3QZCA

Structure of the periplasmic stress response protein cpxp
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
108
structure length
108
Chain Sequence
HMFDGISLTEHQRQQMRDLMQQARHEQPPVNVSELETMHRLVTAENFDENAVRAQAEKMANEQIARQVEMAKVRNQMYRLLTPEQQAVLNEKHQQRMEQLRDVTQWQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Periplasmic Stress Response Protein CpxP.
pubmed doi rcsb
molecule keywords Periplasmic protein CpxP
molecule tags Signaling protein
source organism Escherichia coli
total genus 41
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1490 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3qzcA00
3LAYA 2Y3DA 2Y39A 2Y3HA 3EPVA 2Y3BA 2Y3GA 3QZCA 3ZG1A 3ITFA 3O39A 3OEOA
chains in the Genus database with same CATH superfamily
1UFBA 4PJLA 3JZ0A 3SXMA 4I1OB 4J32B 3HLZA 2EPLX 4U5DE 3DD7A 3GEEA 2G62A 2LFDA 2LCHA 2YLDA 1K40A 4E18A 1UG7A 2ZXRA 3GM1A 3LAYA 1GS9A 4AE4A 1FNTc 4KI2A 2OOCA 5B1BC 2ZPAA 3C7JA 1VLSA 2J7PD 3U9JA 3LNRA 3POVA 4YT5A 2Y69C 1O3UA 1A7DA 4KNWA 1ZW3A 3CSKA 1I4ZA 4LDKA 4WGYA 2L6FA 1RXQA 3PMRA 4BPMA 4XLPF 3OA1A 2OCCC 3LEVA 4CS9C 1LE4A 1FR0A 2W45A 3VRCA 2AVKA 1WGWA 3JSZA 1T6IA 2XSEA 4OIOF 4MTOA 2NUTA 3AG2C 5CIVA 2PX3A 4AX2A 1CPQA 1EQ1A 4DRJB 1CPRA 3ASOC 256BA 4JKVA 4R32A 1Z6AA 3SYNA 5L3QA 1LKXA 1ORSC 1FMWA 4ULWA 1ZHTA 3U3FA 1H9TA 1JRAA 1ZHXA 1BR2A 3NYJA 3EFOA 4OD4A 2YL1A 5CI8A 2QE9A 1CGOA 2LIGA 4BJ5A 2OEXA 5T3TA 4YWQA 3B0VC 4QI0A 3ITFA 3TJ5A 3VM6A 2Q9CA 3QVZA 2IYLD 2P1AA 4J7YA 1MQVA 1XWJA 4U5BE 3RH3A 3X2QC 1E86A 1FFTC 4C7OB 2R7VA 1QKRA 4NTAA 1BZ4A 2LQGA 3GWLA 3EQLF 4YL0A 3M1CB 1M2VB 2XLWA 1EKYA 5IY5C 2R7UA 1L3PA 4Q7CA 3IPMO 3U3BA 4DOZA 2GFHA 3SXZA 3MX3A 4NCQA 1T9KA 1WTYA 3UMIA 3GEIA 2YLGA 3W8IA 3SP1A 2XL6A 4BJ5C 4NY3A 4IARA 3ZG1A 2MWQA 3OWTA 2EILC 3S84A 2CGEA 2NPUA 4BG0A 2W4MA 2BC5A 2MHRA 1Z7Qc 1KNYA 2ZXPA 5KYNA 2LP4A 3ABKC 4HE8D 4AE4B 3UNGC 2J7PA 3QW0A 2A6HF 2LFFA 3W8HA 3CEXA 1PV3A 4MTGA 2EPMX 3L8IA 2QNLA 3ZTMA 1AVOB 2HSBA 2YWAA 4O79A 3KL4A 3HJCA 2YL7A 1C02A 2HMQA 4EUKB 4K0DA 2R7OA 3QTHA 2CW0F 3EZIA 4JCHA 4PFOA 1OQCA 2HUJA 4OIRF 4KBLA 3HNLA 4ONSA 1ZHZA 2NUTB 4IB4A 4MVQA 1MMGA 1JPJA 1ZU4A 2AU5A 2Y3GA 3S27A 4G7ZF 1YARO 3SZRA 4AL0A 2B0JA 1YA7O 2CDQA 1AEPA 2V3CC 1T5OA 5EGYA 4O6NA 3AOUA 3L34A 5DLJA 3O6XA 3LNMB 2QTVA 3AG1C 3EFOB 3OEOA 3ZWIA 2ETSA 4LDQA 5KYWA 5AGFA 2J9BA 2ASRA 3ATPA 3IHUA 4PACA 1FFHA 1SZIA 3I4UA 2QLAA 4G7HF 1SMYF 2J9VA 2R25A 2PX0A 4U5GA 4DJ9A 1ORJA 1XZQA 2XM0A 3BEHA 3U2LA 4EBJA 1G4WR 5AC4A 1TWCA 3S0XA 4AK9A 2VASA 3JYHA 3UMKA 2DB4A 1LM3B 4IAOA 3S28A 3T9OA 3WAQA 4BJTA 3RW0A 2A6EF 4JRZA 2J9WA 5L0HA 2PP4A 5L0DA 3S90A 3MFNA 2NG1A 3S29A 1A7EA 3TQOA 2YVKA 3VF0A 1ZVZA 4DRHB 1E85A 3EZHA 3T6JA 3HTKC 1BR1A 3G4XA 5FZTA 5E33A 4LLCA 1JOGA 1LVKA 1NLXA 3L1MA 1Q0DA 3Q7LA 1LPEA 1VOMA 3GWNA 3LLIA 4I44A 4N06A 1M57C 4ANJA 1Z63A 2KSFA 4MVOA 3DE8A 4JVSA 4YK5A 5AC5A 4JURI 1RMVA 1PCXA 1LS1A 1R5ID 3HKKA 4CJOA 1VB5A 3CAXA 4QDLA 1R4TA 2W9YA 2D4UA 3DMDA 5E3CA 5F28E 3ZIBA 4CDVA 4N6HA 1WN0A 5COGA 1YZAA 1V54C 3NMJA 5EK0A 1LS4A 2C03A 2Y3DA 1MNDA 4EHPA 3RQEA 5HV9A 3ZQYA 3GM3A 4MS2A 1T6UA 3QZCA 1H9GA 3VAYA 3N2ZB 1ST6A 3RKOF 4BJ6A 1VYIA 2PF4E 4JW1A 1OCRC 1C17M 1ZHWA 1QQ3A 4XEVA 1TFKB 2WL8A 1LI5A 2H8AA 2EIKC 2LD6A 5HSWA 4X0RA 1WWPA 4WABA 3NMIA 4E0HA 2G3KA 4CS7A 2H7OA 4E17A 2KQ9A 4W8PA 3JTLO 4IRUA 5DQTA 2R7XA 4EIYA 1HY5A 1Q0GA 2J8WA 3B0PA 3GORA 5L0IA 5T1DB 3A9CA 4FX5A 4N6CA 4PK4A 2JPUA 1VLTA 2L9JA 1EI7A 2IM8A 1GGQA 4FAPB 5KYWB 3NKEA 1YA9A 2TMVP 3V5YA 1W2WA 3ZVRA 2L6GA 2HFIA 4LLEA 