3QZCA

Structure of the periplasmic stress response protein cpxp
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
108
structure length
108
Chain Sequence
HMFDGISLTEHQRQQMRDLMQQARHEQPPVNVSELETMHRLVTAENFDENAVRAQAEKMANEQIARQVEMAKVRNQMYRLLTPEQQAVLNEKHQQRMEQLRDVTQWQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Periplasmic Stress Response Protein CpxP.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Signaling protein
molecule keywords Periplasmic protein CpxP
total genus 41
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1490 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3qzcA00
2Y3HA 3EPVA 3ITFA 2Y39A 3O39A 3QZCA 2Y3GA 3ZG1A 2Y3BA 3LAYA 2Y3DA 3OEOA
chains in the Genus database with same CATH superfamily
1CGME 3V5ZA 2HS5A 1DOWA 1G8XA 2PFDA 3LS0A 1GGQA 4JKVA 3GWNA 3ZC4A 1A41A 2IXNA 1D1CA 1EI7A 2XM4A 3DAGA 4H54A 1PD0A 2EIJC 1FAPB 4DVZA 5KYXB 1I5NA 3KYIA 1XWJA 5E2QA 1MNDA 1JR8A 1QPUA 1FMWA 2J45A 3DWWA 1A7EA 4ULVA 3LNMB 3JYYA 4XPXA 3HNKA 1EKYA 1LI7A 4I1MA 4U5BE 1HW2A 2Q9AA 3TJ5A 2WVQA 2H7VC 4NTFA 3IPMO 5B3SC 4G78A 3HKKA 3GEHA 2XL4A 3W4YA 5EK0A 5FCLA 3M4BA 2NUTB 2VH3A 4DVYP 1MQVA 3JTLO 2GA0A 4PR9A 2L6GA 4GQHA 1TWAA 2Y3GA 1LS4A 1M2VA 3DD7A 4AL0A 2R7SA 2XLWA 3JT1A 4J32B 3GM1A 5KYYA 2L7AA 2W4MA 3ABKC 3LESA 2NSFA 4G7OF 1R5ID 1K40A 5F5FA 3C18A 4RBNA 3FHDA 2R7UA 1OCRC 1H7IA 1TKNA 3M79A 1Z5ZA 1Q0KA 5A69A 1N1CA 1RKEB 3UMIA 5AGFA 2YZSA 3V7OA 4JTAB 1D0ZA 3RH3A 2NSGA 1T6QA 3B0VC 2UUHA 4WGZA 3MBGA 2PX3A 3EHNA 4XLPF 2J7PA 4MNDA 2L81A 3WG7C 4EWCA 3OEOA 5A6KA 4BJ6C 2O9XA 3PCVA 4LDRA 3ECSA 1MNEA 1ZVZA 4IJJA 3T6BA 3O55A 2P6VA 2LFFA 1T6UA 4UDVA 2OOCA 4PJNA 4PFOA 3H2VA 3JZ0A 4U5FE 1YLMA 3BRJA 3DI5A 1Z7Qc 5F5HA 1O5HA 2KJGA 2OEXA 2DYSC 4N4WA 1Q0FA 1KU2A 3JRTA 1OW8A 1Y4CA 3X1OA 1LVKA 3N2ZB 4XWJA 1JMWA 3O10A 3US6A 3L1MA 1NU7D 1QLEC 1G4US 1JAFA 3AG2C 3O39A 3I5PA 3L34A 4LDKA 4O7GA 5E3AA 1ZHXA 4PJLA 1BDJB 3AJMA 5L0GA 3DE8A 3EQLF 3LUTB 5BQGA 2VCCA 2Y3HA 3R7CA 1E85A 2Q9CA 1PD1A 1HW1A 1J8YF 2X51A 3KYJA 4DRJB 2YHSA 2XLOA 3QTHA 3EFOB 4JVSA 5KYNA 4LDQA 4I3MA 4XQ1A 1O3UA 3W8HA 4DOZA 4I1OB 4MVQA 3C8GD 3F46A 3L8IA 2HV7A 2L9JA 4OIPF 3J06A 2A6HF 3VRCA 3GM2A 1OR3A 1BZ4A 4O79A 4AE4A 4CDAA 3B71A 3B0UX 2VCBA 4JEBA 4K1OA 3R2PA 2VB6A 4Z9JA 4OIOF 1ZHTA 2BL2A 2CCYA 2YLIA 3X2QC 3DKAA 2AP3A 1RKCA 2D5RB 2M4EA 2YQYA 3KL4A 4OD5A 5D92A 1W2WA 4DBRA 4C7OB 4RDAA 1U6HA 4E18A 2VC9A 2QE9A 1CGOA 3TQOA 1APCA 4DRIB 1NBBA 3C8ZA 4PJMA 1YJGA 5CIVA 1JRAA 1TWGA 4XPWA 2L6FA 2XLMA 1T9KA 3IQCA 4CJGA 1IZMA 1G4WR 3DJNB 4JCHA 256BA 3ZVRA 2CGEA 1WOLA 1OW7A 2RSEB 3T6GB 3TOMA 4CSAC 1U0BB 3T6JA 3WAQA 5T3WA 4BJ5A 1E84A 2QUPA 4JRZA 1A7VA 2IBFA 1CPQA 3U5SA 5KYWB 3LAYA 2A69F 3L0IA 1XZQA 4C3DA 2W45A 1OCCC 1QVXA 2RD9A 3G4ZA 3QZCA 4ANJA 5JT4A 1YARO 3RIPA 3N0TA 1MMNA 4XLNF 1FTSA 5GPGB 4O6NA 3UGPA 3FDQA 3CSKA 2CNWA 4A4AA 3ZTMA 3M1CB 1ZHWA 3NKEA 3C8GA 4OD4A 4BJ6A 2EINC 1SF8A 3U9JA 2R7QA 3RQEA 4RD9A 4M63A 4N6CA 2J9UA 5T1DB 1LI5A 1OKKD 2E87A 4XPYA 3PMRA 2EILC 3VM6A 4IARA 1NG1A 1IW7F 2XRHA 5L0JA 5KYXA 4P6IC 4QDLA 4EUKB 1BR1A 3DZAA 4B6IA 4CS8C 4JZAA 4H4KC 3ZG1A 1VB5A 5COGA 1CGNA 4HEAJ 4D4NA 4EHPA 2YLGA 5JUAA 2GFHA 3DMDA 3K1HA 1JOGA 5DS5A 3NG1A 2LK4A 3O6XA 4JEAA 4MVSA 2AVKA 1V4AA 3SXYA 2Q9BA 2YL7A 3VYWA 1KTMA 1HMOA 4CDYA 3RW0A 2XS1A 2EPLX 1F1MA 3ZSUA 4E7ZA 1OXBA 4HFFB 5BQHA 4MTGA 1JPJA 3IQ6A 4R32A 1WN0A 4HFKB 4JTCB 5COFA 2XLDA 3H65A 2YL0A 4IRUA 3EPVA 4YL1A 2HFIA 4E17A 4BPMA 5DQZA 1DOVA 2KC3A 1NSGB 2FGYA 3KMIA 4NCQA 5B1AC 4P9FA 3UNGC 4BG0A 1H9TA 