4XPWA

Crystal structures of leu114f mutant
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
131
structure length
131
Chain Sequence
b'MALMTWTAAEFGTNVGFADDQHKTIFDMVNKLHDTAATGNRSEIGKQLDALIDYVVMHFKSEETEMQKKGYADFAAHKAEHDKLVGVCADLQKKFHAGEAEVNQDTTRFVRDWFVNHIPKVDKLYGPCLSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bacteriohemerythrin
publication title The bacteriohemerythrin from Methylococcus capsulatus (Bath): Crystal structures reveal that Leu114 regulates a water tunnel.
pubmed doi rcsb
molecule tags Oxygen binding protein
total genus 58
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2015-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01814 Hemerythrin Hemerythrin HHE cation binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.50 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Hemerythrin-like 4xpwA00
1A7EA 3AGTA 4XQ1A 2AVKA 1HMDA 3WHNA 3WAQA 2HMZA 2MHRA 1I4YA 1HMOA 4XPWA 2AWCA 1A7DA 2HMQA 4XPXA 2AWYA 3AGUA 1I4ZA 4XPYA
chains in the Genus database with same CATH superfamily
1ZU4A 5L0IA 3LS1A 4BEJA 1A7EA 1YJGA 4Q5SF 1XZPA 1VYKA 4MW3A 3GM2A 4N4WA 1RJ9B 3K1IA 2YRFA 2Q00A 3TOLA 1TWAA 3WHNA 3CEXA 4HE8D 5BQIA 1W2WA 1OR2A 2ICWG 1DOVA 1JPJA 5HV9A 1MMGA 1D1CA 1OW8A 5B3SC 2R7WA 1NU9C 4NC3A 2IXNA 3EHMA 3GORA 4K0DA 1OXKA 3OEOA 2PNOA 1OW6A 1QLEC 3BRJA 5FZTA 2NSFA 4YT2A 3RVZA 2XXAA 1TFOB 5A6AA 4CSAA 3RH3A 3CSKA 2W4BA 4MVRA 4C3DA 1VTMP 2LQGA 3I5QA 1RMVA 4PJNA 3C7JA 3DXJF 2Y3DA 4PJMA 3G4XA 5A6BA 3JT1A 3LEOA 3F47A 2HV6A 3TD7A 2H7VC 3DD7A 3VF0A 2C04A 3NRHA 3S28A 3S0XA 3S90A 1C17M 1T6UA 3HLZA 1OQCA 3ZQYA 4BJ1A 1LS1A 3ZTZA 3E70C 4O6MA 4WGZA 3QW0A 5GPGB 5AC4A 1I4YA 1EKYA 1VLTA 2LSEA 2D4UA 2YL7A 4GQHA 5KYUB 3N2ZB 5T3TA 4YT8A 3H65A 3RVYA 4CS7A 1ZHYA 1RXQA 2YLDA 3T4RA 1BR4A 1U6HA 1NU7D 1LM3B 4D4XA 1HE1A 1S05A 1V55C 2ASRA 3O10A 3SXMA 4DBRA 2XM4A 4NTAA 3RW0A 3QW1A 3IPMO 3AG3C 2J7PD 2EIKC 4KNVA 5KYWA 4XEFA 3B29A 3HNJA 1T9KA 2GA0A 3DWWA 4WJ0A 4NTFA 2FAPB 1FFTC 1VK5A 1R4TA 2IXOA 3NKEA 1WGWA 3NMJA 2WVQA 4J32B 3ZSUA 1OCCC 1E83A 3X1OA 5B1BC 3DAGA 2NG1A 3C62A 3NG1A 4MVUA 3KPHA 3L34A 4DVYP 5L0DA 3FHDA 1ORJA 3Q7GA 2VASA 1TKNA 2JPUA 2ZD9A 3C8GD 2L7AA 3ATPA 3ZG1A 1ZYRF 3DZAA 4LACB 2TMVP 2KGOA 5E2QA 2MWQA 1G4WR 1IW7F 2I8BA 3AQBA 256BA 3KH2A 4MVSA 1Q0KA 3H2UA 3O39A 4JE9A 1FFHA 2LIGA 1ZZPA 3NYMA 4KI2A 4JRZA 4MTOA 1TWGA 4OD4A 2EINC 4N6HA 5DS5A 4CIPA 1D0YA 1Z3IX 2KQ9A 4NY3A 3VM6A 3M1CB 3KL4A 3T6GB 3LNMB 3KYIA 4NQFA 2Q7RA 2XLEA 3AGTA 