4AL1A 2ZXWC 3M15A 5BQHA 4YT4A 1E84A 1BDJB 2DYSC 2GA0A 4G78A 3EG9A 4H54A 1KU2A 1V4AA 2A0BA 1Q0KA 1SR2A 3AQBA 3DI5A 3IEEA 2EINC 3WG7C 3K66A 1M6TA 4MW8A 3TOMA 3IQCA 2PFDA 5JP7A 2BL2A 1G5ZA 1OR3A 1OW6A 4HFKB 3W4YA 4U5CE 5L0FA 1WATA 2EIJC 4OIQF 3JRTA 3NMKA 4UDVA 5COMA 3RFYA 2OJQA 4NQFA 4MVUA 3K6BA 1N1CA 5GPGB 5DS4A 2XS8A 2A69F 4XTKA 2Q00A 3O39A 2IXPA 5EHHA 1EA8A 3Q6NA 3JCUQ 1O87A 4N4WA 2YQYA 5TJ5E 1V55C 3PDMP 3EGXA 1OCCC 3DM9B 2O9XA 1S7ZA 4CS8A 4DRIB 3AQCA 3MYIA 1OCOC 3E9VA 5L0GA 4FWVA 2OKUA 4JTCB 1OXBA 3MYFA 2X51A 3HNJA 5CI9A 3TK0A 2EPOA 1C03A 2Q7RA 2WB7A 3ZSUA 4JTAB 1NU9C 4P9FA 3W2VA 1K05A 2F22A 3LEOA 2IXOA 3KMIA 2L6HA 4O6YA 3EJNA 3DAFA 3RQGA 1TKNA 4DVZA 3EGDA 1VYKA 4K7BA 1D0YA 4HEAJ 5KYXA 1YDIA 3FHDA 4NC3A 4Q5SF 1B68A 3AGTA 1MNEA 3DAGA 2D5RB 4MVZA 3AJMA 4PFPA 2M4EA 1FAPB 2OJED 3U2MA 3N24A 4CS8C 5B3SC 4XEKA 4CIPA 2HV6A 3NYLA 1PD1A 1YJGA 4IWBA 4XQ1A 2QUPA 5D92A 2RSEB 1YYJA 2VCBA 2HSQA 3K1IA 3K1HA 1OXKA 1U6HA 3O10A 1M56C 3NG1A 1FMVA 3C63A 1BBHA 5BUOA 3K7DA 1HE9A 2XM4A 4CDAA 2HKVA 1U89A 2HJ3A 3EG9B 4RDAA 1JR8A 4LACB 4PJJA 3EH2A 4JJGA 2XLMA 3U8VA 4BEJA 3NYMA 3E70C 1GQAA 1OW8A 3S9OA 5DS5A 2CNWA 1CGNA 4HFFB 3FVYA 4L6RA 1JPNA 3K1IC 1DOWA 2JD3A 4NTFA 1IZMA 2DYRC 5JRAA 4D4XA 3DWWA 3I5QA 4U9DA 3H65A 2KC3A 5A6AA 4LDRA 3KH2A 3EGXB 1T6QA 1GM5A 3C8ZA 2PNOA 4DBRA 2R7QA 2UUHA 2KK1A 1OR2A 2KJGA 3LJBA 4P9TA 4ER9A 1TWHA 5DQZA 3DZAA 3G4ZA 4G0HA 2P7VA 1E83A 3RF3A 1S05A 5A6JA 1JAFA 1LI7A 1QZXA 4A2NB 1Y4CA 2A0UA 2NUPA 2YL3A 3GODA 4Z9HA 4XLNF 3EGDB 3B9QA 1M2OA 1ZYRF 1NG1A 1NSGB 1OCZC 3FMSA 1G4US 3F47A 1YYXA 3WODF 4DXWA 4F4BA 5KYXB 3R7CA 4ZLDA 2R9RB 4JIOA 2IXMA 2J0WA 3FAPB 4EBKA 5F5HA 4EBBA 5KYUB 3FOOA 3US6A 2GAQA 3GANA 2CCYA 2NSGA 1Q0MA 1SF8A 2DGJA 1HE1A 4K1OA 2W4BA 3M4CA 5BQIA 2YKZA 4E7SA 5A6BD 2VC9A 1J8YF 3H2VA 5T3WA 3V5XA 1L7CA 1MMAA 2KYHA 4YJWA 3U0CA 1LE2A 1D1BA 3MBGA 4MW3A 3U5SA 4YT2A 2AWYA 3DM5A 4MQ9F 2J46A 2I15A 2MYSA 4J7TA 2IXNA 3CQZA 3I5PA 3QVYA 4U5HA 3SEOA 1VTMP 1MMNA 2Y3BA 3RVZA 1D1AA 1QLEC 4RBNA 1J8MF 3V7OA 2WZFA 1Z5ZA 2AP3A 4BJ1A 4MTFA 2HJMA 2YZSA 3DXJF 4PJNA 4BJ6C 4JTDB 3L8JA 4A4AA 5L0JA 2R7RA 3Q6MA 3DE9A 5JSLA 4BEMJ 2FGYA 4CS9A 2I8BA 5A6KA 2VB6A 3H2UA 1APCA 3EH1A 4OIPF 3ABLC 4CX9A 3N0TA 4PJMA 2LSEA 2R02A 1T01A 1E2XA 1YVIA 3DJNB 1TR2A 1KTMA 2VH3A 3SXYA 2XXAA 3WHNA 2E87A 4WJ0A 1D0XA 3C18A 1I5NA 4H4KC 4MVSA 1XZPA 1JMWA 2RD9A 1D0ZA 4MNDA 3KPHA 4YL3A 3ZC4A 1CGME 4Z9JA 2V26A 3LLKA 2P0NA 2H7VC 1RCPA 3FXHA 4U5EE 4LERA 4OINF 1V74B 1WOLA 2HS5A 2CNWD 1RKCA 2QY9A 4IGGA 2A68F 4XPXA 3GM2A 3G50A 3SNHA 1LIHA 3F46A 4XEFA 2GDCA 1AUEA 4WGZA 3J06A 2XL4A 3EHMA 4CJGA 3FDQA 3C8GB 3ZQVA 4C3BA 2NUPB 4IAQA 1BR4A 1RJ9A 2R03A 3AG3C 3JYYA 4J30B 1OKKD 2YHSA 3MLGA 2XRHA 4YT8A 4MVMA 1RKEA 1YAUO 2Q9BA 3W2WA 3LESA 2J0XA 2P6VA 3L0IA 1F1MA 3T6GB 4KC9A 1HMDA 2XLOA 4W8KA 1FTSA 5A6BA 2P61A 2A1DD 1WASA 1K04A 2R05A 1ZW2A 4GEHA 2Q4FA 1TQGA 3UGOA 3EPVA 3NKDA 2WVNA 4Z9IA 4KNVA 3RQFA 3C8GD 2EIMC 3JRMO 5BQGA 3A11A 2KGOA 3ZTZA 5JLIA 4JJFA 2OQMA 4XPWA 4YN0B 3AG4C 4GQHA 5KYUA 2HMZA 2ICWG 1VK5A 2JX0A 1ZU5A 1H7IA 1G8XA 2L7AA 3B71A 4CIHA 4GYTA 3UMHA 4D4NA 2Y3HA 4EKWA 4Q4ZF 3IQTA 4NTBA 2AWCA 4I3MA 3DJUB 3JT1A 3RVYA 3LUTB 5JT4A 4U5FE 3PCVA 1I4YA 4FESA 4E7ZA 2Z15A 2YRFA 3LS1A 3GEHA 3AGUA 3QW1A 2KW3C 4JC7A 4CBEA 5K0IA 3KYIA 5B1AC 5L3VA 3TOLA 3RIPA 1U0BB 2IBFA 1Q0FA 2DI3A 2R7SA 5KYYA 1OW7A 4I1MA 5COFA 4RD9A 2XXAB 3HNIA 4YL1A 3JSEO 2J9UA 5JS5A 4DBQA 3IQ5A 4C3EA 3BRJA 2C04A 2XLVA 1H6GA 5JUAA 3UGPA 3T4RA 1ZZPA 1HW2A 2B0HA 1SYQA 2OG2A 3U9MA 