1RKCA 1V55C 1ZHTA 3LAYA 1LS1A 4MVRA 1R5ID 2R7QA 4JRZA 5B1AC 3F46A 3SEOA 4BEJA 2ZXWC 3O55A 1M6TA 1O5HA 1TFKB 2G3KA 4PJMA 3SXYA 2R03A 2YL3A 3Q7LA 3V5XA 4PJNA 1LVKA 4R32A 3SNHA 4LDQA 3GWLA 4JKVA 1AUEA 1G5ZA 1T6IA 1V4AA 2J0WA 3CEXA 3EFOA 2NUPA 4AX2A 1Z3IX 4JZAA 3U9MA 1ZU5A 2NPUA 3EJNA 4PJLA 1SR2A 2IOQA 3VYWA 3G4ZA 1ZU4A 3MX3A 5B1BC 1I4ZA 3DJUB 2GA0A 1QVXA 5AGFA 4E18A 5JP7A 3EG9A 4AL0A 4MW3A 4CS8C 4CBEA 2VH3A 1G8XA 1ZHXA 2ASRA 2KGOA 1LE2A 3JSEO 4NC3A 3V5YA 4JVSA 5L0IA 1V74B 1HMOA 4KC9A 1ZZPA 2R7RA 4G7ZF 4CS9A 4LERA 1A41A 3TOLA 3IQ5A 1QKRA 1SZIA 1TWAA 1GQAA 3C7JA 3GEIA 2R05A 3UNGC 1D0YA 3SXMA 2A1DD 3EGDA 1E83A 1LM3B 2IBFA 3K1IA 3DXJF 3M4CA 4MTOA 3LEOA 3RVZA 2JPUA 3DM9B 1BR1A 2A0BA 2J9UA 1NG1A 3JT1A 3NMJA 2F22A 3UMIA 4E0IA 2XXAB 3LUTB 2IYLD 3R2PA 1JPJA 1E85A 2VCAA 4GQHA 1YA9A 2IXMA 2OJQA 1RXQA 3W8IA 1J8MF 5L3QA 1HE9A 1WATA 4O6YA 1A0BA 4OIQF 4C3BA 4JCZA 1ZHYA 2ZD9A 3ZIBA 4NQFA 3W2WA 1MMGA 2OG2A 4GEHA 2HKVA 3L0IA 4MNDA 4H54A 3GEHA 1VTMP 5COMA 4XQ1A 1T01A 4J7YA 3QW0A 2EILC 1Q0GA 2GDCA 4G0HA 4JTCB 3EHNA 4XEKA 4BJTA 2M64A 2Q4FA 1MQVA 2KNHA 3EGXA 3I5PA 2X51A 3E9VA 1VYIA 4Z9IA 3QVYA 4AL1A 3RIPA 2YWAA 2H8AA 1NSGB 2DYSC 2R02A 1XWJA 1FFTC 3AG4C 1RJ9B 1FMVA 2L6GA 1MMNA 2P0NA 3Q6NA 3JZ0A 3OA1A 2EPKX 3DKAA 2NUTB 3ZVRA 3RYLA 2HSBA 1YJGA 3UGPA 1GGQA 3MBGA 4LLEA 1VOMA 3AGUA 2C04A 3G50A 1HW2A 2V3CC 4MQ9F 3NDBB 4ZLDA 1C02A 4IGGA 2OCCC 5D92A 3SP1A 3E70C 3U2MA 4CIHA 2XLDA 1Q0MA 5T1DB 2C03A 3LJBA 2P7VA 3SZRA 2EIJC 4ONSA 4GYTA 4JTAB 4C3DA 4I44A 3EZHA 1PD0A 4XEVA 1U89A 2LFFA 2YKZA 5DS6A 4YL0A 4C7OB 3ABLC 3PHF2 2QTVA 2FFHA 2WVQA 5DVWA 4HEAJ 4DJ9A 4XPXA 4XPWA 4MVSA 2YZSA 4QI0A 4U5GA 3U2LA 3MLGA 2Q9AA 4NTFA 3RW0A 1GS9A 1ZHWA 2HJ3A 3JRMO 1ST6A 3H65A 5E2QA 3SYNA 5AC5A 2FGYA 1OCRC 2KJGA 2ZPAA 1QZXA 2KSFA 2XLWA 3ITFA 3B0UX 4YK5A 1FMWA 2CNWD 3IEEA 3AOUA 2R9RB 4U5BE 4F4BA 4UDVA 3WHNA 2H7BA 4O79A 2WVNA 2R7UA 3S29A 1OW7A 1OCCC 2KW3C 4JE9A 4PFOA 3RFYA 3WODF 4O6NA 2CDQA 5KYWB 1HW1A 1RCPA 3GANA 3J06A 4FX5A 5JVEA 2XL8A 1E84A 2EPNA 2A6EF 4ER9A 5A6BA 3ZQYA 2Y39A 256BA 3US6A 3ZDLA 2L7AA 5CI9A 5K0IA 1TQGA 3BEHA 3NKEA 1KTMA 4U5CE 2KYHA 1R4TA 1MNEA 2YL1A 2MWQA 3JTLO 4MVUA 