4U5DE

Crystal structure of glua2, con-ikot-ikot snail toxin, partial agonist ka and postitive modulator (r,r)-2b complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
85
structure length
85
Chain Sequence
GPADCCRMKECCTDRVNECLQRYSGREDKFVSFCYQEATVTCGSFNEIVGCCYGYQMCMIRVVKPNSLSGAHEACKTVSCGNPCA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutamate receptor 2
publication title X-ray structures of AMPA receptor-cone snail toxin complexes illuminate activation mechanism.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport protein/toxin
total genus 25
structure length 85
sequence length 85
chains with identical sequence F
ec nomenclature
pdb deposition date 2014-07-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1800 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4u5dE00
4U5HA 4U5DE 4U5CE 4U5GA 4U5FE 4U5BE 4U5EE
chains in the Genus database with same CATH superfamily
2J7PA 2J45A 2R7UA 2ZD9A 2Y69C 3J06A 3PHF2 3JTLO 4GEHA 4YT5A 2R03A 3IQ6A 3U5SA 3MFNA 3UGPA 3ZG1A 1VYIA 3UMKA 4IAOA 5KYYA 4N6HA 4MVUA 3ASOC 3C8GA 3GEEA 4QI0A 2AWYA 5L0FA 1TWCA 2EPKX 2W45A 2PNOA 2X51A 2XXAB 4DOZA 4AK9A 2EPNA 1B68A 4Z9HA 1AVOB 5KYWB 2R7XA 5AC5A 4MVSA 4XEFA 2CYDA 3DM5A 3IQTA 2A6HF 4JKVA 4O6MA 4P9FA 3OWTA 3DJNB 4H54A 3KPHA 3NKEA 1TFOB 4XTKA 5CI8A 2FGYA 1HMOA 5K0IA 2CDQA 2XL6A 3KMIA 3TOLA 3I4UA 2E87A 4L6RA 1PCXA 1A41A 1C03A 3TQOA 3ZQYA 4BJ1A 1UG7A 3TK0A 1D0XA 2L9JA 3VAYA 3Q6NA 1MMGA 4G7HF 3A9CA 1K40A 1I4YA 2Q3TA 2A0BA 3NYLA 3SXZA 1TWGA 3SNHA 1ZHWA 3DWWA 4BJ6C 2WZGA 3FOOA 4C7OA 1YVIA 2BL2A 1JPNA 3ZTMA 4I44A 2XLMA 4DRJB 1E83A 3EGDB 2YL1A 1HW2A 3NYMA 3AG2C 1YYJA 2HS5A 2P0NA 3MYIA 4E7ZA 1E84A 4QDLA 5FZTA 4CS9C 4KNVA 1DOWA 5L0JA 1HE1A 2IM8A 4PFPA 1PD0A 3GM2A 4YL3A 3UR3C 2NUPB 2L6FA 4CS8C 4XPWA 4XLNF 2IXMA 4YJWA 2CW0F 3L8JA 5JS5A 3TJ5A 1RKEB 1VMAA 2XM0A 3ECSA 2XLOA 5T3TA 1I4ZA 2Q00A 4DRIB 3M4CA 5B3SC 2KGOA 4I1OB 3T9OA 2UUHA 3U8PA 2R7VA 4KC9A 5E3CA 4AE4B 1V54C 2Y3GA 3ATPA 2Q9BA 4U5DE 4U9EA 1M6TA 4AL0A 4MVZA 2DI3A 2F22A 2P1AA 3NRHA 3FAJA 5E3AA 3S0XA 5L0DA 3MX3A 3U2LA 5L3QA 3AQCA 1M57C 2CGEA 3DE8A 2CCYA 4K0DA 4W8PA 4K1OA 3HTKC 3RQFA 4XPXA 2XLEA 3EPVA 2AU5A 5A6BD 1O5HA 2NPUA 2ZXWC 2J9UA 4O7GA 4J32B 4W8KA 3I5QA 3AG3C 4JJFA 1VLSA 1LI5A 3W4YA 5E2QA 3HNKA 4ANJA 4CS7A 1OR2A 1H7IA 1T6UA 1XZPA 2HJ3A 3RW0A 3EHMA 3ZTZA 4PACA 4G0HA 2A1DD 2R7QA 3DD7A 1T9KA 4Q7CA 1LS4A 3S9OA 2HMZA 4E0HA 4EBKA 5JVEA 1NZEA 5B1AC 3L1MA 4CIPA 5A69A 1ORYA 2A69F 1ZHZA 4IWBA 2GWWA 3EFOA 2J46A 1SF8A 2HKVA 3S29A 5IY5C 4PR9A 1R4TA 1A7DA 5KYXB 1U0BB 1OKKD 1TKNA 5DS5A 2MWQA 2W4BA 4NTAA 4G78A 4LACB 3FXHA 3NKDA 3IQ5A 1R5ID 1VOMA 3QMKA 3V5XA 1QQ3A 4NTBA 1JR8A 2YL0A 1NBBA 2KJGA 1IZMA 3AGUA 1VYKA 1ZW2A 3K66A 3TD7A 1OCZC 1JOGA 4FESA 4ONSA 3ZDLA 2Y3BA 1DOVA 3B0PA 5F28E 3EG9B 3H2UA 3JSEO 3SYNA 2XS1A 3BEHA 2ASRA 5EGYA 1BR1A 5F5FA 2Z15A 3CEXA 5DQTA 4MTOA 1EI7A 3C63A 4YN0B 2OKUA 1IW7F 3LNMB 2MYSA 2EIJC 2R7WA 4DVYP 3S90A 1K05A 3IHUA 2HFIA 2WVNA 2Y3DA 1A7VA 2EPLX 2PF4E 4CDYA 3UGOA 1EA8A 2J7PD 2OCCC 2RD9A 3RVZA 3JCUQ 3OEOA 5KYYB 2OJQA 1QZXA 2XRHA 3C8GB 1PV3A 3U9MA 2HV7A 3JRMO 2L6GA 3K33A 3QTHA 2Q7RA 2H8AA 3B0UX 1YAUO 1SZIA 3C8GD 2KNHA 2VASA 2QLAA 3LS0A 2AP3A 1UFBA 3U8VA 2PFDA 2R7SA 4Z9IA 1S05A 2JX0A 2XSEA 2AWCA 1BDJB 3N24A 2I8BA 4EUKB 2YQYA 4EIYA 2XLDA 3EJNA 4U9DA 2ZPAA 3HLZA 3U3BA 3LJBA 4JTAB 4RBNA 1LKXA 4UDVA 3V5YA 1A0BA 4BJTA 1C17M 3N2ZB 2NUTA 1EKYA 3QZCA 3EHNA 4LDQA 1LS1A 3ZC4A 5JP7A 1HW1A 1XWJA 1WWPA 3GWNA 1WTYA 5CI9A 1H6GA 1JRAA 4I1MA 5HSWA 4H4KC 1OCOC 