4U5DE

Crystal structure of glua2, con-ikot-ikot snail toxin, partial agonist ka and postitive modulator (r,r)-2b complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
85
structure length
85
Chain Sequence
GPADCCRMKECCTDRVNECLQRYSGREDKFVSFCYQEATVTCGSFNEIVGCCYGYQMCMIRVVKPNSLSGAHEACKTVSCGNPCA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutamate receptor 2
publication title X-ray structures of AMPA receptor-cone snail toxin complexes illuminate activation mechanism.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport protein/toxin
total genus 25
structure length 85
sequence length 85
chains with identical sequence F
ec nomenclature
pdb deposition date 2014-07-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1800 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4u5dE00
4U5HA 4U5FE 4U5DE 4U5GA 4U5BE 4U5CE 4U5EE
chains in the Genus database with same CATH superfamily
2HSBA 2Q4FA 1DOVA 3L1MA 3NMIA 3EH2A 4IARA 4EHPA 4FX5A 2GWWA 2XM0A 2RD9A 4K1OA 2QLAA 4U5EE 3S9OA 4J30B 1LI7A 3TJ6A 2R7WA 1ZU4A 3JSZA 2KK1A 1Q0GA 2OJQA 2BC5A 4MW8A 1LM3B 4NTBA 4MVSA 3RFYA 2AP3A 2Y3GA 4OINF 2HMZA 2HS5A 3BRJA 3MFNA 1ZHZA 3VRCA 1KNYA 3DJNB 1JPNA 4HFKB 1W2WA 3G50A 2C03A 2L9JA 3B0UX 2IBFA 3GM3A 5GPGB 1NU7D 5L0IA 3NKEA 4C7OB 2Y39A 3WG7C 3WODF 1FMWA 2R7XA 1H9GA 2WB7A 1JOGA 1OXKA 3OA1A 2LCHA 3V5YA 5DS6A 1HMDA 3VYWA 1RXQA 4WABA 4XWJA 3RKOF 2CNWA 1C02A 1ORSC 2YZSA 2MWQA 1APCA 1D0XA 3LNMB 2FAPB 2OG2A 4E7SA 2VCBA 1OW6A 1ZHTA 2H7BA 1OCCC 2P6VA 3GORA 4LLCA 4PR9A 3TQOA 2DYSC 2GDCA 2PFDA 3M15A 1ZZPA 4ULVA 1PV3A 1NFOA 2EIKC 3HNJA 5CI8A 5DLJA 4ANJA 3B0PA 1TR2A 2IXOA 2R05A 4IJJA 4CS7A 3FXHA 3ZDLA 2LK4A 1K05A 2NSGA 3GODA 1BR2A 4JZAA 2L6FA 3FVYA 4J7TA 1WTYA 2JPUA 4PJMA 2KJGA 3JTLO 4N06A 3V5XA 2G3KA 2XS1A 2YQYA 2OOCA 2ZD9A 3N24A 3T9OA 4A2NB 3TD7A 4RBNA 1Z23A 2Q9AA 2TMVP 4CSAA 2FGYA 5HSWA 3NKDA 3SXMA 4EIYA 4UDVA 2C04A 2YVKA 2YLIA 2CDQA 3GEIA 4IWBA 2NUTB 4LLEA 5B3SC 4D4XA 2XLHA 4JJFA 4K7BA 1R5ID 3TK0A 4JIOA 4N4WA 1QPUA 4MTOA 3UMIA 1YJGA 2CGEA 4F4BA 1WN0A 2J0XA 2IXPA 1OW7A 4CS9A 3QW0A 1QLEC 3AG1C 3VM6A 4R32A 2LQGA 2VCAA 3DE8A 3S84A 4MVQA 3A11A 3E9VA 4I44A 3SXYA 2UUHA 2HV7A 3K7DA 4O6YA 1V55C 3RQEA 3EQLF 3U2LA 3CEXA 3ZTMA 5BUOA 1YZCA 2XL4A 4EUKB 1V74B 2KQ9A 3ITFA 4U5GA 4JKVA 1QQ3A 3MYFA 3TJ5A 2XSEA 4OIPF 3IEEA 3EZIA 4OIOF 2R02A 3NMKA 4KBLA 1MMDA 2R7SA 2LFFA 4FESA 4BEJA 1NFNA 3Q6MA 2RSEB 1OW8A 1TFKB 1EI7A 3SEOA 1U6HA 3H65A 2PNOA 4DRHB 1ZHYA 1RJ9A 1TQGA 5EGYA 1VLTA 1Y4CA 1GM5A 4XEFA 1HE1A 3KYJA 4BJTA 5KYXA 1NG1A 1O87A 2W9YA 3MLGA 5F5FA 4YJWA 4OIRF 3K6BA 1MMNA 2R9RB 4CJGA 2Y3DA 4RD9A 4U5FE 1OKKA 2HUJA 5F28E 3PMRA 3HKKA 3L34A 5T3WA 3R7CA 2J9UA 1O5HA 2XM4A 1FFTC 4Z9IA 2OJED 1LPEA 2YRFA 4JW1A 3EJNA 2NUPA 1YYJA 2HSQA 3NDBB 4XPXA 1I4ZA 3ZC4A 1K04A 2XS8A 4GYTA 5JP7A 3DI5A 2ZPAA 1G4US 4D4NA 5T1DB 3TOLA 2XL8A 2L81A 1QKRA 2P61A 3EGDA 4I1MA 4MW3A 4KI2A 5JSLA 4ZLDA 2R7OA 1T6IA 2G3VA 3L8JA 2R7TA 1T5OA 3DE9A 2OU6A 4PJNA 5L0DA 2WVNA 3RVZA 3AQBA 2O9XA 3IPMO 3JRMO 4GEHA 5AGFA 5E2QA 5E3CA 3IQTA 2IXMA 3AQCA 3K66A 3NG1A 4U5HA 3JYHA 4J32B 3B71A 1RCPA 3C8GD 3U9MA 1YLMA 3LLIA 1I4YA 1MMAA 3C8GA 2ICWG 1E2XA 4MTFA 4NC3A 3U0CA 1TFOB 4DRIB 5DQZA 4E0HA 4C3EA 1SF8A 2WVOA 2YHSA 4CS8A 4O7GA 2NUTA 1BZ4A 1E86A 3LS1A 1K40A 3SYNA 1CPRA 1RJ9B 3KYIA 1WASA 1D1CA 2R7UA 1MQVA 5FZTA 5DQTA 5A69A 1AEPA 1OCRC 4P6IC 1NU9C 4AE4A 1BR1A 4Z9JA 2EPOA 4CS9C 5COFA 3M1CB 1VYIA 3GM2A 3ECSA 3NRHA 5CI9A 5CIVA 5L0CA 4EBJA 2HJ3A 5JS5A 2OKUA 1VK5A 2V26A 1D1AA 4BJ6C 1AVOB 2YL3A 