4YT5A 1S05A 4CS7A 2XLHA 2EPLX 4RBNA 1NU7D 4MVZA 4MW8A 3GORA 4LDRA 2XXAA 5DLJA 2G3VA 2NG1A 5EHHA 3A9CA 3KPHA 2A69F 1WTYA 2KC3A 3B0PA 4IJJA 3U0CA 1L3PA 3FVYA 1YDIA 1E86A 5T3TA 1OXBA 1LI5A 5BQHA 1CGNA 2XL6A 3S84A 1KNYA 1J8YF 2Y3BA 4U5HA 5T3WA 2GWWA 4CDVA 3X1OA 2E87A 2J7PD 4G78A 2EINC 2YLDA 2HV6A 3ASOC 2ZXRA 4U5EE 1FTSA 3HNLA 3QVZA 3FAPB 5L0JA 2JX0A 4W8PA 2BC5A 5JSLA 2J9WA 3NKDA 1T5OA 4CJGA 3NYLA 3TD7A 3V7OA 4CDYA 5JUAA 3POVA 3CQZA 5A6AA 1RJ9A 4OD5A 2VASA 4U5FE 2H7OA 4NY3A 2EIKC 4KI2A 5JLIA 3GM2A 3A11A 3ZTMA 1HE1A 2NUTA 4OINF 4RDAA 2Z15A 4DOZA 4CIPA 5L3VA 2X0CA 5BUOA 4J32B 3U3BA 3V5ZA 3ZG1A 2AWCA 1NU9C 2WZLA 1FR0A 4EIYA 2R7VA 5L0HA 4JEBA 3DJNB 1T9KA 1OW8A 3JRTA 4U9DA 3T9OA 3ABMC 4BJ6C 1OQCA 4G7HF 3PDMP 4FESA 3R7CA 3AG1C 2IXPA 1ZYRF 4XLNF 3WG7C 1DOVA 1V54C 3HTKC 3N2ZB 3QW1A 1E2XA 2XM4A 5TJ5E 4JTDB 5COGA 1M57C 3EHMA 4C7OA 4J7TA 3LS0A 3M15A 4I3MA 3C62A 3NRHA 3JYHA 4Q5SF 1D1BA 3CZ6A 4QI2A 3GODA 2NSGA 3CAXA 1QPUA 3T6GB 4JJFA 3DMDA 1F1MA 2YQYA 3JYYA 2XS1A 5B3SC 1NFNA 1D1CA 1U6HA 2GFHA 2ICWG 5L0FA 1M56C 3CSKA 5A69A 2Q9CA 2Q7RA 1VK5A 4HFFB 3LLKA 2JD3A 5IY5C 4JC7A 5BQIA 3U9JA 2VB6A 4EKWA 1FFHA 1NLXA 3RQEA 2ZXOA 3C8ZA 4K7BA 5E33A 1Q0FA 2YL0A 4MTFA 1NFOA 4X0RA 4EWCA 5KYWA 1CPRA 4NCQA 4Q7CA 4XPYA 2PBEA 2PNOA 2J46A 2R7TA 2J9VA 3K33A 3ECSA 1Q0DA 3ABKC 3EH2A 3T6JA 1LE4A 2P6VA 2J7PA 5FZTA 4YWQA 3T6BA 1JOGA 1RKEB 1TKNA 3FDQA 1A7EA 1WOLA 1JAFA 3MYIA 4E17A 1IZMA 1ORSC 2L9JA 1QQ3A 3LS1A 3C8GB 5DS5A 1CGOA 4MVQA 3UR3C 2HMQA 1Z7Qc 1VB5A 2QLAA 1B68A 4Q4ZF 4CS8A 2R7WA 2J9BA 4RD9A 2W9YA 4DRJB 1UFBA 1BZ4A 1YVIA 3DE9A 5F28E 1YARO 2Y3GA 5KYNA 3SXKA 1TR2A 1O87A 3FHDA 3NMKA 1MMAA 3IQ6A 3RQGA 3S28A 1APCA 4YT8A 2P61A 1MMDA 1VLSA 4B6IA 4YN0B 2DI3A 3VF0A 4PACA 1LS4A 5AC4A 4PK4A 5EGYA 2I8BA 3QMKA 1W2WA 3HLZA 5JS5A 1EQ1A 4AK9A 3NMIA 4U5DE 3TK0A 2B0JA 2AWYA 4BJ6A 5F5HA 4YJWA 4CDAA 1JRAA 1TWCA 2OEXA 2QY9A 3AG2C 3B71A 4O7GA 3JSZA 3FOOA 5CIVA 3HNKA 1FNTc 1CGME 4G7OF 2PP4A 1Y4CA 3C8GD 3LNRA 1YZAA 1HY5A 2RD9A 3NYJA 2R7OA 3FAJA 3L8IA 3QZCA 4LACB 4DBRA 3ASNC 4P6IC 1D0ZA 4A2NB 3Q6MA 1VLTA 1MNDA 2OQMA 2ZXPA 1TWGA 2XLEA 3DWWA 3X2QC 2EPMX 1YYJA 1OW6A 2WL8A 5L0CA 4YL3A 