3TJ6A 2A68F 4MS2A 2ASRA 1YA9A 2HUJA 1L7CA 2JX0A 3GODA 5FZTA 4U5GA 1BBHA 4J7YA 3S9OA 3ZWIA 2HV6A 2R7WA 1OCZC 3Q6MA 2AWCA 4OIRF 2L6HA 2XLVA 3LJBA 3E9VA 1M2OA 3EGDA 1GS9A 2J46A 1RJ9B 5B3IA 2Y3BA 5JSLA 1H9GA 3A11A 2A0UA 2XL8A 3QVZA 4U5HA 1Q0MA 2M64A 4G0HA 4I44A 3OWTA 4C3BA 4YT8A 5BQIA 3NDBB 1QSPA 3EZIA 2R03A 2HSQA 3FAPB 2QTVA 4WGYA 4D4XA 4YWQA 3DE9A 5KYWA 2YL1A 2ICWG 2F22A 4Q5SF 1OXKA 2KYHA 3C63A 5L0CA 2WZLA 3K6BA 4KI2A 1H6GA 1HMDA 1FFHA 1M6TA 2WZGA 4IGGA 1YZAA 1C03A 1WASA 1ZU4A 3BEHA 1ZHZA 4MQ9F 4GEHA 5L0FA 4A2NB 2TMVP 4BEJA 2HMQA 2OJED 4YJWA 3K33A 1Q0DA 1RKEA 1RXQA 2DGJA 4NTBA 4Z9HA 4IAQA 3S29A 2IYLD 2J0WA 5HV9A 2QY9A 3CZ6A 3B9QA 3FMSA 2KNHA 3U8PA 3SEOA 3DAFA 3GWLA 4X0RA 2LQGA 2A6EF 3LLKA 1OCOC 3LS1A 4YL0A 4YN0B 3SXMA 3QW1A 5K0IA 1T5OA 4CS7A 4CS8A 1M2VB 2PX0A 3AG3C 2ZD9A 4KNVA 3T9OA 4Z9IA 3TULA 4J30B 1S05A 1UFBA 1BR2A 3AOUA 2UUIA 2CYDA 3B29A 1AEPA 3NYMA 2AWYA 4MTOA 2R7VA 2J8WA 3ABMC 2R9RB 1T01A 3AQBA 2J9BA 3ASNC 3ZTZA 1V54C 2LFDA 1D0XA 4XEVA 3TK0A 3MX3A 2IXMA 3EH1A 2R05A 1RJ9A 4FX5A 1G5ZA 2Y39A 4N6HA 3QW0A 5CI9A 1RCPA 1ST6A 4CS9A 3G50A 4JTDB 3W8IA 1YVIA 3PDMP 3ZQVA 3HLZA 2G3KA 3KH2A 1ORJA 1FMVA 4LACB 4AK9A 5L0HA 4BJ5C 4EBBA 1XZPA 4K7BA 3DJUB 2XSEA 3S90A 3MYFA 4E7SA 2GDCA 5DLJA 2IXPA 5T3TA 1TFOB 1Z63A 4MVUA 2FAPB 2OQMA 2WB7A 1OQCA 1D1BA 4BJ1A 1AUEA 5DQTA 4XEFA 3RQFA 3LEOA 2IOQA 4KC9A 5L3VA 3SP1A 3RFYA 1SZIA 1ZU5A 3F47A 3FOPA 3LNRA 4EBKA 4BJTA 5B1BC 3U2LA 2LSEA 3W2VA 3RQGA 3NYLA 2H7OA 1SR2A 1LIHA 1VLSA 3HNLA 1C02A 3KKBA 4NC3A 1M57C 1SYQA 2G3VA 1J8MF 1EQ1A 3AG1C 1NZEA 1PCXA 1Q0GA 4CIPA 1E2XA 3CQZA 3UMKA 1B68A 3POVA 1NFOA 2Y3DA 2XS8A 3AGUA 3PHF2 1TR2A 5JVEA 3JYHA 3IQTA 3ZQYA 1QKRA 3M4CA 4GYTA 2V26A 4DJ9A 2C04A 4MVZA 4XEKA 4YT2A 2OJQA 5F28E 4C3EA 3NYJA 2CNWD 3LEVA 2LIGA 2NUTA 1LKXA 4AX2A 3Q7LA 2XM0A 3EFOA 3MFNA 3T4RA 4JE9A 2Q00A 2CDQA 2Z15A 3GEEA 1GM5A 2W4BA 5AC4A 2Q3TA 3HJCA 4U5CE 4EKWA 2LP4A 4CIHA 2PBEA 4E0HA 2EPOA 3EG9A 4ONSA 1LE4A 4DBQA 4CJOA 3FXHA 5BUOA 4JJFA 1E86A 2WVNA 3FVYA 1BR4A 2PF4E 2Q4FA 2X0CA 4ZLCA 3CAXA 1YDIA 3C62A 1VMAA 4CBEA 5L0DA 1M56C 3IQ5A 3UMHA 3HTKC 2LD6A 2C03A 2P0NA 3WHNA 4MVOA 1AVOB 3U0CA 2KW3C 2ZXPA 2QNLA 3EZHA 3EHMA 4IWBA 3U8VA 1VK5A 1MMGA 1ZW3A 1Z23A 3EGXB 4DXWA 2PP4A 3SZRA 2NUPA 4FAPB 3NMKA 5A6BA 2MWQA 2KSFA 1SMYF 3E70C 4QI0A 3SYNA 2H8AA 4KBLA 4O6YA 1I4YA 4WJ0A 4QI2A 3L8JA 1ZYRF 1TWHA 1OW6A 3JRMO 3V5YA 2YEVA 2XXAB 1TQGA 2J0XA 3AG4C 4F4BA 2J9WA 2I8BA 5KYUB 1EA8A 2R7RA 4CSAA 3S28A 3ATPA 4Q7CA 5AC5A 4IAOA 5TJ5E 2Q7RA 4U9DA 2MYSA 4AE4B 2HJMA 3K66A 1YYJA 4OINF 1VYKA 3U9MA 2YLDA 4CS9C 4EBJA 2R7XA 3W2WA 1YA7O 3K1IA 4OIQF 2DYRC 1WATA 3RVYA 5JS5A 4U5DE 2YKZA 2HJ3A 1LE2A 2ZXRA 1WGWA 2OU6A 4MW3A 1O87A 4YT4A 2ZPAA 3B0PA 3SNHA 2MHRA 2P1AA 1ZZPA 3QMKA 5A6BD 2BE5F 3WODF 3NMIA 4Q4ZF 4DRHB 1VYIA 1GQAA 1MMAA 1UG7A 4JURI 2W9YA 3U2MA 1D0YA 2GWWA 3ASOC 4PK4A 3SXZA 3HNJA 4E0IA 3RVZA 5JLIA 4G7HF 4CX9A 1NFNA 2OKUA 3JSEO 4LLEA 5A6JA 3GORA 1Z3IX 3TOLA 5EGYA 3EGDB 2J9VA 3NMJA 2R02A 2I15A 4XTKA 4CDVA 2J7PD 4YK5A 2NPUA 1JPNA 1OKKA 2HMZA 3MLGA 3V5XA 2P7VA 3JCUQ 3DXJF 1FNTc 4G7ZF 2D4UA 3ABLC 2HZ8A 5DS6A 5DVWA 4EIYA 1E83A 2AU5A 1LM3B 4MW8A 4ER9A 1WTYA 4LLCA 1Z6AA 2WZFA 3VAYA 1YAUO 2XLEA 3G4XA 3ZIBA 1KNYA 1C17M 3KPHA 4NTAA 3UR3C 2P61A 2XL6A 3I5QA 4JIOA 2OEVA 3N24A 4O6MA 4ULWA 5L3QA 5HSWA 1VOMA 2YWAA 3RF3A 3JSZA 2ETSA 1LPEA 1S7ZA 1T6IA 2R25A 2JD3A 1FFTC 2ZXOA 2Y69C 3GEIA 5D91A 1LS1A 1R4TA 2A1DD 5COMA 3I4UA 2B0HA 2OG2A 3U3FA 3HNIA 3TD7A 1RMVA 1V55C 2DB4A 5A6AA 1I4ZA 1K05A 1YZCA 3AQCA 