2XLEA 4P6IC 4QI2A 2X0CA 4G7OF 2HV7A 3C62A 1HMOA 4C3DA 3PHF2 2WZGA 4XWJA 2WVOA 3Q7GA 5DVWA 2FFHA 4ZLCA 2XS1A 1TWAA 1OKKA 3SXKA 3HNKA 2EPKX 4PR9A 2XL8A 2Y39A 1RJ9B 3EHNA 1QVXA 2Q9AA 3CZ6A 1RKEB 1D1CA 2WZLA 2YLIA 2G3VA 2ZD9A 1Z3IX 1ORYA 3M4BA 4JEBA 2VCAA 4JE9A 4OD5A 3RYLA 3TD7A 3B29A 3TULA 2OEVA 4E0IA 2CYDA 2IOQA 2GWWA 2YEVA 5E2QA 1MMDA 2VCCA 2M64A 4IJJA 3U8PA 1A0BA 3C8GA 1IW7F 1NFOA 3X1OA 2OU6A 2ZXOA 3T6BA 4CSAA 2YL0A 3V5ZA 4M63A 5B3IA 5L0CA 1O5HA 1HW1A 4JEAA 5JVEA 1NBBA 1YLMA 2PBEA 2HZ8A 2XLDA 3FOPA 4ULVA 5F5FA 3NDBB 5D91A 3QMKA 3KKBA 3O55A 1DOVA 1VMAA 1PD0A 2Q3TA 1QPUA 3K33A 4U9EA 5E3AA 4EWCA 2L81A 5DS6A 5FCLA 3KYJA 1A41A 2J45A 4O7GA 2NSFA 3FAJA 2R7WA 3B0UX 4CDYA 4XPYA 1NZEA 2H7BA 4C7OA 2LK4A 2WVQA 4JCZA 3ZDLA 3NRHA 1Z23A 1ZHYA 2BE5F 3UR3C 3DKAA 1NFNA 3ABMC 3M79A 4CSAC 1QSPA 2KNHA 1TFOB 1M2VA 3ASNC 3LS0A 2FAPB 1YZCA 4MVRA 5A69A 5KYYB 3ECSA 2XLHA 3TJ6A 1NU7D 4JZAA 4DVYP 3VYWA 1Y6DA 3R2PA 1TWGA 4B6IA 2UUIA 4O6MA 3IQ6A 2R7TA 2EPNA 1A7VA
chains in the Genus database with same CATH topology
4PJLA 4I1OB 4J32B 3HLZA 4U5DE 3DD7A 2G62A 2ZXRA 3LAYA 4AE4A 4KI2A 5B1BC 2ZPAA 2J7PD 3LNRA 3POVA 4YT5A 2Y69C 4KNWA 5EGYA 3CSKA 4XLPF 3PMRA 3OA1A 2OCCC 3LEVA 4CS9C 2W45A 1WGWA 3JSZA 2XSEA 4OIOF 2NUTA 3AG2C 2PX3A 4AX2A 3ASOC 3SYNA 5L3QA 1Z6AA 1LKXA 1FMWA 4ULWA 1ZHTA 1ZHXA 1BR2A 3NYJA 3EFOA 4OD4A 5CI8A 4BJ5A 5T3TA 4YWQA 3B0VC 4QI0A 3ITFA 2Q9CA 3RH3A 2IYLD 4U5BE 3X2QC 2R7VA 4C7OB 1FFTC 3EQLF 3M1CB 1M2VB 5IY5C 2R7UA 4Q7CA 4DOZA 2GFHA 3MX3A 3UMIA 3W8IA 3SP1A 4BJ5C 4NY3A 3ZG1A 2MWQA 3OWTA 2EILC 2CGEA 4BG0A 2W4MA 2ZXPA 5KYNA 3ABKC 4HE8D 4AE4B 3UNGC 2J7PA 3W8HA 2A6HF 4O79A 3KL4A 3HJCA 4K0DA 2R7OA 4JCHA 2CW0F 3EZIA 4PFOA 4OIRF 4KBLA 1ZHZA 2NUTB 1MMGA 1JPJA 1ZU4A 2Y3GA 3S27A 3SZRA 2B0JA 2CDQA 2V3CC 4O6NA 3L34A 5DLJA 3O6XA 2QTVA 3AG1C 3EFOB 3OEOA 5KYWA 1FFHA 1SZIA 3I4UA 4G7HF 1SMYF 2J9VA 4U5GA 2PX0A 1TWCA 3S0XA 4AK9A 2VASA 3JYHA 3UMKA 4IAOA 3S28A 4BJTA 2A6EF 2J9WA 2PP4A 2NG1A 3S29A 3EZHA 3T6JA 3HTKC 1BR1A 4LLCA 1LVKA 3Q7LA 4I44A 1VOMA 3LLIA 4N06A 1M57C 4ANJA 1Z63A 4JVSA 4JURI 1PCXA 1LS1A 4QDLA 5E3CA 2W9YA 3DMDA 3ZIBA 1V54C 2Y3DA 2C03A 1MNDA 3QZCA 3VAYA 3N2ZB 1ST6A 3RKOF 4BJ6A 1VYIA 2PF4E 4JW1A 1OCRC 1ZHWA 2WL8A 2EIKC 5HSWA 4X0RA 2G3KA 4CS7A 2H7OA 2KQ9A 4IRUA 5DQTA 2R7XA 3B0PA 5T1DB 4FX5A 4PK4A 2L9JA 5KYWB 1W2WA 3ZVRA 4LLEA 2ZXWC 4YT4A 2DYSC 3EG9A 1KU2A 3WG7C 3AQBA 3IEEA 2EINC 3K66A 2PFDA 4HFKB 4U5CE 2EIJC 4OIQF 3JRTA 3RFYA 3K6BA 1N1CA 5DS4A 2A69F 4XTKA 3O39A 2IXPA 5EHHA 3Q6NA 3JCUQ 1O87A 1V55C 3EGXA 1OCCC 3DM9B 2O9XA 1S7ZA 4CS8A 3AQCA 1OCOC 3E9VA 4FWVA 2X51A 5CI9A 3ZSUA 2WB7A 1NU9C 3W2VA 2IXOA 3KMIA 4O6YA 3EJNA 3DAFA 4DVZA 1TKNA 3EGDA 1VYKA 4K7BA 1D0YA 4HEAJ 5KYXA 3FHDA 4Q5SF 3DAGA 1MNEA 2D5RB 4PFPA 2M4EA 4CS8C 3N24A 5B3SC 2HV6A 3NYLA 1PD1A 4IWBA 5D92A 3K1HA 1M56C 3NG1A 1FMVA 5BUOA 3K7DA 3EG9B 4RDAA 4LACB 4PJJA 3EH2A 4JJGA 4BEJA 3NYMA 3E70C 5DS5A 2CNWA 4HFFB 3FVYA 1JPNA 3K1IC 2JD3A 1IZMA 2DYRC 3I5QA 3H65A 3KH2A 3EGXB 4DBRA 2R7QA 2KJGA 3LJBA 1TWHA 5DQZA 3DZAA 4G0HA 2P7VA 1QZXA 4A2NB 4XLNF 2NUPA 3GODA 3EGDB 3B9QA 1M2OA 1ZYRF 1NG1A 1OCZC 3WODF 3F47A 5KYXB 4ZLDA 4F4BA 2IXMA 2J0WA 5F5HA 4EBBA 5KYUB 3GANA 1SF8A 2DGJA 2W4BA 4E7SA 1J8YF 5T3WA 1MMAA 4YJWA 1D1BA 4YT2A 3DM5A 4MQ9F 2J46A 2MYSA 2IXNA 3CQZA 3I5PA 4U5HA 3SEOA 1MMNA 2Y3BA 1D1AA 1QLEC 4RBNA 1J8MF 3V7OA 2WZFA 1Z5ZA 4BJ1A 4G7ZF 2YZSA 3DXJF 4PJNA 4BJ6C 2R7RA 3Q6MA 2FGYA 4CS9A 2I8BA 2VB6A 3EH1A 4OIPF 3ABLC 3N0TA 4PJMA 2LSEA 3DJNB 1TR2A 2VH3A 2XXAA 2E87A 4WJ0A 