2HV6A 4Q7CA 3AGUA 2H7OA 4KNVA 3I5PA 1OR3A 3LJBA 1SYQA 3X2QC 1VMAA 2Z15A 4CJOA 3C18A 4N6CA 5KYYB 1SMYF 4MVMA 4JVSA 3S28A 1ZW2A 1ZW3A 5L3QA 2PX3A 3I5QA 2GA0A 2A1DD 2NUPB 3AG4C 3C8ZA 1O3UA 3GEEA 1PCXA 4CIHA 3AG2C 5L0JA 5A6JA 2LSEA 4O6NA 3SXZA 4XLNF 3ZIBA 2DI3A 4DRJB 3CQZA 5EHHA 1ORYA 2L6GA 3EGDB 3V5ZA 2YLGA 4H54A 4PJLA 1UG7A 3EGXA 4XTKA 1CPQA 4M63A 4NTAA 3EFOB 2AWCA 4E0IA 5A6BD 4U5BE 2BL2A 5B1AC 1LI5A 5B3IA 1GS9A 2DB4A 1IZMA 4MVUA 4O6MA 2ZXWC 3EHNA 4W8PA 5AC4A 1UFBA 5KYWA 3K1IA 3EPVA 1OCZC 3E70C 3LAYA 4XEKA 3C8GB 4G78A 1E83A 2KC3A 2P0NA 1NSGB 1TWHA 2J8WA 2R7RA 4BPMA 2JX0A 2V3CC 3KL4A 1JPJA 1S7ZA 2KSFA 4OIQF 2EIJC 2XLMA 3KH2A 2ETSA 2PX0A 4CBEA 4P9FA 3S29A 3K33A 3M79A 1LS1A 1MNEA 4PFPA 2J0WA 3LS0A 3RIPA 5BQHA 2XRHA 4JE9A 2P7VA 2LD6A 2EPNA 1D0ZA 3AG3C 3C63A 3DZAA 4AE4B 3FMSA 4BJ5A 3ASNC 4MNDA 3ATPA 4K0DA 3RVYA 3S27A 1J8MF 3DD7A 4E18A 1YA7O 3PHF2 5HV9A 5DS4A 5JT4A 1MNDA 4BJ6A 2I8BA 2P1AA 4U9EA 3T4RA 4JTDB 3SXKA 3N0TA 2A69F 3U2MA 1FNTc 4U9DA 1T01A 3JCUQ 2HZ8A 3VF0A 4JTCB 4KNWA 5D91A 3VAYA 4JJGA 5IY5C 4AL0A 1PD1A 1L3PA 2IM8A 1A7VA 2Q9CA 3FOOA 5FCLA 3F46A 4CS8C 4G7ZF 4Z9HA 2E87A 3Q7GA 5AC5A 4YT5A 1B68A 3C7JA 3DMDA 4CDVA 1NBBA 1H6GA 4KC9A 2XLVA 1XWJA 2Y3BA 1KU2A 3GEHA 3ZQVA 2WVQA 1BDJB 1HW1A 4BEMJ 2XL6A 1R4TA 1V54C 1Z5ZA 2KW3C 4DBQA 2DGJA 3WAQA 2HJMA 3EGXB 4C3BA 2A6EF 3ZQYA 2YKZA 4PFOA 3MYIA 2IYLD 3ZVRA 2I15A 4MVZA 4DOZA 1BBHA 1VOMA 2FFHA 3NYJA 1RMVA 3PCVA 4NQFA 5KYWB 1ST6A 1N1CA 2QE9A 2A0UA 1DOWA 1FAPB 4NCQA 1HMOA 2Q9BA 5COMA 3X1OA 2VC9A 4C3DA 3G4ZA 5KYYA 4XLPF 3UMKA 2ASRA 2R7QA 4JCZA 4MS2A 1ZVZA 2W4BA 3J06A 2DYRC 3T6GB 1GGQA 3R2PA 4LDRA 3W8HA 1RKEB 4WGZA 3W8IA 3C62A 4WGYA 4HE8D 4EKWA 2EINC 4MVRA 5DS5A 4G7OF 3H2VA 3KKBA 3KMIA 5JLIA 3ZWIA 4PK4A 3RQGA 4NY3A 1EKYA 1OCOC 3ZTZA 3IQCA 5KYUB 1ZHXA 4EBBA 5F5HA 1WATA 1VYKA 2J45A 1I5NA 1OXBA 2J7PD 2Y69C 4MTGA 1Q0KA 2AVKA 2EPKX 1M2OA 3EFOA 3DAFA 3GANA 1YARO 4AX2A 3RH3A 2J9WA 3LESA 3UGPA 4QI0A 1A0BA 1V4AA 5BQIA 2OCCC 3K1IC 3DM5A 4J7YA 4YT2A 1M57C 1D1BA 1Z3IX 2NSFA 3U3BA 2QY9A 3FHDA 1IW7F 1Q0FA 2WZGA 1SZIA 1JRAA 3I4UA 3M4CA 3OWTA 4HFFB 2YWAA 3JZ0A 4L6RA 2D4UA 1VB5A 3A9CA 4AL1A 3GWLA 2R25A 2XLOA 3OEOA 4FAPB 3DXJF 1HE9A 2Y3HA 3POVA 4JCHA 3T6BA 1Q0MA 1T6QA 2J9VA 3DAGA 1CGME 3FOPA 2VB6A 2BE5F 2NG1A 2WZLA 4JEBA 4BJ1A 1T9KA 1TKNA 2YEVA 4BJ5C 4YT4A 3AJMA 3NYMA 2CW0F 2XLDA 5A6AA 3HTKC 4XEVA 2GFHA 3QTHA 2EPLX 4ULWA 3S0XA 1E85A 5E3AA 5D92A 2EIMC 2J9BA 1ORJA 1J8YF 4JURI 4U5DE 1U0BB 1XZQA 1TWCA 1MMGA 4EWCA 1KTMA 3NYLA 4Q4ZF 3W2WA 2B0JA 3QMKA 2G62A 2M4EA 2JD3A 3BEHA 1SR2A 3NMJA 3W4YA 1H9TA 4ZLCA 4IAQA 1LKXA 2CYDA 4WJ0A 2YLDA 1U89A 1QVXA 4GQHA 1GQAA 1BR4A 1ZU5A 2OEVA 1PD0A 2PF4E 3O39A 3ABLC 5DVWA 4DJ9A 1QZXA 3SZRA 3LUTB 1WOLA 4DVYP 4O79A 2ZXOA 3RYLA 1A7EA 1YVIA 2PBEA 3B9QA 2KYHA 3LEVA 3US6A 3LLKA 3JYYA 4JRZA 5L0GA 3ABMC 3CAXA 3JRTA 4PJJA 5BQGA 1LS4A 2A68F 4DVZA 5KYNA 5A6BA 4LDQA 3ZG1A 2YL1A 3EG9A 2XXAA 2ZXPA 1G4WR 2CNWD 1EA8A 3EZHA 4N6HA 1L7CA 4MQ9F 2VASA 2AU5A 2AWYA 2YL0A 3Q7LA 3QVYA 1LE2A 1NLXA 4DXWA 3N2ZB 2W45A 1T6UA 3L8IA 1RKEA 4LACB 1LE4A 4G0HA 2X0CA 5A6KA 4OD5A 4E7ZA 1ZHWA 3MX3A 3W2VA 4BG0A 3DKAA 2LP4A 5L0FA 2M64A 3EHMA 3RW0A 3KPHA 3UNGC 2XLWA 4HEAJ 4RDAA 5KYXB 3IHUA 3IQ6A 3O6XA 4JEAA 4IB4A 2A0BA 3K1HA 5KYUA 4ER9A 4YN0B 2F22A 3L0IA 4YWQA 1TWGA 4YL0A 3ABKC 1OQCA 1YYXA 3RF3A 2Q3TA 1FTSA 2L6HA 5T3TA 3V7OA 3UR3C 3B29A 5L3VA 2XLEA 3IQ5A 4JC7A 2H8AA 2HMQA 1Z6AA 3O55A 1XZPA 1M2VA 2IOQA 3HLZA 5K0IA 5COGA 2WZFA 2MYSA 1FMVA 3F47A 4MVOA 3HNKA 1JMWA 3GWNA 3M4BA 2QTVA 3U8PA 3UGOA 