2LCHA 3NKDA 4JW1A 5IY5C 2B0JA 4FWVA 4JC7A 4YL3A 3ZDLA 2R7TA 1K04A 1FR0A 3MYIA 2BC5A 2EPNA 2VASA 4C7OA 4LERA 1NU9C 4KNWA 1QQ3A 1TFKB 1A0BA 5JRAA 3QVYA 2GAQA 3EGXA 3EG9B 3GANA 5KYYB 2EPKX 2WVOA 4K0DA 4AL1A 5JP7A 5L0IA 4NQFA 3U3BA 1QZXA 3A9CA 3VF0A 4YT5A 2A0BA 1Y6DA 1HE9A 1ZHYA 2EPMX 3K7DA 1MMDA 3K1IC 4P9TA 2KGOA 2FFHA 2HSBA 4MTFA 2WL8A 3FAJA 3IHUA 2EIMC 4J7TA 2CW0F 1YYXA 2IM8A 2YVKA 5E33A 2V3CC 1D1AA 3NRHA 4WABA 4PFPA 2VCAA 1TWCA 3EJNA 3SXKA 2ZXWC 3EH2A 1L3PA 4N06A 1ZW2A 3ITFA 2YL3A 3AGTA 3CEXA 3IEEA 3LLIA 3S27A 3GM3A 3RKOF 1VTMP 4L6RA 3C7JA 3DM9B 4BEMJ 4PACA 5DS4A 1ORSC 2YRFA 1CPRA 4W8KA 3UGOA 4HE8D 4U9EA 1OR2A 2DI3A 2QLAA 3FOOA 5KYUA 2G62A 3OA1A 4IB4A 1PV3A 2KQ9A 4NY3A 2PNOA 5E3CA 2R7OA 2IXOA 1U89A 4MVRA 1V74B 3H2UA 2H7BA 4W8PA 5CI8A 1VLTA 3M15A 1WWPA 2NG1A 2NUPB 4FESA 3RYLA 4ZLDA 2EIKC 1HY5A 2HKVA 2XLHA 5EHHA 2JPUA 2KK1A 4JJGA 2XXAA 3S84A 4U5EE 2OCCC 3Q6NA 4MVMA 1NLXA 3Q7GA 1HE1A 3C8GB 3DM5A 3S0XA 1ORYA 1A7DA 4JCZA 4PJJA
chains in the Genus database with same CATH topology
2PFDA 1G8XA 3LS0A 3ZC4A 2IXNA 4DVZA 1D1CA 3DAGA 1PD0A 2EIJC 5KYXB 5E2QA 1MNDA 2J45A 1FMWA 4I1MA 4U5BE 2Q9AA 2WVQA 2H7VC 5B3SC 2XL4A 5FCLA 2NUTB 2VH3A 4DVYP 1TWAA 2Y3GA 1M2VA 3DD7A 2R7SA 3JT1A 4J32B 5KYYA 2W4MA 3ABKC 3LESA 4G7OF 5F5FA 4RBNA 3FHDA 2R7UA 1OCRC 1TKNA 1Z5ZA 1N1CA 3UMIA 2YZSA 3V7OA 1D0ZA 3RH3A 3B0VC 2PX3A 3EHNA 4XLPF 2J7PA 4MNDA 2L81A 3WG7C 4EWCA 3OEOA 4BJ6C 2O9XA 3ECSA 1MNEA 3T6BA 4IJJA 2P6VA 4PJNA 4PFOA 4U5FE 5F5HA 1O5HA 2KJGA 2DYSC 1KU2A 3JRTA 3X1OA 1LVKA 3N2ZB 4XWJA 1NU7D 1QLEC 3AG2C 3O39A 4YT4A 3L34A 3I5PA 5E3AA 4O7GA 1ZHXA 4PJLA 3EQLF 2Y3HA 2Q9CA 1PD1A 1J8YF 2X51A 2YHSA 4JVSA 3EFOB 5KYNA 4I3MA 3W8HA 4DOZA 4I1OB 3F46A 2HV7A 2L9JA 4OIPF 2A6HF 4O79A 4AE4A 3B0UX 4OIOF 2VB6A 1ZHTA 3X2QC 4OD5A 2D5RB 2M4EA 4C7OB 3KL4A 4DBRA 5D92A 1W2WA 4RDAA 4PJMA 1TWGA 1IZMA 3DJNB 3ZVRA 4JCHA 4CSAC 2CGEA 3T6JA 4BJ5A 5T3WA 5KYWB 3LAYA 2A69F 3L0IA 4C3DA 2W45A 1OCCC 4ANJA 3QZCA 3RIPA 3N0TA 1MMNA 4XLNF 1FTSA 4O6NA 3UGPA 3FDQA 3CSKA 2CNWA 3M1CB 1ZHWA 3NKEA 4OD4A 4BJ6A 2EINC 1SF8A 2R7QA 4RD9A 4M63A 2J9UA 5T1DB 2E87A 1OKKD 3PMRA 2EILC 1NG1A 1IW7F 2XRHA 5KYXA 4P6IC 4QDLA 1BR1A 3DZAA 4B6IA 4CS8C 4JZAA 4H4KC 3ZG1A 4HEAJ 2GFHA 3DMDA 3K1HA 5DS5A 3NG1A 3O6XA 2Q9BA 3VYWA 3ZSUA 4E7ZA 4HFFB 1JPJA 4HFKB 3H65A 4IRUA 3EPVA 5DQZA 3UNGC 2FGYA 3KMIA 4BG0A 5B1AC 2A68F 3GODA 4U5GA 2HV6A 2R7WA 1OCZC 3Q6MA 4OIRF 3LJBA 3E9VA 1M2OA 3EGDA 2J46A 1RJ9B 2Y3BA 4U5HA 4YT8A 4G0HA 4I44A 3OWTA 4C3BA 3NDBB 3EZIA 5KYWA 2QTVA 4YWQA 4Q5SF 2WZLA 3K6BA 4KI2A 1FFHA 2WZGA 1ZU4A 1ZHZA 4MQ9F 4GEHA 4BEJA 4YJWA 3K33A 2DGJA 3S29A 2IYLD 2J0WA 2QY9A 3CZ6A 3B9QA 2KNHA 3SEOA 3DAFA 4X0RA 2A6EF 3LLKA 1OCOC 3LS1A 4YN0B 4CS7A 4CS8A 1M2VB 2PX0A 3AG3C 4KNVA 4J30B 1BR2A 3NYMA 2R7VA 3ABMC 3ASNC 3AQBA 1V54C 1D0XA 3MX3A 2IXMA 3EH1A 4FX5A 1RJ9A 2Y39A 5CI9A 4CS9A 1ST6A 3W8IA 3HLZA 2G3KA 3KH2A 4LACB 1FMVA 4AK9A 4BJ5C 4EBBA 4K7BA 3DJUB 2XSEA 4E7SA 5DLJA 2IXPA 5T3TA 1Z63A 2WB7A 4BJ1A 1D1BA 5DQTA 2IOQA 4KC9A 5L3VA 3SP1A 3RFYA 1SZIA 1ZU5A 3F47A 3LNRA 4BJTA 5B1BC 3W2VA 2LSEA 3NYLA 2H7OA 3KKBA 1M57C 2G3VA 1J8MF 3AG1C 1NZEA 1PCXA 3CQZA 3UMKA 3POVA 2Y3DA 3PHF2 1TR2A 3JYHA 4GYTA 2V26A 2C04A 4YT2A 4C3EA 3NYJA 2CNWD 3LEVA 2NUTA 1LKXA 4AX2A 3Q7LA 3EFOA 3T4RA 2CDQA 2Z15A 2W4BA 2Q3TA 3HJCA 4U5CE 4CIHA 3EG9A 4DBQA 5BUOA 4JJFA 2WVNA 3FVYA 1BR4A 2PF4E 4ZLCA 1VMAA 4CBEA 1M56C 3UMHA 3HTKC 2C03A 2KW3C 2ZXPA 3EZHA 3EHMA 4IWBA 1VK5A 1MMGA 1Z23A 3EGXB 2PP4A 3SZRA 2NUPA 2MWQA 1SMYF 3E70C 4QI0A 