1D0XA 4H4KC 1D0ZA 4MNDA 3ZC4A 2V26A 3LLKA 2H7VC 4U5EE 4OINF 4LERA 2CNWD 2QY9A 2A68F 3SNHA 3F46A 2XL4A 3EHMA 3FDQA 4C3BA 2NUPB 1BR4A 1RJ9A 5E33A 3AG3C 4J30B 1OKKD 3MLGA 2YHSA 2XRHA 4YT8A 2Q9BA 3W2WA 3LESA 2J0XA 2P6VA 3L0IA 4KC9A 4W8KA 1FTSA 2A1DD 4GEHA 3UGOA 3EPVA 3NKDA 2WVNA 4KNVA 2EIMC 2KGOA 4JJFA 4YN0B 3AG4C 5KYUA 1VK5A 1ZU5A 1G8XA 4CIHA 4GYTA 3UMHA 2Y3HA 4Q4ZF 4I3MA 3DJUB 3JT1A 4U5FE 4FESA 4E7ZA 2Z15A 3LS1A 2KW3C 4CBEA 5L3VA 5B1AC 3RIPA 2R7SA 5KYYA 2XXAB 4I1MA 4RD9A 2J9UA 4DBQA 4C3EA 2C04A 3UGPA 3T4RA 2OG2A 4P6IC 4QI2A 4G7OF 2HV7A 4C3DA 3PHF2 2WZGA 4XWJA 2WVOA 3Q7GA 5DVWA 2FFHA 4ZLCA 1TWAA 1OKKA 2Y39A 1RJ9B 3EHNA 2Q9AA 3CZ6A 1D1CA 2WZLA 2G3VA 3TD7A 1Z3IX 4OD5A 3RYLA 2IOQA 2YEVA 5E2QA 1MMDA 4IJJA 1IW7F 3X1OA 2ZXOA 3T6BA 4CSAA 4M63A 1O5HA 5F5FA 3NDBB 5D91A 3QMKA 3KKBA 1VMAA 2Q3TA 1PD0A 3K33A 5E3AA 4EWCA 5DS6A 2L81A 5FCLA 4O7GA 2J45A 3FAJA 2R7WA 3B0UX 1NZEA 2H7BA 4C7OA 2WVQA 3NRHA 1Z23A 1ZHYA 2BE5F 3UR3C 3ABMC 4CSAC 2KNHA 1M2VA 3ASNC 3LS0A 5KYYB 3ECSA 1NU7D 4JZAA 4DVYP 3VYWA 1TWGA 4B6IA 4O6MA 2R7TA 3NKEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LAY A;  2Y3D A;  2Y39 A;  2Y3H A;  3EPV A;  2Y3B A;  2Y3G A;  3QZC A;  3ZG1 A;  3ITF A;  3O39 A;  3OEO A; 
#chains in the Genus database with same CATH topology
 1UFB A;  4PJL A;  3JZ0 A;  3SXM A;  4I1O B;  4J32 B;  3HLZ A;  2EPL X;  4U5D E;  3DD7 A;  3GEE A;  2G62 A;  2LFD A;  2LCH A;  2YLD A;  1K40 A;  4E18 A;  1UG7 A;  2ZXR A;  3GM1 A;  3LAY A;  1GS9 A;  4AE4 A;  1FNT c;  4KI2 A;  2OOC A;  5B1B C;  2ZPA A;  3C7J A;  1VLS A;  2J7P D;  3U9J A;  3LNR A;  3POV A;  4YT5 A;  2Y69 C;  1O3U A;  1A7D A;  4KNW A;  1ZW3 A;  3CSK A;  1I4Z A;  4LDK A;  4WGY A;  2L6F A;  1RXQ A;  3PMR A;  4BPM A;  4XLP F;  3OA1 A;  2OCC C;  3LEV A;  4CS9 C;  1LE4 A;  1FR0 A;  2W45 A;  3VRC A;  2AVK A;  1WGW A;  3JSZ A;  1T6I A;  2XSE A;  4OIO F;  4MTO A;  2NUT A;  3AG2 C;  5CIV A;  2PX3 A;  4AX2 A;  1CPQ A;  1EQ1 A;  4DRJ B;  1CPR A;  3ASO C;  256B A;  4JKV A;  4R32 A;  1Z6A A;  3SYN A;  5L3Q A;  1LKX A;  1ORS C;  1FMW A;  4ULW A;  1ZHT A;  3U3F A;  1H9T A;  1JRA A;  1ZHX A;  1BR2 A;  3NYJ A;  3EFO A;  4OD4 A;  2YL1 A;  5CI8 A;  2QE9 A;  1CGO A;  2LIG A;  4BJ5 A;  2OEX A;  5T3T A;  4YWQ A;  3B0V C;  4QI0 A;  3ITF A;  3TJ5 A;  3VM6 A;  2Q9C A;  3QVZ A;  2IYL D;  2P1A A;  4J7Y A;  1MQV A;  1XWJ A;  4U5B E;  3RH3 A;  3X2Q C;  1E86 A;  1FFT C;  4C7O B;  2R7V A;  1QKR A;  4NTA A;  1BZ4 A;  2LQG A;  3GWL A;  3EQL F;  4YL0 A;  3M1C B;  1M2V B;  2XLW A;  1EKY A;  5IY5 C;  2R7U A;  1L3P A;  4Q7C A;  3IPM O;  3U3B A;  4DOZ A;  2GFH A;  3SXZ A;  3MX3 A;  4NCQ A;  1T9K A;  1WTY A;  3UMI A;  3GEI A;  2YLG A;  3W8I A;  3SP1 A;  2XL6 A;  4BJ5 C;  4NY3 A;  4IAR A;  3ZG1 A;  2MWQ A;  3OWT A;  2EIL C;  3S84 A;  2CGE A;  2NPU A;  4BG0 A;  2W4M A;  2BC5 A;  2MHR A;  1Z7Q c;  1KNY A;  2ZXP A;  5KYN A;  2LP4 A;  3ABK C;  4HE8 D;  4AE4 B;  3UNG C;  2J7P A;  3QW0 A;  2A6H F;  2LFF A;  3W8H A;  3CEX A;  1PV3 A;  4MTG A;  2EPM X;  3L8I A;  2QNL A;  3ZTM A;  1AVO B;  2HSB A;  2YWA A;  4O79 A;  3KL4 A;  3HJC A;  2YL7 A;  1C02 A;  2HMQ A;  4EUK B;  4K0D A;  2R7O A;  3QTH A;  2CW0 F;  3EZI A;  4JCH A;  4PFO A;  1OQC A;  2HUJ A;  4OIR F;  4KBL A;  3HNL A;  4ONS A;  1ZHZ A;  2NUT B;  4IB4 A;  4MVQ A;  1MMG A;  1JPJ A;  1ZU4 A;  2AU5 A;  2Y3G A;  3S27 A;  4G7Z F;  1YAR O;  3SZR A;  4AL0 A;  2B0J A;  1YA7 O;  2CDQ A;  1AEP A;  2V3C C;  1T5O A;  5EGY A;  4O6N A;  3AOU A;  3L34 A;  5DLJ A;  3O6X A;  3LNM B;  2QTV A;  3AG1 C;  3EFO B;  3OEO A;  3ZWI A;  2ETS A;  4LDQ A;  5KYW A;  5AGF A;  2J9B A;  2ASR A;  3ATP A;  3IHU A;  4PAC A;  1FFH A;  1SZI A;  3I4U A;  2QLA A;  4G7H F;  1SMY F;  2J9V A;  2R25 A;  2PX0 A;  4U5G A;  4DJ9 A;  1ORJ A;  1XZQ A;  2XM0 A;  3BEH A;  3U2L A;  4EBJ A;  1G4W R;  5AC4 A;  1TWC A;  3S0X A;  4AK9 A;  2VAS A;  3JYH A;  3UMK A;  2DB4 A;  1LM3 B;  4IAO A;  3S28 A;  3T9O A;  3WAQ A;  4BJT A;  3RW0 A;  2A6E F;  4JRZ A;  2J9W A;  5L0H A;  2PP4 A;  5L0D A;  3S90 A;  3MFN A;  2NG1 A;  3S29 A;  1A7E A;  3TQO A;  2YVK A;  3VF0 A;  1ZVZ A;  4DRH B;  1E85 A;  3EZH A;  3T6J A;  3HTK C;  1BR1 A;  3G4X A;  5FZT A;  5E33 A;  4LLC A;  1JOG A;  1LVK A;  1NLX A;  3L1M A;  1Q0D A;  3Q7L A;  1LPE A;  1VOM A;  3GWN A;  3LLI A;  4I44 A;  4N06 A;  1M57 C;  4ANJ A;  1Z63 A;  2KSF A;  4MVO A;  3DE8 A;  4JVS A;  4YK5 A;  5AC5 A;  4JUR I;  1RMV A;  1PCX A;  1LS1 A;  1R5I D;  3HKK A;  4CJO A;  1VB5 A;  3CAX A;  4QDL A;  1R4T A;  2W9Y A;  2D4U A;  3DMD A;  5E3C A;  5F28 E;  3ZIB A;  4CDV A;  4N6H A;  1WN0 A;  5COG A;  1YZA A;  1V54 C;  3NMJ A;  5EK0 A;  1LS4 A;  2C03 A;  2Y3D A;  1MND A;  4EHP A;  3RQE A;  5HV9 A;  3ZQY A;  3GM3 A;  4MS2 A;  1T6U A;  3QZC A;  1H9G A;  3VAY A;  3N2Z B;  1ST6 A;  3RKO F;  4BJ6 A;  1VYI A;  2PF4 E;  4JW1 A;  1OCR C;  1C17 M;  1ZHW A;  1QQ3 A;  4XEV A;  1TFK B;  2WL8 A;  1LI5 A;  2H8A A;  2EIK C;  2LD6 A;  5HSW A;  4X0R A;  1WWP A;  4WAB A;  3NMI A;  4E0H A;  2G3K A;  4CS7 A;  2H7O A;  4E17 A;  2KQ9 A;  4W8P A;  3JTL O;  4IRU A;  5DQT A;  2R7X A;  4EIY A;  1HY5 A;  1Q0G A;  2J8W A;  3B0P A;  3GOR A;  5L0I A;  5T1D B;  3A9C A;  4FX5 A;  4N6C A;  4PK4 A;  2JPU A;  1VLT A;  2L9J A;  1EI7 A;  2IM8 A;  1GGQ A;  4FAP B;  5KYW B;  3NKE A;  1YA9 A;  2TMV P;  3V5Y A;  1W2W A;  3ZVR A;  2L6G A;  2HFI A;  4LLE A;  4AL1 A;  2ZXW C;  3M15 A;  5BQH A;  4YT4 A;  1E84 A;  1BDJ B;  2DYS C;  2GA0 A;  4G78 A;  3EG9 A;  4H54 A;  1KU2 A;  1V4A A;  2A0B A;  1Q0K A;  1SR2 A;  3AQB A;  3DI5 A;  3IEE A;  2EIN C;  3WG7 C;  3K66 A;  1M6T A;  4MW8 A;  3TOM A;  3IQC A;  2PFD A;  5JP7 A;  2BL2 A;  1G5Z A;  1OR3 A;  1OW6 A;  4HFK B;  3W4Y A;  4U5C E;  5L0F A;  1WAT A;  2EIJ C;  4OIQ F;  3JRT A;  3NMK A;  4UDV A;  5COM A;  3RFY A;  2OJQ A;  4NQF A;  4MVU A;  3K6B A;  1N1C A;  5GPG B;  5DS4 A;  2XS8 A;  2A69 F;  4XTK A;  2Q00 A;  3O39 A;  2IXP A;  5EHH A;  1EA8 A;  3Q6N A;  3JCU Q;  1O87 A;  4N4W A;  2YQY A;  5TJ5 E;  1V55 C;  3PDM P;  3EGX A;  1OCC C;  3DM9 B;  2O9X A;  1S7Z A;  4CS8 A;  4DRI B;  3AQC A;  3MYI A;  1OCO C;  3E9V A;  5L0G A;  4FWV A;  2OKU A;  4JTC B;  1OXB A;  3MYF A;  2X51 A;  3HNJ A;  5CI9 A;  3TK0 A;  2EPO A;  1C03 A;  2Q7R A;  2WB7 A;  3ZSU A;  4JTA B;  1NU9 C;  4P9F A;  3W2V A;  1K05 A;  2F22 A;  3LEO A;  2IXO A;  3KMI A;  2L6H A;  4O6Y A;  3EJN A;  3DAF A;  3RQG A;  1TKN A;  4DVZ A;  3EGD A;  1VYK A;  4K7B A;  1D0Y A;  4HEA J;  5KYX A;  1YDI A;  3FHD A;  4NC3 A;  4Q5S F;  1B68 A;  3AGT A;  1MNE A;  3DAG A;  2D5R B;  4MVZ A;  3AJM A;  4PFP A;  2M4E A;  1FAP B;  2OJE D;  3U2M A;  3N24 A;  4CS8 C;  5B3S C;  4XEK A;  4CIP A;  2HV6 A;  3NYL A;  1PD1 A;  1YJG A;  4IWB A;  4XQ1 A;  2QUP A;  5D92 A;  2RSE B;  1YYJ A;  2VCB A;  2HSQ A;  3K1I A;  3K1H A;  1OXK A;  1U6H A;  3O10 A;  1M56 C;  3NG1 A;  1FMV A;  3C63 A;  1BBH A;  5BUO A;  3K7D A;  1HE9 A;  2XM4 A;  4CDA A;  2HKV A;  1U89 A;  2HJ3 A;  3EG9 B;  4RDA A;  1JR8 A;  4LAC B;  4PJJ A;  3EH2 