4U5DE

Crystal structure of glua2, con-ikot-ikot snail toxin, partial agonist ka and postitive modulator (r,r)-2b complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
85
structure length
85
Chain Sequence
GPADCCRMKECCTDRVNECLQRYSGREDKFVSFCYQEATVTCGSFNEIVGCCYGYQMCMIRVVKPNSLSGAHEACKTVSCGNPCA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein/toxin
molecule keywords Glutamate receptor 2
publication title X-ray structures of AMPA receptor-cone snail toxin complexes illuminate activation mechanism.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 25
structure length 85
sequence length 85
chains with identical sequence F
ec nomenclature
pdb deposition date 2014-07-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1800 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4u5dE00
4U5HA 4U5DE 4U5CE 4U5EE 4U5GA 4U5FE 4U5BE
chains in the Genus database with same CATH superfamily
2EPNA 1ZVZA 2J9BA 4MW8A 2KSFA 3U9MA 3T4RA 2DI3A 4NC3A 4Q4ZF 3FVYA 4IWBA 1ORYA 1TWGA 2R7XA 3EG9A 2IXPA 1CGOA 3SNHA 1HW1A 3EHMA 1Q0DA 1ZU5A 3IPMO 3N0TA 3RQGA 1JPJA 3ZG1A 5L3VA 3G4XA 5HSWA 2OCCC 3ZVRA 5A6KA 4BJ1A 3RW0A 3ABKC 1TFOB 3HTKC 5T3TA 4JJFA 2QUPA 1GS9A 3IQTA 2LP4A 3S28A 2DB4A 4ER9A 1E86A 2KYHA 1LE2A 3K6BA 3T9OA 1M6TA 1S7ZA 4K1OA 4U5EE 5KYUA 4AE4B 1Z63A 4DOZA 3LLKA 4CDYA 3B0PA 3GEEA 5KYXB 2Q9AA 3TJ5A 1DOWA 1JRAA 3ZC4A 4JCHA 1H9GA 1SMYF 3UMIA 1M57C 2WVNA 4CIPA 1TQGA 2ZPAA 3WAQA 3A9CA 3WODF 4DBQA 1I4ZA 1VTMP 3NRHA 2KK1A 2FAPB 1HE9A 1IZMA 3BRJA 3EGDB 4J7TA 5L0JA 2XXAB 1VB5A 2W4BA 3OEOA 2M64A 1SZIA 3C63A 2P1AA 3LJBA 4MVQA 2WL8A 3VF0A 3AG3C 2VASA 5DVWA 2KGOA 4EUKB 4A4AA 1YA9A 4MW3A 5EK0A 2Y69C 1TWHA 1PCXA 2ZD9A 4E7SA 3JSEO 3LAYA 2AWYA 1QQ3A 3K66A 2C04A 3V5YA 4DRIB 1HMDA 4F4BA 3EFOA 2X0CA 1LPEA 2Q00A 2W4MA 3VM6A 4P9TA 3W8HA 2CW0F 4OIQF 1C03A 3T6GB 3VYWA 3EZIA 1NZEA 3MBGA 3U3BA 5KYWA 1O87A 2EPOA 2XL4A 3NDBB 2H7OA 2IXNA 3CEXA 4KNWA 3LNMB 4XLNF 3UGOA 4C7OB 4U5DE 3DWWA 4XTKA 5D92A 1O5HA 2OJQA 3IQCA 5COFA 3UMKA 4O6NA 5KYYA 3PHF2 2NSFA 4CDAA 2ZXWC 2OJED 2NPUA 4JEBA 4J7YA 2O9XA 3U3FA 1WOLA 1Q0MA 5E33A 3S0XA 3RH3A 256BA 5B3SC 2GWWA 1ZHWA 2YLGA 2MYSA 2QNLA 3FMSA 1D1BA 3X1OA 3AG2C 3SXMA 3AGUA 1FMVA 1WGWA 1XWJA 1WASA 2EIKC 2J7PD 4C3DA 1E85A 2AVKA 1EI7A 2RSEB 3FHDA 1N1CA 3ZWIA 2UUHA 1MMNA 3FOPA 5JSLA 4JE9A 4CSAC 1FFTC 3TD7A 1OCZC 2YLIA 2XM4A 2HJ3A 1MNDA 3F46A 1RMVA 1M2OA 3JT1A 1FR0A 3VAYA 2HUJA 4H54A 3EG9B 4IARA 1JMWA 1QLEC 3GM1A 1NU9C 3RYLA 3ZQYA 1VYIA 3MYIA 3C8GD 4XEVA 3SXYA 1J8MF 1VLTA 2YHSA 3Q7GA 3AOUA 4WGZA 3DE9A 3E70C 4YL3A 4YJWA 1PD0A 4DXWA 2EIJC 4CS9A 4JRZA 5DLJA 2MWQA 4JZAA 3ZTMA 5A6JA 4N4WA 4L6RA 1V74B 4EBJA 3UR3C 1K04A 3AQBA 3Q6NA 3ZIBA 3K1IA 4G78A 2UUIA 4DJ9A 2R7WA 2OEVA 3L0IA 2R7SA 1VLSA 1YDIA 1R4TA 3EJNA 2OEXA 3LEOA 3M4CA 2J0XA 4Z9JA 4DVYP 3MYFA 1U89A 2P6VA 5KYUB 1E84A 2Q7RA 4YK5A 5L3QA 2Y3BA 4HFFB 1VYKA 2HMZA 1YVIA 2R7OA 5L0FA 1C02A 2AP3A 4XEKA 2IXOA 3GM2A 3O6XA 1NFOA 4LLCA 4D4XA 1U6HA 4E17A 4B6IA 2A1DD 3W2VA 4JKVA 2EILC 2G3KA 2GAQA 5B1AC 3QW0A 1UG7A 3A11A 2H7VC 2XS8A 4CS8A 3KMIA 5JVEA 2G3VA 2KJGA 2HMQA 3FAJA 3U5SA 4KNVA 2EIMC 1Z6AA 2W45A 3JYYA 2L6HA 5T3WA 2Y3DA 2WVQA 3KL4A 2Z15A 2B0JA 1Y6DA 1OKKD 3X2QC 4G0HA 4DBRA 3TULA 1OW8A 2J9UA 1R5ID 2JX0A 2Q3TA 3DJNB 3S9OA 5AC4A 4CIHA 5A6BA 3B0VC 2ZXOA 3V5ZA 3K33A 3HNLA 1ORSC 1D0ZA 4K0DA 1LS4A 2CGEA 4N06A 4JC7A 3W4YA 2KW3C 1YZCA 4JURI 1RKEA 2HSBA 2OG2A 2XS1A 2J8WA 2P0NA 2VCBA 2LQGA 1YA7O 2NSGA 1LI7A 2PX3A 1T9KA 3W8IA 3ITFA 3SZRA 1Q0KA 4QDLA 5JLIA 3QVZA 4IJJA 3NYJA 