3SYNA 4WJ0A 4KBLA 4O6YA 4QI2A 1ZYRF 1TWHA 2XXAB 2YEVA 2J0XA 3AG4C 4F4BA 2J9WA 2I8BA 5KYUB 2R7RA 4CSAA 3S28A 4Q7CA 4IAOA 2MYSA 4AE4B 3K66A 4OINF 4CS9C 2R7XA 1VYKA 3W2WA 4OIQF 2DYRC 4U5DE 2ZXRA 1WGWA 1O87A 3B0PA 2ZPAA 3SNHA 3QMKA 4Q4ZF 2BE5F 3WODF 1VYIA 4JURI 1MMAA 2W9YA 1D0YA 3ASOC 4PK4A 4G7HF 4LLEA 1Z3IX 5EGYA 3EGDB 2J9VA 4XTKA 2J7PD 1JPNA 1OKKA 3MLGA 2P7VA 3JCUQ 3DXJF 4G7ZF 3ABLC 5DS6A 3ZIBA 4LLCA 1Z6AA 2WZFA 3VAYA 4A2NB 3UR3C 3I5QA 3N24A 4O6MA 4ULWA 5L3QA 5HSWA 1VOMA 3JSZA 1S7ZA 2JD3A 1FFTC 2ZXOA 2Y69C 5D91A 1LS1A 2A1DD 3I4UA 2OG2A 3TD7A 1V55C 3AQCA 3NKDA 4JW1A 5IY5C 2R7TA 2B0JA 4FWVA 2VASA 4C7OA 4LERA 1NU9C 4KNWA 3EGXA 3EG9B 3GANA 5KYYB 2WVOA 4K0DA 1QZXA 4YT5A 1ZHYA 3K7DA 1MMDA 3K1IC 2KGOA 2FFHA 2WL8A 3FAJA 2EIMC 2CW0F 5E33A 2V3CC 1D1AA 3NRHA 4PFPA 1TWCA 3EJNA 2ZXWC 3EH2A 4N06A 3ITFA 3IEEA 3LLIA 3S27A 3RKOF 3DM9B 5DS4A 4W8KA 3UGOA 4HE8D 5KYUA 2G62A 3OA1A 2KQ9A 4NY3A 5E3CA 2R7OA 2IXOA 2H7BA 5CI8A 4FESA 2NUPB 2NG1A 3RYLA 4ZLDA 2EIKC 5EHHA 4JJGA 2XXAA 4U5EE 2OCCC 3Q6NA 3Q7GA 3S0XA 3DM5A 5DVWA 4PJJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y3H A;  3EPV A;  3ITF A;  2Y39 A;  3O39 A;  3QZC A;  2Y3G A;  3ZG1 A;  2Y3B A;  3LAY A;  2Y3D A;  3OEO A; 
#chains in the Genus database with same CATH topology
 1CGM E;  3V5Z A;  2HS5 A;  1DOW A;  1G8X A;  2PFD A;  3LS0 A;  1GGQ A;  4JKV A;  3GWN A;  3ZC4 A;  1A41 A;  2IXN A;  1D1C A;  1EI7 A;  2XM4 A;  3DAG A;  4H54 A;  1PD0 A;  2EIJ C;  1FAP B;  4DVZ A;  5KYX B;  1I5N A;  3KYI A;  1XWJ A;  5E2Q A;  1MND A;  1JR8 A;  1QPU A;  1FMW A;  2J45 A;  3DWW A;  1A7E A;  4ULV A;  3LNM B;  3JYY A;  4XPX A;  3HNK A;  1EKY A;  1LI7 A;  4I1M A;  4U5B E;  1HW2 A;  2Q9A A;  3TJ5 A;  2WVQ A;  2H7V C;  4NTF A;  3IPM O;  5B3S C;  4G78 A;  3HKK A;  3GEH A;  2XL4 A;  3W4Y A;  5EK0 A;  5FCL A;  3M4B A;  2NUT B;  2VH3 A;  4DVY P;  1MQV A;  3JTL O;  2GA0 A;  4PR9 A;  2L6G A;  4GQH A;  1TWA A;  2Y3G A;  1LS4 A;  1M2V A;  3DD7 A;  4AL0 A;  2R7S A;  2XLW A;  3JT1 A;  4J32 B;  3GM1 A;  5KYY A;  2L7A A;  2W4M A;  3ABK C;  3LES A;  2NSF A;  4G7O F;  1R5I D;  1K40 A;  5F5F A;  3C18 A;  4RBN A;  3FHD A;  2R7U A;  1OCR C;  1H7I A;  1TKN A;  3M79 A;  1Z5Z A;  1Q0K A;  5A69 A;  1N1C A;  1RKE B;  3UMI A;  5AGF A;  2YZS A;  3V7O A;  4JTA B;  1D0Z A;  3RH3 A;  2NSG A;  1T6Q A;  3B0V C;  2UUH A;  4WGZ A;  3MBG A;  2PX3 A;  3EHN A;  4XLP F;  2J7P A;  4MND A;  2L81 A;  3WG7 C;  4EWC A;  3OEO A;  5A6K A;  4BJ6 C;  2O9X A;  3PCV A;  4LDR A;  3ECS A;  1MNE A;  1ZVZ A;  4IJJ A;  3T6B A;  3O55 A;  2P6V A;  2LFF A;  1T6U A;  4UDV A;  2OOC A;  4PJN A;  4PFO A;  3H2V A;  3JZ0 A;  4U5F E;  1YLM A;  3BRJ A;  3DI5 A;  1Z7Q c;  5F5H A;  1O5H A;  2KJG A;  2OEX A;  2DYS C;  4N4W A;  1Q0F A;  1KU2 A;  3JRT A;  1OW8 A;  1Y4C A;  3X1O A;  1LVK A;  3N2Z B;  4XWJ A;  1JMW A;  3O10 A;  3US6 A;  3L1M A;  1NU7 D;  1QLE C;  1G4U S;  1JAF A;  3AG2 C;  3O39 A;  3I5P A;  3L34 A;  4LDK A;  4O7G A;  5E3A A;  1ZHX A;  4PJL A;  1BDJ B;  3AJM A;  5L0G A;  3DE8 A;  3EQL F;  3LUT B;  5BQG A;  2VCC A;  2Y3H A;  3R7C A;  1E85 A;  2Q9C A;  1PD1 A;  1HW1 A;  1J8Y F;  2X51 A;  3KYJ A;  4DRJ B;  2YHS A;  2XLO A;  3QTH A;  3EFO B;  4JVS A;  5KYN A;  4LDQ A;  4I3M A;  4XQ1 A;  1O3U A;  3W8H A;  4DOZ A;  4I1O B;  4MVQ A;  3C8G D;  3F46 A;  3L8I A;  2HV7 A;  2L9J A;  4OIP F;  3J06 A;  2A6H F;  3VRC A;  3GM2 A;  1OR3 A;  1BZ4 A;  4O79 A;  4AE4 A;  4CDA A;  3B71 A;  3B0U X;  2VCB A;  4JEB A;  4K1O A;  3R2P A;  