A;  4JJG A;  2XLM A;  3U8V A;  4BEJ A;  3NYM A;  3E70 C;  1GQA A;  1OW8 A;  3S9O A;  5DS5 A;  2CNW A;  1CGN A;  4HFF B;  3FVY A;  4L6R A;  1JPN A;  3K1I C;  1DOW A;  2JD3 A;  4NTF A;  1IZM A;  2DYR C;  5JRA A;  4D4X A;  3DWW A;  3I5Q A;  4U9D A;  3H65 A;  2KC3 A;  5A6A A;  4LDR A;  3KH2 A;  3EGX B;  1T6Q A;  1GM5 A;  3C8Z A;  2PNO A;  4DBR A;  2R7Q A;  2UUH A;  2KK1 A;  1OR2 A;  2KJG A;  3LJB A;  4P9T A;  4ER9 A;  1TWH A;  5DQZ A;  3DZA A;  3G4Z A;  4G0H A;  2P7V A;  1E83 A;  3RF3 A;  1S05 A;  5A6J A;  1JAF A;  1LI7 A;  1QZX A;  4A2N B;  1Y4C A;  2A0U A;  2NUP A;  2YL3 A;  3GOD A;  4Z9H A;  4XLN F;  3EGD B;  3B9Q A;  1M2O A;  1ZYR F;  1NG1 A;  1NSG B;  1OCZ C;  3FMS A;  1G4U S;  3F47 A;  1YYX A;  3WOD F;  4DXW A;  4F4B A;  5KYX B;  3R7C A;  4ZLD A;  2R9R B;  4JIO A;  2IXM A;  2J0W A;  3FAP B;  4EBK A;  5F5H A;  4EBB A;  5KYU B;  3FOO A;  3US6 A;  2GAQ A;  3GAN A;  2CCY A;  2NSG A;  1Q0M A;  1SF8 A;  2DGJ A;  1HE1 A;  4K1O A;  2W4B A;  3M4C A;  5BQI A;  2YKZ A;  4E7S A;  5A6B D;  2VC9 A;  1J8Y F;  3H2V A;  5T3W A;  3V5X A;  1L7C A;  1MMA A;  2KYH A;  4YJW A;  3U0C A;  1LE2 A;  1D1B A;  3MBG A;  4MW3 A;  3U5S A;  4YT2 A;  2AWY A;  3DM5 A;  4MQ9 F;  2J46 A;  2I15 A;  2MYS A;  4J7T A;  2IXN A;  3CQZ A;  3I5P A;  3QVY A;  4U5H A;  3SEO A;  1VTM P;  1MMN A;  2Y3B A;  3RVZ A;  1D1A A;  1QLE C;  4RBN A;  1J8M F;  3V7O A;  2WZF A;  1Z5Z A;  2AP3 A;  4BJ1 A;  4MTF A;  2HJM A;  2YZS A;  3DXJ F;  4PJN A;  4BJ6 C;  4JTD B;  3L8J A;  4A4A A;  5L0J A;  2R7R A;  3Q6M A;  3DE9 A;  5JSL A;  4BEM J;  2FGY A;  4CS9 A;  2I8B A;  5A6K A;  2VB6 A;  3H2U A;  1APC A;  3EH1 A;  4OIP F;  3ABL C;  4CX9 A;  3N0T A;  4PJM A;  2LSE A;  2R02 A;  1T01 A;  1E2X A;  1YVI A;  3DJN B;  1TR2 A;  1KTM A;  2VH3 A;  3SXY A;  2XXA A;  3WHN A;  2E87 A;  4WJ0 A;  1D0X A;  3C18 A;  1I5N A;  4H4K C;  4MVS A;  1XZP A;  1JMW A;  2RD9 A;  1D0Z A;  4MND A;  3KPH A;  4YL3 A;  3ZC4 A;  1CGM E;  4Z9J A;  2V26 A;  3LLK A;  2P0N A;  2H7V C;  1RCP A;  3FXH A;  4U5E E;  4LER A;  4OIN F;  1V74 B;  1WOL A;  2HS5 A;  2CNW D;  1RKC A;  2QY9 A;  4IGG A;  2A68 F;  4XPX A;  3GM2 A;  3G50 A;  3SNH A;  1LIH A;  3F46 A;  4XEF A;  2GDC A;  1AUE A;  4WGZ A;  3J06 A;  2XL4 A;  3EHM A;  4CJG A;  3FDQ A;  3C8G B;  3ZQV A;  4C3B A;  2NUP B;  4IAQ A;  1BR4 A;  1RJ9 A;  2R03 A;  3AG3 C;  3JYY A;  4J30 B;  1OKK D;  2YHS A;  3MLG A;  2XRH A;  4YT8 A;  4MVM A;  1RKE A;  1YAU O;  2Q9B A;  3W2W A;  3LES A;  2J0X A;  2P6V A;  3L0I A;  1F1M A;  3T6G B;  4KC9 A;  1HMD A;  2XLO A;  4W8K A;  1FTS A;  5A6B A;  2P61 A;  2A1D D;  1WAS A;  1K04 A;  2R05 A;  1ZW2 A;  4GEH A;  2Q4F A;  1TQG A;  3UGO A;  3EPV A;  3NKD A;  2WVN A;  4Z9I A;  4KNV A;  3RQF A;  3C8G D;  2EIM C;  3JRM O;  5BQG A;  3A11 A;  2KGO A;  3ZTZ A;  5JLI A;  4JJF A;  2OQM A;  4XPW A;  4YN0 B;  3AG4 C;  4GQH A;  5KYU A;  2HMZ A;  2ICW G;  1VK5 A;  2JX0 A;  1ZU5 A;  1H7I A;  1G8X A;  2L7A A;  3B71 A;  4CIH A;  4GYT A;  3UMH A;  4D4N A;  2Y3H A;  4EKW A;  4Q4Z F;  3IQT A;  4NTB A;  2AWC A;  4I3M A;  3DJU B;  3JT1 A;  3RVY A;  3LUT B;  5JT4 A;  4U5F E;  3PCV A;  1I4Y A;  4FES A;  4E7Z A;  2Z15 A;  2YRF A;  3LS1 A;  3GEH A;  3AGU A;  3QW1 A;  2KW3 C;  4JC7 A;  4CBE A;  5K0I A;  3KYI A;  5B1A C;  5L3V A;  3TOL A;  3RIP A;  1U0B B;  2IBF A;  1Q0F A;  2DI3 A;  2R7S A;  5KYY A;  1OW7 A;  4I1M A;  5COF A;  4RD9 A;  2XXA B;  3HNI A;  4YL1 A;  3JSE O;  2J9U A;  5JS5 A;  4DBQ A;  3IQ5 A;  4C3E A;  3BRJ A;  