4E18A 3UMHA 3RF3A 4NY3A 1LIHA 3RIPA 3ZVRA 3NG1A 3GEIA 3DI5A 1Z5ZA 1FMVA 1ZZPA 5D92A 1Z6AA 3F47A 1H9GA 2XLVA 2WL8A 1CGNA 2RSEB 5JUAA 3SXKA 1LI7A 5T3WA 4YT2A 4MVMA 3GWLA 2P7VA 1VB5A 3UMIA 3B0VC 4PK4A 3Q6MA 2EIMC 4LDKA 2EILC 5BQGA 1H9TA 1YZCA 4Q5SF 256BA 1JPJA 1MQVA 4PJMA 2R25A 3HJCA 2KSFA 3E9VA 4C3EA 1Q0KA 1D1AA 4D4XA 3LS1A 3AGTA 3OA1A 3G50A 4YWQA 2LFDA 4F4BA 2H7BA 4U5EE 4N06A 4BG0A 3ZIBA 2L81A 2YLDA 1OW7A 5BUOA 4XEVA 3X1OA 1WOLA 1O87A 2YZSA 5A6JA 1BR2A 3CAXA 3EH1A 3L34A 4GQHA 3O39A 3FDQA 1LE2A 3MBGA 3RH3A 2L6HA 3W8HA 5E33A 2Y39A 4C3DA 4DBRA 3DM9B 5D91A 5B3IA 2QTVA 1AUEA 1KNYA 1LE4A 2C04A 1TR2A 2LD6A 5COFA 2XXAA 4BEJA 5KYWA 2KW3C 3MYFA 3T6BA 1LPEA 4IJJA 1U6HA 5T1DB 3BRJA 3ITFA 1LVKA 1OCCC 1OW6A 3X2QC 2ZXRA 1Z7Qc 3ABKC 1WGWA 1RCPA 3Q7GA 5L3VA 3EFOB 4MTFA 3E70C 1WN0A 4U5HA 4NQFA 4N4WA 4X0RA 1Z23A 3DJUB 2CNWD 2B0HA 4JTDB 4BPMA 1JMWA 5DQZA 1VK5A 3M1CB 2EIKC 3VM6A 4FX5A 1FAPB 2Y3HA 4FWVA 4WGYA 5DVWA 5AC4A 4G7OF 2HMQA 2PX0A 4CDAA 1KU2A 1OQCA 2KC3A 3B71A 3LUTB 4IGGA 4IRUA 4OD5A 4U5CE 4YT8A 5CIVA 3K1IC 3QVZA 4BJ6A 2FAPB 2DB4A 3H2VA 3PCVA 4JURI 1FTSA 1G5ZA 2Q4FA 1ZYRF 3DE9A 2GDCA 3JZ0A 2J0XA 4XEKA 4CX9A 3RFYA 1QKRA 2OOCA 3U9JA 5DS4A 2GAQA 1KTMA 1MMAA 1ZU4A 4CS9A 1TQGA 2ICWG 1Y6DA 4DRHB 4JC7A 4CJGA 1TWAA 3G4ZA 4YL0A 3RYLA 4R32A 4BJ5C 3T6GB 3DXJF 5B1BC 2G62A 4Q4ZF 2H7OA 1D0ZA 2YWAA 3PMRA 1I5NA 1RKEA 3M4BA 3RQEA 1Q0GA 3O55A 3QW1A 4CDVA 3G4XA 2DYRC 2IYLD 1G4WR 3EGXA 3O10A 1T01A 1YLMA 4JRZA 2QUPA 4AE4A 3SP1A 2OEVA 2J9VA 4U5FE 3SXYA 3SEOA 4WABA 3TULA 2YHSA 1O3UA 2DGJA 4MNDA 2VCAA 4AX2A 4GYTA 1LM3B 2WZLA 3ASNC 3NYJA 4CSAC 2G3KA 2OU6A 2XLHA 4M63A 4U5BE 3NMIA 5A6BA 2R02A 3GM1A 3O6XA 2PBEA 1AEPA 2R9RB 3CQZA 4A4AA 2R7TA 1GGQA 2Q9CA 2NUTB 2WVQA 4DJ9A 1QVXA 4OIQF 1SYQA 1NU9C 2HJMA 4Z9JA 3VF0A 3LESA 1C02A 1L3PA 2LSEA 2M64A 4MW3A 2A0UA 3GORA 5AGFA 4CIHA 5L0GA 1RJ9A 4I3MA 2VCBA 4G7ZF 3WAQA 4AL1A 4JE9A 3ABMC 2NG1A 4OINF 1FFTC 3FMSA 2EPMX 4EWCA 1QSPA 3MLGA 1BZ4A 1OKKA 1T5OA 1T6QA 3JYHA 3FAPB 3EH2A 4HFKB 3V7OA 3KYJA 1OXKA 1YDIA 4QI2A 2R7RA 2JPUA 3IQCA 3PDMP 3CSKA 3KH2A 4MVQA 1RKCA 3LNRA 4HFFB 2PP4A 1ZW3A 1NG1A 2WZFA 5L0HA 4HEAJ 3DAFA 2XS8A 4J30B 3ZWIA 5L0CA 2FFHA 4A2NB 3Q7LA 4C7OB 3JRTA 4MVRA 3CZ6A 3VRCA 2JD3A 3HNIA 1T6IA 3EG9A 4EKWA 3H65A 1ORSC 2XL4A 2YVKA 3U2MA 2P61A 4LLEA 1M2VA 3UNGC 1JAFA 1CGME 1HE9A 1OW8A 1YARO 2MHRA 3ZQVA 1YYXA 2HSQA 3I5PA 3T6JA 4P9TA 4WJ0A 2C03A 4XWJA 3B29A 4E7SA 4PJJA 3EZIA 3FOPA 3QVYA 1E2XA 2VB6A 3K6BA 5L0IA 2EINC 4DBQA 4YL1A 5COGA 3C8ZA 4LDRA 1HY5A 1W2WA 3VYWA 3NMJA 1D1BA 1J8YF 2R7OA 2I15A 2D5RB 3DMDA 3LLIA 2XM4A 1RXQA 2V26A 2DYSC 3US6A 1YZAA 3NMKA 1BBHA 4P6IC 3C62A 5KYUA 1RMVA 1BR4A 1A7EA 1GS9A 2WVOA 2J9WA 2P6VA 1SMYF 4LERA 1E86A 2BC5A 1Q0FA 3FHDA 3QW0A 1G4US 1ZHYA 1EQ1A 3N0TA 2J8WA 3R7CA 2LQGA 5F5HA 4EHPA 5EHHA 2YL7A 1GM5A 1ZVZA 1G8XA 1ZU5A 1MMDA 2B0JA 3C7JA 4IAQA 4BEMJ 1N1CA 3LEVA 3SZRA 3B9QA 4OIRF 3W2WA 1Z3IX 1YA9A 3KYIA 4JJGA 5BQIA 3EZHA 3AJMA 1FNTc 3FVYA 2YRFA 1NU7D 2NSFA 1VLTA 1QLEC 2LK4A 2HUJA 2UUIA 1V55C 4E17A 5JRAA 1MNEA 1YJGA 2QE9A 3POVA 4LLCA 3C18A 2ZXPA 3M79A 4NC3A 3DAGA 2OJED 4XPYA 3WG7C 1FFHA 2LFFA 2W4MA 1D0YA 2VCCA 1NFOA 4EBBA 1E85A 3S84A 4JEAA 4RD9A 3AOUA 4JVSA 3JSZA 4KNWA 1F1MA 3W8IA 3EGXB 2Q9AA 3AG4C 1OXBA 4XLPF 4IARA 4O79A 5TJ5E 3EQLF 3WHNA 5BQHA 1Q0MA 1Z63A 4PJLA 1V74B 3EGDA 4JIOA 5A6KA 2HV6A 2TMVP 2YEVA 4KI2A 4ZLDA 2KK1A 1Y4CA 2LCHA 2PX3A 3M15A 4ULWA 1K04A 3NDBB 1QPUA 3S28A 5A6AA 2IOQA 1FR0A 1SR2A 2O9XA 4OIOF 2G3VA 2NUPA 2OG2A 3GANA 3KKBA 1HMDA 2H7VC 2HZ8A 4JTCB 4CS8A 