5D91A 3S90A 1CGME 3S27A 3MX3A 5A6AA 1HE1A 3ABLC 1Z3IX 2KQ9A 1FFHA 1RXQA 2HSQA 3ASOC 1I5NA 3KKBA 3FOOA 3M4BA 4I44A 4MNDA 2NUTA 4OIOF 1OCCC 2R7VA 1WWPA 1EA8A 2NUPA 4CJGA 2J0WA 1H9TA 2HZ8A 1K40A 1ST6A 5A69A 3B0UX 1WATA 1EKYA 3MLGA 1ZHYA 4PR9A 1A7DA 2CNWD 4Z9IA 5AGFA 1EQ1A 1DOVA 1L3PA 2IYLD 3OWTA 1G4WR 1NFNA 1Q0FA 1QVXA 2J9VA 2PP4A 2R7UA 4PFPA 2Y3GA 3US6A 2HV6A 2R9RB 2WZFA 1VMAA 4IB4A 4ANJA 2YVKA 3KYIA 1H6GA 3S84A 4AX2A 4BJTA 5BUOA 2LCHA 2A68F 1BBHA 1OXKA 2C03A 3GWLA 2EPKX 1GGQA 2I15A 4EIYA 5B3IA 1LE4A 1W2WA 3KH2A 1AVOB 2ICWG 2BC5A 4IGGA 2J9WA 3HKKA 1GQAA 1OR2A 4NCQA 4XLPF 2DGJA 3C8ZA 4P9FA 4PJLA 4RDAA 2WZGA 3RKOF 3U8VA 4JEAA 3SEOA 3DAFA 5BQHA 3KPHA 1M56C 5K0IA 3GM3A 3GEIA 3EGXA 2MHRA 1JOGA 3NMIA 4MVUA 4PACA 2YWAA 3GODA 4DVZA 3ZSUA 4BJ5A 3H2VA 4BG0A 2IBFA 3L8JA 3NMKA 1C17M 4KC9A 2LFDA 4O7GA 3UNGC 4UDVA 4XEFA 1CPQA 3M1CB 2HS5A 2L9JA 1PD1A 3R7CA 3EPVA 3O10A 2A0UA 4EKWA 4G7ZF 1NSGB 3N2ZB 4WABA 2V3CC 2R03A 2VH3A 3C62A 2PBEA 5HV9A 2GA0A 3U0CA 3PDMP 1E2XA 4CS9C 2LIGA 2OQMA 3ABMC 2R7QA 3V7OA 4K7BA 1TWAA 1QKRA 3DKAA 3K1IC 2Y3HA 2XL8A 5DQZA 2ETSA 4LERA 4CDVA 2CDQA 4I3MA 4MS2A 2EPMX 3I5PA 5BQIA 1TFKB 5F28E 1FNTc 1MMAA 1JR8A 2YQYA 1V4AA 4Z9HA 3HJCA 4OIPF 2WB7A 3DAGA 1T6IA 2AWCA 2R02A 2YL1A 4RBNA 2CNWA 3ATPA 1AEPA 1Z5ZA 4LDKA 5DS6A 1PV3A 2LK4A 3CZ6A 3LUTB 4PFOA 2DYRC 2L6GA 3IQ6A 1BDJB 1KNYA 2H7BA 3EGDA 4CS8C 2BL2A 3B9QA 1A7VA 3O39A 3QMKA 2PF4E 3JRTA 3NKEA 5CI8A 3LLIA 2M4EA 4LDRA 4QI0A 2YEVA 2D4UA 4U9DA 1RKEB 2DYSC 1D0YA 2P61A 4ULVA 4JTCB 4AL0A 1T6QA 3QTHA 3ZQVA 4G7OF 4RD9A 5EGYA 2R7RA 3RQFA 4NTFA 5COMA 3OA1A 4PJMA 3Q6MA 1H7IA 1LKXA 3C7JA 3DI5A 2NG1A 4O6MA 1L7CA 4D4NA 4P6IC 4G7HF 1SF8A 2JD3A 4AK9A 4CJOA 3HNJA 4U5HA 4U5CE 4MVMA 3BEHA 4FESA 2YRFA 1YLMA 3NG1A 3O55A 1MMGA 1XZPA 4IRUA 2Q9BA 2Y39A 2NUPB 3QVYA 2IM8A 4EBBA 2WZLA 1KTMA 3RQEA 1BR4A 2KNHA 3QZCA 2XLHA 1A41A 4HFKB 3SXZA 1D1CA 1U0BB 4J30B 3K1HA 4JJGA 2HFIA 2QLAA 4YL0A 4OD4A 2R7TA 1G4US 3G4ZA 3JCUQ 3RVYA 4KI2A 1HMOA 2CCYA 2WVOA 4JIOA 1J8YF 1M2VA 3EH1A 2HV7A 3TK0A 2A69F 1RJ9A 2EPLX 4YT4A 3LNRA 2HJMA 3KYJA 2J7PA 4U5FE 3VRCA 4XPWA 1ZHXA 3SP1A 4QI2A 2JPUA 3ZDLA 3M79A 4WGYA 1CGNA 2PNOA 1Z7Qc 2W9YA 3EFOB 5E2QA 1ZZPA 4AL1A 5JRAA 1VOMA 5T1DB 1TKNA 1VK5A 3UMHA 5JT4A 4PJNA 4KBLA 5BQGA 3K7DA 4JTAB 3EGXB 3IQ5A 4OIRF 2ASRA 1V54C 2YLDA 3AQCA 4I1MA 1TWCA 3F47A 4Q7CA 3ZTZA 5KYWB 2CYDA 4GYTA 4IAQA 4BJ6A 1BZ4A 3UGPA 1ZU4A 1NLXA 3C8GA 1HY5A 4ZLCA 1FTSA 3L8IA 3NMJA 1JAFA 1ZW2A 5KYYB 4NTBA 1A0BA 3AJMA 1D0XA 1NG1A 1AUEA 3R2PA 3WG7C 3GWNA 4HE8D 1T01A 1T5OA 3FAPB 4A2NB 4CS7A 3I5QA 5L0HA 2I8BA 3B29A 4JVSA 4HEAJ 2VB6A 2ZXPA 2B0HA 2F22A 4BJ5C 5CIVA 2TMVP 3JSZA 1ORJA 2YKZA 4R32A 1TR2A 3TOMA 2PFDA 2VC9A 3GORA 2LFFA 3CQZA 1V55C 4ZLDA 4PJJA 1CPRA 5F5HA 1G5ZA 2XSEA 2Q9CA 2Q4FA 2YL3A 3JZ0A 2E87A 3CSKA 3S29A 4X0RA 2J45A 2V26A 4E7ZA 3E9VA 4MVRA 2VCAA 3T6JA 3NYMA 2QY9A 3U8PA 1NBBA 1YARO 1FAPB 1QSPA 4U9EA 1BR2A 2XM0A 1YJGA 3U9JA 1ZHTA 2H8AA 4J32B 1Q0GA 5FZTA 3U2MA 1ZHZA 1OKKA 3DMDA 2L81A 4W8KA 1WTYA 1IW7F 2XLOA 3U2LA 1SYQA 4Q5SF 2QE9A 4JW1A 2LSEA 4O6YA 1LS1A 4OD5A 4MQ9F 2VCCA 3PCVA 4N6HA 5EHHA 3HLZA 1KU2A 1G8XA 3W2WA 5L0DA 5DQTA 1OCOC 3AG1C 4FWVA 4MVZA 1JPNA 4LDQA 4C3BA 2A0BA 1OXBA 4EWCA 4ULWA 3RFYA 2XLWA 3G50A 2OKUA 5CI9A 2QTVA 3L34A 1LIHA 1ZW3A 3NYLA 1YAUO 3IHUA 4MVSA 3RF3A 1LI5A 3FDQA 1QPUA 4O79A 3Q7LA 4E0IA 4EHPA 2A6EF 1LVKA 1MNEA 2OOCA 4XWJA 1BR1A 5FCLA 3TOLA 1XZQA 4NQFA 3GEHA 4MVOA 4I1OB 4AE4A 1D1AA 1S05A 3WHNA 2GFHA 5JUAA 2IXMA 1OW6A 5KYXA 3JYHA 2G62A 4WJ0A 1YYJA 3ASNC 1I4YA 4YT5A 