3HJCA 4B6IA 2Q00A 2LIGA 3EH1A 5E33A 4CX9A 2KGOA 2CCYA 3U5SA 3DJUB 2GAQA 2YL7A 1C03A 2X51A 1QSPA 2VCCA 3SNHA 4YL3A 3TOMA 3HNIA 3QZCA 2D5RB 4CDAA 2IXNA 4CDYA 3FDQA 3B0VC 2QNLA 5B1BC 4YT8A 2PP4A 2HKVA 4XQ1A 5EK0A 4XPYA 4ONSA 1H7IA 1WWPA 2EILC 1F1MA 1A41A 3JSEO 2UUIA 3EG9B 2XXAB 5JUAA 1OR2A 3QVZA 4IAOA 1Q0DA 3JT1A 1Y6DA 4H4KC 3HNLA 4X0RA 3QW1A 1YA9A 1LIHA 1HW2A 3O10A 1G8XA 3U9JA 4U5CE 4YK5A 1VLSA 1AUEA 4AK9A 1FFHA 3AOUA 3S90A 256BA 3Q6NA 3RQFA 1CGOA 4CIPA 4Q5SF 1HY5A 2OEXA 4FWVA 1G5ZA 1Z7Qc 4LERA 4EBKA 1C17M 1JR8A 3LEOA 2B0HA 3DM9B 4OD4A 3T6JA 5L0HA 5JRAA 1TWAA 5JVEA 4C7OA 3CZ6A 1OKKD 2J7PA 2L7AA 1YAUO 4I1OB 3U8VA 4W8KA 1RKCA 2MHRA 3WHNA 4NTFA 5TJ5E 1M56C 4A4AA 3MBGA 1E84A 3FAPB 1FR0A 1A7DA 1M2VB 2LFDA 4P9TA 3H2UA 2H7VC 2ZXRA 2KNHA 2W4MA 2R7VA 1YDIA 3U3FA 2VH3A 3AGTA 1CGNA 4DBRA 3TULA 1NZEA 4XPWA 3G4XA 4IRUA 3DWWA 4QDLA 3UMHA 2A6HF 4YL1A 2OQMA 1D0YA 1YZAA 1Z63A 3GM1A 1ZYRF 4I3MA 3ZSUA 2Q7RA 2WL8A 3ASOC 2J46A 1WGWA 2R03A 4JTAB 3FAJA 2QUPA 2HFIA 1S05A 2EPMX 1LVKA 3CSKA 4PACA 3SP1A 3LNRA 4G7HF 1M6TA 1EQ1A 4IGGA 2NPUA 3PDMP 4CSAC 1VTMP 1JAFA 4QI2A 4E17A 4LDKA
chains in the Genus database with same CATH topology
3EH2A 4FX5A 2R7WA 4U5EE 4J30B 1ZU4A 3JSZA 3RFYA 2Y3GA 4OINF 1ZHZA 3DJNB 1JPNA 4HFKB 1W2WA 2C03A 2L9JA 3B0UX 1NU7D 4C7OB 3NKEA 2Y39A 3WG7C 3WODF 1FMWA 2R7XA 2WB7A 3OA1A 5DS6A 3VYWA 4XWJA 3RKOF 2CNWA 2YZSA 2MWQA 1D0XA 2OG2A 4E7SA 1ZHTA 2H7BA 1OCCC 2P6VA 4LLCA 2DYSC 2PFDA 5CI8A 5DLJA 2EIKC 4ANJA 3B0PA 1TR2A 2IXOA 4IJJA 4CS7A 4JZAA 3GODA 1BR2A 3FVYA 4PJMA 2KJGA 4N06A 2G3KA 3N24A 4A2NB 3TD7A 4RBNA 1Z23A 2Q9AA 4CSAA 2FGYA 5HSWA 3NKDA 2C04A 2CDQA 4IWBA 5B3SC 2NUTB 4LLEA 4JJFA 4K7BA 3UMIA 2CGEA 4F4BA 2J0XA 2IXPA 4CS9A 1QLEC 3AG1C 3E9VA 4I44A 2HV7A 3K7DA 4O6YA 1V55C 3EQLF 5BUOA 2XL4A 2KQ9A 3ITFA 4U5GA 4OIPF 2XSEA 3IEEA 3EZIA 4OIOF 4KBLA 1MMDA 2R7SA 4BEJA 4FESA 3Q6MA 3SEOA 3H65A 1ZHYA 1RJ9A 5EGYA 4BJTA 5KYXA 1NG1A 1O87A 2W9YA 3MLGA 5F5FA 4YJWA 4OIRF 3K6BA 1MMNA 2Y3DA 4RD9A 4U5FE 1OKKA 3PMRA 3L34A 5T3WA 2J9UA 1O5HA 1FFTC 4JW1A 3EJNA 2NUPA 3NDBB 3ZC4A 4GYTA 2ZPAA 5T1DB 2L81A 3EGDA 4I1MA 4KI2A 4ZLDA 2R7OA 2G3VA 2R7TA 4PJNA 2WVNA 3AQBA 2O9XA 4GEHA 5E2QA 5E3CA 3K66A 2IXMA 3AQCA 3NG1A 4U5HA 3JYHA 4J32B 3LLIA 1MMAA 5DQZA 4C3EA 1SF8A 2WVOA 2YHSA 4CS8A 4O7GA 2NUTA 3LS1A 3SYNA 1RJ9B 1D1CA 2R7UA 5DQTA 1OCRC 4P6IC 1NU9C 4AE4A 1BR1A 4CS9C 5KYXB 3M1CB 1VYIA 5CI9A 3ECSA 3NRHA 1VK5A 2V26A 1D1AA 4BJ6C 2HV6A 4Q7CA 4KNVA 2H7OA 3I5PA 3LJBA 3X2QC 1VMAA 2Z15A 5KYYB 1SMYF 3S28A 4JVSA 5L3QA 2PX3A 3I5QA 2A1DD 2NUPB 3AG4C 1PCXA 4CIHA 3AG2C 2LSEA 4O6NA 4XLNF 3ZIBA 3CQZA 5EHHA 3EGDB 4PJLA 3EGXA 4XTKA 4M63A 3EFOB 4U5BE 5B1AC 4O6MA 1IZMA 2ZXWC 3EHNA 5KYWA 3EPVA 1OCZC 3E70C 3LAYA 1TWHA 2R7RA 2V3CC 3KL4A 1JPJA 1S7ZA 4OIQF 2EIJC 3KH2A 2PX0A 4CBEA 3S29A 3K33A 1LS1A 1MNEA 4PFPA 2J0WA 3LS0A 3RIPA 2XRHA 2P7VA 1D0ZA 3AG3C 3DZAA 4AE4B 4BJ5A 3ASNC 4MNDA 4K0DA 3S27A 1J8MF 3DD7A 3PHF2 5DS4A 1MNDA 4BJ6A 2I8BA 3T4RA 3N0TA 2A69F 3JCUQ 4KNWA 5D91A 3VAYA 4JJGA 5IY5C 1PD1A 2Q9CA 5FCLA 3F46A 4CS8C 4G7ZF 2E87A 3Q7GA 4YT5A 3DMDA 4KC9A 2Y3BA 1KU2A 2WVQA 4DBQA 1V54C 1Z5ZA 2KW3C 2DGJA 3EGXB 4C3BA 2A6EF 4PFOA 2IYLD 3ZVRA 4DOZA 1VOMA 2FFHA 3NYJA 5KYWB 1ST6A 1N1CA 3X1OA 4C3DA 2Q9BA 4XLPF 5KYYA 3UMKA 2R7QA 2W4BA 2DYRC 3W8HA 3W8IA 4HE8D 2EINC 4G7OF 5DS5A 3KKBA 3KMIA 4PK4A 4NY3A 1OCOC 5KYUB 1ZHXA 4EBBA 5F5HA 2J45A 1VYKA 2J7PD 2Y69C 3EFOA 1M2OA 3GANA 3DAFA 4AX2A 3RH3A 2J9WA 3LESA 3UGPA 4QI0A 2OCCC 3K1IC 3DM5A 4YT2A 1M57C 1D1BA 1Z3IX 2QY9A 3FHDA 1IW7F 2WZGA 