2BE5F 4YT4A 3RKOF 1ZHXA 5FCLA 3KL4A 1PD1A 2IXNA 1XZQA 4MQ9F 4MTGA 2QY9A 2XLWA 4K7BA 4CBEA 1YA7O 4MVOA 2ETSA 5JT4A 1CPQA 1RJ9B 2WB7A 5KYNA 3U0CA 3JT1A 1J8MF 1ORJA 2IXOA 2W9YA 4JEBA 3TOMA 2YL3A 3HNLA 5COMA 2A6EF 2CNWA 5DLJA 2A68F 4EBJA 2NSGA 4MW8A 4OD4A 1ST6A 1OCRC 3K7DA 4JCZA 2ZXOA 4C3BA 4DVZA 4ZLCA 1VTMP 1NSGB 4U5GA 3W2VA 3LEOA 1CGOA 3GM3A 3HKKA 3K1HA 3RQGA 2YKZA 4PJNA 4XQ1A 1ZHTA 3S27A 5GPGB 4YK5A 2AVKA 1S7ZA 3IPMO 3AG1C 1TFKB 1TWHA 3IEEA 1APCA 3HNJA 3ABLC 2KQ9A 1NLXA 3K1IA 1L7CA 4FAPB 2J9BA 5JLIA 4WGZA 1FMWA 4RDAA 2X0CA 2LIGA 2VC9A 2IBFA 2QNLA 2OQMA 3DZAA 4JZAA 3GODA 4HE8D 3U3FA 2XL8A 3AQBA 4IB4A 3DKAA 3WODF 2EPOA 4KBLA 4NCQA 4J7TA 1M2OA 5JSLA 1M2VB 2J0WA 4NTFA 3L0IA 2L7AA 4CJOA 4DXWA 1WASA 5KYXA 4BJ5A 4B6IA 4PFOA 4JW1A 2D4UA 4JCHA 1GQAA 4O6NA 1D1CA 3TJ6A 2GA0A 2GFHA 4OIPF 3A11A 1Q0DA 1V4AA 3L8IA 4J7YA 2YLIA 2VH3A 3ZSUA 4O6YA 1M56C 5DS6A 1WATA 3SXMA 1U89A 3LLKA 5EK0A 4D4NA 4E0IA 4ER9A 5HV9A 3LAYA 2HSBA 2M4EA 4ULVA 3JYYA 3RVYA 3R2PA 2V3CC 3GEHA 2OEXA 1MNDA 1NFNA 2KYHA 2YLGA 2LP4A 3V5ZA 1CPRA 3F46A 1OR3A 1MMNA 4CSAA 3T4RA 2R05A 5KYUB 4MS2A 2IXPA 4N6CA
chains in the Genus database with same CATH topology
2J7PA 2J45A 2R7UA 2Y69C 3PHF2 4GEHA 4YT5A 3UGPA 3ZG1A 1VYIA 3UMKA 4IAOA 5KYYA 3ASOC 4QI0A 1TWCA 2W45A 2X51A 2XXAB 4DOZA 4AK9A 5KYWB 2R7XA 3DM5A 2A6HF 4O6MA 3OWTA 3DJNB 3NKEA 4XTKA 5CI8A 2FGYA 2CDQA 3KMIA 3I4UA 2E87A 1PCXA 4BJ1A 1D0XA 2L9JA 3VAYA 3Q6NA 1MMGA 4G7HF 2Q3TA 3NYLA 1TWGA 3SNHA 1ZHWA 4BJ6C 2WZGA 4C7OA 1JPNA 4I44A 3EGDB 3NYMA 3AG2C 4E7ZA 4QDLA 4CS9C 4KNVA 4PFPA 1PD0A 3UR3C 2NUPB 4CS8C 4XLNF 2IXMA 4YJWA 2CW0F 3ECSA 1VMAA 5T3TA 5B3SC 2KGOA 4I1OB 2R7VA 4KC9A 5E3CA 4AE4B 1V54C 2Y3GA 2Q9BA 4U5DE 3NRHA 3FAJA 5E3AA 3S0XA 3MX3A 5L3QA 3AQCA 1M57C 2CGEA 4K0DA 3HTKC 3EPVA 1O5HA 2ZXWC 2J9UA 4O7GA 4J32B 4W8KA 3I5QA 3AG3C 4JJFA 4CS7A 5E2QA 4ANJA 3EHMA 4G0HA 2A1DD 2R7QA 3DD7A 4Q7CA 1NZEA 5B1AC 2A69F 1ZHZA 4IWBA 3EFOA 2J46A 1SF8A 3S29A 5IY5C 5KYXB 1OKKD 1TKNA 5DS5A 2MWQA 2W4BA 4LACB 3NKDA 1VOMA 3QMKA 2KJGA 1IZMA 1VYKA 3K66A 3TD7A 1OCZC 4FESA 2Y3BA 3B0PA 3EG9B 3SYNA 5EGYA 1BR1A 5F5FA 2Z15A 5DQTA 4YN0B 1IW7F 2MYSA 2EIJC 2R7WA 4DVYP 2WVNA 2Y3DA 2PF4E 3UGOA 2J7PD 2OCCC 3JCUQ 3OEOA 5KYYB 2XRHA 1QZXA 2HV7A 3K33A 3B0UX 1SZIA 2KNHA 2VASA 3LS0A 2PFDA 2R7SA 2XSEA 3N24A 2I8BA 3EJNA 2ZPAA 3HLZA 3LJBA 4RBNA 1LKXA 4BJTA 3N2ZB 2NUTA 3QZCA 3EHNA 1LS1A 3ZC4A 5CI9A 4I1MA 5HSWA 4H4KC 1OCOC 3UMHA 4NY3A 3RIPA 3ZVRA 3NG1A 1Z5ZA 1FMVA 5D92A 1Z6AA 3F47A 2WL8A 4YT2A 5T3WA 2P7VA 3UMIA 3B0VC 4PK4A 3Q6MA 2EIMC 2EILC 4Q5SF 1JPJA 4PJMA 3HJCA 3E9VA 4C3EA 1D1AA 3LS1A 3OA1A 4YWQA 4F4BA 2H7BA 4U5EE 4N06A 4BG0A 3ZIBA 2L81A 5BUOA 3X1OA 1O87A 2YZSA 1BR2A 3EH1A 3L34A 3O39A 3FDQA 3RH3A 4DBRA 3W8HA 5E33A 2Y39A 4C3DA 3DM9B 5D91A 2QTVA 2C04A 1TR2A 2XXAA 4BEJA 5KYWA 2KW3C 3T6BA 4IJJA 5T1DB 3ITFA 1LVKA 1OCCC 3X2QC 2ZXRA 3ABKC 1WGWA 3Q7GA 5L3VA 3EFOB 3E70C 4U5HA 4X0RA 1Z23A 3DJUB 2CNWD 5DQZA 1VK5A 3M1CB 2EIKC 4FX5A 5DVWA 2Y3HA 4FWVA 4G7OF 2PX0A 1KU2A 4OD5A 4YT8A 4IRUA 4U5CE 3K1IC 4BJ6A 4JURI 1FTSA 1ZYRF 2J0XA 3RFYA 5DS4A 1MMAA 1ZU4A 4CS9A 1TWAA 3RYLA 4BJ5C 3DXJF 5B1BC 2G62A 4Q4ZF 2H7OA 1D0ZA 3PMRA 2DYRC 2IYLD 3EGXA 4AE4A 3SP1A 2J9VA 4U5FE 3SEOA 2YHSA 4MNDA 2DGJA 4AX2A 4GYTA 2WZLA 3ASNC 3NYJA 4CSAC 2G3KA 4M63A 4U5BE 3O6XA 3CQZA 2R7TA 2Q9CA 2NUTB 2WVQA 4OIQF 1NU9C 3LESA 2LSEA 4CIHA 1RJ9A 4I3MA 4G7ZF 3ABMC 2NG1A 4OINF 1FFTC 4EWCA 3MLGA 1OKKA 3JYHA 3EH2A 4HFKB 3V7OA 4QI2A 2R7RA 3CSKA 3KH2A 3LNRA 4HFFB 2PP4A 1NG1A 2WZFA 4HEAJ 3DAFA 4J30B 2FFHA 