2C04 A;  2XLV A;  1H6G A;  5JUA A;  3UGP A;  3T4R A;  1ZZP A;  1HW2 A;  2B0H A;  1SYQ A;  2OG2 A;  3U9M A;  2XLE A;  4P6I C;  4QI2 A;  2X0C A;  4G7O F;  2HV7 A;  3C62 A;  1HMO A;  4C3D A;  3PHF 2;  2WZG A;  4XWJ A;  2WVO A;  3Q7G A;  5DVW A;  2FFH A;  4ZLC A;  2XS1 A;  1TWA A;  1OKK A;  3SXK A;  3HNK A;  2EPK X;  4PR9 A;  2XL8 A;  2Y39 A;  1RJ9 B;  3EHN A;  1QVX A;  2Q9A A;  3CZ6 A;  1RKE B;  1D1C A;  2WZL A;  2YLI A;  2G3V A;  2ZD9 A;  1Z3I X;  1ORY A;  3M4B A;  4JEB A;  2VCA A;  4JE9 A;  4OD5 A;  3RYL A;  3TD7 A;  3B29 A;  3TUL A;  2OEV A;  4E0I A;  2CYD A;  2IOQ A;  2GWW A;  2YEV A;  5E2Q A;  1MMD A;  2VCC A;  2M64 A;  4IJJ A;  3U8P A;  1A0B A;  3C8G A;  1IW7 F;  1NFO A;  3X1O A;  2OU6 A;  2ZXO A;  3T6B A;  4CSA A;  2YL0 A;  3V5Z A;  4M63 A;  5B3I A;  5L0C A;  1O5H A;  1HW1 A;  4JEA A;  5JVE A;  1NBB A;  1YLM A;  2PBE A;  2HZ8 A;  2XLD A;  3FOP A;  4ULV A;  5F5F A;  3NDB B;  5D91 A;  3QMK A;  3KKB A;  3O55 A;  1DOV A;  1VMA A;  1PD0 A;  2Q3T A;  1QPU A;  3K33 A;  4U9E A;  5E3A A;  4EWC A;  2L81 A;  5DS6 A;  5FCL A;  3KYJ A;  1A41 A;  2J45 A;  4O7G A;  2NSF A;  3FAJ A;  2R7W A;  3B0U X;  4CDY A;  4XPY A;  1NZE A;  2H7B A;  4C7O A;  2LK4 A;  2WVQ A;  4JCZ A;  3ZDL A;  3NRH A;  1Z23 A;  1ZHY A;  2BE5 F;  3UR3 C;  3DKA A;  1NFN A;  3ABM C;  3M79 A;  4CSA C;  1QSP A;  2KNH A;  1TFO B;  1M2V A;  3ASN C;  3LS0 A;  2FAP B;  1YZC A;  4MVR A;  5A69 A;  5KYY B;  3ECS A;  2XLH A;  3TJ6 A;  1NU7 D;  4JZA A;  4DVY P;  3VYW A;  1Y6D A;  3R2P A;  1TWG A;  4B6I A;  2UUI A;  4O6M A;  3IQ6 A;  2R7T A;  2EPN A;  1A7V A; 
#chains in the Genus database with same CATH homology
 4PJL A;  4I1O B;  4J32 B;  3HLZ A;  4U5D E;  3DD7 A;  2G62 A;  2ZXR A;  3LAY A;  4AE4 A;  4KI2 A;  5B1B C;  2ZPA A;  2J7P D;  3LNR A;  3POV A;  4YT5 A;  2Y69 C;  4KNW A;  5EGY A;  3CSK A;  4XLP F;  3PMR A;  3OA1 A;  2OCC C;  3LEV A;  4CS9 C;  2W45 A;  1WGW A;  3JSZ A;  2XSE A;  4OIO F;  2NUT A;  3AG2 C;  2PX3 A;  4AX2 A;  3ASO C;  3SYN A;  5L3Q A;  1Z6A A;  1LKX A;  1FMW A;  4ULW A;  1ZHT A;  1ZHX A;  1BR2 A;  3NYJ A;  3EFO A;  4OD4 A;  5CI8 A;  4BJ5 A;  5T3T A;  4YWQ A;  3B0V C;  4QI0 A;  3ITF A;  2Q9C A;  3RH3 A;  2IYL D;  4U5B E;  3X2Q C;  2R7V A;  4C7O B;  1FFT C;  3EQL F;  3M1C B;  1M2V B;  5IY5 C;  2R7U A;  4Q7C A;  4DOZ A;  2GFH A;  3MX3 A;  3UMI A;  3W8I A;  3SP1 A;  4BJ5 C;  4NY3 A;  3ZG1 A;  2MWQ A;  3OWT A;  2EIL C;  2CGE A;  4BG0 A;  2W4M A;  2ZXP A;  5KYN A;  3ABK C;  4HE8 D;  4AE4 B;  3UNG C;  2J7P A;  3W8H A;  2A6H F;  4O79 A;  3KL4 A;  3HJC A;  4K0D A;  2R7O A;  4JCH A;  2CW0 F;  3EZI A;  4PFO A;  4OIR F;  4KBL A;  1ZHZ A;  2NUT B;  1MMG A;  1JPJ A;  1ZU4 A;  2Y3G A;  3S27 A;  3SZR A;  2B0J A;  2CDQ A;  2V3C C;  4O6N A;  3L34 A;  5DLJ A;  3O6X A;  2QTV A;  3AG1 C;  3EFO B;  3OEO A;  5KYW A;  1FFH A;  1SZI A;  3I4U A;  4G7H F;  1SMY F;  2J9V A;  4U5G A;  2PX0 A;  1TWC A;  3S0X A;  4AK9 A;  2VAS A;  3JYH A;  3UMK A;  4IAO A;  3S28 A;  4BJT A;  2A6E F;  2J9W A;  2PP4 A;  2NG1 A;  3S29 A;  3EZH A;  3T6J A;  3HTK C;  1BR1 A;  4LLC A;  1LVK A;  3Q7L A;  4I44 A;  1VOM A;  3LLI A;  4N06 A;  1M57 C;  4ANJ A;  1Z63 A;  4JVS A;  4JUR I;  1PCX A;  1LS1 A;  4QDL A;  5E3C A;  2W9Y A;  3DMD A;  3ZIB A;  1V54 C;  2Y3D A;  2C03 A;  1MND A;  3QZC A;  3VAY A;  3N2Z B;  1ST6 A;  3RKO F;  4BJ6 A;  1VYI A;  2PF4 E;  4JW1 A;  1OCR C;  1ZHW A;  2WL8 A;  2EIK C;  5HSW A;  4X0R A;  2G3K A;  4CS7 A;  2H7O A;  2KQ9 A;  4IRU A;  5DQT