3I4UA 1SZIA 4I3MA 4HFFB 3OWTA 3OEOA 3DXJF 2Y3HA 3POVA 4JCHA 3T6BA 2J9VA 3DAGA 2VB6A 2BE5F 2NG1A 2WZLA 4BJ1A 1TKNA 2YEVA 4BJ5C 4YT4A 3NYMA 2CW0F 3HTKC 2GFHA 4ULWA 3S0XA 5E3AA 5D92A 2EIMC 4JURI 1J8YF 4U5DE 1TWCA 1MMGA 4EWCA 3NYLA 4Q4ZF 3W2WA 2B0JA 3QMKA 2G62A 2M4EA 2JD3A 4ZLCA 1LKXA 4WJ0A 3T6JA 2PF4E 1BR4A 1ZU5A 5DVWA 1PD0A 3O39A 3ABLC 1QZXA 3SZRA 4DVYP 4O79A 2ZXOA 3RYLA 3B9QA 3LEVA 3LLKA 3ABMC 3JRTA 4PJJA 2A68F 4DVZA 5KYNA 3ZG1A 3EG9A 2XXAA 2ZXPA 2CNWD 3EZHA 4MQ9F 2VASA 3Q7LA 3N2ZB 2W45A 4LACB 4G0HA 4OD5A 4E7ZA 1ZHWA 3MX3A 3W2VA 4BG0A 3EHMA 3UNGC 4RDAA 4HEAJ 3O6XA 3K1HA 5KYUA 4YN0B 3L0IA 4YWQA 1TWGA 3ABKC 3V7OA 2Q3TA 1FTSA 5T3TA 3UR3C 5L3VA 1Z6AA 1M2VA 2IOQA 3HLZA 2WZFA 2MYSA 1FMVA 3F47A 2QTVA 3UGOA 3HJCA 4B6IA 3EH1A 5E33A 2KGOA 3DJUB 2X51A 3SNHA 3FDQA 3QZCA 3B0VC 2D5RB 2IXNA 5B1BC 4YT8A 2PP4A 2EILC 3EG9B 2XXAB 4IAOA 3JT1A 4H4KC 4X0RA 1G8XA 4U5CE 4AK9A 1FFHA 3Q6NA 4Q5SF 4FWVA 4LERA 3DM9B 4OD4A 1TWAA 4C7OA 3CZ6A 1OKKD 2J7PA 4I1OB 4W8KA 1M56C 1M2VB 2H7VC 2ZXRA 2KNHA 2W4MA 2R7VA 2VH3A 4DBRA 1NZEA 4IRUA 4QDLA 3UMHA 2A6HF 1D0YA 1Z63A 1ZYRF 3ZSUA 2WL8A 3ASOC 2J46A 1WGWA 3FAJA 1LVKA 3CSKA 3SP1A 3LNRA 4G7HF 4CSAC 4QI2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U5H A;  4U5F E;  4U5D E;  4U5G A;  4U5B E;  4U5C E;  4U5E E; 
#chains in the Genus database with same CATH topology
 2HSB A;  2Q4F A;  1DOV A;  3L1M A;  3NMI A;  3EH2 A;  4IAR A;  4EHP A;  4FX5 A;  2GWW A;  2XM0 A;  2RD9 A;  4K1O A;  2QLA A;  4U5E E;  3S9O A;  4J30 B;  1LI7 A;  3TJ6 A;  2R7W A;  1ZU4 A;  3JSZ A;  2KK1 A;  1Q0G A;  2OJQ A;  2BC5 A;  4MW8 A;  1LM3 B;  4NTB A;  4MVS A;  3RFY A;  2AP3 A;  2Y3G A;  4OIN F;  2HMZ A;  2HS5 A;  3BRJ A;  3MFN A;  1ZHZ A;  3VRC A;  1KNY A;  3DJN B;  1JPN A;  4HFK B;  1W2W A;  3G50 A;  2C03 A;  2L9J A;  3B0U X;  2IBF A;  3GM3 A;  5GPG B;  1NU7 D;  5L0I A;  3NKE A;  4C7O B;  2Y39 A;  3WG7 C;  3WOD F;  1FMW A;  2R7X A;  1H9G A;  2WB7 A;  1JOG A;  1OXK A;  3OA1 A;  2LCH A;  3V5Y A;  5DS6 A;  1HMD A;  3VYW A;  1RXQ A;  4WAB A;  4XWJ A;  3RKO F;  2CNW A;  1C02 A;  1ORS C;  2YZS A;  2MWQ A;  1APC A;  1D0X A;  3LNM B;  2FAP B;  2OG2 A;  4E7S A;  2VCB A;  1OW6 A;  1ZHT A;  2H7B A;  1OCC C;  2P6V A;  3GOR A;  4LLC A;  4PR9 A;  3TQO A;  2DYS C;  2GDC A;  2PFD A;  3M15 A;  1ZZP A;  4ULV A;  1PV3 A;  1NFO A;  2EIK C;  3HNJ A;  5CI8 A;  5DLJ A;  4ANJ A;  3B0P A;  1TR2 A;  2IXO A;  2R05 A;  4IJJ A;  4CS7 A;  3FXH A;  3ZDL A;  2LK4 A;  1K05 A;  2NSG A;  3GOD A;  1BR2 A;  4JZA A;  2L6F A;  3FVY A;  4J7T A;  1WTY A;  2JPU A;  4PJM A;  2KJG A;  3JTL O;  4N06 A;  3V5X A;  2G3K A;  2XS1 A;  2YQY A;  2OOC A;  2ZD9 A;  3N24 A;  3T9O A;  4A2N B;  3TD7 A;  4RBN A;  1Z23 A;  2Q9A A;  2TMV P;  4CSA A;  2FGY A;  5HSW A;  3NKD A;  3SXM A;  4EIY A;  4UDV A;  2C04 A;  2YVK A;  2YLI A;  2CDQ A;  3GEI A;  4IWB A;  2NUT B;  4LLE A;  5B3S C;  4D4X A;  2XLH A;  4JJF A;  4K7B A;  1R5I D;  3TK0 A;  4JIO A;  4N4W A;  1QPU A;  4MTO A;  3UMI A;  1YJG A;  2CGE A;  4F4B A;  1WN0 A;  2J0X A;  2IXP A;  1OW7 A;  4CS9 A;  3QW0 A;  1QLE C;  3AG1 C;  3VM6 A;  4R32 A;  2LQG A;  2VCA A;  3DE8 A;  3S84 A;  4MVQ A;  3A11 A;  3E9V A;  4I44 A;  3SXY A;  2UUH A;  2HV7 A;  3K7D A;  4O6Y A;  1V55 C;  3RQE A;  3EQL F;  3U2L A;  3CEX A;  3ZTM A;  5BUO A;  1YZC A;  2XL4 A;  4EUK B;  1V74 B;  2KQ9 A;  3ITF A;  4U5G A;  4JKV A;  1QQ3 A;  3MYF A;  3TJ5 A;  2XSE A;  4OIP F;  3IEE A;  3EZI A;  4OIO F;  2R02 A;  3NMK A;  4KBL A;  1MMD A;  2R7S A;  2LFF