4EBKA 3IQTA 3LLIA 1VYIA 5T3WA 4YT4A 5CI9A 3AJMA 2BE5F 1LKXA 3S27A 5L0CA 2OU6A 1T6QA 3EG9A 3TQOA 3W8IA 1MMAA 2P7VA 2HMZA 3EH1A 4G0HA 4GEHA 4I3MA 4U5EE 5KYYA 3IQ5A 2B0HA 3B9QA 1SMYF 2J46A 2R02A 2Q3TA 2V26A 3UGPA 4CDVA 4PFPA 4G7HF 3UMKA 4U5GA 4P6IC 2QY9A 4DBQA 2IOQA 5JS5A 2EPLX 3ZVRA 2R7QA 1OW7A 1TWHA 3B0PA 3JTLO 5E3AA 3UMHA 2XL8A 4MVZA 2XL6A 3J06A 2HFIA 1A41A 2KSFA 2GAQA 3FXHA 2J9VA 2CNWA 4ULVA 4G7ZF 1FAPB 3MX3A 1G5ZA 3DMDA 2A68F 1Z6AA 2KW3C 3SYNA 2V3CC 2VB6A 1N1CA 4D4NA 5DVWA 3DI5A 3ECSA 1SYQA 3W4YA 1ZW2A 3C63A 3DE8A 4I1MA 1GS9A 2L81A 4JJGA 4LLEA 4CS9C 2BC5A 4JIOA 3ASOC 4C3EA 4RDAA 4IRUA 4MW8A 1OR3A 4DRHB 4EWCA 4YJWA 2JX0A 5F5HA 2P61A 2XXAB 3V7OA 1QVXA 2BL2A 3EZIA 3HJCA 4XLPF 3TOMA 5EK0A 4DRJB 1XWJA 2ZPAA 5JUAA 3FOPA 3Q6MA 4MS2A 1O5HA 1K04A 1C03A 2LP4A 3HTKC 4HFKB 3OWTA 1JMWA 3U9MA 2W45A 2P1AA 5DLJA 4U5FE 3SP1A 1JAFA 4CJGA 2VC9A 1EA8A 3LNRA 2CDQA 4O6NA 1MMNA 1V54C 4ANJA 2GDCA 4A2NB 2HJ3A 2YLGA 3T6BA 5FCLA 1WWPA 1YARO 1NBBA 2QLAA 3ASNC 5COMA 4YL3A 4AL1A 4A4AA 2Q9CA 3DKAA 3NMKA 1NSGB 1OCOC 4OIRF 4CBEA 4Q4ZF 2LFFA 5KYWB 1O3UA 1G4US 3M15A 3RF3A 3RQEA 3CZ6A 3GWLA 3UGOA 2HMQA 1ZU5A 2AU5A 3U3FA 1JPNA 3GM1A 1H9TA 4UDVA 1SZIA 3QTHA 3EGXA 3WG7C 4NCQA 1GM5A 3JZ0A 1LE4A 5T1DB 2Q4FA 4CJOA 4ER9A 2IBFA 5AC5A 1FMWA 3L8IA 3U2MA 4CS8C 2J45A 2VCBA 2J9WA 2YL1A 4EUKB 1HMDA 4Z9HA 2EPOA 4MNDA 1ZW3A 4O79A 2Y3BA 1CGOA 2I15A 1FR0A 2A6EF 2XM0A 3EQLF 3Q7LA 2VCCA 3EZHA 1QSPA 1E2XA 2CCYA 1D0XA 2A6HF 1YLMA 2J0WA 1Q0MA 1SR2A 2YWAA 2KYHA 1YDIA 2CGEA 2PP4A 1D0ZA 1D1AA 3CAXA 4O6YA 3TK0A 4AX2A 3U2LA 3PHF2 3QVYA 2R7RA 2CW0F 3IEEA 2A0BA 4H54A 4U5DE 4OINF 2J0XA 3PCVA 1TQGA 2H7BA 3EG9B 2R7VA 5KYYB 1AVOB 3ITFA 1M2VA 2OEVA 4EIYA 4PJJA 2DYSC 5A6BD 1U0BB 4ZLDA 1AEPA 4K7BA 4U5BE 4YL1A 1AUEA 5JVEA 4MQ9F 3RQFA 5L0JA 3ZWIA 2AVKA 1BR1A 4MVQA 3VRCA 2YEVA 4JC7A 3NDBB 2Y3HA 1QPUA 5DQTA 4BJTA 3M4CA 4BPMA 2NPUA 3MBGA 3JRTA 4E0IA 1RKEA 3UMIA 4LLCA 3JYYA 1HY5A 2PBEA 4LDQA 1LVKA 4QI0A 3X2QC 3ZTMA 4PFOA 4XPWA 2EPKX 5BUOA 5EGYA 4R32A 1YVIA 4FX5A 3V5XA 3DE9A 1WASA 2RD9A 1FNTc 2EILC 3MFNA 5L0GA 3B71A 1CPRA 3T9OA 4LDKA 3V5YA 1I4ZA 3KKBA 2W9YA 4C3BA 1MNDA 1E86A 2YL3A 2HSQA 3H2VA 2DB4A 1PV3A 2ZXRA 3A9CA 1IZMA 4P9FA 3VYWA 2B0JA 2IXPA 3C18A 3US6A 4IAQA 3KYJA 5E3CA 3GODA 4W8KA 1BBHA 3WAQA 1YA7O 4LERA 4JCHA 3TJ6A 4F4BA 1D1BA 4IGGA 4Z9JA 1HMOA 3R7CA 2XLOA 1RKCA 2XS8A 2YZSA 3HNKA 2WZGA 4BJ6C 3PDMP 3B0UX 3RIPA 3W2WA 3AQCA 2PX3A 1HW1A 4KNWA 4LDRA 3DJUB 4CDYA 2E87A 5D92A 1PCXA 2M4EA 3NKDA 4JJFA 