4YWQA 3DM5A 2X51A 2YZSA 1M2VB 3EH2A 1NU7D 2XLDA 1RJ9B 4NTAA 3DJUB 4BEJA 2XXAA 2ZXRA 2KC3A 2D5RB 1MMDA 5A6BD 3NKDA 1K05A 1E83A 3JRMO 4FAPB 4W8PA 2IOQA 5E3AA 3T6BA 4IAOA 3N24A 5AC5A 3J06A 3DM9B 3POVA 2XLMA 1OCRC 3TQOA 1FMWA 4MTGA 3EQLF 3LEVA 3QW1A 2LD6A 4JCZA 5F5FA 4YT2A 5IY5C 3EHNA 2GDCA 4H4KC 1Y4CA 4NY3A 2XRHA 3JTLO 4C3EA 4MTFA 4XPYA 3LS0A 5DS4A 2XLVA 1A7EA 3C8GB 3EZHA 4XQ1A 3DD7A 1ZYRF 3H2UA 4GEHA 2NUTB 4LACB 1RCPA 2FFHA 4DRJB 4YL1A 2AU5A 3TJ6A 4E18A 3HNIA 3PMRA 1UFBA 5L0GA 1SR2A 4ONSA 3ECSA 5JS5A 1MQVA 4JTDB 2EINC 3CAXA 4E0HA 1GM5A 3H65A 1WN0A 3DXJF 5COGA 3FXHA 3L1MA 2L7AA 2YL0A 1YYXA 3AGTA 2FGYA 4XPXA 4C7OA 5L0IA 4BJ6C 1OW7A 3M15A 3B71A 4YN0B 4GQHA 4MTOA 3MFNA 4CX9A 2BE5F 2J46A 4FX5A 5GPGB 4YT8A 1OR3A 3DE8A 4DRHB 4OINF 2P7VA 4U5BE 3I4UA 3SXKA 1QZXA 1F1MA 2OU6A 3IEEA 4PK4A 5KYNA 4LLEA 5L0CA 4N6CA 2L6FA 5E3CA 3V5XA 4CSAA 3HNKA 4U5GA 2A6HF 3AG4C 5TJ5E 4CBEA 3DZAA 3LS1A 3RVZA 1HW2A 3GANA 5DS5A 1RKCA 4BEMJ 2RD9A 4BPMA 1B68A 1T6UA 5B1BC 1LM3B 1Z23A 3RIPA 4EBKA 3C18A 2R25A 2XL6A 2XLEA 1YZAA 2R05A 2PX0A 2HKVA 2YL7A 4M63A 1O3UA 1APCA 5JP7A 1OQCA 3LESA 3SYNA
chains in the Genus database with same CATH topology
3T4RA 4Q4ZF 3FVYA 4IWBA 1TWGA 2R7XA 3EG9A 2IXPA 3SNHA 3EHMA 1ZU5A 3N0TA 3ZG1A 1JPJA 5L3VA 5HSWA 2OCCC 3ZVRA 4BJ1A 3ABKC 3HTKC 5T3TA 4JJFA 3S28A 3K6BA 5KYUA 1S7ZA 4U5EE 4AE4B 1Z63A 4DOZA 3LLKA 3B0PA 5KYXB 2Q9AA 3ZC4A 4JCHA 1SMYF 3UMIA 1M57C 2WVNA 2ZPAA 3WODF 4DBQA 3NRHA 3EGDB 2XXAB 1IZMA 2W4BA 3OEOA 1SZIA 3LJBA 2WL8A 3AG3C 2VASA 5DVWA 2KGOA 2Y69C 1TWHA 1PCXA 4E7SA 3LAYA 3K66A 2C04A 4F4BA 3EFOA 2W4MA 3W8HA 2CW0F 4OIQF 3VYWA 3EZIA 1NZEA 5KYWA 1O87A 2XL4A 3NDBB 2H7OA 2IXNA 4KNWA 4C7OB 4XLNF 3UGOA 4U5DE 4XTKA 5D92A 1O5HA 3UMKA 3PHF2 5KYYA 4O6NA 2ZXWC 2O9XA 5E33A 3S0XA 3RH3A 5B3SC 1ZHWA 2MYSA 3X1OA 1D1BA 3AG2C 1FMVA 1WGWA 2J7PD 2EIKC 4C3DA 3FHDA 1N1CA 1MMNA 4CSAC 1FFTC 3TD7A 1OCZC 3F46A 1MNDA 1M2OA 3JT1A 3VAYA 3EG9B 1QLEC 1NU9C 3RYLA 1VYIA 1J8MF 2YHSA 3Q7GA 3E70C 4YJWA 1PD0A 2EIJC 4CS9A 5DLJA 2MWQA 4JZAA 3UR3C 3AQBA 3Q6NA 3ZIBA 2R7WA 3L0IA 2R7SA 3EJNA 2J0XA 4DVYP 2P6VA 5KYUB 5L3QA 2Y3BA 4HFFB 1VYKA 2R7OA 2IXOA 3O6XA 4LLCA 4B6IA 2A1DD 3W2VA 2EILC 2G3KA 5B1AC 2H7VC 4CS8A 3KMIA 2G3VA 2KJGA 3FAJA 4KNVA 2EIMC 1Z6AA 2W45A 5T3WA 2Y3DA 2WVQA 3KL4A 2Z15A 2B0JA 1OKKD 3X2QC 4G0HA 2J9UA 3DJNB 2Q3TA 4CIHA 3B0VC 2ZXOA 3K33A 1D0ZA 4K0DA 2CGEA 4N06A 2KW3C 4JURI 2OG2A 2PX3A 3W8IA 3ITFA 3SZRA 4QDLA 4IJJA 3NYJA 5D91A 3S27A 3MX3A 3ABLC 1Z3IX 2KQ9A 1FFHA 4I44A 3ASOC 3KKBA 4MNDA 2NUTA 4OIOF 1OCCC 2R7VA 2NUPA 2J0WA 1ST6A 3B0UX 3MLGA 1ZHYA 2CNWD 2IYLD 3OWTA 2R7UA 2J9VA 2PP4A 4PFPA 2Y3GA 2HV6A 2WZFA 1VMAA 4ANJA 4AX2A 4BJTA 5BUOA 2A68F 2C03A 1W2WA 3KH2A 2J9WA 4XLPF 2DGJA 4PJLA 4RDAA 2WZGA 3RKOF 3SEOA 3DAFA 1M56C 3EGXA 4DVZA 3GODA 3ZSUA 4BJ5A 4BG0A 4KC9A 4O7GA 3UNGC 3M1CB 2L9JA 1PD1A 3EPVA 4G7ZF 3N2ZB 2V3CC 2VH3A 4CS9C 3ABMC 2R7QA 3V7OA 4K7BA 1TWAA 3K1IC 2Y3HA 5DQZA 4LERA 2CDQA 4I3MA 3I5PA 1MMAA 3HJCA 4OIPF 2WB7A 3DAGA 4RBNA 2CNWA 1Z5ZA 5DS6A 3CZ6A 4PFOA 2DYRC 3EGDA 2H7BA 4CS8C 3B9QA 3O39A 3QMKA 2PF4E 3JRTA 3NKEA 5CI8A 3LLIA 2M4EA 4QI0A 2YEVA 2DYSC 1D0YA 4G7OF 4RD9A 5EGYA 2R7RA 3OA1A 4PJMA 3Q6MA 1LKXA 4O6MA 4DBRA 4G7HF 2NG1A 4P6IC 1SF8A 2JD3A 4AK9A 4U5HA 4U5CE 4FESA 3NG1A 1MMGA 4IRUA 2Q9BA 2Y39A 2NUPB 4EBBA 2WZLA 1BR4A 2KNHA 3QZCA 4HFKB 1D1CA 4J30B 3K1HA 4JJGA 4OD4A 2R7TA 3JCUQ 4KI2A 2WVOA 1J8YF 1M2VA 3EH1A 2HV7A 2A69F 1RJ9A 4YT4A 3LNRA 4U5FE 2J7PA 1ZHXA 3SP1A 4QI2A 2W9YA 3EFOB 5E2QA 1VOMA 5T1DB 1TKNA 1VK5A 3UMHA 4PJNA 