A;  4FES A;  4BEJ A;  1NFN A;  3Q6M A;  2RSE B;  1OW8 A;  1TFK B;  1EI7 A;  3SEO A;  1U6H A;  3H65 A;  2PNO A;  4DRH B;  1ZHY A;  1RJ9 A;  1TQG A;  5EGY A;  1VLT A;  1Y4C A;  1GM5 A;  4XEF A;  1HE1 A;  3KYJ A;  4BJT A;  5KYX A;  1NG1 A;  1O87 A;  2W9Y A;  3MLG A;  5F5F A;  4YJW A;  4OIR F;  3K6B A;  1MMN A;  2R9R B;  4CJG A;  2Y3D A;  4RD9 A;  4U5F E;  1OKK A;  2HUJ A;  5F28 E;  3PMR A;  3HKK A;  3L34 A;  5T3W A;  3R7C A;  2J9U A;  1O5H A;  2XM4 A;  1FFT C;  4Z9I A;  2OJE D;  1LPE A;  2YRF A;  4JW1 A;  3EJN A;  2NUP A;  1YYJ A;  2HSQ A;  3NDB B;  4XPX A;  1I4Z A;  3ZC4 A;  1K04 A;  2XS8 A;  4GYT A;  5JP7 A;  3DI5 A;  2ZPA A;  1G4U S;  4D4N A;  5T1D B;  3TOL A;  2XL8 A;  2L81 A;  1QKR A;  2P61 A;  3EGD A;  4I1M A;  4MW3 A;  4KI2 A;  5JSL A;  4ZLD A;  2R7O A;  1T6I A;  2G3V A;  3L8J A;  2R7T A;  1T5O A;  3DE9 A;  2OU6 A;  4PJN A;  5L0D A;  2WVN A;  3RVZ A;  3AQB A;  2O9X A;  3IPM O;  3JRM O;  4GEH A;  5AGF A;  5E2Q A;  5E3C A;  3IQT A;  2IXM A;  3AQC A;  3K66 A;  3NG1 A;  4U5H A;  3JYH A;  4J32 B;  3B71 A;  1RCP A;  3C8G D;  3U9M A;  1YLM A;  3LLI A;  1I4Y A;  1MMA A;  3C8G A;  2ICW G;  1E2X A;  4MTF A;  4NC3 A;  3U0C A;  1TFO B;  4DRI B;  5DQZ A;  4E0H A;  4C3E A;  1SF8 A;  2WVO A;  2YHS A;  4CS8 A;  4O7G A;  2NUT A;  1BZ4 A;  1E86 A;  3LS1 A;  1K40 A;  3SYN A;  1CPR A;  1RJ9 B;  3KYI A;  1WAS A;  1D1C A;  2R7U A;  1MQV A;  5FZT A;  5DQT A;  5A69 A;  1AEP A;  1OCR C;  4P6I C;  1NU9 C;  4AE4 A;  1BR1 A;  4Z9J A;  2EPO A;  4CS9 C;  5COF A;  3M1C B;  1VYI A;  3GM2 A;  3ECS A;  3NRH A;  5CI9 A;  5CIV A;  5L0C A;  4EBJ A;  2HJ3 A;  5JS5 A;  2OKU A;  1VK5 A;  2V26 A;  1D1A A;  4BJ6 C;  1AVO B;  2YL3 A;  2HV6 A;  4Q7C A;  3AGU A;  2H7O A;  4KNV A;  3I5P A;  1OR3 A;  3LJB A;  1SYQ A;  3X2Q C;  1VMA A;  2Z15 A;  4CJO A;  3C18 A;  4N6C A;  5KYY B;  1SMY F;  4MVM A;  4JVS A;  3S28 A;  1ZW2 A;  1ZW3 A;  5L3Q A;  2PX3 A;  3I5Q A;  2GA0 A;  2A1D D;  2NUP B;  3AG4 C;  3C8Z A;  1O3U A;  3GEE A;  1PCX A;  4CIH A;  3AG2 C;  5L0J A;  5A6J A;  2LSE A;  4O6N A;  3SXZ A;  4XLN F;  3ZIB A;  2DI3 A;  4DRJ B;  3CQZ A;  5EHH A;  1ORY A;  2L6G A;  3EGD B;  3V5Z A;  2YLG A;  4H54 A;  4PJL A;  1UG7 A;  3EGX A;  4XTK A;  1CPQ A;  4M63 A;  4NTA A;  3EFO B;  2AWC A;  4E0I A;  5A6B D;  4U5B E;  2BL2 A;  5B1A C;  1LI5 A;  5B3I A;  1GS9 A;  2DB4 A;  1IZM A;  4MVU A;  4O6M A;  2ZXW C;  3EHN A;  4W8P A;  5AC4 A;  1UFB A;  5KYW A;  3K1I A;  3EPV A;  1OCZ C;  3E70 C;  3LAY A;  4XEK A;  3C8G B;  4G78 A;  1E83 A;  2KC3 A;  2P0N A;  1NSG B;  1TWH A;  2J8W A;  2R7R A;  4BPM A;  2JX0 A;  2V3C C;  3KL4 A;  1JPJ A;  1S7Z A;  2KSF A;  4OIQ F;  2EIJ C;  2XLM A;  3KH2 A;  2ETS A;  2PX0 A;  4CBE A;  4P9F A;  3S29 A;  3K33 A;  3M79 A;  1LS1 A;  1MNE A;  4PFP A;  2J0W A;  3LS0 A;  3RIP A;  5BQH A;  2XRH A;  4JE9 A;  2P7V A;  2LD6 A;  2EPN A;  1D0Z A;  3AG3 C;  3C63 A;  3DZA A;  4AE4 B;  3FMS A;  4BJ5 A;  3ASN C;  4MND A;  3ATP A;  4K0D A;  3RVY A;  3S27 A;  1J8M F;  3DD7 A;  4E18 A;  1YA7 O;  3PHF 2;  5HV9 A;  5DS4 A;  5JT4 A;  1MND A;  4BJ6 A;  2I8B A;  2P1A A;  4U9E A;  3T4R A;  4JTD B;  3SXK A;  3N0T A;  2A69 F;  3U2M A;  1FNT c;  4U9D A;  1T01 A;  3JCU Q;  2HZ8 A;  3VF0 A;  4JTC B;  4KNW A;  5D91 A;  3VAY A;  4JJG A;  5IY5 C;  4AL0 A;  1PD1 A;  1L3P A;  2IM8 A;  1A7V A;  2Q9C A;  3FOO A;  5FCL A;  3F46 A;  4CS8 C;  4G7Z F;  4Z9H A;  2E87 A;  3Q7G A;  5AC5 A;  4YT5 A;  1B68 A;  3C7J A;  3DMD A;  4CDV A;  1NBB A;  1H6G A;  4KC9 A;  2XLV