4A2NB 3Q7LA 4C7OB 3JRTA 3CZ6A 2JD3A 3EG9A 3H65A 2XL4A 4LLEA 1M2VA 3UNGC 3I5PA 3T6JA 4WJ0A 2C03A 4XWJA 4E7SA 4PJJA 3EZIA 2VB6A 3K6BA 2EINC 4DBQA 1W2WA 3VYWA 1D1BA 1J8YF 2R7OA 2D5RB 3DMDA 3LLIA 2V26A 2DYSC 4P6IC 5KYUA 1BR4A 2WVOA 2J9WA 2P6VA 1SMYF 4LERA 3FHDA 1ZHYA 3N0TA 5F5HA 5EHHA 1G8XA 1ZU5A 1MMDA 2B0JA 1N1CA 3LEVA 3SZRA 3B9QA 4OIRF 3W2WA 1Z3IX 4JJGA 3EZHA 3FVYA 1NU7D 1QLEC 1V55C 1MNEA 3POVA 4LLCA 2ZXPA 3DAGA 3WG7C 1FFHA 2W4MA 1D0YA 4EBBA 4RD9A 4JVSA 3JSZA 4KNWA 3W8IA 3EGXB 2Q9AA 3AG4C 4XLPF 4O79A 3EQLF 1Z63A 4PJLA 3EGDA 4KI2A 2HV6A 2YEVA 4ZLDA 4ULWA 2PX3A 3NDBB 3S28A 2IOQA 2O9XA 4OIOF 2G3VA 2NUPA 2OG2A 3GANA 3KKBA 2H7VC 4CS8A 4YT4A 2BE5F 3RKOF 1ZHXA 5FCLA 3KL4A 1PD1A 2IXNA 4MQ9F 2QY9A 4K7BA 4CBEA 1RJ9B 2WB7A 5KYNA 3JT1A 1J8MF 2IXOA 2W9YA 5DLJA 2A6EF 2CNWA 2A68F 4OD4A 1ST6A 1OCRC 3K7DA 2ZXOA 4C3BA 4DVZA 4ZLCA 4U5GA 3W2VA 3K1HA 4PJNA 3S27A 1ZHTA 1S7ZA 3AG1C 1TWHA 3IEEA 3ABLC 2KQ9A 1FMWA 4RDAA 3DZAA 4JZAA 3GODA 4HE8D 3AQBA 3WODF 4KBLA 1M2OA 1M2VB 2J0WA 3L0IA 5KYXA 4BJ5A 4B6IA 4PFOA 4JW1A 4JCHA 4O6NA 1D1CA 2GFHA 4OIPF 3ZSUA 2VH3A 4O6YA 1M56C 5DS6A 3LLKA 3LAYA 2M4EA 2V3CC 1MNDA 3F46A 1MMNA 4CSAA 3T4RA 5KYUB 2IXPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U5H A;  4U5D E;  4U5C E;  4U5G A;  4U5F E;  4U5B E;  4U5E E; 
#chains in the Genus database with same CATH topology
 2J7P A;  2J45 A;  2R7U A;  2ZD9 A;  2Y69 C;  3J06 A;  3PHF 2;  3JTL O;  4GEH A;  4YT5 A;  2R03 A;  3IQ6 A;  3U5S A;  3MFN A;  3UGP A;  3ZG1 A;  1VYI A;  3UMK A;  4IAO A;  5KYY A;  4N6H A;  4MVU A;  3ASO C;  3C8G A;  3GEE A;  4QI0 A;  2AWY A;  5L0F A;  1TWC A;  2EPK X;  2W45 A;  2PNO A;  2X51 A;  2XXA B;  4DOZ A;  4AK9 A;  2EPN A;  1B68 A;  4Z9H A;  1AVO B;  5KYW B;  2R7X A;  5AC5 A;  4MVS A;  4XEF A;  2CYD A;  3DM5 A;  3IQT A;  2A6H F;  4JKV A;  4O6M A;  4P9F A;  3OWT A;  3DJN B;  4H54 A;  3KPH A;  3NKE A;  1TFO B;  4XTK A;  5CI8 A;  2FGY A;  1HMO A;  5K0I A;  2CDQ A;  2XL6 A;  3KMI A;  3TOL A;  3I4U A;  2E87 A;  4L6R A;  1PCX A;  1A41 A;  1C03 A;  3TQO A;  3ZQY A;  4BJ1 A;  1UG7 A;  3TK0 A;  1D0X A;  2L9J A;  3VAY A;  3Q6N A;  1MMG A;  4G7H F;  3A9C A;  1K40 A;  1I4Y A;  2Q3T A;  2A0B A;  3NYL A;  3SXZ A;  1TWG A;  3SNH A;  1ZHW A;  3DWW A;  4BJ6 C;  2WZG A;  3FOO A;  4C7O A;  1YVI A;  2BL2 A;  1JPN A;  3ZTM A;  4I44 A;  2XLM A;  4DRJ B;  1E83 A;  3EGD B;  2YL1 A;  1HW2 A;  3NYM A;  3AG2 C;  1YYJ A;  2HS5 A;  2P0N A;  3MYI A;  4E7Z A;  1E84 A;  4QDL A;  5FZT A;  4CS9 C;  4KNV A;  1DOW A;  5L0J A;  1HE1 A;  2IM8 A;  4PFP A;  1PD0 A;  3GM2 A;  4YL3 A;  3UR3 C;  2NUP B;  2L6F A;  4CS8 C;  4XPW A;  4XLN F;  2IXM A;  4YJW A;  2CW0 F;  3L8J A;  5JS5 A;  3TJ5 A;  1RKE B;  1VMA A;  2XM0 A;  3ECS A;  2XLO A;  5T3T A;  1I4Z A;  2Q00 A;  4DRI B;  3M4C A;  5B3S C;  2KGO A;  4I1O B;  3T9O A;  2UUH A;  3U8P A;  2R7V A;  4KC9 A;  5E3C A;  4AE4 B;  1V54 C;  2Y3G A;  3ATP A;  2Q9B A;  4U5D E;  4U9E A;  1M6T A;  4AL0 A;  4MVZ A;  2DI3 A;  2F22 A;  2P1A A;  3NRH A;  3FAJ A;  5E3A A;  3S0X A;  5L0D A;  3MX3 A;  3U2L A;  5L3Q A;  3AQC A;  1M57 C;  2CGE A;  3DE8 A;  2CCY A;  4K0D A;  4W8P A;  4K1O A;  3HTK C;  3RQF A;  4XPX A;  2XLE A;  3EPV A;  2AU5 A;  5A6B D;  1O5H A;  2NPU A;  2ZXW C;  2J9U A;  4O7G A;  4J32 B;  4W8K A;  3I5Q A;  3AG3 C;  4JJF A;  1VLS A;  1LI5 A;  3W4Y A;  5E2Q A;  3HNK A;  4ANJ A;  4CS7 A;  1OR2 A;  1H7I A;  1T6U A;  1XZP A;  2HJ3 A;  3RW0 A;  3EHM A;  3ZTZ A;  4PAC A;  4G0H A;  2A1D D;  2R7Q A;  3DD7 A;  1T9K