1YAUO 1YZCA 2LIGA 2XLVA 3JCUQ 3KMIA 3H2VA 3VAYA 1H6GA 4D4NA 4DBQA 1H9GA 3DAFA 3RVYA 3TOMA 5L0DA 4N06A 4XTKA 2YEVA 3VRCA 4D4XA 2Y3DA 2RSEB 3F47A 1OKKD 4CS9C 4AE4B 1G4WR 2XL4A 3O39A 1EA8A 1XZQA 1SF8A 1U0BB 4MVMA 4EBBA 2OEVA 3S0XA 2HJMA 3N24A 4IAOA 2J45A 1LI7A 2CYDA 1D1AA 2AVKA 4CX9A 2D4UA 2HV7A 3H2UA 4BJ1A 1PD1A 2UUIA 3B29A 1YA7O 5F5FA 1I4YA 1Z5ZA 3FMSA 1VYKA 2UUHA 1WGWA 2YRFA 1Z23A 2HMZA 3AJMA 3I4UA 1ZW3A 2XSEA 4EBJA 3K7DA 4DXWA 3QTHA 5JT4A 2W4BA 1EI7A 2L81A 2P1AA 2WZGA 2WZFA 1NBBA 2CCYA 4EUKB 1D0XA 2G62A 1O3UA 3VM6A 4DVZA 1OR3A 1DOWA 3EZIA 3IPMO 2HUJA 4IB4A 3W2VA 2MHRA 2LK4A 2HZ8A 2A0UA 2OKUA 4XLPF 1VMAA 1C03A 2XLMA 3M1CB 1M2VB 3Q7GA 2YLGA 3L8JA 4WABA 1A7VA 4WGYA 3L34A 2J8WA 2KK1A 2LCHA 3PMRA 5COFA 2OOCA 4JURI 3U5SA 4DVYP 1LIHA 3EQLF 5DQTA 3K66A 4CSAC 3AG3C 2W45A 1K40A 4N6CA 4WGZA 2L6HA 3U8PA 4DRHB 1OR2A 1RKEA 1TFOB 2IM8A 1BDJB 1ZHZA 5D91A 3HNIA 3O10A 5HSWA 2H7VC 4WJ0A 1UG7A 2AP3A 3FXHA 1M2OA 3C8GA 3W4YA 2CNWA 2W4MA 3C63A 4JIOA 2Q3TA 3IHUA 3KYJA 3ZSUA 4ULVA 2PF4E 2XLOA 1YLMA 2OJED 3EPVA 1G4US 4JEAA 3TJ6A 3ZC4A 2TMVP 1OCOC 5KYXB 1Y6DA 1T6QA 2Q9BA 1OXKA 4W8KA 5KYYB 1K04A 2LSEA 2VCCA 4IAQA 1ZW2A 1N1CA 1PV3A 3S27A 5BQGA 3SXZA 5DS4A 2V26A 4P9FA 2DB4A 1IW7F 5DQZA 3M4BA 3W8HA 3O6XA 1QLEC 1OKKA 2LFDA 1YYXA 4OIRF 2CGEA 3UMHA 4KNWA 2YHSA 4HE8D 4JCHA 1NZEA 5GPGB 3C18A 1TWHA 4YT4A 4QDLA
chains in the Genus database with same CATH topology
3WAQA 4XPXA 4XPWA 4XPYA 1I4ZA 2MHRA 2AWYA 1HMDA 3AGUA 1A7EA 2AVKA 1HMOA 2HMQA 3WHNA 1I4YA 4XQ1A 2AWCA 2HMZA 3AGTA 1A7DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WAQ A;  4XPX A;  4XPW A;  4XPY A;  1I4Z A;  2MHR A;  2AWY A;  1HMD A;  3AGU A;  1A7E A;  2AVK A;  1HMO A;  2HMQ A;  3WHN A;  1I4Y A;  4XQ1 A;  2AWC A;  2HMZ A;  3AGT A;  1A7D A; 
#chains in the Genus database with same CATH topology