3MYFA 4CIHA 4CS9A 3M79A 1H9GA 3RKOF 4P9TA 4IWBA 3ABKC 1QQ3A 2KNHA 3GEIA 5CI8A 4AE4A 5HSWA 4YN0B 2GFHA 3EFOA 4IAOA 2X51A 3EGDA 2UUHA 1JR8A 1T01A 2R7OA 1PD1A 3PMRA 2Y39A 4JTCB 1TFKB 1JOGA 3DJNB 2QNLA 3DM5A 1VOMA 2P0NA 2Q9BA 2ZXOA 1YA9A 3G50A 3ZDLA 5DQZA 4U9EA 2R7TA 4M63A 2YHSA 3QVZA 4G7OF 3NMIA 2Y69C 3EGXB 3FVYA 3LS0A 4KC9A 4ONSA 3S9OA 3S29A 3SZRA 1H6GA 4HFFB 4RD9A 3B0VC 1T5OA 2L6HA 2OEXA 2Y3GA 5KYXA 1LPEA 2KJGA 2QE9A 1APCA 2NUPA 4BG0A 4FESA 4BJ5C 1WN0A 3K1HA 2XSEA 4EBBA 3RQGA 2FFHA 4U5CE 4PJLA 2G62A 5COGA 2R03A 4YWQA 2A69F 3C8ZA 1NG1A 3L0IA 4JEAA 1F1MA 3A11A 3JSZA 2GWWA 2A0UA 2O9XA 4H4KC 4XEVA 1Z7Qc 4W8PA 1J8YF 4EHPA 1CGNA 1PD0A 1QKRA 3N0TA 2HS5A 2NUTA 5EHHA 2OG2A 1K40A 4E7SA 5F28E 5L0FA 5JSLA 2AP3A 2OQMA 4OIOF 2XS1A 4PK4A 4O7GA 1YZCA 3W8HA 1XZQA 2CNWD 2J8WA 4C7OA 2DYRC 1M2VB 2HKVA 2J9BA 4PR9A 3U8VA 3IHUA 3ZQVA 1UFBA 3OA1A 4CS8A 1C02A 1ZHWA 1Z23A 1BDJB 1M57C 2W4MA 2WVNA 3FMSA 3GEHA 3IQCA 3ZC4A 1A0BA 4K1OA 2WB7A 4XTKA 1HW2A 4XWJA 4J30B 3GEEA 3HNLA 1SF8A 2YVKA 4XEKA 2R05A 3K6BA 1GGQA 2X0CA 3FDQA 1J8MF 1RKEB 1KNYA 2IYLD 2J7PA 4E18A 2H8AA 3JSEO 4WGYA 2EIJC 2KC3A 1ST6A 2PX0A 2XRHA 2YLIA 1OKKD 3EHNA 4FWVA 5L0HA 4J7YA 4OIQF 3U3BA 1FTSA 4DRIB 1RCPA 1ZHXA 1YYXA 4JURI 3U9JA 2MYSA 3F46A 5CIVA 4JZAA 5BQGA 2G3KA 1OCRC 1NLXA 4JKVA 2R7XA 4JCZA 1UG7A 1BR2A 1U89A 2AWCA 4GYTA 2VCAA 3K1IC 5F5FA 3C8GA 1EQ1A 2IXMA 1NFNA 2RSEB 2WVOA 3LEVA 3U8PA 4G78A 4MVOA 2LD6A 1E85A 1VLSA 3L1MA 3O55A 3QZCA 3T6JA 5L3QA 1VMAA 3U0CA 1TWCA 2JD3A 2L6FA 5E33A 3I5PA 1E84A 1HE9A 1A7VA 1L7CA 1M2OA 2FGYA 1OCZC 3UNGC 3CQZA 3LJBA 1QZXA 2HV7A 4CSAC 2R25A 4DVZA 3UR3C 2EPNA 1LS4A 1KTMA 3AG4C 3AOUA 4RBNA 5B3IA 5JRAA 3SEOA 3S84A 3HNIA 1DOWA 3Q6NA 3TJ5A 5JT4A 2IM8A 3AG1C 3MYIA 4DOZA 3LESA 5A6JA 1CPQA 1ORSC 1RJ9A 2H7OA 3DAFA 3O6XA 3EPVA 4OIPF 1B68A 1BZ4A 1LE2A 4L6RA 2EPMX 4JTDB 3SXKA 4AE4B 4XPXA 2F22A 5AGFA 2LCHA 4AL0A 2CYDA 2OJQA 3EFOB 1NFOA 3EGDB 3SNHA 1G8XA 2G3VA 1KU2A 3IQ6A 3W2VA 2OCCC 1CGME 2C03A 2UUIA 1ZVZA 1S7ZA 2OOCA 4YK5A 2NSGA 4XQ1A 2LK4A 2OKUA 4NTBA 2XLMA 1Y6DA 4IB4A 2XLHA 3FAPB 2PF4E 4B6IA 5BQHA 5L3VA 3DM9B 4BJ6A 5DS6A 3ABLC 4YL0A 4Z9IA 4CX9A 1OXBA 5K0IA 3POVA 2MHRA 5KYXB 3G4ZA 2NUPB 1NZEA 3K7DA 4X0RA 4J7TA 1YZAA 3EH2A 1V74B 2J9UA 4XLNF 4MVMA 1GQAA 3ZIBA 3HKKA 1I5NA 2YKZA 3JCUQ 3WODF 2R7UA 3JYHA 1A7DA 3NYJA 2LFDA 2WZLA 1YAUO 2AWYA 2HUJA 2M64A 4E0HA 1LIHA 3AGUA 3U5SA 4I1OB 3MLGA 4U9DA 1Q0FA 2Q9AA 5D91A 1LI5A 5KYUA 3RFYA 2NUTB 3LUTB 2KK1A 3SXZA 2XLDA 1VB5A 1WATA 4IJJA 4AK9A 