A;  4Q7C A;  1LS4 A;  3S9O A;  2HMZ A;  4E0H A;  4EBK A;  5JVE A;  1NZE A;  5B1A C;  3L1M A;  4CIP A;  5A69 A;  1ORY A;  2A69 F;  1ZHZ A;  4IWB A;  2GWW A;  3EFO A;  2J46 A;  1SF8 A;  2HKV A;  3S29 A;  5IY5 C;  4PR9 A;  1R4T A;  1A7D A;  5KYX B;  1U0B B;  1OKK D;  1TKN A;  5DS5 A;  2MWQ A;  2W4B A;  4NTA A;  4G78 A;  4LAC B;  3FXH A;  3NKD A;  3IQ5 A;  1R5I D;  1VOM A;  3QMK A;  3V5X A;  1QQ3 A;  4NTB A;  1JR8 A;  2YL0 A;  1NBB A;  2KJG A;  1IZM A;  3AGU A;  1VYK A;  1ZW2 A;  3K66 A;  3TD7 A;  1OCZ C;  1JOG A;  4FES A;  4ONS A;  3ZDL A;  2Y3B A;  1DOV A;  3B0P A;  5F28 E;  3EG9 B;  3H2U A;  3JSE O;  3SYN A;  2XS1 A;  3BEH A;  2ASR A;  5EGY A;  1BR1 A;  5F5F A;  2Z15 A;  3CEX A;  5DQT A;  4MTO A;  1EI7 A;  3C63 A;  4YN0 B;  2OKU A;  1IW7 F;  3LNM B;  2MYS A;  2EIJ C;  2R7W A;  4DVY P;  3S90 A;  1K05 A;  3IHU A;  2HFI A;  2WVN A;  2Y3D A;  1A7V A;  2EPL X;  2PF4 E;  4CDY A;  3UGO A;  1EA8 A;  2J7P D;  2OCC C;  2RD9 A;  3RVZ A;  3JCU Q;  3OEO A;  5KYY B;  2OJQ A;  1QZX A;  2XRH A;  3C8G B;  1PV3 A;  3U9M A;  2HV7 A;  3JRM O;  2L6G A;  3K33 A;  3QTH A;  2Q7R A;  2H8A A;  3B0U X;  1YAU O;  1SZI A;  3C8G D;  2KNH A;  2VAS A;  2QLA A;  3LS0 A;  2AP3 A;  1UFB A;  3U8V A;  2PFD A;  2R7S A;  4Z9I A;  1S05 A;  2JX0 A;  2XSE A;  2AWC A;  1BDJ B;  3N24 A;  2I8B A;  4EUK B;  2YQY A;  4EIY A;  2XLD A;  3EJN A;  4U9D A;  2ZPA A;  3HLZ A;  3U3B A;  3LJB A;  4JTA B;  4RBN A;  1LKX A;  4UDV A;  3V5Y A;  1A0B A;  4BJT A;  1C17 M;  3N2Z B;  2NUT A;  1EKY A;  3QZC A;  3EHN A;  4LDQ A;  1LS1 A;  3ZC4 A;  5JP7 A;  1HW1 A;  1XWJ A;  1WWP A;  3GWN A;  1WTY A;  5CI9 A;  1H6G A;  1JRA A;  4I1M A;  5HSW A;  4H4K C;  1OCO C;  4E18 A;  3UMH A;  3RF3 A;  4NY3 A;  1LIH A;  3RIP A;  3ZVR A;  3NG1 A;  3GEI A;  3DI5 A;  1Z5Z A;  1FMV A;  1ZZP A;  5D92 A;  1Z6A A;  3F47 A;  1H9G A;  2XLV A;  2WL8 A;  1CGN A;  2RSE B;  5JUA A;  3SXK A;  1LI7 A;  5T3W A;  4YT2 A;  4MVM A;  3GWL A;  2P7V A;  1VB5 A;  3UMI A;  3B0V C;  4PK4 A;  3Q6M A;  2EIM C;  4LDK A;  2EIL C;  5BQG A;  1H9T A;  1YZC A;  4Q5S F;  256B A;  1JPJ A;  1MQV A;  4PJM A;  2R25 A;  3HJC A;  2KSF A;  3E9V A;  4C3E A;  1Q0K A;  1D1A A;  4D4X A;  3LS1 A;  3AGT A;  3OA1 A;  3G50 A;  4YWQ A;  2LFD A;  4F4B A;  2H7B A;  4U5E E;  4N06 A;  4BG0 A;  3ZIB A;  2L81 A;  2YLD A;  1OW7 A;  5BUO A;  4XEV A;  3X1O A;  1WOL A;  1O87 A;  2YZS A;  5A6J A;  1BR2 A;  3CAX A;  3EH1 A;  3L34 A;  4GQH A;  3O39 A;  3FDQ A;  1LE2 A;  3MBG A;  3RH3 A;  2L6H A;  3W8H A;  5E33 A;  2Y39 A;  4C3D A;  4DBR A;  3DM9 B;  5D91 A;  5B3I A;  2QTV A;  1AUE A;  1KNY A;  1LE4 A;  2C04 A;  1TR2 A;  2LD6 A;  5COF A;  2XXA A;  4BEJ A;  5KYW A;  2KW3 C;  3MYF A;  3T6B A;  1LPE A;  4IJJ A;  1U6H A;  5T1D B;  3BRJ A;  3ITF A;  1LVK A;  1OCC C;  1OW6 A;  3X2Q C;  2ZXR A;  1Z7Q c;  3ABK C;  1WGW A;  1RCP A;  3Q7G A;  5L3V A;  3EFO B;  4MTF A;  3E70 C;  1WN0 A;  4U5H A;  4NQF A;  4N4W A;  4X0R A;  1Z23 A;  3DJU B;  2CNW D;  2B0H A;  4JTD B;  4BPM A;  1JMW A;  5DQZ A;  1VK5 A;  3M1C B;  2EIK C;  3VM6 A;  4FX5 A;  1FAP B;  2Y3H A;  4FWV A;  4WGY A;  5DVW A;  5AC4 A;  4G7O F;  2HMQ A;  2PX0 A;  4CDA A;  1KU2 A;  1OQC A;  2KC3 A;  3B71 A;  3LUT B;  4IGG A;  4IRU A;  4OD5 A;  4U5C E;  4YT8 A;  5CIV A;  3K1I C;  3QVZ A;  4BJ6 A;  2FAP B;  2DB4 A;  3H2V A;  3PCV A;  4JUR I;  1FTS A;  1G5Z A;  2Q4F A;  1ZYR F;  3DE9 A;  2GDC A;  3JZ0 A;  2J0X A;  4XEK A;  4CX9 A;  3RFY A;  1QKR A;  2OOC A;  3U9J A;  5DS4 A;  2GAQ A;  1KTM