A;  2R7X A;  3B0P A;  5T1D B;  4FX5 A;  4PK4 A;  2L9J A;  5KYW B;  1W2W A;  3ZVR A;  4LLE A;  2ZXW C;  4YT4 A;  2DYS C;  3EG9 A;  1KU2 A;  3WG7 C;  3AQB A;  3IEE A;  2EIN C;  3K66 A;  2PFD A;  4HFK B;  4U5C E;  2EIJ C;  4OIQ F;  3JRT A;  3RFY A;  3K6B A;  1N1C A;  5DS4 A;  2A69 F;  4XTK A;  3O39 A;  2IXP A;  5EHH A;  3Q6N A;  3JCU Q;  1O87 A;  1V55 C;  3EGX A;  1OCC C;  3DM9 B;  2O9X A;  1S7Z A;  4CS8 A;  3AQC A;  1OCO C;  3E9V A;  4FWV A;  2X51 A;  5CI9 A;  3ZSU A;  2WB7 A;  1NU9 C;  3W2V A;  2IXO A;  3KMI A;  4O6Y A;  3EJN A;  3DAF A;  4DVZ A;  1TKN A;  3EGD A;  1VYK A;  4K7B A;  1D0Y A;  4HEA J;  5KYX A;  3FHD A;  4Q5S F;  3DAG A;  1MNE A;  2D5R B;  4PFP A;  2M4E A;  4CS8 C;  3N24 A;  5B3S C;  2HV6 A;  3NYL A;  1PD1 A;  4IWB A;  5D92 A;  3K1H A;  1M56 C;  3NG1 A;  1FMV A;  5BUO A;  3K7D A;  3EG9 B;  4RDA A;  4LAC B;  4PJJ A;  3EH2 A;  4JJG A;  4BEJ A;  3NYM A;  3E70 C;  5DS5 A;  2CNW A;  4HFF B;  3FVY A;  1JPN A;  3K1I C;  2JD3 A;  1IZM A;  2DYR C;  3I5Q A;  3H65 A;  3KH2 A;  3EGX B;  4DBR A;  2R7Q A;  2KJG A;  3LJB A;  1TWH A;  5DQZ A;  3DZA A;  4G0H A;  2P7V A;  1QZX A;  4A2N B;  4XLN F;  2NUP A;  3GOD A;  3EGD B;  3B9Q A;  1M2O A;  1ZYR F;  1NG1 A;  1OCZ C;  3WOD F;  3F47 A;  5KYX B;  4ZLD A;  4F4B A;  2IXM A;  2J0W A;  5F5H A;  4EBB A;  5KYU B;  3GAN A;  1SF8 A;  2DGJ A;  2W4B A;  4E7S A;  1J8Y F;  5T3W A;  1MMA A;  4YJW A;  1D1B A;  4YT2 A;  3DM5 A;  4MQ9 F;  2J46 A;  2MYS A;  2IXN A;  3CQZ A;  3I5P A;  4U5H A;  3SEO A;  1MMN A;  2Y3B A;  1D1A A;  1QLE C;  4RBN A;  1J8M F;  3V7O A;  2WZF A;  1Z5Z A;  4BJ1 A;  4G7Z F;  2YZS A;  3DXJ F;  4PJN A;  4BJ6 C;  2R7R A;  3Q6M A;  2FGY A;  4CS9 A;  2I8B A;  2VB6 A;  3EH1 A;  4OIP F;  3ABL C;  3N0T A;  4PJM A;  2LSE A;  3DJN B;  1TR2 A;  2VH3 A;  2XXA A;  2E87 A;  4WJ0 A;  1D0X A;  4H4K C;  1D0Z A;  4MND A;  3ZC4 A;  2V26 A;  3LLK A;  2H7V C;  4U5E E;  4OIN F;  4LER A;  2CNW D;  2QY9 A;  2A68 F;  3SNH A;  3F46 A;  2XL4 A;  3EHM A;  3FDQ A;  4C3B A;  2NUP B;  1BR4 A;  1RJ9 A;  5E33 A;  3AG3 C;  4J30 B;  1OKK D;  3MLG A;  2YHS A;  2XRH A;  4YT8 A;  2Q9B A;  3W2W A;  3LES A;  2J0X A;  2P6V A;  3L0I A;  4KC9 A;  4W8K A;  1FTS A;  2A1D D;  4GEH A;  3UGO A;  3EPV A;  3NKD A;  2WVN A;  4KNV A;  2EIM C;  2KGO A;  4JJF A;  4YN0 B;  3AG4 C;  5KYU A;  1VK5 A;  1ZU5 A;  1G8X A;  4CIH A;  4GYT A;  3UMH A;  2Y3H A;  4Q4Z F;  4I3M A;  3DJU B;  3JT1 A;  4U5F E;  4FES A;  4E7Z A;  2Z15 A;  3LS1 A;  2KW3 C;  4CBE A;  5L3V A;  5B1A C;  3RIP A;  2R7S A;  5KYY A;  2XXA B;  4I1M A;  4RD9 A;  2J9U A;  4DBQ A;  4C3E A;  2C04 A;  3UGP A;  3T4R A;  2OG2 A;  4P6I C;  4QI2 A;  4G7O F;  2HV7 A;  4C3D A;  3PHF 2;  2WZG A;  4XWJ A;  2WVO A;  3Q7G A;  5DVW A;  2FFH A;  4ZLC A;  1TWA A;  1OKK A;  2Y39 A;  1RJ9 B;  3EHN A;  2Q9A A;  3CZ6 A;  1D1C A;  2WZL A;  2G3V A;  3TD7 A;  1Z3I X;  4OD5 A;  3RYL A;  2IOQ A;  2YEV A;  5E2Q A;  1MMD A;  4IJJ A;  1IW7 F;  3X1O A;  2ZXO A;  3T6B A;  4CSA A;  4M63 A;  1O5H A;  5F5F A;  3NDB B;  5D91 A;  3QMK A;  3KKB A;  1VMA A;  2Q3T A;  1PD0 A;  3K33 A;  5E3A A;  4EWC A;  5DS6 A;  2L81 A;  5FCL A;  4O7G A;  2J45 A;  3FAJ A;  2R7W A;  3B0U X;  1NZE A;  2H7B A;  4C7O A;  2WVQ A;  3NRH A;  1Z23 A;  1ZHY A;  2BE5 F;  3UR3 C;  3ABM C;  4CSA C;  2KNH A;  1M2V A;  3ASN C;  3LS0 A;  5KYY B;  3ECS A;  1NU7 D;  4JZA A;  4DVY P;  3VYW A;  1TWG A;  4B6I A;  4O6M A;  2R7T A;  3NKE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...