1Q0DA 1V4AA 3N24A 1Q0GA 4DXWA 5IY5C 3GM3A 3ABMC 3NYLA 5JLIA 1H7IA 2Z15A 5A6KA 2R9RB 3K33A 4C7OB 4EBJA 2XLVA 3GANA 1ZHZA 4IARA 2QUPA 1M6TA 4MTFA 2YL0A 1Y4CA 4BJ5A 2ZXWC 2L6GA 3JRMO 4N6CA 4FAPB 1Z63A 4JTAB 5TJ5E 4I44A 3RYLA 1R5ID 3E9VA 3FAJA 1WTYA 3FOOA 4BEMJ 4WABA 4OD5A 3V5ZA 1JRAA 2EIMC 3VAYA 5KYNA 3KMIA 1T6IA 3I4UA 4PACA 3R2PA 1EI7A 1K05A 1Z5ZA 1WOLA 3L8JA 4JW1A 1M56C 2HSBA 4JVSA 5DS4A 5A69A 2A1DD 1MQVA 2WZFA 2QTVA 2PFDA 2YQYA 2HZ8A 3M4BA 2P6VA 1YYJA 2L9JA 4MTGA 4U5HA 1MNEA 5JP7A 4CDAA 2VH3A 3C8GB 3K66A 2R7SA 1OKKA 3LAYA 2ZXPA 1MMDA 1ZHTA 3QMKA 4QI2A 2D5RB 5COFA 3AG2C 4Q7CA 3SXYA 3LLKA 4E7ZA 3EJNA 5B1AC 4DJ9A 4N06A 1LI7A 2DI3A 4ULWA 1O87A 2XL4A 2XLWA 4HEAJ 4JEBA 2DGJA 4ZLCA 2HJMA 4KBLA 1L3PA 4YT5A 3GWNA 1TR2A 4QDLA 4E17A 2ETSA 1FMVA 1ORYA 2OJED 3TULA 3BEHA 4EKWA 2WL8A 4XPYA
chains in the Genus database with same CATH topology
1A7EA 3AGTA 4XQ1A 2AVKA 1HMDA 3WHNA 3WAQA 2HMZA 2MHRA 1I4YA 1HMOA 4XPWA 2AWCA 1A7DA 2HMQA 4XPXA 2AWYA 3AGUA 1I4ZA 4XPYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A7E A;  3AGT A;  4XQ1 A;  2AVK A;  1HMD A;  3WHN A;  3WAQ A;  2HMZ A;  2MHR A;  1I4Y A;  1HMO A;  4XPW A;  2AWC A;  1A7D A;  2HMQ A;  4XPX A;  2AWY A;  3AGU A;  1I4Z A;  4XPY A; 
#chains in the Genus database with same CATH topology
 1ZU4 A;  5L0I A;  3LS1 A;  4BEJ A;  1A7E A;  1YJG A;  4Q5S F;  1XZP A;  1VYK A;  4MW3 A;  3GM2 A;  4N4W A;  1RJ9 B;  3K1I A;  2YRF A;  2Q00 A;  3TOL A;  1TWA A;  3WHN A;  3CEX A;  4HE8 D;  5BQI A;  1W2W A;  1OR2 A;  2ICW G;  1DOV A;  1JPJ A;  5HV9 A;  1MMG A;  1D1C A;  1OW8 A;  5B3S C;  2R7W A;  1NU9 C;  4NC3 A;  2IXN A;  3EHM A;  3GOR A;  4K0D A;  1OXK A;  3OEO A;  2PNO A;  1OW6 A;  1QLE C;  3BRJ A;  5FZT A;  2NSF A;  4YT2 A;  3RVZ A;  2XXA A;  1TFO B;  5A6A A;  4CSA A;  3RH3 A;  3CSK A;  2W4B A;  4MVR A;  4C3D A;  1VTM P;  2LQG A;  3I5Q A;  1RMV A;  4PJN A;  3C7J A;  3DXJ F;  2Y3D A;  4PJM A;  3G4X A;  5A6B A;  3JT1 A;  3LEO A;  3F47 A;  2HV6 A;  3TD7 A;  2H7V C;  3DD7 A;  3VF0 A;  2C04 A;  3NRH A;  3S28 A;  3S0X A;  3S90 A;  1C17 M;  1T6U A;  3HLZ A;  1OQC A;  3ZQY A;  4BJ1 A;  1LS1 A;  3ZTZ A;  3E70 C;  4O6M A;  4WGZ A;  3QW0 A;  5GPG B;  5AC4 A;  1I4Y A;  1EKY A;  1VLT A;  2LSE A;  2D4U A;  2YL7 A;  4GQH A;  5KYU B;  3N2Z B;  5T3T A;  4YT8 A;  3H65 A;  3RVY A;  4CS7 A;  1ZHY A;  1RXQ A;  2YLD A;  3T4R A;  1BR4 A;  1U6H A;  1NU7 D;  1LM3 B;  4D4X A;  1HE1 A;  1S05 A;  1V55 C;  2ASR A;  3O10 A;  3SXM