A;  1MMA A;  1ZU4 A;  4CS9 A;  1TQG A;  2ICW G;  1Y6D A;  4DRH B;  4JC7 A;  4CJG A;  1TWA A;  3G4Z A;  4YL0 A;  3RYL A;  4R32 A;  4BJ5 C;  3T6G B;  3DXJ F;  5B1B C;  2G62 A;  4Q4Z F;  2H7O A;  1D0Z A;  2YWA A;  3PMR A;  1I5N A;  1RKE A;  3M4B A;  3RQE A;  1Q0G A;  3O55 A;  3QW1 A;  4CDV A;  3G4X A;  2DYR C;  2IYL D;  1G4W R;  3EGX A;  3O10 A;  1T01 A;  1YLM A;  4JRZ A;  2QUP A;  4AE4 A;  3SP1 A;  2OEV A;  2J9V A;  4U5F E;  3SXY A;  3SEO A;  4WAB A;  3TUL A;  2YHS A;  1O3U A;  2DGJ A;  4MND A;  2VCA A;  4AX2 A;  4GYT A;  1LM3 B;  2WZL A;  3ASN C;  3NYJ A;  4CSA C;  2G3K A;  2OU6 A;  2XLH A;  4M63 A;  4U5B E;  3NMI A;  5A6B A;  2R02 A;  3GM1 A;  3O6X A;  2PBE A;  1AEP A;  2R9R B;  3CQZ A;  4A4A A;  2R7T A;  1GGQ A;  2Q9C A;  2NUT B;  2WVQ A;  4DJ9 A;  1QVX A;  4OIQ F;  1SYQ A;  1NU9 C;  2HJM A;  4Z9J A;  3VF0 A;  3LES A;  1C02 A;  1L3P A;  2LSE A;  2M64 A;  4MW3 A;  2A0U A;  3GOR A;  5AGF A;  4CIH A;  5L0G A;  1RJ9 A;  4I3M A;  2VCB A;  4G7Z F;  3WAQ A;  4AL1 A;  4JE9 A;  3ABM C;  2NG1 A;  4OIN F;  1FFT C;  3FMS A;  2EPM X;  4EWC A;  1QSP A;  3MLG A;  1BZ4 A;  1OKK A;  1T5O A;  1T6Q A;  3JYH A;  3FAP B;  3EH2 A;  4HFK B;  3V7O A;  3KYJ A;  1OXK A;  1YDI A;  4QI2 A;  2R7R A;  2JPU A;  3IQC A;  3PDM P;  3CSK A;  3KH2 A;  4MVQ A;  1RKC A;  3LNR A;  4HFF B;  2PP4 A;  1ZW3 A;  1NG1 A;  2WZF A;  5L0H A;  4HEA J;  3DAF A;  2XS8 A;  4J30 B;  3ZWI A;  5L0C A;  2FFH A;  4A2N B;  3Q7L A;  4C7O B;  3JRT A;  4MVR A;  3CZ6 A;  3VRC A;  2JD3 A;  3HNI A;  1T6I A;  3EG9 A;  4EKW A;  3H65 A;  1ORS C;  2XL4 A;  2YVK A;  3U2M A;  2P61 A;  4LLE A;  1M2V A;  3UNG C;  1JAF A;  1CGM E;  1HE9 A;  1OW8 A;  1YAR O;  2MHR A;  3ZQV A;  1YYX A;  2HSQ A;  3I5P A;  3T6J A;  4P9T A;  4WJ0 A;  2C03 A;  4XWJ A;  3B29 A;  4E7S A;  4PJJ A;  3EZI A;  3FOP A;  3QVY A;  1E2X A;  2VB6 A;  3K6B A;  5L0I A;  2EIN C;  4DBQ A;  4YL1 A;  5COG A;  3C8Z A;  4LDR A;  1HY5 A;  1W2W A;  3VYW A;  3NMJ A;  1D1B A;  1J8Y F;  2R7O A;  2I15 A;  2D5R B;  3DMD A;  3LLI A;  2XM4 A;  1RXQ A;  2V26 A;  2DYS C;  3US6 A;  1YZA A;  3NMK A;  1BBH A;  4P6I C;  3C62 A;  5KYU A;  1RMV A;  1BR4 A;  1A7E A;  1GS9 A;  2WVO A;  2J9W A;  2P6V A;  1SMY F;  4LER A;  1E86 A;  2BC5 A;  1Q0F A;  3FHD A;  3QW0 A;  1G4U S;  1ZHY A;  1EQ1 A;  3N0T A;  2J8W A;  3R7C A;  2LQG A;  5F5H A;  4EHP A;  5EHH A;  2YL7 A;  1GM5 A;  1ZVZ A;  1G8X A;  1ZU5 A;  1MMD A;  2B0J A;  3C7J A;  4IAQ A;  4BEM J;  1N1C A;  3LEV A;  3SZR A;  3B9Q A;  4OIR F;  3W2W A;  1Z3I X;  1YA9 A;  3KYI A;  4JJG A;  5BQI A;  3EZH A;  3AJM A;  1FNT c;  3FVY A;  2YRF A;  1NU7 D;  2NSF A;  1VLT A;  1QLE C;  2LK4 A;  2HUJ A;  2UUI A;  1V55 C;  4E17 A;  5JRA A;  1MNE A;  1YJG A;  2QE9 A;  3POV A;  4LLC A;  3C18 A;  2ZXP A;  3M79 A;  4NC3 A;  3DAG A;  2OJE D;  4XPY A;  3WG7 C;  1FFH A;  2LFF A;  2W4M A;  1D0Y A;  2VCC A;  1NFO A;  4EBB A;  1E85 A;  3S84 A;  4JEA A;  4RD9 A;  3AOU A;  4JVS A;  3JSZ A;  4KNW A;  1F1M A;  3W8I A;  3EGX B;  2Q9A A;  3AG4 C;  1OXB A;  4XLP F;  4IAR A;  4O79 A;  5TJ5 E;  3EQL F;  3WHN A;  5BQH A;  1Q0M A;  1Z63 A;  4PJL A;  1V74 B;  3EGD A;  4JIO A;  5A6K A;  2HV6 A;  2TMV P;  2YEV A;  4KI2 A;  4ZLD A;  2KK1 A;  1Y4C A;  2LCH A;  2PX3 A;  3M15 A;  4ULW A;  1K04 A;  3NDB B;  1QPU A;  3S28 A;  5A6A A;  2IOQ A;  1FR0 A;  1SR2 A;  2O9X A;  4OIO F;  2G3V A;  2NUP A;  2OG2 A;  3GAN A;  3KKB A;  1HMD A;  2H7V C;  2HZ8 A;  4JTC B;  4CS8 A;  2BE5 F;  4YT4 A;  3RKO F;  1ZHX A;  5FCL A;  