2VB6 A;  4Z9J A;  4OIO F;  1ZHT A;  2BL2 A;  2CCY A;  2YLI A;  3X2Q C;  3DKA A;  2AP3 A;  1RKC A;  2D5R B;  2M4E A;  2YQY A;  3KL4 A;  4OD5 A;  5D92 A;  1W2W A;  4DBR A;  4C7O B;  4RDA A;  1U6H A;  4E18 A;  2VC9 A;  2QE9 A;  1CGO A;  3TQO A;  1APC A;  4DRI B;  1NBB A;  3C8Z A;  4PJM A;  1YJG A;  5CIV A;  1JRA A;  1TWG A;  4XPW A;  2L6F A;  2XLM A;  1T9K A;  3IQC A;  4CJG A;  1IZM A;  1G4W R;  3DJN B;  4JCH A;  256B A;  3ZVR A;  2CGE A;  1WOL A;  1OW7 A;  2RSE B;  3T6G B;  3TOM A;  4CSA C;  1U0B B;  3T6J A;  3WAQ A;  5T3W A;  4BJ5 A;  1E84 A;  2QUP A;  4JRZ A;  1A7V A;  2IBF A;  1CPQ A;  3U5S A;  5KYW B;  3LAY A;  2A69 F;  3L0I A;  1XZQ A;  4C3D A;  2W45 A;  1OCC C;  1QVX A;  2RD9 A;  3G4Z A;  3QZC A;  4ANJ A;  5JT4 A;  1YAR O;  3RIP A;  3N0T A;  1MMN A;  4XLN F;  1FTS A;  5GPG B;  4O6N A;  3UGP A;  3FDQ A;  3CSK A;  2CNW A;  4A4A A;  3ZTM A;  3M1C B;  1ZHW A;  3NKE A;  3C8G A;  4OD4 A;  4BJ6 A;  2EIN C;  1SF8 A;  3U9J A;  2R7Q A;  3RQE A;  4RD9 A;  4M63 A;  4N6C A;  2J9U A;  5T1D B;  1LI5 A;  1OKK D;  2E87 A;  4XPY A;  3PMR A;  2EIL C;  3VM6 A;  4IAR A;  1NG1 A;  1IW7 F;  2XRH A;  5L0J A;  5KYX A;  4P6I C;  4QDL A;  4EUK B;  1BR1 A;  3DZA A;  4B6I A;  4CS8 C;  4JZA A;  4H4K C;  3ZG1 A;  1VB5 A;  5COG A;  1CGN A;  4HEA J;  4D4N A;  4EHP A;  2YLG A;  5JUA A;  2GFH A;  3DMD A;  3K1H A;  1JOG A;  5DS5 A;  3NG1 A;  2LK4 A;  3O6X A;  4JEA A;  4MVS A;  2AVK A;  1V4A A;  3SXY A;  2Q9B A;  2YL7 A;  3VYW A;  1KTM A;  1HMO A;  4CDY A;  3RW0 A;  2XS1 A;  2EPL X;  1F1M A;  3ZSU A;  4E7Z A;  1OXB A;  4HFF B;  5BQH A;  4MTG A;  1JPJ A;  3IQ6 A;  4R32 A;  1WN0 A;  4HFK B;  4JTC B;  5COF A;  2XLD A;  3H65 A;  2YL0 A;  4IRU A;  3EPV A;  4YL1 A;  2HFI A;  4E17 A;  4BPM A;  5DQZ A;  1DOV A;  2KC3 A;  1NSG B;  2FGY A;  3KMI A;  4NCQ A;  5B1A C;  4P9F A;  3UNG C;  4BG0 A;  1H9T A;  3TJ6 A;  2A68 F;  4MS2 A;  2ASR A;  1YA9 A;  2HUJ A;  1L7C A;  2JX0 A;  3GOD A;  5FZT A;  4U5G A;  1BBH A;  4J7Y A;  3S9O A;  3ZWI A;  2HV6 A;  2R7W A;  1OCZ C;  3Q6M A;  2AWC A;  4OIR F;  2L6H A;  2XLV A;  3LJB A;  3E9V A;  1M2O A;  3EGD A;  1GS9 A;  2J46 A;  1RJ9 B;  5B3I A;  2Y3B A;  5JSL A;  1H9G A;  3A11 A;  2A0U A;  2XL8 A;  3QVZ A;  4U5H A;  1Q0M A;  2M64 A;  4G0H A;  4I44 A;  3OWT A;  4C3B A;  4YT8 A;  5BQI A;  3NDB B;  1QSP A;  3EZI A;  2R03 A;  2HSQ A;  3FAP B;  2QTV A;  4WGY A;  4D4X A;  4YWQ A;  3DE9 A;  5KYW A;  2YL1 A;  2ICW G;  2F22 A;  4Q5S F;  1OXK A;  2KYH A;  3C63 A;  5L0C A;  2WZL A;  3K6B A;  4KI2 A;  1H6G A;  1HMD A;  1FFH A;  1M6T A;  2WZG A;  4IGG A;  1YZA A;  1C03 A;  1WAS A;  1ZU4 A;  3BEH A;  1ZHZ A;  4MQ9 F;  4GEH A;  5L0F A;  4A2N B;  2TMV P;  4BEJ A;  2HMQ A;  2OJE D;  4YJW A;  3K33 A;  1Q0D A;  1RKE A;  1RXQ A;  2DGJ A;  4NTB A;  4Z9H A;  4IAQ A;  3S29 A;  2IYL D;  2J0W A;  5HV9 A;  2QY9 A;  3CZ6 A;  3B9Q A;  3FMS A;  2KNH A;  3U8P A;  3SEO A;  3DAF A;  3GWL A;  4X0R A;  2LQG A;  2A6E F;  3LLK A;  1OCO C;  3LS1 A;  4YL0 A;  4YN0 B;  3SXM A;  3QW1 A;  5K0I A;  1T5O A;  4CS7 A;  4CS8 A;  1M2V B;  2PX0 A;  3AG3 C;  2ZD9 A;  4KNV A;  3T9O A;  4Z9I A;  3TUL A;  4J30 B;  1S05 A;  1UFB A;  1BR2 A;  3AOU A;  2UUI A;  2CYD A;  3B29 A;  1AEP A;  3NYM A;  2AWY A;  4MTO A;  2R7V A;  2J8W A;  3ABM C;  2R9R B;  1T01 A;  3AQB A;  2J9B A;  3ASN C;  3ZTZ A;  1V54 C;  2LFD A;  1D0X A;  4XEV A;  3TK0 A;  3MX3 A;  2IXM A;  3EH1 A;  2R05 A;  1RJ9 A;  4FX5 A;  1G5Z A;  2Y39 A;  4N6H A;  3QW0 A;  5CI9 A;  