4KBLA 3K7DA 3EGXB 4OIRF 3AQCA 1V54C 4Q7CA 4I1MA 5KYWB 1TWCA 3F47A 4GYTA 4BJ6A 3UGPA 1ZU4A 4ZLCA 1FTSA 5KYYB 1D0XA 1NG1A 3WG7C 4HE8D 4CS7A 4A2NB 3I5QA 2I8BA 4JVSA 4HEAJ 2VB6A 2ZXPA 4BJ5C 3JSZA 1TR2A 2PFDA 4ZLDA 3CQZA 1V55C 4PJJA 5F5HA 2XSEA 2Q9CA 2E87A 3CSKA 3S29A 4X0RA 2V26A 2J45A 4E7ZA 3E9VA 3T6JA 3NYMA 2QY9A 1BR2A 1ZHTA 4J32B 1ZHZA 1OKKA 3DMDA 2L81A 4W8KA 1IW7F 4Q5SF 4JW1A 2LSEA 4O6YA 1LS1A 4OD5A 4MQ9F 5EHHA 3HLZA 1KU2A 1G8XA 3W2WA 5DQTA 1OCOC 3AG1C 4FWVA 4C3BA 1JPNA 4EWCA 4ULWA 3RFYA 5CI9A 2QTVA 3L34A 3NYLA 3FDQA 4O79A 3Q7LA 2A6EF 1LVKA 1MNEA 4XWJA 1BR1A 5FCLA 4I1OB 4AE4A 1D1AA 2GFHA 2IXMA 5KYXA 3JYHA 2G62A 4WJ0A 3ASNC 4YT5A 4YWQA 3DM5A 2X51A 2YZSA 1M2VB 3EH2A 1NU7D 1RJ9B 3DJUB 4BEJA 2XXAA 2ZXRA 2D5RB 1MMDA 3NKDA 2IOQA 5E3AA 3T6BA 4IAOA 3N24A 3DM9B 3POVA 1OCRC 1FMWA 3EQLF 3LEVA 5F5FA 4YT2A 5IY5C 3EHNA 4H4KC 4NY3A 2XRHA 4C3EA 3LS0A 5DS4A 3EZHA 3DD7A 1ZYRF 4GEHA 2NUTB 4LACB 2FFHA 3PMRA 3ECSA 2EINC 3H65A 3DXJF 2FGYA 4C7OA 4BJ6C 4YN0B 2BE5F 2J46A 4FX5A 4YT8A 4OINF 2P7VA 4U5BE 3I4UA 1QZXA 3IEEA 4PK4A 5KYNA 4LLEA 5E3CA 4CSAA 4U5GA 2A6HF 3AG4C 4CBEA 3DZAA 3LS1A 3GANA 5DS5A 5B1BC 1Z23A 3RIPA 2PX0A 4M63A 3LESA 3SYNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U5H A;  4U5D E;  4U5C E;  4U5E E;  4U5G A;  4U5F E;  4U5B E; 
#chains in the Genus database with same CATH topology
 2EPN A;  1ZVZ A;  2J9B A;  4MW8 A;  2KSF A;  3U9M A;  3T4R A;  2DI3 A;  4NC3 A;  4Q4Z F;  3FVY A;  4IWB A;  1ORY A;  1TWG A;  2R7X A;  3EG9 A;  2IXP A;  1CGO A;  3SNH A;  1HW1 A;  3EHM A;  1Q0D A;  1ZU5 A;  3IPM O;  3N0T A;  3RQG A;  1JPJ A;  3ZG1 A;  5L3V A;  3G4X A;  5HSW A;  2OCC C;  3ZVR A;  5A6K A;  4BJ1 A;  3RW0 A;  3ABK C;  1TFO B;  3HTK C;  5T3T A;  4JJF A;  2QUP A;  1GS9 A;  3IQT A;  2LP4 A;  3S28 A;  2DB4 A;  4ER9 A;  1E86 A;  2KYH A;  1LE2 A;  3K6B A;  3T9O A;  1M6T A;  1S7Z A;  4K1O A;  4U5E E;  5KYU A;  4AE4 B;  1Z63 A;  4DOZ A;  3LLK A;  4CDY A;  3B0P A;  3GEE A;  5KYX B;  2Q9A A;  3TJ5 A;  1DOW A;  1JRA A;  3ZC4 A;  4JCH A;  1H9G A;  1SMY F;  3UMI A;  1M57 C;  2WVN A;  4CIP A;  1TQG A;  2ZPA A;  3WAQ A;  3A9C A;  3WOD F;  4DBQ A;  1I4Z A;  1VTM P;  3NRH A;  2KK1 A;  2FAP B;  1HE9 A;  1IZM A;  3BRJ A;  3EGD B;  4J7T A;  5L0J A;  2XXA B;  1VB5 A;  2W4B A;  3OEO A;  2M64 A;  1SZI A;  3C63 A;  2P1A A;  3LJB A;  4MVQ A;  2WL8 A;  3VF0 A;  3AG3 C;  2VAS A;  5DVW A;  2KGO A;  4EUK B;  4A4A A;  1YA9 A;  4MW3 A;  5EK0 A;  2Y69 C;  1TWH A;  1PCX A;  2ZD9 A;  4E7S A;  3JSE O;  3LAY A;  2AWY A;  1QQ3 A;  3K66 A;  2C04 A;  3V5Y A;  4DRI B;  1HMD A;  4F4B A;  3EFO A;  2X0C A;  1LPE A;  2Q00 A;  2W4M A;  3VM6 A;  4P9T A;  3W8H A;  2CW0 F;  4OIQ F;  1C03 A;  3T6G B;  3VYW A;  3EZI A;  1NZE A;  3MBG A;  3U3B A;  5KYW A;  1O87 A;  2EPO A;  2XL4 A;  3NDB B;  2H7O A;  2IXN A;  3CEX A;  4KNW A;  3LNM B;  4XLN F;  3UGO A;  4C7O B;  4U5D E;  3DWW A;  4XTK A;  5D92 A;  1O5H A;  2OJQ A;  3IQC A;  5COF A;  3UMK A;  4O6N A;  5KYY A;  3PHF 2;  2NSF A;  4CDA A;  2ZXW C;  2OJE D;  2NPU A;  4JEB A;  4J7Y A;  2O9X A;  3U3F A;  1WOL A;  1Q0M A;  5E33 A;  3S0X A;  3RH3 A;  256B A;  5B3S C;  2GWW A;  1ZHW A;  2YLG A;  2MYS A;  2QNL A;  3FMS A;  1D1B A;  3X1O A;  3AG2 C;  3SXM A;  3AGU A;  1FMV A;  1WGW A;  1XWJ A;  1WAS A;  2EIK C;  2J7P D;  4C3D A;  1E85 A;  2AVK A;  1EI7 A;  2RSE B;  3FHD A;  1N1C A;  3ZWI A;  2UUH A;  1MMN A;  3FOP A;  5JSL A;  4JE9 A;  4CSA C;  1FFT C;  3TD7 A;  1OCZ C;  2YLI A;  2XM4 A;  2HJ3 A;  1MND A;  3F46 