A;  4DBR A;  2XM4 A;  4NTA A;  3RW0 A;  3QW1 A;  3IPM O;  3AG3 C;  2J7P D;  2EIK C;  4KNV A;  5KYW A;  4XEF A;  3B29 A;  3HNJ A;  1T9K A;  2GA0 A;  3DWW A;  4WJ0 A;  4NTF A;  2FAP B;  1FFT C;  1VK5 A;  1R4T A;  2IXO A;  3NKE A;  1WGW A;  3NMJ A;  2WVQ A;  4J32 B;  3ZSU A;  1OCC C;  1E83 A;  3X1O A;  5B1B C;  3DAG A;  2NG1 A;  3C62 A;  3NG1 A;  4MVU A;  3KPH A;  3L34 A;  4DVY P;  5L0D A;  3FHD A;  1ORJ A;  3Q7G A;  2VAS A;  1TKN A;  2JPU A;  2ZD9 A;  3C8G D;  2L7A A;  3ATP A;  3ZG1 A;  1ZYR F;  3DZA A;  4LAC B;  2TMV P;  2KGO A;  5E2Q A;  2MWQ A;  1G4W R;  1IW7 F;  2I8B A;  3AQB A;  256B A;  3KH2 A;  4MVS A;  1Q0K A;  3H2U A;  3O39 A;  4JE9 A;  1FFH A;  2LIG A;  1ZZP A;  3NYM A;  4KI2 A;  4JRZ A;  4MTO A;  1TWG A;  4OD4 A;  2EIN C;  4N6H A;  5DS5 A;  4CIP A;  1D0Y A;  1Z3I X;  2KQ9 A;  4NY3 A;  3VM6 A;  3M1C B;  3KL4 A;  3T6G B;  3LNM B;  3KYI A;  4NQF A;  2Q7R A;  2XLE A;  3AGT A;  4EBK A;  3IQT A;  3LLI A;  1VYI A;  5T3W A;  4YT4 A;  5CI9 A;  3AJM A;  2BE5 F;  1LKX A;  3S27 A;  5L0C A;  2OU6 A;  1T6Q A;  3EG9 A;  3TQO A;  3W8I A;  1MMA A;  2P7V A;  2HMZ A;  3EH1 A;  4G0H A;  4GEH A;  4I3M A;  4U5E E;  5KYY A;  3IQ5 A;  2B0H A;  3B9Q A;  1SMY F;  2J46 A;  2R02 A;  2Q3T A;  2V26 A;  3UGP A;  4CDV A;  4PFP A;  4G7H F;  3UMK A;  4U5G A;  4P6I C;  2QY9 A;  4DBQ A;  2IOQ A;  5JS5 A;  2EPL X;  3ZVR A;  2R7Q A;  1OW7 A;  1TWH A;  3B0P A;  3JTL O;  5E3A A;  3UMH A;  2XL8 A;  4MVZ A;  2XL6 A;  3J06 A;  2HFI A;  1A41 A;  2KSF A;  2GAQ A;  3FXH A;  2J9V A;  2CNW A;  4ULV A;  4G7Z F;  1FAP B;  3MX3 A;  1G5Z A;  3DMD A;  2A68 F;  1Z6A A;  2KW3 C;  3SYN A;  2V3C C;  2VB6 A;  1N1C A;  4D4N A;  5DVW A;  3DI5 A;  3ECS A;  1SYQ A;  3W4Y A;  1ZW2 A;  3C63 A;  3DE8 A;  4I1M A;  1GS9 A;  2L81 A;  4JJG A;  4LLE A;  4CS9 C;  2BC5 A;  4JIO A;  3ASO C;  4C3E A;  4RDA A;  4IRU A;  4MW8 A;  1OR3 A;  4DRH B;  4EWC A;  4YJW A;  2JX0 A;  5F5H A;  2P61 A;  2XXA B;  3V7O A;  1QVX A;  2BL2 A;  3EZI A;  3HJC A;  4XLP F;  3TOM A;  5EK0 A;  4DRJ B;  1XWJ A;  2ZPA A;  5JUA A;  3FOP A;  3Q6M A;  4MS2 A;  1O5H A;  1K04 A;  1C03 A;  2LP4 A;  3HTK C;  4HFK B;  3OWT A;  1JMW A;  3U9M A;  2W45 A;  2P1A A;  5DLJ A;  4U5F E;  3SP1 A;  1JAF A;  4CJG A;  2VC9 A;  1EA8 A;  3LNR A;  2CDQ A;  4O6N A;  1MMN A;  1V54 C;  4ANJ A;  2GDC A;  4A2N B;  2HJ3 A;  2YLG A;  3T6B A;  5FCL A;  1WWP A;  1YAR O;  1NBB A;  2QLA A;  3ASN C;  5COM A;  4YL3 A;  4AL1 A;  4A4A A;  2Q9C A;  