1RCP A;  1ST6 A;  4CS9 A;  3G50 A;  4JTD B;  3W8I A;  1YVI A;  3PDM P;  3ZQV A;  3HLZ A;  2G3K A;  3KH2 A;  1ORJ A;  1FMV A;  4LAC B;  4AK9 A;  5L0H A;  4BJ5 C;  4EBB A;  1XZP A;  4K7B A;  3DJU B;  2XSE A;  3S90 A;  3MYF A;  4E7S A;  2GDC A;  5DLJ A;  2IXP A;  5T3T A;  1TFO B;  1Z63 A;  4MVU A;  2FAP B;  2OQM A;  2WB7 A;  1OQC A;  1D1B A;  4BJ1 A;  1AUE A;  5DQT A;  4XEF A;  3RQF A;  3LEO A;  2IOQ A;  4KC9 A;  5L3V A;  3SP1 A;  3RFY A;  1SZI A;  1ZU5 A;  3F47 A;  3FOP A;  3LNR A;  4EBK A;  4BJT A;  5B1B C;  3U2L A;  2LSE A;  3W2V A;  3RQG A;  3NYL A;  2H7O A;  1SR2 A;  1LIH A;  1VLS A;  3HNL A;  1C02 A;  3KKB A;  4NC3 A;  1M57 C;  1SYQ A;  2G3V A;  1J8M F;  1EQ1 A;  3AG1 C;  1NZE A;  1PCX A;  1Q0G A;  4CIP A;  1E2X A;  3CQZ A;  3UMK A;  1B68 A;  3POV A;  1NFO A;  2Y3D A;  2XS8 A;  3AGU A;  3PHF 2;  1TR2 A;  5JVE A;  3JYH A;  3IQT A;  3ZQY A;  1QKR A;  3M4C A;  4GYT A;  2V26 A;  4DJ9 A;  2C04 A;  4MVZ A;  4XEK A;  4YT2 A;  2OJQ A;  5F28 E;  4C3E A;  3NYJ A;  2CNW D;  3LEV A;  2LIG A;  2NUT A;  1LKX A;  4AX2 A;  3Q7L A;  2XM0 A;  3EFO A;  3MFN A;  3T4R A;  4JE9 A;  2Q00 A;  2CDQ A;  2Z15 A;  3GEE A;  1GM5 A;  2W4B A;  5AC4 A;  2Q3T A;  3HJC A;  4U5C E;  4EKW A;  2LP4 A;  4CIH A;  2PBE A;  4E0H A;  2EPO A;  3EG9 A;  4ONS A;  1LE4 A;  4DBQ A;  4CJO A;  3FXH A;  5BUO A;  4JJF A;  1E86 A;  2WVN A;  3FVY A;  1BR4 A;  2PF4 E;  2Q4F A;  2X0C A;  4ZLC A;  3CAX A;  1YDI A;  3C62 A;  1VMA A;  4CBE A;  5L0D A;  1M56 C;  3IQ5 A;  3UMH A;  3HTK C;  2LD6 A;  2C03 A;  2P0N A;  3WHN A;  4MVO A;  1AVO B;  3U0C A;  2KW3 C;  2ZXP A;  2QNL A;  3EZH A;  3EHM A;  4IWB A;  3U8V A;  1VK5 A;  1MMG A;  1ZW3 A;  1Z23 A;  3EGX B;  4DXW A;  2PP4 A;  3SZR A;  2NUP A;  4FAP B;  3NMK A;  5A6B A;  2MWQ A;  2KSF A;  1SMY F;  3E70 C;  4QI0 A;  3SYN A;  2H8A A;  4KBL A;  4O6Y A;  1I4Y A;  4WJ0 A;  4QI2 A;  3L8J A;  1ZYR F;  1TWH A;  1OW6 A;  3JRM O;  3V5Y A;  2YEV A;  2XXA B;  1TQG A;  2J0X A;  3AG4 C;  4F4B A;  2J9W A;  2I8B A;  5KYU B;  1EA8 A;  2R7R A;  4CSA A;  3S28 A;  3ATP A;  4Q7C A;  5AC5 A;  4IAO A;  5TJ5 E;  2Q7R A;  4U9D A;  2MYS A;  4AE4 B;  2HJM A;  3K66 A;  1YYJ A;  4OIN F;  1VYK A;  3U9M A;  2YLD A;  4CS9 C;  4EBJ A;  2R7X A;  3W2W A;  1YA7 O;  3K1I A;  4OIQ F;  2DYR C;  1WAT A;  3RVY A;  5JS5 A;  4U5D E;  2YKZ A;  2HJ3 A;  1LE2 A;  2ZXR A;  1WGW A;  2OU6 A;  4MW3 A;  1O87 A;  4YT4 A;  2ZPA A;  3B0P A;  3SNH A;  2MHR A;  2P1A A;  1ZZP A;  3QMK A;  5A6B D;  2BE5 F;  3WOD F;  3NMI A;  4Q4Z F;  4DRH B;  1VYI A;  1GQA A;  1MMA A;  1UG7 A;  4JUR I;  2W9Y A;  3U2M A;  1D0Y A;  2GWW A;  3ASO C;  4PK4 A;  3SXZ A;  3HNJ A;  4E0I A;  3RVZ A;  5JLI A;  4G7H F;  4CX9 A;  1NFN A;  2OKU A;  3JSE O;  4LLE A;  5A6J A;  3GOR A;  1Z3I X;  3TOL A;  5EGY A;  3EGD B;  2J9V A;  3NMJ A;  2R02 A;  2I15 A;  4XTK A;  4CDV A;  2J7P D;  4YK5 A;  2NPU A;  1JPN A;  1OKK A;  2HMZ A;  3MLG A;  3V5X A;  2P7V A;  3JCU Q;  3DXJ F;  1FNT c;  4G7Z F;  2D4U A;  3ABL C;  2HZ8 A;  5DS6 A;  5DVW A;  4EIY A;  1E83 A;  2AU5 A;  1LM3 B;  4MW8 A;  4ER9 A;  1WTY A;  4LLC A;  1Z6A A;  2WZF A;  3VAY A;  1YAU O;  2XLE A;  3G4X A;  3ZIB A;  1KNY A;  1C17 M;  3KPH A;  4NTA A;  3UR3 C;  2P61 A;  2XL6 A;  3I5Q A;  4JIO A;  2OEV A;  3N24 A;  4O6M A;  4ULW A;  5L3Q A;  5HSW A;  1VOM A;  2YWA A;  3RF3 A;  3JSZ A;  2ETS A;  1LPE A;  1S7Z A;  1T6I A;  2R25 A;  2JD3 A;  1FFT C;  2ZXO A;  2Y69 C;  3GEI A;  5D91 A;  1LS1 A;  1R4T A;  2A1D D;  5COM A;  3I4U