 3DI5 A;  4NTA A;  1GM5 A;  4BG0 A;  1JMW A;  4KBL A;  1JPN A;  3RQF A;  5KYU B;  1CPQ A;  4I1O B;  4EHP A;  1FAP B;  3LES A;  1LPE A;  1ZVZ A;  5A6K A;  2O9X A;  3S9O A;  1ORY A;  2AU5 A;  2L6F A;  2GAQ A;  1KU2 A;  2Q00 A;  4P9T A;  5E3C A;  3GM3 A;  2BE5 F;  4DRI B;  2WVO A;  3MFN A;  4AE4 A;  3ZQV A;  5A6B D;  3MYF A;  2HS5 A;  2A6H F;  3DZA A;  3EFO B;  3DE8 A;  2NUP B;  4IAR A;  4BJ5 C;  2LD6 A;  3DM5 A;  4E7Z A;  3PCV A;  1LKX A;  1L7C A;  4Z9J A;  2D5R B;  2I15 A;  2Y3H A;  4E0H A;  1A7D A;  2QE9 A;  3NYM A;  4C3E A;  3HKK A;  3K1H A;  5E3A A;  4U9E A;  3B9Q A;  3EG9 B;  3GEE A;  2DGJ A;  3WAQ A;  4CSA A;  2PX3 A;  3I5Q A;  5EK0 A;  4OD4 A;  5A6J A;  2R25 A;  3BRJ A;  4ULW A;  1WWP A;  2DYR C;  2XM0 A;  3U3F A;  3OEO A;  1BR2 A;  4O6M A;  3EH1 A;  3TQO A;  3UGO A;  5FCL A;  3U8V A;  4IWB A;  2LQG A;  3N0T A;  2YLI A;  4K0D A;  1H7I A;  3T4R A;  4BPM A;  4ANJ A;  1S7Z A;  2PX0 A;  2FAP B;  4I1M A;  4PR9 A;  3RKO F;  4BEM J;  4CJO A;  2R7S A;  4XEF A;  3AQB A;  2WB7 A;  2M4E A;  3EGD B;  4PJJ A;  5L0G A;  2OU6 A;  4N6H A;  1PCX A;  3ATP A;  1QSP A;  4HFK B;  3B0V C;  1EKY A;  3RH3 A;  1WN0 A;  2QUP A;  4MVO A;  3GM1 A;  1M2V A;  3KYI A;  3LEV A;  4K1O A;  1AVO B;  4N4W A;  3NG1 A;  2YVK A;  2CW0 F;  2B0H A;  3ZTZ A;  2A68 F;  2BL2 A;  4H4K C;  2LP4 A;  1K05 A;  4IRU A;  3M79 A;  5CI8 A;  1Z6A A;  1BR4 A;  3FOP A;  4FWV A;  3LLI A;  1I5N A;  2VC9 A;  3DAG A;  4OIP F;  5B3I A;  3LNM B;  3IQT A;  3IQC A;  4MTG A;  1Q0K A;  4MS2 A;  4JW1 A;  3G4X A;  4Z9H A;  3TJ5 A;  4ZLC A;  3TUL A;  2Y69 C;  3L1M A;  2ETS A;  4FAP B;  1AEP A;  2YL7 A;  4M63 A;  1SYQ A;  2PFD A;  5JRA A;  3S90 A;  1RMV A;  5KYX A;  3HNJ A;  4LLC A;  2XS8 A;  4XWJ A;  4YT2 A;  1WAS A;  4LDK A;  3K1I C;  3EGX B;  3DD7 A;  5KYY A;  2EPO A;  2MYS A;  1JR8 A;  3ZWI A;  2KQ9 A;  4J30 B;  4JJG A;  3AGT A;  2IXO A;  2HSQ A;  3UMK A;  2XRH A;  2VCB A;  5HV9 A;  1T6U A;  2NSF A;  3KH2 A;  3OWT A;  1OCZ C;  2EIM C;  4YL1 A;  4BJ5 A;  4A4A A;  1H9T A;  2HFI A;  4OIO F;  1ORJ A;  4PFP A;  4E7S A;  1Z63 A;  3GWN A;  3K6B A;  3HJC A;  4KNV A;  4NTB A;  1C17 M;  1SMY F;  4L6R A;  1BBH A;  3AQC A;  2R7X A;  3KL4 A;  1HMD A;  2QNL A;  3RF3 A;  2J0X A;  4EBK A;  3KKB A;  5KYU A;  2IXN A;  1XZP A;  1RKC A;  1V55 C;  1ZHT A;  3LAY A;  1LS1 A;  4MVR A;  1R5I D;  2R7Q A;  4JRZ A;  5B1A C;  3F46 A;  3SEO A;  4BEJ A;  2ZXW C;  3O55 A;  1M6T A;  1O5H A;  1TFK B;  2G3K A;  