3DKA A;  3NMK A;  1NSG B;  1OCO C;  4OIR F;  4CBE A;  4Q4Z F;  2LFF A;  5KYW B;  1O3U A;  1G4U S;  3M15 A;  3RF3 A;  3RQE A;  3CZ6 A;  3GWL A;  3UGO A;  2HMQ A;  1ZU5 A;  2AU5 A;  3U3F A;  1JPN A;  3GM1 A;  1H9T A;  4UDV A;  1SZI A;  3QTH A;  3EGX A;  3WG7 C;  4NCQ A;  1GM5 A;  3JZ0 A;  1LE4 A;  5T1D B;  2Q4F A;  4CJO A;  4ER9 A;  2IBF A;  5AC5 A;  1FMW A;  3L8I A;  3U2M A;  4CS8 C;  2J45 A;  2VCB A;  2J9W A;  2YL1 A;  4EUK B;  1HMD A;  4Z9H A;  2EPO A;  4MND A;  1ZW3 A;  4O79 A;  2Y3B A;  1CGO A;  2I15 A;  1FR0 A;  2A6E F;  2XM0 A;  3EQL F;  3Q7L A;  2VCC A;  3EZH A;  1QSP A;  1E2X A;  2CCY A;  1D0X A;  2A6H F;  1YLM A;  2J0W A;  1Q0M A;  1SR2 A;  2YWA A;  2KYH A;  1YDI A;  2CGE A;  2PP4 A;  1D0Z A;  1D1A A;  3CAX A;  4O6Y A;  3TK0 A;  4AX2 A;  3U2L A;  3PHF 2;  3QVY A;  2R7R A;  2CW0 F;  3IEE A;  2A0B A;  4H54 A;  4U5D E;  4OIN F;  2J0X A;  3PCV A;  1TQG A;  2H7B A;  3EG9 B;  2R7V A;  5KYY B;  1AVO B;  3ITF A;  1M2V A;  2OEV A;  4EIY A;  4PJJ A;  2DYS C;  5A6B D;  1U0B B;  4ZLD A;  1AEP A;  4K7B A;  4U5B E;  4YL1 A;  1AUE A;  5JVE A;  4MQ9 F;  3RQF A;  5L0J A;  3ZWI A;  2AVK A;  1BR1 A;  4MVQ A;  3VRC A;  2YEV A;  4JC7 A;  3NDB B;  2Y3H A;  1QPU A;  5DQT A;  4BJT A;  3M4C A;  4BPM A;  2NPU A;  3MBG A;  3JRT A;  4E0I A;  1RKE A;  3UMI A;  4LLC A;  3JYY A;  1HY5 A;  2PBE A;  4LDQ A;  1LVK A;  4QI0 A;  3X2Q C;  3ZTM A;  4PFO A;  4XPW A;  2EPK X;  5BUO A;  5EGY A;  4R32 A;  1YVI A;  4FX5 A;  3V5X A;  3DE9 A;  1WAS A;  2RD9 A;  1FNT c;  2EIL C;  3MFN A;  5L0G A;  3B71 A;  1CPR A;  3T9O A;  4LDK A;  3V5Y A;  1I4Z A;  3KKB A;  2W9Y A;  4C3B A;  1MND A;  1E86 A;  2YL3 A;  2HSQ A;  3H2V A;  2DB4 A;  1PV3 A;  2ZXR A;  3A9C A;  1IZM A;  4P9F A;  3VYW A;  2B0J A;  2IXP A;  3C18 A;  3US6 A;  4IAQ A;  3KYJ A;  5E3C A;  3GOD A;  4W8K A;  1BBH A;  3WAQ A;  1YA7 O;  4LER A;  4JCH A;  3TJ6 A;  4F4B A;  1D1B A;  4IGG A;  4Z9J A;  1HMO A;  3R7C A;  2XLO A;  1RKC A;  2XS8 A;  2YZS A;  3HNK A;  2WZG A;  4BJ6 C;  3PDM P;  3B0U X;  3RIP A;  3W2W A;  3AQC A;  2PX3 A;  1HW1 A;  4KNW A;  4LDR A;  3DJU B;  4CDY A;  2E87 A;  5D92 A;  1PCX A;  2M4E A;  3NKD A;  4JJF A;  3MYF A;  4CIH A;  4CS9 A;  3M79 A;  1H9G A;  3RKO F;  4P9T A;  4IWB A;  3ABK C;  1QQ3 A;  2KNH A;  3GEI A;  5CI8 A;  4AE4 A;  5HSW A;  4YN0 B;  2GFH A;  3EFO A;  4IAO A;  2X51 A;  3EGD A;  2UUH A;  1JR8 A;  1T01 A;  2R7O A;  1PD1 A;  3PMR A;  2Y39 A;  4JTC B;  1TFK B;  1JOG A;  3DJN B;  