A;  2B0H A;  2OG2 A;  3U3F A;  3HNI A;  3TD7 A;  1RMV A;  1V55 C;  2DB4 A;  5A6A A;  1I4Z A;  1K05 A;  1YZC A;  3AQC A;  2LCH A;  3NKD A;  4JW1 A;  5IY5 C;  2B0J A;  4FWV A;  4JC7 A;  4YL3 A;  3ZDL A;  2R7T A;  1K04 A;  1FR0 A;  3MYI A;  2BC5 A;  2EPN A;  2VAS A;  4C7O A;  4LER A;  1NU9 C;  4KNW A;  1QQ3 A;  1TFK B;  1A0B A;  5JRA A;  3QVY A;  2GAQ A;  3EGX A;  3EG9 B;  3GAN A;  5KYY B;  2EPK X;  2WVO A;  4K0D A;  4AL1 A;  5JP7 A;  5L0I A;  4NQF A;  3U3B A;  1QZX A;  3A9C A;  3VF0 A;  4YT5 A;  2A0B A;  1Y6D A;  1HE9 A;  1ZHY A;  2EPM X;  3K7D A;  1MMD A;  3K1I C;  4P9T A;  2KGO A;  2FFH A;  2HSB A;  4MTF A;  2WL8 A;  3FAJ A;  3IHU A;  2EIM C;  4J7T A;  2CW0 F;  1YYX A;  2IM8 A;  2YVK A;  5E33 A;  2V3C C;  1D1A A;  3NRH A;  4WAB A;  4PFP A;  2VCA A;  1TWC A;  3EJN A;  3SXK A;  2ZXW C;  3EH2 A;  1L3P A;  4N06 A;  1ZW2 A;  3ITF A;  2YL3 A;  3AGT A;  3CEX A;  3IEE A;  3LLI A;  3S27 A;  3GM3 A;  3RKO F;  1VTM P;  4L6R A;  3C7J A;  3DM9 B;  4BEM J;  4PAC A;  5DS4 A;  1ORS C;  2YRF A;  1CPR A;  4W8K A;  3UGO A;  4HE8 D;  4U9E A;  1OR2 A;  2DI3 A;  2QLA A;  3FOO A;  5KYU A;  2G62 A;  3OA1 A;  4IB4 A;  1PV3 A;  2KQ9 A;  4NY3 A;  2PNO A;  5E3C A;  2R7O A;  2IXO A;  1U89 A;  4MVR A;  1V74 B;  3H2U A;  2H7B A;  4W8P A;  5CI8 A;  1VLT A;  3M15 A;  1WWP A;  2NG1 A;  2NUP B;  4FES A;  3RYL A;  4ZLD A;  2EIK C;  1HY5 A;  2HKV A;  2XLH A;  5EHH A;  2JPU A;  2KK1 A;  4JJG A;  2XXA A;  3S84 A;  4U5E E;  2OCC C;  3Q6N A;  4MVM A;  1NLX A;  3Q7G A;  1HE1 A;  3C8G B;  3DM5 A;  3S0X A;  1ORY A;  1A7D A;  4JCZ A;  4PJJ A; 
#chains in the Genus database with same CATH homology
 2PFD A;  1G8X A;  3LS0 A;  3ZC4 A;  2IXN A;  4DVZ A;  1D1C A;  3DAG A;  1PD0 A;  2EIJ C;  5KYX B;  5E2Q A;  1MND A;  2J45 A;  1FMW A;  4I1M A;  4U5B E;  2Q9A A;  2WVQ A;  2H7V C;  5B3S C;  2XL4 A;  5FCL A;  2NUT B;  2VH3 A;  4DVY P;  1TWA A;  2Y3G A;  1M2V A;  3DD7 A;  2R7S A;  3JT1 A;  4J32 B;  5KYY A;  2W4M A;  3ABK C;  3LES A;  4G7O F;  5F5F A;  4RBN A;  3FHD A;  2R7U A;  1OCR C;  1TKN A;  1Z5Z A;  1N1C A;  3UMI A;  2YZS A;  3V7O A;  1D0Z A;  3RH3 A;  3B0V C;  2PX3 A;  3EHN A;  4XLP F;  2J7P A;  4MND A;  2L81 A;  3WG7 C;  4EWC A;  3OEO A;  4BJ6 C;  2O9X A;  3ECS A;  1MNE A;  3T6B A;  4IJJ A;  2P6V A;  4PJN A;  4PFO A;  4U5F E;  5F5H A;  1O5H A;  2KJG A;  2DYS C;  1KU2 A;  3JRT A;  3X1O A;  1LVK A;  3N2Z B;  4XWJ A;  1NU7 D;  1QLE C;  3AG2 C;  3O39 A;  4YT4 A;  3L34 A;  3I5P A;  5E3A A;  4O7G A;  1ZHX A;  4PJL A;  3EQL F;  2Y3H A;  2Q9C A;  1PD1 A;  1J8Y F;  2X51 A;  2YHS A;  4JVS A;  3EFO B;  5KYN A;  4I3M A;  3W8H A;  4DOZ A;  4I1O B;  3F46 A;  2HV7 A;  2L9J A;  4OIP F;  2A6H F;  4O79 A;  4AE4 A;  3B0U X;  4OIO F;  2VB6 A;  1ZHT A;  3X2Q C;  4OD5 A;  2D5R B;  2M4E A;  4C7O B;  3KL4 A;  4DBR A;  5D92 A;  1W2W A;  4RDA A;  4PJM A;  1TWG A;  1IZM A;  3DJN B;  3ZVR A;  4JCH A;  4CSA C;  2CGE A;  3T6J A;  4BJ5 A;  5T3W A;  5KYW B;  3LAY A;  2A69 F;  3L0I A;  4C3D A;  2W45 A;  1OCC C;  4ANJ A;  3QZC A;  3RIP A;  3N0T A;  1MMN A;  4XLN F;  1FTS A;  4O6N A;  3UGP A;  3FDQ A;  3CSK A;  2CNW A;  3M1C B;  1ZHW A;  3NKE A;  4OD4 A;  4BJ6 A;  2EIN C;  1SF8 A;  2R7Q A;  4RD9 A;  4M63 A;  2J9U A;  5T1D B;  2E87 A;  1OKK D;  3PMR A;  2EIL C;  1NG1 A;  1IW7 F;  2XRH A;  5KYX A;  4P6I C;  4QDL A;  1BR1 A;  3DZA A;  4B6I A;  4CS8 C;  4JZA A;  4H4K C;  3ZG1 A;  4HEA J;  2GFH A;  3DMD A;  3K1H A;  5DS5 A;  3NG1 A;  3O6X A;  2Q9B A;  3VYW