3KL4 A;  1PD1 A;  2IXN A;  1XZQ A;  4MQ9 F;  4MTG A;  2QY9 A;  2XLW A;  4K7B A;  4CBE A;  1YA7 O;  4MVO A;  2ETS A;  5JT4 A;  1CPQ A;  1RJ9 B;  2WB7 A;  5KYN A;  3U0C A;  3JT1 A;  1J8M F;  1ORJ A;  2IXO A;  2W9Y A;  4JEB A;  3TOM A;  2YL3 A;  3HNL A;  5COM A;  2A6E F;  2CNW A;  5DLJ A;  2A68 F;  4EBJ A;  2NSG A;  4MW8 A;  4OD4 A;  1ST6 A;  1OCR C;  3K7D A;  4JCZ A;  2ZXO A;  4C3B A;  4DVZ A;  4ZLC A;  1VTM P;  1NSG B;  4U5G A;  3W2V A;  3LEO A;  1CGO A;  3GM3 A;  3HKK A;  3K1H A;  3RQG A;  2YKZ A;  4PJN A;  4XQ1 A;  1ZHT A;  3S27 A;  5GPG B;  4YK5 A;  2AVK A;  1S7Z A;  3IPM O;  3AG1 C;  1TFK B;  1TWH A;  3IEE A;  1APC A;  3HNJ A;  3ABL C;  2KQ9 A;  1NLX A;  3K1I A;  1L7C A;  4FAP B;  2J9B A;  5JLI A;  4WGZ A;  1FMW A;  4RDA A;  2X0C A;  2LIG A;  2VC9 A;  2IBF A;  2QNL A;  2OQM A;  3DZA A;  4JZA A;  3GOD A;  4HE8 D;  3U3F A;  2XL8 A;  3AQB A;  4IB4 A;  3DKA A;  3WOD F;  2EPO A;  4KBL A;  4NCQ A;  4J7T A;  1M2O A;  5JSL A;  1M2V B;  2J0W A;  4NTF A;  3L0I A;  2L7A A;  4CJO A;  4DXW A;  1WAS A;  5KYX A;  4BJ5 A;  4B6I A;  4PFO A;  4JW1 A;  2D4U A;  4JCH A;  1GQA A;  4O6N A;  1D1C A;  3TJ6 A;  2GA0 A;  2GFH A;  4OIP F;  3A11 A;  1Q0D A;  1V4A A;  3L8I A;  4J7Y A;  2YLI A;  2VH3 A;  3ZSU A;  4O6Y A;  1M56 C;  5DS6 A;  1WAT A;  3SXM A;  1U89 A;  3LLK A;  5EK0 A;  4D4N A;  4E0I A;  4ER9 A;  5HV9 A;  3LAY A;  2HSB A;  2M4E A;  4ULV A;  3JYY A;  3RVY A;  3R2P A;  2V3C C;  3GEH A;  2OEX A;  1MND A;  1NFN A;  2KYH A;  2YLG A;  2LP4 A;  3V5Z A;  1CPR A;  3F46 A;  1OR3 A;  1MMN A;  4CSA A;  3T4R A;  2R05 A;  5KYU B;  4MS2 A;  2IXP A;  4N6C A; 
#chains in the Genus database with same CATH homology
 2J7P A;  2J45 A;  2R7U A;  2Y69 C;  3PHF 2;  4GEH A;  4YT5 A;  3UGP A;  3ZG1 A;  1VYI A;  3UMK A;  4IAO A;  5KYY A;  3ASO C;  4QI0 A;  1TWC A;  2W45 A;  2X51 A;  2XXA B;  4DOZ A;  4AK9 A;  5KYW B;  2R7X A;  3DM5 A;  2A6H F;  4O6M A;  3OWT A;  3DJN B;  3NKE A;  4XTK A;  5CI8 A;  2FGY A;  2CDQ A;  3KMI A;  3I4U A;  2E87 A;  1PCX A;  4BJ1 A;  1D0X A;  2L9J A;  3VAY A;  3Q6N A;  1MMG A;  4G7H F;  2Q3T A;  3NYL A;  1TWG A;  3SNH A;  1ZHW A;  4BJ6 C;  2WZG A;  4C7O A;  1JPN A;  4I44 A;  3EGD B;  3NYM A;  3AG2 C;  4E7Z A;  4QDL A;  4CS9 C;  4KNV A;  4PFP A;  1PD0 A;  3UR3 C;  2NUP B;  4CS8 C;  4XLN F;  2IXM A;  4YJW A;  2CW0 F;  3ECS A;  1VMA A;  5T3T A;  5B3S C;  2KGO A;  4I1O B;  2R7V A;  4KC9 A;  5E3C A;  4AE4 B;  1V54 C;  2Y3G A;  2Q9B A;  4U5D E;  3NRH A;  3FAJ A;  5E3A A;  3S0X A;  3MX3 A;  5L3Q A;  3AQC A;  1M57 C;  2CGE A;  4K0D A;  3HTK C;  3EPV A;  1O5H A;  2ZXW C;  2J9U A;  4O7G A;  4J32 B;  4W8K A;  3I5Q A;  3AG3 C;  4JJF A;  4CS7 A;  5E2Q A;  4ANJ A;  3EHM A;  4G0H A;  2A1D D;  2R7Q A;  3DD7 A;  4Q7C A;  1NZE A;  5B1A C;  2A69 F;  1ZHZ A;  4IWB A;  3EFO A;  2J46 A;  1SF8 A;  3S29 A;  5IY5 C;  5KYX B;  1OKK D;  1TKN A;  5DS5 A;  2MWQ A;  2W4B A;  4LAC B;  3NKD A;  1VOM A;  3QMK A;  2KJG A;  1IZM A;  1VYK A;  3K66 A;  3TD7 A;  1OCZ C;  4FES A;  2Y3B A;  3B0P A;  3EG9 B;  3SYN A;  5EGY A;  1BR1 A;  5F5F A;  2Z15 A;  5DQT A;  4YN0 B;  1IW7 F;  2MYS A;  2EIJ C;  2R7W A;  4DVY P;  2WVN A;  2Y3D A;  2PF4 E;  3UGO A;  2J7P D;  2OCC C;  3JCU Q;  3OEO A;  5KYY B;  2XRH A;  1QZX A;  2HV7 A;  3K33 A;  3B0U X;  1SZI A;  2KNH A;  2VAS A;  3LS0 A;  2PFD A;  2R7S A;  2XSE A;  3N24 A;  2I8B A;  3EJN A;  2ZPA A;  3HLZ A;  3LJB A;  4RBN A;  1LKX A;  4BJT A;  3N2Z B;  2NUT A;  3QZC A;  3EHN A;  1LS1 A;  3ZC4 A;  5CI9 A;  