A;  1RMV A;  1M2O A;  3JT1 A;  1FR0 A;  3VAY A;  2HUJ A;  4H54 A;  3EG9 B;  4IAR A;  1JMW A;  1QLE C;  3GM1 A;  1NU9 C;  3RYL A;  3ZQY A;  1VYI A;  3MYI A;  3C8G D;  4XEV A;  3SXY A;  1J8M F;  1VLT A;  2YHS A;  3Q7G A;  3AOU A;  4WGZ A;  3DE9 A;  3E70 C;  4YL3 A;  4YJW A;  1PD0 A;  4DXW A;  2EIJ C;  4CS9 A;  4JRZ A;  5DLJ A;  2MWQ A;  4JZA A;  3ZTM A;  5A6J A;  4N4W A;  4L6R A;  1V74 B;  4EBJ A;  3UR3 C;  1K04 A;  3AQB A;  3Q6N A;  3ZIB A;  3K1I A;  4G78 A;  2UUI A;  4DJ9 A;  2R7W A;  2OEV A;  3L0I A;  2R7S A;  1VLS A;  1YDI A;  1R4T A;  3EJN A;  2OEX A;  3LEO A;  3M4C A;  2J0X A;  4Z9J A;  4DVY P;  3MYF A;  1U89 A;  2P6V A;  5KYU B;  1E84 A;  2Q7R A;  4YK5 A;  5L3Q A;  2Y3B A;  4HFF B;  1VYK A;  2HMZ A;  1YVI A;  2R7O A;  5L0F A;  1C02 A;  2AP3 A;  4XEK A;  2IXO A;  3GM2 A;  3O6X A;  1NFO A;  4LLC A;  4D4X A;  1U6H A;  4E17 A;  4B6I A;  2A1D D;  3W2V A;  4JKV A;  2EIL C;  2G3K A;  2GAQ A;  5B1A C;  3QW0 A;  1UG7 A;  3A11 A;  2H7V C;  2XS8 A;  4CS8 A;  3KMI A;  5JVE A;  2G3V A;  2KJG A;  2HMQ A;  3FAJ A;  3U5S A;  4KNV A;  2EIM C;  1Z6A A;  2W45 A;  3JYY A;  2L6H A;  5T3W A;  2Y3D A;  2WVQ A;  3KL4 A;  2Z15 A;  2B0J A;  1Y6D A;  1OKK D;  3X2Q C;  4G0H A;  4DBR A;  3TUL A;  1OW8 A;  2J9U A;  1R5I D;  2JX0 A;  2Q3T A;  3DJN B;  3S9O A;  5AC4 A;  4CIH A;  5A6B A;  3B0V C;  2ZXO A;  3V5Z A;  3K33 A;  3HNL A;  1ORS C;  1D0Z A;  4K0D A;  1LS4 A;  2CGE A;  4N06 A;  4JC7 A;  3W4Y A;  2KW3 C;  1YZC A;  4JUR I;  1RKE A;  2HSB A;  2OG2 A;  2XS1 A;  2J8W A;  2P0N A;  2VCB A;  2LQG A;  1YA7 O;  2NSG A;  1LI7 A;  2PX3 A;  1T9K A;  3W8I A;  3ITF A;  3SZR A;  1Q0K A;  4QDL A;  5JLI A;  3QVZ A;  4IJJ A;  3NYJ A;  5D91 A;  3S90 A;  1CGM E;  3S27 A;  3MX3 A;  5A6A A;  1HE1 A;  3ABL C;  1Z3I X;  2KQ9 A;  1FFH A;  1RXQ A;  2HSQ A;  3ASO C;  1I5N A;  3KKB A;  3FOO A;  3M4B A;  4I44 A;  4MND A;  2NUT A;  4OIO F;  1OCC C;  2R7V A;  1WWP A;  1EA8 A;  2NUP A;  4CJG A;  2J0W A;  1H9T A;  2HZ8 A;  1K40 A;  1ST6 A;  5A69 A;  3B0U X;  1WAT A;  1EKY A;  3MLG A;  1ZHY A;  4PR9 A;  1A7D A;  2CNW D;  4Z9I A;  5AGF A;  1EQ1 A;  1DOV A;  1L3P A;  2IYL D;  3OWT A;  1G4W R;  1NFN A;  1Q0F A;  1QVX A;  2J9V A;  2PP4 A;  2R7U A;  4PFP A;  2Y3G A;  3US6 A;  2HV6 A;  2R9R B;  2WZF A;  1VMA A;  4IB4 A;  4ANJ A;  2YVK A;  3KYI A;  1H6G A;  3S84 A;  4AX2 A;  4BJT A;  5BUO A;  2LCH A;  2A68 F;  1BBH A;  1OXK A;  2C03 A;  3GWL A;  2EPK X;  1GGQ A;  2I15 A;  4EIY A;  5B3I A;  1LE4 A;  1W2W A;  3KH2 A;  1AVO B;  2ICW G;  2BC5 A;  4IGG A;  2J9W A;  3HKK A;  1GQA A;  1OR2 A;  4NCQ A;  4XLP F;  2DGJ A;  3C8Z A;  4P9F A;  4PJL A;  4RDA A;  2WZG A;  3RKO F;  3U8V A;  4JEA A;  3SEO A;  3DAF A;  5BQH A;  3KPH A;  1M56 C;  5K0I A;  3GM3 A;  3GEI A;  3EGX A;  2MHR A;  1JOG A;  3NMI A;  4MVU A;  4PAC A;  2YWA A;  3GOD A;  4DVZ A;  3ZSU A;  4BJ5 A;  3H2V A;  4BG0 A;  2IBF A;  3L8J A;  3NMK A;  1C17 M;  4KC9 A;  2LFD A;  4O7G A;  3UNG C;  4UDV A;  4XEF A;  1CPQ A;  3M1C B;  2HS5 A;  2L9J A;  1PD1 A;  3R7C A;  3EPV A;  3O10 A;  2A0U A;  4EKW A;  4G7Z F;  1NSG B;  3N2Z B;  4WAB A;  2V3C C;  2R03 A;  2VH3 A;  3C62 A;  2PBE A;  5HV9 A;  2GA0 A;  3U0C A;  3PDM P;  1E2X A;  4CS9 C;  2LIG A;  2OQM A;  3ABM C;  2R7Q A;  3V7O A;  4K7B A;  1TWA A;  1QKR A;  3DKA A;  3K1I C;  2Y3H A;  2XL8 A;  5DQZ A;  2ETS A;  4LER A;  4CDV A;  2CDQ A;  4I3M A;  4MS2 A;  2EPM X;  3I5P A;  5BQI A;  1TFK B;  5F28 E;  1FNT c;  1MMA A;  1JR8 A;  2YQY A;  1V4A A;  4Z9H A;  3HJC