A;  3ZSU A;  4E7Z A;  4HFF B;  1JPJ A;  4HFK B;  3H65 A;  4IRU A;  3EPV A;  5DQZ A;  3UNG C;  2FGY A;  3KMI A;  4BG0 A;  5B1A C;  2A68 F;  3GOD A;  4U5G A;  2HV6 A;  2R7W A;  1OCZ C;  3Q6M A;  4OIR F;  3LJB A;  3E9V A;  1M2O A;  3EGD A;  2J46 A;  1RJ9 B;  2Y3B A;  4U5H A;  4YT8 A;  4G0H A;  4I44 A;  3OWT A;  4C3B A;  3NDB B;  3EZI A;  5KYW A;  2QTV A;  4YWQ A;  4Q5S F;  2WZL A;  3K6B A;  4KI2 A;  1FFH A;  2WZG A;  1ZU4 A;  1ZHZ A;  4MQ9 F;  4GEH A;  4BEJ A;  4YJW A;  3K33 A;  2DGJ A;  3S29 A;  2IYL D;  2J0W A;  2QY9 A;  3CZ6 A;  3B9Q A;  2KNH A;  3SEO A;  3DAF A;  4X0R A;  2A6E F;  3LLK A;  1OCO C;  3LS1 A;  4YN0 B;  4CS7 A;  4CS8 A;  1M2V B;  2PX0 A;  3AG3 C;  4KNV A;  4J30 B;  1BR2 A;  3NYM A;  2R7V A;  3ABM C;  3ASN C;  3AQB A;  1V54 C;  1D0X A;  3MX3 A;  2IXM A;  3EH1 A;  4FX5 A;  1RJ9 A;  2Y39 A;  5CI9 A;  4CS9 A;  1ST6 A;  3W8I A;  3HLZ A;  2G3K A;  3KH2 A;  4LAC B;  1FMV A;  4AK9 A;  4BJ5 C;  4EBB A;  4K7B A;  3DJU B;  2XSE A;  4E7S A;  5DLJ A;  2IXP A;  5T3T A;  1Z63 A;  2WB7 A;  4BJ1 A;  1D1B A;  5DQT A;  2IOQ A;  4KC9 A;  5L3V A;  3SP1 A;  3RFY A;  1SZI A;  1ZU5 A;  3F47 A;  3LNR A;  4BJT A;  5B1B C;  3W2V A;  2LSE A;  3NYL A;  2H7O A;  3KKB A;  1M57 C;  2G3V A;  1J8M F;  3AG1 C;  1NZE A;  1PCX A;  3CQZ A;  3UMK A;  3POV A;  2Y3D A;  3PHF 2;  1TR2 A;  3JYH A;  4GYT A;  2V26 A;  2C04 A;  4YT2 A;  4C3E A;  3NYJ A;  2CNW D;  3LEV A;  2NUT A;  1LKX A;  4AX2 A;  3Q7L A;  3EFO A;  3T4R A;  2CDQ A;  2Z15 A;  2W4B A;  2Q3T A;  3HJC A;  4U5C E;  4CIH A;  3EG9 A;  4DBQ A;  5BUO A;  4JJF A;  2WVN A;  3FVY A;  1BR4 A;  2PF4 E;  4ZLC A;  1VMA A;  4CBE A;  1M56 C;  3UMH A;  3HTK C;  2C03 A;  2KW3 C;  2ZXP A;  3EZH A;  3EHM A;  4IWB A;  1VK5 A;  1MMG A;  1Z23 A;  3EGX B;  2PP4 A;  3SZR A;  2NUP A;  2MWQ A;  1SMY F;  3E70 C;  4QI0 A;  3SYN A;  4WJ0 A;  4KBL A;  4O6Y A;  4QI2 A;  1ZYR F;  1TWH A;  2XXA B;  2YEV A;  2J0X A;  3AG4 C;  4F4B A;  2J9W A;  2I8B A;  5KYU B;  2R7R A;  4CSA A;  3S28 A;  4Q7C A;  4IAO A;  2MYS A;  4AE4 B;  3K66 A;  4OIN F;  4CS9 C;  2R7X A;  1VYK A;  3W2W A;  4OIQ F;  2DYR C;  4U5D E;  2ZXR A;  1WGW A;  1O87 A;  3B0P A;  2ZPA A;  3SNH A;  3QMK A;  4Q4Z F;  2BE5 F;  3WOD F;  1VYI A;  4JUR I;  1MMA A;  2W9Y A;  1D0Y A;  3ASO C;  4PK4 A;  4G7H F;  4LLE A;  1Z3I X;  5EGY A;  3EGD B;  2J9V A;  4XTK A;  2J7P D;  1JPN A;  1OKK A;  3MLG A;  2P7V A;  3JCU Q;  3DXJ F;  4G7Z F;  3ABL C;  5DS6 A;  3ZIB A;  4LLC A;  1Z6A A;  2WZF A;  3VAY A;  4A2N B;  3UR3 C;  3I5Q A;  3N24 A;  4O6M A;  4ULW A;  5L3Q A;  5HSW A;  1VOM A;  3JSZ A;  1S7Z A;  2JD3 A;  1FFT C;  2ZXO A;  2Y69 C;  5D91 A;  1LS1 A;  2A1D D;  3I4U A;  2OG2 A;  3TD7 A;  1V55 C;  3AQC A;  3NKD A;  4JW1 A;  5IY5 C;  2R7T A;  2B0J A;  4FWV A;  2VAS A;  4C7O A;  4LER A;  1NU9 C;  4KNW A;  3EGX A;  3EG9 B;  3GAN A;  5KYY B;  2WVO A;  4K0D A;  1QZX A;  4YT5 A;  1ZHY A;  3K7D A;  1MMD A;  3K1I C;  2KGO A;  2FFH A;  2WL8 A;  3FAJ A;  2EIM C;  2CW0 F;  5E33 A;  2V3C C;  1D1A A;  3NRH A;  4PFP A;  1TWC A;  3EJN A;  2ZXW C;  3EH2 A;  4N06 A;  3ITF A;  3IEE A;  3LLI A;  3S27 A;  3RKO F;  3DM9 B;  5DS4 A;  4W8K A;  3UGO A;  4HE8 D;  5KYU A;  2G62 A;  3OA1 A;  2KQ9 A;  4NY3 A;  5E3C A;  2R7O A;  2IXO A;  2H7B A;  5CI8 A;  4FES A;  2NUP B;  2NG1 A;  3RYL A;  4ZLD A;  2EIK C;  5EHH A;  4JJG A;  2XXA A;  4U5E E;  2OCC C;  3Q6N A;  3Q7G A;  3S0X A;  3DM5 A;  5DVW A;  4PJJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...