2QNL A;  3DM5 A;  1VOM A;  2P0N A;  2Q9B A;  2ZXO A;  1YA9 A;  3G50 A;  3ZDL A;  5DQZ A;  4U9E A;  2R7T A;  4M63 A;  2YHS A;  3QVZ A;  4G7O F;  3NMI A;  2Y69 C;  3EGX B;  3FVY A;  3LS0 A;  4KC9 A;  4ONS A;  3S9O A;  3S29 A;  3SZR A;  1H6G A;  4HFF B;  4RD9 A;  3B0V C;  1T5O A;  2L6H A;  2OEX A;  2Y3G A;  5KYX A;  1LPE A;  2KJG A;  2QE9 A;  1APC A;  2NUP A;  4BG0 A;  4FES A;  4BJ5 C;  1WN0 A;  3K1H A;  2XSE A;  4EBB A;  3RQG A;  2FFH A;  4U5C E;  4PJL A;  2G62 A;  5COG A;  2R03 A;  4YWQ A;  2A69 F;  3C8Z A;  1NG1 A;  3L0I A;  4JEA A;  1F1M A;  3A11 A;  3JSZ A;  2GWW A;  2A0U A;  2O9X A;  4H4K C;  4XEV A;  1Z7Q c;  4W8P A;  1J8Y F;  4EHP A;  1CGN A;  1PD0 A;  1QKR A;  3N0T A;  2HS5 A;  2NUT A;  5EHH A;  2OG2 A;  1K40 A;  4E7S A;  5F28 E;  5L0F A;  5JSL A;  2AP3 A;  2OQM A;  4OIO F;  2XS1 A;  4PK4 A;  4O7G A;  1YZC A;  3W8H A;  1XZQ A;  2CNW D;  2J8W A;  4C7O A;  2DYR C;  1M2V B;  2HKV A;  2J9B A;  4PR9 A;  3U8V A;  3IHU A;  3ZQV A;  1UFB A;  3OA1 A;  4CS8 A;  1C02 A;  1ZHW A;  1Z23 A;  1BDJ B;  1M57 C;  2W4M A;  2WVN A;  3FMS A;  3GEH A;  3IQC A;  3ZC4 A;  1A0B A;  4K1O A;  2WB7 A;  4XTK A;  1HW2 A;  4XWJ A;  4J30 B;  3GEE A;  3HNL A;  1SF8 A;  2YVK A;  4XEK A;  2R05 A;  3K6B A;  1GGQ A;  2X0C A;  3FDQ A;  1J8M F;  1RKE B;  1KNY A;  2IYL D;  2J7P A;  4E18 A;  2H8A A;  3JSE O;  4WGY A;  2EIJ C;  2KC3 A;  1ST6 A;  2PX0 A;  2XRH A;  2YLI A;  1OKK D;  3EHN A;  4FWV A;  5L0H A;  4J7Y A;  4OIQ F;  3U3B A;  1FTS A;  4DRI B;  1RCP A;  1ZHX A;  1YYX A;  4JUR I;  3U9J A;  2MYS A;  3F46 A;  5CIV A;  4JZA A;  5BQG A;  2G3K A;  1OCR C;  1NLX A;  4JKV A;  2R7X A;  4JCZ A;  1UG7 A;  1BR2 A;  1U89 A;  2AWC A;  4GYT A;  2VCA A;  3K1I C;  5F5F A;  3C8G A;  1EQ1 A;  2IXM A;  1NFN A;  2RSE B;  2WVO A;  3LEV A;  3U8P A;  4G78 A;  4MVO A;  2LD6 A;  1E85 A;  1VLS A;  3L1M A;  3O55 A;  3QZC A;  3T6J A;  5L3Q A;  1VMA A;  3U0C A;  1TWC A;  2JD3 A;  2L6F A;  5E33 A;  3I5P A;  1E84 A;  1HE9 A;  1A7V A;  1L7C A;  1M2O A;  2FGY A;  1OCZ C;  3UNG C;  3CQZ A;  3LJB A;  1QZX A;  2HV7 A;  4CSA C;  2R25 A;  4DVZ A;  3UR3 C;  2EPN A;  1LS4 A;  1KTM A;  3AG4 C;  3AOU A;  4RBN A;  5B3I A;  5JRA A;  3SEO A;  3S84 A;  3HNI A;  1DOW A;  3Q6N A;  3TJ5 A;  5JT4 A;  2IM8 A;  3AG1 C;  3MYI A;  4DOZ A;  3LES A;  5A6J A;  1CPQ A;  1ORS C;  1RJ9 A;  2H7O A;  3DAF A;  3O6X A;  3EPV A;  4OIP F;  1B68 A;  1BZ4 A;  1LE2 A;  4L6R A;  2EPM X;  4JTD B;  3SXK A;  4AE4 B;  4XPX A;  