4I1M A;  5HSW A;  4H4K C;  1OCO C;  3UMH A;  4NY3 A;  3RIP A;  3ZVR A;  3NG1 A;  1Z5Z A;  1FMV A;  5D92 A;  1Z6A A;  3F47 A;  2WL8 A;  4YT2 A;  5T3W A;  2P7V A;  3UMI A;  3B0V C;  4PK4 A;  3Q6M A;  2EIM C;  2EIL C;  4Q5S F;  1JPJ A;  4PJM A;  3HJC A;  3E9V A;  4C3E A;  1D1A A;  3LS1 A;  3OA1 A;  4YWQ A;  4F4B A;  2H7B A;  4U5E E;  4N06 A;  4BG0 A;  3ZIB A;  2L81 A;  5BUO A;  3X1O A;  1O87 A;  2YZS A;  1BR2 A;  3EH1 A;  3L34 A;  3O39 A;  3FDQ A;  3RH3 A;  4DBR A;  3W8H A;  5E33 A;  2Y39 A;  4C3D A;  3DM9 B;  5D91 A;  2QTV A;  2C04 A;  1TR2 A;  2XXA A;  4BEJ A;  5KYW A;  2KW3 C;  3T6B A;  4IJJ A;  5T1D B;  3ITF A;  1LVK A;  1OCC C;  3X2Q C;  2ZXR A;  3ABK C;  1WGW A;  3Q7G A;  5L3V A;  3EFO B;  3E70 C;  4U5H A;  4X0R A;  1Z23 A;  3DJU B;  2CNW D;  5DQZ A;  1VK5 A;  3M1C B;  2EIK C;  4FX5 A;  5DVW A;  2Y3H A;  4FWV A;  4G7O F;  2PX0 A;  1KU2 A;  4OD5 A;  4YT8 A;  4IRU A;  4U5C E;  3K1I C;  4BJ6 A;  4JUR I;  1FTS A;  1ZYR F;  2J0X A;  3RFY A;  5DS4 A;  1MMA A;  1ZU4 A;  4CS9 A;  1TWA A;  3RYL A;  4BJ5 C;  3DXJ F;  5B1B C;  2G62 A;  4Q4Z F;  2H7O A;  1D0Z A;  3PMR A;  2DYR C;  2IYL D;  3EGX A;  4AE4 A;  3SP1 A;  2J9V A;  4U5F E;  3SEO A;  2YHS A;  4MND A;  2DGJ A;  4AX2 A;  4GYT A;  2WZL A;  3ASN C;  3NYJ A;  4CSA C;  2G3K A;  4M63 A;  4U5B E;  3O6X A;  3CQZ A;  2R7T A;  2Q9C A;  2NUT B;  2WVQ A;  4OIQ F;  1NU9 C;  3LES A;  2LSE A;  4CIH A;  1RJ9 A;  4I3M A;  4G7Z F;  3ABM C;  2NG1 A;  4OIN F;  1FFT C;  4EWC A;  3MLG A;  1OKK A;  3JYH A;  3EH2 A;  4HFK B;  3V7O A;  4QI2 A;  2R7R A;  3CSK A;  3KH2 A;  3LNR A;  4HFF B;  2PP4 A;  1NG1 A;  2WZF A;  4HEA J;  3DAF A;  4J30 B;  2FFH A;  4A2N B;  3Q7L A;  4C7O B;  3JRT A;  3CZ6 A;  2JD3 A;  3EG9 A;  3H65 A;  2XL4 A;  4LLE A;  1M2V A;  3UNG C;  3I5P A;  3T6J A;  4WJ0 A;  2C03 A;  4XWJ A;  4E7S A;  4PJJ A;  3EZI A;  2VB6 A;  3K6B A;  2EIN C;  4DBQ A;  1W2W A;  3VYW A;  1D1B A;  1J8Y F;  2R7O A;  2D5R B;  3DMD A;  3LLI A;  2V26 A;  2DYS C;  4P6I C;  5KYU A;  1BR4 A;  2WVO A;  2J9W A;  2P6V A;  1SMY F;  4LER A;  3FHD A;  1ZHY A;  3N0T A;  5F5H A;  5EHH A;  1G8X A;  1ZU5 A;  1MMD A;  2B0J A;  1N1C A;  3LEV A;  3SZR A;  3B9Q A;  4OIR F;  3W2W A;  1Z3I X;  4JJG A;  3EZH A;  3FVY A;  1NU7 D;  1QLE C;  1V55 C;  1MNE A;  3POV A;  4LLC A;  2ZXP A;  3DAG A;  3WG7 C;  1FFH A;  2W4M A;  1D0Y A;  4EBB A;  4RD9 A;  4JVS A;  3JSZ A;  4KNW A;  3W8I A;  3EGX B;  2Q9A A;  3AG4 C;  4XLP F;  4O79 A;  3EQL F;  1Z63 A;  4PJL A;  3EGD A;  4KI2 A;  2HV6 A;  2YEV A;  4ZLD A;  4ULW A;  2PX3 A;  3NDB B;  3S28 A;  2IOQ A;  2O9X A;  4OIO F;  2G3V A;  2NUP A;  2OG2 A;  3GAN A;  3KKB A;  2H7V C;  4CS8 A;  4YT4 A;  2BE5 F;  3RKO F;  1ZHX A;  5FCL A;  3KL4 A;  1PD1 A;  2IXN A;  4MQ9 F;  2QY9 A;  4K7B A;  4CBE A;  1RJ9 B;  2WB7 A;  5KYN A;  3JT1 A;  1J8M F;  2IXO A;  2W9Y A;  5DLJ A;  2A6E F;  2CNW A;  2A68 F;  4OD4 A;  1ST6 A;  1OCR C;  3K7D A;  2ZXO A;  4C3B A;  4DVZ A;  4ZLC A;  4U5G A;  3W2V A;  3K1H A;  4PJN A;  3S27 A;  1ZHT A;  1S7Z A;  3AG1 C;  1TWH A;  3IEE A;  3ABL C;  2KQ9 A;  1FMW A;  4RDA A;  3DZA A;  4JZA A;  3GOD A;  4HE8 D;  3AQB A;  3WOD F;  4KBL A;  1M2O A;  1M2V B;  2J0W A;  3L0I A;  5KYX A;  4BJ5 A;  4B6I A;  4PFO A;  4JW1 A;  4JCH A;  4O6N A;  1D1C A;  2GFH A;  4OIP F;  3ZSU A;  2VH3 A;  4O6Y A;  1M56 C;  5DS6 A;  3LLK A;  3LAY A;  2M4E A;  2V3C C;  1MND A;  3F46 A;  1MMN A;  4CSA A;  3T4R A;  5KYU B;  2IXP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...