A;  4OIP F;  2WB7 A;  3DAG A;  1T6I A;  2AWC A;  2R02 A;  2YL1 A;  4RBN A;  2CNW A;  3ATP A;  1AEP A;  1Z5Z A;  4LDK A;  5DS6 A;  1PV3 A;  2LK4 A;  3CZ6 A;  3LUT B;  4PFO A;  2DYR C;  2L6G A;  3IQ6 A;  1BDJ B;  1KNY A;  2H7B A;  3EGD A;  4CS8 C;  2BL2 A;  3B9Q A;  1A7V A;  3O39 A;  3QMK A;  2PF4 E;  3JRT A;  3NKE A;  5CI8 A;  3LLI A;  2M4E A;  4LDR A;  4QI0 A;  2YEV A;  2D4U A;  4U9D A;  1RKE B;  2DYS C;  1D0Y A;  2P61 A;  4ULV A;  4JTC B;  4AL0 A;  1T6Q A;  3QTH A;  3ZQV A;  4G7O F;  4RD9 A;  5EGY A;  2R7R A;  3RQF A;  4NTF A;  5COM A;  3OA1 A;  4PJM A;  3Q6M A;  1H7I A;  1LKX A;  3C7J A;  3DI5 A;  2NG1 A;  4O6M A;  1L7C A;  4D4N A;  4P6I C;  4G7H F;  1SF8 A;  2JD3 A;  4AK9 A;  4CJO A;  3HNJ A;  4U5H A;  4U5C E;  4MVM A;  3BEH A;  4FES A;  2YRF A;  1YLM A;  3NG1 A;  3O55 A;  1MMG A;  1XZP A;  4IRU A;  2Q9B A;  2Y39 A;  2NUP B;  3QVY A;  2IM8 A;  4EBB A;  2WZL A;  1KTM A;  3RQE A;  1BR4 A;  2KNH A;  3QZC A;  2XLH A;  1A41 A;  4HFK B;  3SXZ A;  1D1C A;  1U0B B;  4J30 B;  3K1H A;  4JJG A;  2HFI A;  2QLA A;  4YL0 A;  4OD4 A;  2R7T A;  1G4U S;  3G4Z A;  3JCU Q;  3RVY A;  4KI2 A;  1HMO A;  2CCY A;  2WVO A;  4JIO A;  1J8Y F;  1M2V A;  3EH1 A;  2HV7 A;  3TK0 A;  2A69 F;  1RJ9 A;  2EPL X;  4YT4 A;  3LNR A;  2HJM A;  3KYJ A;  2J7P A;  4U5F E;  3VRC A;  4XPW A;  1ZHX A;  3SP1 A;  4QI2 A;  2JPU A;  3ZDL A;  3M79 A;  4WGY A;  1CGN A;  2PNO A;  1Z7Q c;  2W9Y A;  3EFO B;  5E2Q A;  1ZZP A;  4AL1 A;  5JRA A;  1VOM A;  5T1D B;  1TKN A;  1VK5 A;  3UMH A;  5JT4 A;  4PJN A;  4KBL A;  5BQG A;  3K7D A;  4JTA B;  3EGX B;  3IQ5 A;  4OIR F;  2ASR A;  1V54 C;  2YLD A;  3AQC A;  4I1M A;  1TWC A;  3F47 A;  4Q7C A;  3ZTZ A;  5KYW B;  2CYD A;  4GYT A;  4IAQ A;  4BJ6 A;  1BZ4 A;  3UGP A;  1ZU4 A;  1NLX A;  3C8G A;  1HY5 A;  4ZLC A;  1FTS A;  3L8I A;  3NMJ A;  1JAF A;  1ZW2 A;  5KYY B;  4NTB A;  1A0B A;  3AJM A;  1D0X A;  1NG1 A;  1AUE A;  3R2P A;  3WG7 C;  3GWN A;  4HE8 D;  1T01 A;  1T5O A;  3FAP B;  4A2N B;  4CS7 A;  3I5Q A;  5L0H A;  2I8B A;  3B29 A;  4JVS A;  4HEA J;  2VB6 A;  2ZXP A;  2B0H A;  2F22 A;  4BJ5 C;  5CIV A;  2TMV P;  3JSZ A;  1ORJ A;  2YKZ A;  4R32 A;  1TR2 A;  3TOM A;  2PFD A;  2VC9 A;  3GOR A;  2LFF A;  3CQZ A;  1V55 C;  4ZLD A;  4PJJ A;  1CPR A;  5F5H A;  1G5Z A;  2XSE A;  2Q9C A;  2Q4F A;  2YL3 A;  3JZ0 A;  2E87 A;  3CSK A;  3S29 A;  4X0R A;  2J45 A;  2V26 A;  4E7Z A;  3E9V A;  4MVR A;  2VCA A;  3T6J A;  3NYM A;  2QY9 A;  3U8P A;  1NBB A;  1YAR O;  1FAP B;  1QSP A;  4U9E A;  1BR2 A;  2XM0 A;  1YJG A;  3U9J A;  1ZHT A;  2H8A A;  4J32 B;  1Q0G A;  5FZT A;  3U2M A;  1ZHZ A;  1OKK A;  3DMD A;  2L81 A;  4W8K A;  1WTY A;  1IW7 F;  2XLO A;  3U2L A;  1SYQ A;  4Q5S F;  2QE9 A;  4JW1 A;  2LSE A;  4O6Y A;  1LS1 A;  4OD5 A;  4MQ9 F;  2VCC A;  3PCV A;  4N6H A;  5EHH A;  3HLZ A;  1KU2 A;  1G8X A;  3W2W A;  5L0D A;  5DQT A;  1OCO C;  3AG1 C;  4FWV A;  4MVZ A;  1JPN A;  4LDQ A;  4C3B A;  2A0B A;  1OXB A;  4EWC A;  4ULW A;  3RFY A;  2XLW A;  3G50 A;  2OKU A;  5CI9 A;  2QTV A;  3L34 A;  1LIH A;  1ZW3 A;  3NYL A;  1YAU O;  3IHU A;  4MVS A;  3RF3 A;  1LI5 A;  3FDQ A;  1QPU A;  4O79 A;  3Q7L A;  4E0I A;  4EHP A;  2A6E F;  1LVK A;  1MNE A;  2OOC A;  4XWJ A;  1BR1 A;  5FCL A;  3TOL A;  1XZQ A;  4NQF A;  3GEH A;  4MVO A;  4I1O B;  4AE4 A;  1D1A A;  1S05 A;  3WHN A;  2GFH A;  5JUA A;  2IXM A;  1OW6 A;  5KYX A;  3JYH A;  2G62 A;  4WJ0 A;  1YYJ A;  3ASN C;  1I4Y A;  4YT5 A;  4YWQ A;  3DM5 A;  2X51 A;  2YZS A;  1M2V B;  