4PJM A;  3SXY A;  2R03 A;  2YL3 A;  3Q7L A;  3V5X A;  4PJN A;  1LVK A;  4R32 A;  3SNH A;  4LDQ A;  3GWL A;  4JKV A;  1AUE A;  1G5Z A;  1T6I A;  1V4A A;  2J0W A;  3CEX A;  3EFO A;  2NUP A;  4AX2 A;  1Z3I X;  4JZA A;  3U9M A;  1ZU5 A;  2NPU A;  3EJN A;  4PJL A;  1SR2 A;  2IOQ A;  3VYW A;  3G4Z A;  1ZU4 A;  3MX3 A;  5B1B C;  1I4Z A;  3DJU B;  2GA0 A;  1QVX A;  5AGF A;  4E18 A;  5JP7 A;  3EG9 A;  4AL0 A;  4MW3 A;  4CS8 C;  4CBE A;  2VH3 A;  1G8X A;  1ZHX A;  2ASR A;  2KGO A;  1LE2 A;  3JSE O;  4NC3 A;  3V5Y A;  4JVS A;  5L0I A;  1V74 B;  1HMO A;  4KC9 A;  1ZZP A;  2R7R A;  4G7Z F;  4CS9 A;  4LER A;  1A41 A;  3TOL A;  3IQ5 A;  1QKR A;  1SZI A;  1TWA A;  1GQA A;  3C7J A;  3GEI A;  2R05 A;  3UNG C;  1D0Y A;  3SXM A;  2A1D D;  3EGD A;  1E83 A;  1LM3 B;  2IBF A;  3K1I A;  3DXJ F;  3M4C A;  4MTO A;  3LEO A;  3RVZ A;  2JPU A;  3DM9 B;  1BR1 A;  2A0B A;  2J9U A;  1NG1 A;  3JT1 A;  3NMJ A;  2F22 A;  3UMI A;  4E0I A;  2XXA B;  3LUT B;  2IYL D;  3R2P A;  1JPJ A;  1E85 A;  2VCA A;  4GQH A;  1YA9 A;  2IXM A;  2OJQ A;  1RXQ A;  3W8I A;  1J8M F;  5L3Q A;  1HE9 A;  1WAT A;  4O6Y A;  1A0B A;  4OIQ F;  4C3B A;  4JCZ A;  1ZHY A;  2ZD9 A;  3ZIB A;  4NQF A;  3W2W A;  1MMG A;  2OG2 A;  4GEH A;  2HKV A;  3L0I A;  4MND A;  4H54 A;  3GEH A;  1VTM P;  5COM A;  4XQ1 A;  1T01 A;  4J7Y A;  3QW0 A;  2EIL C;  1Q0G A;  2GDC A;  4G0H A;  4JTC B;  3EHN A;  4XEK A;  4BJT A;  2M64 A;  2Q4F A;  1MQV A;  2KNH A;  3EGX A;  3I5P A;  2X51 A;  3E9V A;  1VYI A;  4Z9I A;  3QVY A;  4AL1 A;  3RIP A;  2YWA A;  2H8A A;  1NSG B;  2DYS C;  2R02 A;  1XWJ A;  1FFT C;  3AG4 C;  1RJ9 B;  1FMV A;  2L6G A;  1MMN A;  2P0N A;  3Q6N A;  3JZ0 A;  3OA1 A;  2EPK X;  3DKA A;  2NUT B;  3ZVR A;  3RYL A;  2HSB A;  1YJG A;  3UGP A;  1GGQ A;  3MBG A;  4LLE A;  1VOM A;  3AGU A;  2C04 A;  3G50 A;  1HW2 A;  2V3C C;  4MQ9 F;  3NDB B;  4ZLD A;  1C02 A;  4IGG A;  2OCC C;  5D92 A;  3SP1 A;  3E70 C;  3U2M A;  4CIH A;  2XLD A;  1Q0M A;  5T1D B;  2C03 A;  3LJB A;  2P7V A;  3SZR A;  2EIJ C;  4ONS A;  4GYT A;  4JTA B;  4C3D A;  4I44 A;  3EZH A;  1PD0 A;  4XEV A;  1U89 A;  2LFF A;  2YKZ A;  5DS6 A;  4YL0 