A;  1XWJ A;  2Y3B A;  1KU2 A;  3GEH A;  3ZQV A;  2WVQ A;  1BDJ B;  1HW1 A;  4BEM J;  2XL6 A;  1R4T A;  1V54 C;  1Z5Z A;  2KW3 C;  4DBQ A;  2DGJ A;  3WAQ A;  2HJM A;  3EGX B;  4C3B A;  2A6E F;  3ZQY A;  2YKZ A;  4PFO A;  3MYI A;  2IYL D;  3ZVR A;  2I15 A;  4MVZ A;  4DOZ A;  1BBH A;  1VOM A;  2FFH A;  3NYJ A;  1RMV A;  3PCV A;  4NQF A;  5KYW B;  1ST6 A;  1N1C A;  2QE9 A;  2A0U A;  1DOW A;  1FAP B;  4NCQ A;  1HMO A;  2Q9B A;  5COM A;  3X1O A;  2VC9 A;  4C3D A;  3G4Z A;  5KYY A;  4XLP F;  3UMK A;  2ASR A;  2R7Q A;  4JCZ A;  4MS2 A;  1ZVZ A;  2W4B A;  3J06 A;  2DYR C;  3T6G B;  1GGQ A;  3R2P A;  4LDR A;  3W8H A;  1RKE B;  4WGZ A;  3W8I A;  3C62 A;  4WGY A;  4HE8 D;  4EKW A;  2EIN C;  4MVR A;  5DS5 A;  4G7O F;  3H2V A;  3KKB A;  3KMI A;  5JLI A;  3ZWI A;  4PK4 A;  3RQG A;  4NY3 A;  1EKY A;  1OCO C;  3ZTZ A;  3IQC A;  5KYU B;  1ZHX A;  4EBB A;  5F5H A;  1WAT A;  1VYK A;  2J45 A;  1I5N A;  1OXB A;  2J7P D;  2Y69 C;  4MTG A;  1Q0K A;  2AVK A;  2EPK X;  1M2O A;  3EFO A;  3DAF A;  3GAN A;  1YAR O;  4AX2 A;  3RH3 A;  2J9W A;  3LES A;  3UGP A;  4QI0 A;  1A0B A;  1V4A A;  5BQI A;  2OCC C;  3K1I C;  3DM5 A;  4J7Y A;  4YT2 A;  1M57 C;  1D1B A;  1Z3I X;  2NSF A;  3U3B A;  2QY9 A;  3FHD A;  1IW7 F;  1Q0F A;  2WZG A;  1SZI A;  1JRA A;  3I4U A;  3M4C A;  3OWT A;  4HFF B;  2YWA A;  3JZ0 A;  4L6R A;  2D4U A;  1VB5 A;  3A9C A;  4AL1 A;  3GWL A;  2R25 A;  2XLO A;  3OEO A;  4FAP B;  3DXJ F;  1HE9 A;  2Y3H A;  3POV A;  4JCH A;  3T6B A;  1Q0M A;  1T6Q A;  2J9V A;  3DAG A;  1CGM E;  3FOP A;  2VB6 A;  2BE5 F;  2NG1 A;  2WZL A;  4JEB A;  4BJ1 A;  1T9K A;  1TKN A;  2YEV A;  4BJ5 C;  4YT4 A;  3AJM A;  3NYM A;  2CW0 F;  2XLD A;  5A6A A;  3HTK C;  4XEV A;  2GFH A;  3QTH A;  2EPL X;  4ULW A;  3S0X A;  1E85 A;  5E3A A;  5D92 A;  2EIM C;  2J9B A;  1ORJ A;  1J8Y F;  4JUR I;  4U5D E;  1U0B B;  1XZQ A;  1TWC A;  1MMG A;  4EWC A;  1KTM A;  3NYL A;  4Q4Z F;  3W2W A;  2B0J A;  3QMK A;  2G62 A;  2M4E A;  2JD3 A;  3BEH A;  1SR2 A;  3NMJ A;  3W4Y A;  1H9T A;  4ZLC A;  4IAQ A;  1LKX A;  2CYD A;  4WJ0 A;  2YLD A;  1U89 A;  1QVX A;  4GQH A;  1GQA A;  1BR4 A;  1ZU5 A;  2OEV A;  1PD0 A;  2PF4 E;  3O39 A;  3ABL C;  5DVW A;  4DJ9 A;  1QZX A;  3SZR A;  3LUT B;  1WOL A;  4DVY P;  4O79 A;  2ZXO A;  3RYL A;  1A7E A;  1YVI A;  2PBE A;  3B9Q A;  2KYH A;  3LEV A;  3US6 A;  3LLK A;  3JYY A;  4JRZ A;  5L0G A;  3ABM C;  3CAX A;  3JRT A;  4PJJ A;  5BQG A;  1LS4 A;  2A68 F;  4DVZ A;  5KYN A;  5A6B A;  4LDQ A;  3ZG1 A;  2YL1 A;  3EG9 A;  2XXA A;  2ZXP A;  1G4W R;  2CNW D;  1EA8 A;  3EZH A;  4N6H A;  1L7C A;  4MQ9 F;  2VAS A;  2AU5 A;  2AWY A;  2YL0 A;  3Q7L A;  3QVY A;  1LE2 A;  1NLX A;  4DXW A;  3N2Z B;  2W45 A;  1T6U A;  3L8I A;  1RKE A;  4LAC B;  1LE4 A;  4G0H A;  2X0C A;  5A6K A;  4OD5 A;  4E7Z A;  1ZHW A;  3MX3 A;  3W2V A;  4BG0 A;  3DKA A;  2LP4 A;  5L0F A;  2M64 A;  3EHM A;  3RW0 A;  3KPH A;  3UNG C;  2XLW A;  4HEA J;  4RDA A;  5KYX B;  3IHU A;  3IQ6 A;  3O6X A;  4JEA A;  4IB4 A;  2A0B A;  3K1H A;  5KYU A;  4ER9 A;  4YN0 B;  2F22 A;  3L0I A;  4YWQ A;  1TWG A;  4YL0 A;  3ABK C;  1OQC A;  1YYX A;  3RF3 A;  2Q3T A;  1FTS A;  2L6H A;  5T3T A;  3V7O A;  3UR3 C;  3B29 A;  5L3V A;  2XLE A;  3IQ5 A;  4JC7 A;  2H8A A;  2HMQ A;  1Z6A A;  3O55 A;  1XZP A;  1M2V A;  2IOQ A;  3HLZ A;  5K0I A;  5COG A;  2WZF A;  2MYS A;  1FMV A;  3F47 A;  4MVO A;  3HNK A;  1JMW A;  3GWN A;  3M4B A;  2QTV A;  3U8P A;  3UGO A;  3HJC A;  4B6I A;  2Q00 A;  2LIG A;  3EH1 A;  