2F22 A;  5AGF A;  2LCH A;  4AL0 A;  2CYD A;  2OJQ A;  3EFO B;  1NFO A;  3EGD B;  3SNH A;  1G8X A;  2G3V A;  1KU2 A;  3IQ6 A;  3W2V A;  2OCC C;  1CGM E;  2C03 A;  2UUI A;  1ZVZ A;  1S7Z A;  2OOC A;  4YK5 A;  2NSG A;  4XQ1 A;  2LK4 A;  2OKU A;  4NTB A;  2XLM A;  1Y6D A;  4IB4 A;  2XLH A;  3FAP B;  2PF4 E;  4B6I A;  5BQH A;  5L3V A;  3DM9 B;  4BJ6 A;  5DS6 A;  3ABL C;  4YL0 A;  4Z9I A;  4CX9 A;  1OXB A;  5K0I A;  3POV A;  2MHR A;  5KYX B;  3G4Z A;  2NUP B;  1NZE A;  3K7D A;  4X0R A;  4J7T A;  1YZA A;  3EH2 A;  1V74 B;  2J9U A;  4XLN F;  4MVM A;  1GQA A;  3ZIB A;  3HKK A;  1I5N A;  2YKZ A;  3JCU Q;  3WOD F;  2R7U A;  3JYH A;  1A7D A;  3NYJ A;  2LFD A;  2WZL A;  1YAU O;  2AWY A;  2HUJ A;  2M64 A;  4E0H A;  1LIH A;  3AGU A;  3U5S A;  4I1O B;  3MLG A;  4U9D A;  1Q0F A;  2Q9A A;  5D91 A;  1LI5 A;  5KYU A;  3RFY A;  2NUT B;  3LUT B;  2KK1 A;  3SXZ A;  2XLD A;  1VB5 A;  1WAT A;  4IJJ A;  4AK9 A;  1Q0D A;  1V4A A;  3N24 A;  1Q0G A;  4DXW A;  5IY5 C;  3GM3 A;  3ABM C;  3NYL A;  5JLI A;  1H7I A;  2Z15 A;  5A6K A;  2R9R B;  3K33 A;  4C7O B;  4EBJ A;  2XLV A;  3GAN A;  1ZHZ A;  4IAR A;  2QUP A;  1M6T A;  4MTF A;  2YL0 A;  1Y4C A;  4BJ5 A;  2ZXW C;  2L6G A;  3JRM O;  4N6C A;  4FAP B;  1Z63 A;  4JTA B;  5TJ5 E;  4I44 A;  3RYL A;  1R5I D;  3E9V A;  3FAJ A;  1WTY A;  3FOO A;  4BEM J;  4WAB A;  4OD5 A;  3V5Z A;  1JRA A;  2EIM C;  3VAY A;  5KYN A;  3KMI A;  1T6I A;  3I4U A;  4PAC A;  3R2P A;  1EI7 A;  1K05 A;  1Z5Z A;  1WOL A;  3L8J A;  4JW1 A;  1M56 C;  2HSB A;  4JVS A;  5DS4 A;  5A69 A;  2A1D D;  1MQV A;  2WZF A;  2QTV A;  2PFD A;  2YQY A;  2HZ8 A;  3M4B A;  2P6V A;  1YYJ A;  2L9J A;  4MTG A;  4U5H A;  1MNE A;  5JP7 A;  4CDA A;  2VH3 A;  3C8G B;  3K66 A;  2R7S A;  1OKK A;  3LAY A;  2ZXP A;  1MMD A;  1ZHT A;  3QMK A;  4QI2 A;  2D5R B;  5COF A;  3AG2 C;  4Q7C A;  3SXY A;  3LLK A;  4E7Z A;  3EJN A;  5B1A C;  4DJ9 A;  4N06 A;  1LI7 A;  2DI3 A;  4ULW A;  1O87 A;  2XL4 A;  2XLW A;  4HEA J;  4JEB A;  2DGJ A;  4ZLC A;  2HJM A;  4KBL A;  1L3P A;  4YT5 A;  3GWN A;  1TR2 A;  4QDL A;  4E17 A;  2ETS A;  1FMV A;  1ORY A;  2OJE D;  3TUL A;  3BEH A;  4EKW A;  2WL8 A;  4XPY A; 
#chains in the Genus database with same CATH homology
 1A7E A;  3AGT A;  4XQ1 A;  2AVK A;  1HMD A;  3WHN A;  3WAQ A;  2HMZ A;  2MHR A;  1I4Y A;  1HMO A;  4XPW A;  2AWC A;  1A7D A;  2HMQ A;  4XPX A;  2AWY A;  3AGU A;  1I4Z A;  4XPY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...