A;  4C7O B;  3ABL C;  3PHF 2;  2QTV A;  2FFH A;  2WVQ A;  5DVW A;  4HEA J;  4DJ9 A;  4XPX A;  4XPW A;  4MVS A;  2YZS A;  4QI0 A;  4U5G A;  3U2L A;  3MLG A;  2Q9A A;  4NTF A;  3RW0 A;  1GS9 A;  1ZHW A;  2HJ3 A;  3JRM O;  1ST6 A;  3H65 A;  5E2Q A;  3SYN A;  5AC5 A;  2FGY A;  1OCR C;  2KJG A;  2ZPA A;  1QZX A;  2KSF A;  2XLW A;  3ITF A;  3B0U X;  4YK5 A;  1FMW A;  2CNW D;  3IEE A;  3AOU A;  2R9R B;  4U5B E;  4F4B A;  4UDV A;  3WHN A;  2H7B A;  4O79 A;  2WVN A;  2R7U A;  3S29 A;  1OW7 A;  1OCC C;  2KW3 C;  4JE9 A;  4PFO A;  3RFY A;  3WOD F;  4O6N A;  2CDQ A;  5KYW B;  1HW1 A;  1RCP A;  3GAN A;  3J06 A;  4FX5 A;  5JVE A;  2XL8 A;  1E84 A;  2EPN A;  2A6E F;  4ER9 A;  5A6B A;  3ZQY A;  2Y39 A;  256B A;  3US6 A;  3ZDL A;  2L7A A;  5CI9 A;  5K0I A;  1TQG A;  3BEH A;  3NKE A;  1KTM A;  4U5C E;  2KYH A;  1R4T A;  1MNE A;  2YL1 A;  2MWQ A;  3JTL O;  4MVU A;  4YT5 A;  1S05 A;  4CS7 A;  2XLH A;  2EPL X;  4RBN A;  1NU7 D;  4MVZ A;  4MW8 A;  3GOR A;  4LDR A;  2XXA A;  5DLJ A;  2G3V A;  2NG1 A;  5EHH A;  3A9C A;  3KPH A;  2A69 F;  1WTY A;  2KC3 A;  3B0P A;  4IJJ A;  3U0C A;  1L3P A;  3FVY A;  1YDI A;  1E86 A;  5T3T A;  1OXB A;  1LI5 A;  5BQH A;  1CGN A;  2XL6 A;  3S84 A;  1KNY A;  1J8Y F;  2Y3B A;  4U5H A;  5T3W A;  2GWW A;  4CDV A;  3X1O A;  2E87 A;  2J7P D;  4G78 A;  2EIN C;  2YLD A;  2HV6 A;  3ASO C;  2ZXR A;  4U5E E;  1FTS A;  3HNL A;  3QVZ A;  3FAP B;  5L0J A;  2JX0 A;  4W8P A;  2BC5 A;  5JSL A;  2J9W A;  3NKD A;  1T5O A;  4CJG A;  3NYL A;  3TD7 A;  3V7O A;  4CDY A;  5JUA A;  3POV A;  3CQZ A;  5A6A A;  1RJ9 A;  4OD5 A;  2VAS A;  4U5F E;  2H7O A;  4NY3 A;  2EIK C;  4KI2 A;  5JLI A;  3GM2 A;  3A11 A;  3ZTM A;  1HE1 A;  2NUT A;  4OIN F;  4RDA A;  2Z15 A;  4DOZ A;  4CIP A;  5L3V A;  2X0C A;  5BUO A;  4J32 B;  3U3B A;  3V5Z A;  3ZG1 A;  2AWC A;  1NU9 C;  2WZL A;  1FR0 A;  4EIY A;  2R7V A;  5L0H A;  4JEB A;  3DJN B;  1T9K A;  1OW8 A;  3JRT A;  4U9D A;  3T9O A;  3ABM C;  4BJ6 C;  1OQC A;  4G7H F;  3PDM P;  4FES A;  3R7C A;  3AG1 C;  2IXP A;  1ZYR F;  4XLN F;  3WG7 C;  1DOV A;  1V54 C;  3HTK C;  3N2Z B;  3QW1 A;  1E2X A;  2XM4 A;  5TJ5 E;  