5E33 A;  4CX9 A;  2KGO A;  2CCY A;  3U5S A;  3DJU B;  2GAQ A;  2YL7 A;  1C03 A;  2X51 A;  1QSP A;  2VCC A;  3SNH A;  4YL3 A;  3TOM A;  3HNI A;  3QZC A;  2D5R B;  4CDA A;  2IXN A;  4CDY A;  3FDQ A;  3B0V C;  2QNL A;  5B1B C;  4YT8 A;  2PP4 A;  2HKV A;  4XQ1 A;  5EK0 A;  4XPY A;  4ONS A;  1H7I A;  1WWP A;  2EIL C;  1F1M A;  1A41 A;  3JSE O;  2UUI A;  3EG9 B;  2XXA B;  5JUA A;  1OR2 A;  3QVZ A;  4IAO A;  1Q0D A;  3JT1 A;  1Y6D A;  4H4K C;  3HNL A;  4X0R A;  3QW1 A;  1YA9 A;  1LIH A;  1HW2 A;  3O10 A;  1G8X A;  3U9J A;  4U5C E;  4YK5 A;  1VLS A;  1AUE A;  4AK9 A;  1FFH A;  3AOU A;  3S90 A;  256B A;  3Q6N A;  3RQF A;  1CGO A;  4CIP A;  4Q5S F;  1HY5 A;  2OEX A;  4FWV A;  1G5Z A;  1Z7Q c;  4LER A;  4EBK A;  1C17 M;  1JR8 A;  3LEO A;  2B0H A;  3DM9 B;  4OD4 A;  3T6J A;  5L0H A;  5JRA A;  1TWA A;  5JVE A;  4C7O A;  3CZ6 A;  1OKK D;  2J7P A;  2L7A A;  1YAU O;  4I1O B;  3U8V A;  4W8K A;  1RKC A;  2MHR A;  3WHN A;  4NTF A;  5TJ5 E;  1M56 C;  4A4A A;  3MBG A;  1E84 A;  3FAP B;  1FR0 A;  1A7D A;  1M2V B;  2LFD A;  4P9T A;  3H2U A;  2H7V C;  2ZXR A;  2KNH A;  2W4M A;  2R7V A;  1YDI A;  3U3F A;  2VH3 A;  3AGT A;  1CGN A;  4DBR A;  3TUL A;  1NZE A;  4XPW A;  3G4X A;  4IRU A;  3DWW A;  4QDL A;  3UMH A;  2A6H F;  4YL1 A;  2OQM A;  1D0Y A;  1YZA A;  1Z63 A;  3GM1 A;  1ZYR F;  4I3M A;  3ZSU A;  2Q7R A;  2WL8 A;  3ASO C;  2J46 A;  1WGW A;  2R03 A;  4JTA B;  3FAJ A;  2QUP A;  2HFI A;  1S05 A;  2EPM X;  1LVK A;  3CSK A;  4PAC A;  3SP1 A;  3LNR A;  4G7H F;  1M6T A;  1EQ1 A;  4IGG A;  2NPU A;  3PDM P;  4CSA C;  1VTM P;  1JAF A;  4QI2 A;  4E17 A;  4LDK A; 
#chains in the Genus database with same CATH homology
 3EH2 A;  4FX5 A;  2R7W A;  4U5E E;  4J30 B;  1ZU4 A;  3JSZ A;  3RFY A;  2Y3G A;  4OIN F;  1ZHZ A;  3DJN B;  1JPN A;  4HFK B;  1W2W A;  2C03 A;  2L9J A;  3B0U X;  1NU7 D;  4C7O B;  3NKE A;  2Y39 A;  3WG7 C;  3WOD F;  1FMW A;  2R7X A;  2WB7 A;  3OA1 A;  5DS6 A;  3VYW A;  4XWJ A;  3RKO F;  2CNW A;  2YZS A;  2MWQ A;  1D0X A;  2OG2 A;  4E7S A;  1ZHT A;  2H7B A;  1OCC C;  2P6V A;  4LLC A;  2DYS C;  2PFD A;  5CI8 A;  5DLJ A;  2EIK C;  4ANJ A;  3B0P A;  1TR2 A;  2IXO A;  4IJJ A;  4CS7 A;  4JZA A;  3GOD A;  1BR2 A;  3FVY A;  4PJM A;  2KJG A;  4N06 A;  2G3K A;  3N24 A;  4A2N B;  3TD7 A;  4RBN A;  1Z23 A;  2Q9A A;  4CSA A;  2FGY A;  5HSW A;  3NKD A;  2C04 A;  2CDQ A;  4IWB A;  5B3S C;  2NUT B;  4LLE A;  4JJF A;  4K7B A;  3UMI A;  2CGE A;  4F4B A;  2J0X A;  2IXP A;  4CS9 A;  1QLE C;  3AG1 C;  3E9V A;  4I44 A;  2HV7 A;  3K7D A;  4O6Y A;  1V55 C;  3EQL F;  5BUO A;  2XL4 A;  2KQ9 A;  3ITF A;  4U5G A;  4OIP F;  2XSE A;  3IEE A;  3EZI A;  4OIO F;  4KBL A;  1MMD A;  2R7S A;  4BEJ A;  4FES A;  3Q6M A;  3SEO A;  3H65 A;  1ZHY A;  1RJ9 A;  5EGY A;  4BJT A;  5KYX A;  1NG1 A;  1O87 A;  2W9Y A;  3MLG A;  5F5F A;  4YJW A;  4OIR F;  3K6B A;  1MMN A;  2Y3D A;  4RD9 A;  4U5F E;  1OKK A;  3PMR A;  3L34 A;  5T3W A;  2J9U A;  1O5H A;  1FFT C;  4JW1 A;  3EJN A;  2NUP A;  3NDB B;  3ZC4 A;  4GYT A;  2ZPA A;  5T1D B;  2L81 A;  3EGD A;  4I1M A;  4KI2 A;  4ZLD A;  2R7O A;  2G3V A;  2R7T A;  4PJN A;  2WVN A;  3AQB A;  2O9X A;  4GEH A;  5E2Q A;  5E3C A;  3K66 A;  2IXM A;  3AQC A;  3NG1 A;  4U5H A;  3JYH A;  4J32 B;  3LLI A;  1MMA A;  5DQZ A;  4C3E A;  1SF8 A;  2WVO A;  2YHS A;  4CS8 A;  4O7G A;  2NUT A;  3LS1 A;  3SYN A;  1RJ9 B;  1D1C A;  2R7U A;  5DQT A;  1OCR C;  4P6I C;  1NU9 C;  4AE4 A;  1BR1 A;  4CS9 C;  5KYX B;  3M1C B;  1VYI A;  5CI9 A;  