3EH2 A;  1NU7 D;  2XLD A;  1RJ9 B;  4NTA A;  3DJU B;  4BEJ A;  2XXA A;  2ZXR A;  2KC3 A;  2D5R B;  1MMD A;  5A6B D;  3NKD A;  1K05 A;  1E83 A;  3JRM O;  4FAP B;  4W8P A;  2IOQ A;  5E3A A;  3T6B A;  4IAO A;  3N24 A;  5AC5 A;  3J06 A;  3DM9 B;  3POV A;  2XLM A;  1OCR C;  3TQO A;  1FMW A;  4MTG A;  3EQL F;  3LEV A;  3QW1 A;  2LD6 A;  4JCZ A;  5F5F A;  4YT2 A;  5IY5 C;  3EHN A;  2GDC A;  4H4K C;  1Y4C A;  4NY3 A;  2XRH A;  3JTL O;  4C3E A;  4MTF A;  4XPY A;  3LS0 A;  5DS4 A;  2XLV A;  1A7E A;  3C8G B;  3EZH A;  4XQ1 A;  3DD7 A;  1ZYR F;  3H2U A;  4GEH A;  2NUT B;  4LAC B;  1RCP A;  2FFH A;  4DRJ B;  4YL1 A;  2AU5 A;  3TJ6 A;  4E18 A;  3HNI A;  3PMR A;  1UFB A;  5L0G A;  1SR2 A;  4ONS A;  3ECS A;  5JS5 A;  1MQV A;  4JTD B;  2EIN C;  3CAX A;  4E0H A;  1GM5 A;  3H65 A;  1WN0 A;  3DXJ F;  5COG A;  3FXH A;  3L1M A;  2L7A A;  2YL0 A;  1YYX A;  3AGT A;  2FGY A;  4XPX A;  4C7O A;  5L0I A;  4BJ6 C;  1OW7 A;  3M15 A;  3B71 A;  4YN0 B;  4GQH A;  4MTO A;  3MFN A;  4CX9 A;  2BE5 F;  2J46 A;  4FX5 A;  5GPG B;  4YT8 A;  1OR3 A;  3DE8 A;  4DRH B;  4OIN F;  2P7V A;  4U5B E;  3I4U A;  3SXK A;  1QZX A;  1F1M A;  2OU6 A;  3IEE A;  4PK4 A;  5KYN A;  4LLE A;  5L0C A;  4N6C A;  2L6F A;  5E3C A;  3V5X A;  4CSA A;  3HNK A;  4U5G A;  2A6H F;  3AG4 C;  5TJ5 E;  4CBE A;  3DZA A;  3LS1 A;  3RVZ A;  1HW2 A;  3GAN A;  5DS5 A;  1RKC A;  4BEM J;  2RD9 A;  4BPM A;  1B68 A;  1T6U A;  5B1B C;  1LM3 B;  1Z23 A;  3RIP A;  4EBK A;  3C18 A;  2R25 A;  2XL6 A;  2XLE A;  1YZA A;  2R05 A;  2PX0 A;  2HKV A;  2YL7 A;  4M63 A;  1O3U A;  1APC A;  5JP7 A;  1OQC A;  3LES A;  3SYN A; 
#chains in the Genus database with same CATH homology
 3T4R A;  4Q4Z F;  3FVY A;  4IWB A;  1TWG A;  2R7X A;  3EG9 A;  2IXP A;  3SNH A;  3EHM A;  1ZU5 A;  3N0T A;  3ZG1 A;  1JPJ A;  5L3V A;  5HSW A;  2OCC C;  3ZVR A;  4BJ1 A;  3ABK C;  3HTK C;  5T3T A;  4JJF A;  3S28 A;  3K6B A;  5KYU A;  1S7Z A;  4U5E E;  4AE4 B;  1Z63 A;  4DOZ A;  3LLK A;  3B0P A;  5KYX B;  2Q9A A;  3ZC4 A;  4JCH A;  1SMY F;  3UMI A;  1M57 C;  2WVN A;  2ZPA A;  3WOD F;  4DBQ A;  3NRH A;  3EGD B;  2XXA B;  1IZM A;  2W4B A;  3OEO A;  1SZI A;  3LJB A;  2WL8 A;  3AG3 C;  2VAS A;  5DVW A;  2KGO A;  2Y69 C;  1TWH A;  1PCX A;  4E7S A;  3LAY A;  3K66 A;  2C04 A;  4F4B A;  3EFO A;  2W4M A;  3W8H A;  2CW0 F;  4OIQ F;  3VYW A;  3EZI A;  1NZE A;  5KYW A;  1O87 A;  2XL4 A;  3NDB B;  2H7O A;  2IXN A;  4KNW A;  4C7O B;  4XLN F;  3UGO A;  4U5D E;  4XTK A;  5D92 A;  1O5H A;  3UMK A;  3PHF 2;  5KYY A;  4O6N A;  2ZXW C;  2O9X A;  5E33 A;  3S0X A;  3RH3 A;  5B3S C;  1ZHW A;  2MYS A;  3X1O A;  1D1B A;  3AG2 C;  1FMV A;  1WGW A;  2J7P D;  2EIK C;  4C3D A;  3FHD A;  1N1C A;  1MMN A;  4CSA C;  1FFT C;  3TD7 A;  1OCZ C;  3F46 A;  1MND A;  1M2O A;  3JT1 A;  3VAY A;  3EG9 B;  1QLE C;  1NU9 C;  3RYL A;  1VYI A;  1J8M F;  2YHS A;  3Q7G A;  3E70 C;  4YJW A;  1PD0 A;  2EIJ C;  4CS9 A;  5DLJ A;  2MWQ A;  4JZA A;  3UR3 C;  3AQB A;  3Q6N A;  3ZIB A;  2R7W A;  3L0I A;  2R7S A;  3EJN A;  2J0X A;  4DVY P;  2P6V A;  5KYU B;  5L3Q A;  2Y3B A;  4HFF B;  1VYK A;  2R7O A;  2IXO A;  3O6X A;  4LLC A;  4B6I A;  2A1D D;  3W2V A;  2EIL C;  2G3K A;  5B1A C;  2H7V C;  4CS8 A;  3KMI A;  2G3V A;  2KJG A;  3FAJ A;  4KNV A;  2EIM C;  1Z6A A;  2W45 A;  5T3W A;  2Y3D A;  2WVQ A;  3KL4 A;  2Z15 A;  2B0J A;  1OKK D;  3X2Q C;  4G0H A;  2J9U A;  3DJN B;  2Q3T A;  4CIH A;  3B0V C;  2ZXO A;  3K33 A;  1D0Z A;  4K0D A;  2CGE A;  4N06 A;  2KW3 C;  4JUR I;  