4JTD B;  5COG A;  1M57 C;  3EHM A;  4C7O A;  4J7T A;  3LS0 A;  3M15 A;  4I3M A;  3C62 A;  3NRH A;  3JYH A;  4Q5S F;  1D1B A;  3CZ6 A;  4QI2 A;  3GOD A;  2NSG A;  3CAX A;  1QPU A;  3T6G B;  4JJF A;  3DMD A;  1F1M A;  2YQY A;  3JYY A;  2XS1 A;  5B3S C;  1NFN A;  1D1C A;  1U6H A;  2GFH A;  2ICW G;  5L0F A;  1M56 C;  3CSK A;  5A69 A;  2Q9C A;  2Q7R A;  1VK5 A;  4HFF B;  3LLK A;  2JD3 A;  5IY5 C;  4JC7 A;  5BQI A;  3U9J A;  2VB6 A;  4EKW A;  1FFH A;  1NLX A;  3RQE A;  2ZXO A;  3C8Z A;  4K7B A;  5E33 A;  1Q0F A;  2YL0 A;  4MTF A;  1NFO A;  4X0R A;  4EWC A;  5KYW A;  1CPR A;  4NCQ A;  4Q7C A;  4XPY A;  2PBE A;  2PNO A;  2J46 A;  2R7T A;  2J9V A;  3K33 A;  3ECS A;  1Q0D A;  3ABK C;  3EH2 A;  3T6J A;  1LE4 A;  2P6V A;  2J7P A;  5FZT A;  4YWQ A;  3T6B A;  1JOG A;  1RKE B;  1TKN A;  3FDQ A;  1A7E A;  1WOL A;  1JAF A;  3MYI A;  4E17 A;  1IZM A;  1ORS C;  2L9J A;  1QQ3 A;  3LS1 A;  3C8G B;  5DS5 A;  1CGO A;  4MVQ A;  3UR3 C;  2HMQ A;  1Z7Q c;  1VB5 A;  2QLA A;  1B68 A;  4Q4Z F;  4CS8 A;  2R7W A;  2J9B A;  4RD9 A;  2W9Y A;  4DRJ B;  1UFB A;  1BZ4 A;  1YVI A;  3DE9 A;  5F28 E;  1YAR O;  2Y3G A;  5KYN A;  3SXK A;  1TR2 A;  1O87 A;  3FHD A;  3NMK A;  1MMA A;  3IQ6 A;  3RQG A;  3S28 A;  1APC A;  4YT8 A;  2P61 A;  1MMD A;  1VLS A;  4B6I A;  4YN0 B;  2DI3 A;  3VF0 A;  4PAC A;  1LS4 A;  5AC4 A;  4PK4 A;  5EGY A;  2I8B A;  3QMK A;  1W2W A;  3HLZ A;  5JS5 A;  1EQ1 A;  4AK9 A;  3NMI A;  4U5D E;  3TK0 A;  2B0J A;  2AWY A;  4BJ6 A;  5F5H A;  4YJW A;  4CDA A;  1JRA A;  1TWC A;  2OEX A;  2QY9 A;  3AG2 C;  3B71 A;  4O7G A;  3JSZ A;  3FOO A;  5CIV A;  3HNK A;  1FNT c;  1CGM E;  4G7O F;  2PP4 A;  1Y4C A;  3C8G D;  3LNR A;  1YZA A;  1HY5 A;  2RD9 A;  3NYJ A;  2R7O A;  3FAJ A;  3L8I A;  3QZC A;  4LAC B;  4DBR A;  3ASN C;  4P6I C;  1D0Z A;  4A2N B;  3Q6M A;  1VLT A;  1MND A;  2OQM A;  2ZXP A;  1TWG A;  2XLE A;  3DWW A;  3X2Q C;  2EPM X;  1YYJ A;  1OW6 A;  2WL8 A;  5L0C A;  4YL3 A;  1YAU O;  1YZC A;  2LIG A;  2XLV A;  3JCU Q;  3KMI A;  3H2V A;  3VAY A;  1H6G A;  4D4N A;  4DBQ A;  1H9G A;  3DAF A;  3RVY A;  3TOM A;  5L0D A;  4N06 A;  4XTK A;  2YEV A;  3VRC