3ECS A;  3NRH A;  1VK5 A;  2V26 A;  1D1A A;  4BJ6 C;  2HV6 A;  4Q7C A;  4KNV A;  2H7O A;  3I5P A;  3LJB A;  3X2Q C;  1VMA A;  2Z15 A;  5KYY B;  1SMY F;  3S28 A;  4JVS A;  5L3Q A;  2PX3 A;  3I5Q A;  2A1D D;  2NUP B;  3AG4 C;  1PCX A;  4CIH A;  3AG2 C;  2LSE A;  4O6N A;  4XLN F;  3ZIB A;  3CQZ A;  5EHH A;  3EGD B;  4PJL A;  3EGX A;  4XTK A;  4M63 A;  3EFO B;  4U5B E;  5B1A C;  4O6M A;  1IZM A;  2ZXW C;  3EHN A;  5KYW A;  3EPV A;  1OCZ C;  3E70 C;  3LAY A;  1TWH A;  2R7R A;  2V3C C;  3KL4 A;  1JPJ A;  1S7Z A;  4OIQ F;  2EIJ C;  3KH2 A;  2PX0 A;  4CBE A;  3S29 A;  3K33 A;  1LS1 A;  1MNE A;  4PFP A;  2J0W A;  3LS0 A;  3RIP A;  2XRH A;  2P7V A;  1D0Z A;  3AG3 C;  3DZA A;  4AE4 B;  4BJ5 A;  3ASN C;  4MND A;  4K0D A;  3S27 A;  1J8M F;  3DD7 A;  3PHF 2;  5DS4 A;  1MND A;  4BJ6 A;  2I8B A;  3T4R A;  3N0T A;  2A69 F;  3JCU Q;  4KNW A;  5D91 A;  3VAY A;  4JJG A;  5IY5 C;  1PD1 A;  2Q9C A;  5FCL A;  3F46 A;  4CS8 C;  4G7Z F;  2E87 A;  3Q7G A;  4YT5 A;  3DMD A;  4KC9 A;  2Y3B A;  1KU2 A;  2WVQ A;  4DBQ A;  1V54 C;  1Z5Z A;  2KW3 C;  2DGJ A;  3EGX B;  4C3B A;  2A6E F;  4PFO A;  2IYL D;  3ZVR A;  4DOZ A;  1VOM A;  2FFH A;  3NYJ A;  5KYW B;  1ST6 A;  1N1C A;  3X1O A;  4C3D A;  2Q9B A;  4XLP F;  5KYY A;  3UMK A;  2R7Q A;  2W4B A;  2DYR C;  3W8H A;  3W8I A;  4HE8 D;  2EIN C;  4G7O F;  5DS5 A;  3KKB A;  3KMI A;  4PK4 A;  4NY3 A;  1OCO C;  5KYU B;  1ZHX A;  4EBB A;  5F5H A;  2J45 A;  1VYK A;  2J7P D;  2Y69 C;  3EFO A;  1M2O A;  3GAN A;  3DAF A;  4AX2 A;  3RH3 A;  2J9W A;  3LES A;  3UGP A;  4QI0 A;  2OCC C;  3K1I C;  3DM5 A;  4YT2 A;  1M57 C;  1D1B A;  1Z3I X;  2QY9 A;  3FHD A;  1IW7 F;  2WZG A;  3I4U A;  1SZI A;  4I3M A;  4HFF B;  3OWT A;  3OEO A;  3DXJ F;  2Y3H A;  3POV A;  4JCH A;  3T6B A;  2J9V A;  3DAG A;  2VB6 A;  2BE5 F;  2NG1 A;  2WZL A;  4BJ1 A;  1TKN A;  2YEV A;  4BJ5 C;  4YT4 A;  3NYM A;  2CW0 F;  3HTK C;  2GFH A;  4ULW A;  3S0X A;  5E3A A;  5D92 A;  2EIM C;  4JUR I;  1J8Y F;  4U5D E;  1TWC A;  1MMG A;  4EWC A;  3NYL A;  4Q4Z F;  3W2W A;  2B0J A;  3QMK A;  2G62 A;  2M4E A;  2JD3 A;  4ZLC A;  1LKX A;  4WJ0 A;  3T6J A;  2PF4 E;  1BR4 A;  1ZU5 A;  5DVW A;  1PD0 A;  3O39 A;  3ABL C;  1QZX A;  3SZR A;  4DVY P;  4O79 A;  2ZXO A;  3RYL A;  3B9Q A;  3LEV A;  3LLK A;  3ABM C;  3JRT A;  4PJJ A;  2A68 F;  4DVZ A;  5KYN A;  3ZG1 A;  3EG9 A;  2XXA A;  2ZXP A;  2CNW D;  3EZH A;  4MQ9 F;  2VAS A;  3Q7L A;  3N2Z B;  2W45 A;  4LAC B;  4G0H A;  4OD5 A;  4E7Z A;  1ZHW A;  3MX3 A;  3W2V A;  4BG0 A;  3EHM A;  3UNG C;  4RDA A;  4HEA J;  3O6X A;  3K1H A;  5KYU A;  4YN0 B;  3L0I A;  4YWQ A;  1TWG A;  3ABK C;  3V7O A;  2Q3T A;  1FTS A;  5T3T A;  3UR3 C;  5L3V A;  1Z6A A;  1M2V A;  2IOQ A;  3HLZ A;  2WZF A;  2MYS A;  1FMV A;  3F47 A;  2QTV A;  3UGO A;  3HJC A;  4B6I A;  3EH1 A;  5E33 A;  2KGO A;  3DJU B;  2X51 A;  3SNH A;  3FDQ A;  3QZC A;  3B0V C;  2D5R B;  2IXN A;  5B1B C;  4YT8 A;  2PP4 A;  2EIL C;  3EG9 B;  2XXA B;  4IAO A;  3JT1 A;  4H4K C;  4X0R A;  1G8X A;  4U5C E;  4AK9 A;  1FFH A;  3Q6N A;  4Q5S F;  4FWV A;  4LER A;  3DM9 B;  4OD4 A;  1TWA A;  4C7O A;  3CZ6 A;  1OKK D;  2J7P A;  4I1O B;  4W8K A;  1M56 C;  1M2V B;  2H7V C;  2ZXR A;  2KNH A;  2W4M A;  2R7V A;  2VH3 A;  4DBR A;  1NZE A;  4IRU A;  4QDL A;  3UMH A;  2A6H F;  1D0Y A;  1Z63 A;  1ZYR F;  3ZSU A;  2WL8 A;  3ASO C;  2J46 A;  1WGW A;  3FAJ A;  1LVK A;  3CSK A;  3SP1 A;  3LNR A;  4G7H F;  4CSA C;  4QI2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...