2OG2 A;  2PX3 A;  3W8I A;  3ITF A;  3SZR A;  4QDL A;  4IJJ A;  3NYJ A;  5D91 A;  3S27 A;  3MX3 A;  3ABL C;  1Z3I X;  2KQ9 A;  1FFH A;  4I44 A;  3ASO C;  3KKB A;  4MND A;  2NUT A;  4OIO F;  1OCC C;  2R7V A;  2NUP A;  2J0W A;  1ST6 A;  3B0U X;  3MLG A;  1ZHY A;  2CNW D;  2IYL D;  3OWT A;  2R7U A;  2J9V A;  2PP4 A;  4PFP A;  2Y3G A;  2HV6 A;  2WZF A;  1VMA A;  4ANJ A;  4AX2 A;  4BJT A;  5BUO A;  2A68 F;  2C03 A;  1W2W A;  3KH2 A;  2J9W A;  4XLP F;  2DGJ A;  4PJL A;  4RDA A;  2WZG A;  3RKO F;  3SEO A;  3DAF A;  1M56 C;  3EGX A;  4DVZ A;  3GOD A;  3ZSU A;  4BJ5 A;  4BG0 A;  4KC9 A;  4O7G A;  3UNG C;  3M1C B;  2L9J A;  1PD1 A;  3EPV A;  4G7Z F;  3N2Z B;  2V3C C;  2VH3 A;  4CS9 C;  3ABM C;  2R7Q A;  3V7O A;  4K7B A;  1TWA A;  3K1I C;  2Y3H A;  5DQZ A;  4LER A;  2CDQ A;  4I3M A;  3I5P A;  1MMA A;  3HJC A;  4OIP F;  2WB7 A;  3DAG A;  4RBN A;  2CNW A;  1Z5Z A;  5DS6 A;  3CZ6 A;  4PFO A;  2DYR C;  3EGD A;  2H7B A;  4CS8 C;  3B9Q A;  3O39 A;  3QMK A;  2PF4 E;  3JRT A;  3NKE A;  5CI8 A;  3LLI A;  2M4E A;  4QI0 A;  2YEV A;  2DYS C;  1D0Y A;  4G7O F;  4RD9 A;  5EGY A;  2R7R A;  3OA1 A;  4PJM A;  3Q6M A;  1LKX A;  4O6M A;  4DBR A;  4G7H F;  2NG1 A;  4P6I C;  1SF8 A;  2JD3 A;  4AK9 A;  4U5H A;  4U5C E;  4FES A;  3NG1 A;  1MMG A;  4IRU A;  2Q9B A;  2Y39 A;  2NUP B;  4EBB A;  2WZL A;  1BR4 A;  2KNH A;  3QZC A;  4HFK B;  1D1C A;  4J30 B;  3K1H A;  4JJG A;  4OD4 A;  2R7T A;  3JCU Q;  4KI2 A;  2WVO A;  1J8Y F;  1M2V A;  3EH1 A;  2HV7 A;  2A69 F;  1RJ9 A;  4YT4 A;  3LNR A;  4U5F E;  2J7P A;  1ZHX A;  3SP1 A;  4QI2 A;  2W9Y A;  3EFO B;  5E2Q A;  1VOM A;  5T1D B;  1TKN A;  1VK5 A;  3UMH A;  4PJN A;  4KBL A;  3K7D A;  3EGX B;  4OIR F;  3AQC A;  1V54 C;  4Q7C A;  4I1M A;  5KYW B;  1TWC A;  3F47 A;  4GYT A;  4BJ6 A;  3UGP A;  1ZU4 A;  4ZLC A;  1FTS A;  5KYY B;  1D0X A;  1NG1 A;  3WG7 C;  4HE8 D;  4CS7 A;  4A2N B;  3I5Q A;  2I8B A;  4JVS A;  4HEA J;  2VB6 A;  2ZXP A;  4BJ5 C;  3JSZ A;  1TR2 A;  2PFD A;  4ZLD A;  3CQZ A;  1V55 C;  4PJJ A;  5F5H A;  2XSE A;  2Q9C A;  2E87 A;  3CSK A;  3S29 A;  4X0R A;  2V26 A;  2J45 A;  4E7Z A;  3E9V A;  3T6J A;  3NYM A;  2QY9 A;  1BR2 A;  1ZHT A;  4J32 B;  1ZHZ A;  1OKK A;  3DMD A;  2L81 A;  4W8K A;  1IW7 F;  4Q5S F;  4JW1 A;  2LSE A;  4O6Y A;  1LS1 A;  4OD5 A;  4MQ9 F;  5EHH A;  3HLZ A;  1KU2 A;  1G8X A;  3W2W A;  5DQT A;  1OCO C;  3AG1 C;  4FWV A;  4C3B A;  1JPN A;  4EWC A;  4ULW A;  3RFY A;  5CI9 A;  2QTV A;  3L34 A;  3NYL A;  3FDQ A;  4O79 A;  3Q7L A;  2A6E F;  1LVK A;  1MNE A;  4XWJ A;  1BR1 A;  5FCL A;  4I1O B;  4AE4 A;  1D1A A;  2GFH A;  2IXM A;  5KYX A;  3JYH A;  2G62 A;  4WJ0 A;  3ASN C;  4YT5 A;  4YWQ A;  3DM5 A;  2X51 A;  2YZS A;  1M2V B;  3EH2 A;  1NU7 D;  1RJ9 B;  3DJU B;  4BEJ A;  2XXA A;  2ZXR A;  2D5R B;  1MMD A;  3NKD A;  2IOQ A;  5E3A A;  3T6B A;  4IAO A;  3N24 A;  3DM9 B;  3POV A;  1OCR C;  1FMW A;  3EQL F;  3LEV A;  5F5F A;  4YT2 A;  5IY5 C;  3EHN A;  4H4K C;  4NY3 A;  2XRH A;  4C3E A;  3LS0 A;  5DS4 A;  3EZH A;  3DD7 A;  1ZYR F;  4GEH A;  2NUT B;  4LAC B;  2FFH A;  3PMR A;  3ECS A;  2EIN C;  3H65 A;  3DXJ F;  2FGY A;  4C7O A;  4BJ6 C;  4YN0 B;  2BE5 F;  2J46 A;  4FX5 A;  4YT8 A;  4OIN F;  2P7V A;  4U5B E;  3I4U A;  1QZX A;  3IEE A;  4PK4 A;  5KYN A;  4LLE A;  5E3C A;  4CSA A;  4U5G A;  2A6H F;  3AG4 C;  4CBE A;  3DZA A;  3LS1 A;  3GAN A;  5DS5 A;  5B1B C;  1Z23 A;  3RIP A;  2PX0 A;  4M63 A;  3LES A;  3SYN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...