A;  4D4X A;  2Y3D A;  2RSE B;  3F47 A;  1OKK D;  4CS9 C;  4AE4 B;  1G4W R;  2XL4 A;  3O39 A;  1EA8 A;  1XZQ A;  1SF8 A;  1U0B B;  4MVM A;  4EBB A;  2OEV A;  3S0X A;  2HJM A;  3N24 A;  4IAO A;  2J45 A;  1LI7 A;  2CYD A;  1D1A A;  2AVK A;  4CX9 A;  2D4U A;  2HV7 A;  3H2U A;  4BJ1 A;  1PD1 A;  2UUI A;  3B29 A;  1YA7 O;  5F5F A;  1I4Y A;  1Z5Z A;  3FMS A;  1VYK A;  2UUH A;  1WGW A;  2YRF A;  1Z23 A;  2HMZ A;  3AJM A;  3I4U A;  1ZW3 A;  2XSE A;  4EBJ A;  3K7D A;  4DXW A;  3QTH A;  5JT4 A;  2W4B A;  1EI7 A;  2L81 A;  2P1A A;  2WZG A;  2WZF A;  1NBB A;  2CCY A;  4EUK B;  1D0X A;  2G62 A;  1O3U A;  3VM6 A;  4DVZ A;  1OR3 A;  1DOW A;  3EZI A;  3IPM O;  2HUJ A;  4IB4 A;  3W2V A;  2MHR A;  2LK4 A;  2HZ8 A;  2A0U A;  2OKU A;  4XLP F;  1VMA A;  1C03 A;  2XLM A;  3M1C B;  1M2V B;  3Q7G A;  2YLG A;  3L8J A;  4WAB A;  1A7V A;  4WGY A;  3L34 A;  2J8W A;  2KK1 A;  2LCH A;  3PMR A;  5COF A;  2OOC A;  4JUR I;  3U5S A;  4DVY P;  1LIH A;  3EQL F;  5DQT A;  3K66 A;  4CSA C;  3AG3 C;  2W45 A;  1K40 A;  4N6C A;  4WGZ A;  2L6H A;  3U8P A;  4DRH B;  1OR2 A;  1RKE A;  1TFO B;  2IM8 A;  1BDJ B;  1ZHZ A;  5D91 A;  3HNI A;  3O10 A;  5HSW A;  2H7V C;  4WJ0 A;  1UG7 A;  2AP3 A;  3FXH A;  1M2O A;  3C8G A;  3W4Y A;  2CNW A;  2W4M A;  3C63 A;  4JIO A;  2Q3T A;  3IHU A;  3KYJ A;  3ZSU A;  4ULV A;  2PF4 E;  2XLO A;  1YLM A;  2OJE D;  3EPV A;  1G4U S;  4JEA A;  3TJ6 A;  3ZC4 A;  2TMV P;  1OCO C;  5KYX B;  1Y6D A;  1T6Q A;  2Q9B A;  1OXK A;  4W8K A;  5KYY B;  1K04 A;  2LSE A;  2VCC A;  4IAQ A;  1ZW2 A;  1N1C A;  1PV3 A;  3S27 A;  5BQG A;  3SXZ A;  5DS4 A;  2V26 A;  4P9F A;  2DB4 A;  1IW7 F;  5DQZ A;  3M4B A;  3W8H A;  3O6X A;  1QLE C;  1OKK A;  2LFD A;  1YYX A;  4OIR F;  2CGE A;  3UMH A;  4KNW A;  2YHS A;  4HE8 D;  4JCH A;  1NZE A;  5GPG B;  3C18 A;  1TWH A;  4YT4 A;  4QDL A; 
#chains in the Genus database with same CATH homology
 3WAQ A;  4XPX A;  4XPW A;  4XPY A;  1I4Z A;  2MHR A;  2AWY A;  1HMD A;  3AGU A;  1A7E A;  2AVK A;  1HMO A;  2HMQ A;  3WHN A;  1I4Y A;  4XQ1 A;  2AWC A;  2HMZ A;  3AGT A;  1A7D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...