5JUAA

Nitric oxide complex of the l16i mutant of cytochrome c prime from alcaligenes xylosoxidans
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
126
structure length
126
Chain Sequence
b'EFAKPEDAVKYRQSAITLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c'
molecule tags Electron transport
source organism Alcaligenes xylosoxydans xylosoxydans
publication title Engineering proximal vs. distal heme-NO coordination via dinitrosyl dynamics: implications for NO sensor design.
pubmed doi rcsb
total genus 49
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2016-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 5juaA00
5JT4A 3C63A 2BC5A 2YL1A 1A7VA 4JEBA 4ER9A 1LM3B 2YL7A 1JAFA 5B3IA 3HNJA 2QLAA 1GQAA 1QPUA 3DE8A 4N4WA 1QQ3A 2XLEA 3FOPA 3M4CA 4CJOA 1CGNA 3HNIA 4D4NA 3U8PA 4IB4A 3FOOA 4JEAA 5JRAA 1E86A 4WGZA 3TOMA 3DE9A 3QW0A 1YYXA 4U9DA 3QVYA 2YLIA 4CX9A 3QW1A 1CPRA 3NMJA 4JE9A 1M6TA 1YZCA 2J9BA 4NC3A 4IARA 1S05A 4CDYA 4L6RA 1MQVA 5JS5A 3ZTMA 2XLDA 3QVZA 2XLMA 3ZWIA 1YYJA 1E84A 2XL6A 1E85A 1BBHA 1NBBA 5AGFA 3M15A 2J8WA 2XL8A 1RCPA 1YZAA 3NMIA 1CGOA 4JKVA 256BA 3NMKA 4CDVA 5JP7A 4N6HA 5JVEA 3ZTZA 3HNLA 2XLOA 2XM0A 2YLGA 2XM4A 5JSLA 3ZQYA 4IAQA 1E83A 2YL3A 3VRCA 2YL0A 3HNKA 4EIYA 4D4XA 3L1MA 3IQ5A 2XLWA 3M4BA 1APCA 3TOLA 4U9EA 4CDAA 1CPQA 2YKZA 3IQ6A 3M79A 4CJGA 4CIPA 5JLIA 2CCYA 3ZQVA 2XLHA 4ULVA 5JUAA 1EKYA 4WGYA 2YLDA 3C62A 2XLVA
chains in the Genus database with same CATH superfamily
1D0XA 1LKXA 2L7AA 2YL1A 3UMKA 3DKAA 3FMSA 2NUPB 3DZAA 3HKKA 2ZXPA 3Q6MA 2J45A 3AJMA 1LPEA 3DAGA 2NUTB 3S28A 5IY5C 1WATA 2YL7A 3JRMO 1F1MA 2OG2A 1G8XA 3K1HA 5B3IA 1PV3A 3BRJA 1IW7F 5E33A 1LVKA 3J06A 2LK4A 2XXAA 1NFNA 4C3DA 1B68A 5FZTA 3X1OA 1JRAA 4AL0A 4NCQA 1LI7A 4CIHA 1H9GA 1BR1A 2RD9A 2VCCA 3EG9A 1WOLA 3VAYA 2ICWG 4CJOA 1CGNA 1Z6AA 1MMNA 4EWCA 3E9VA 4OIQF 1A7DA 2NPUA 1FAPB 1VMAA 1M56C 3FAJA 4D4NA 2ZXRA 5DQTA 1TR2A 3ATPA 2UUHA 1QZXA 2NSGA 1TKNA 2UUIA 4G7OF 3KYIA 3OA1A 4YL3A 2Y69C 2R7OA 2KGOA 1YDIA 1LE2A 2Z15A 1WGWA 1SMYF 4BJTA 3MX3A 1G4WR 5E2QA 3UR3C 4XEVA 5K0IA 4IRUA 4KC9A 3VF0A 2MYSA 4U5CE 3IQCA 3EFOA 4BJ6A 4U5HA 4JURI 3VM6A 3UMIA 2PNOA 3QW0A 4H54A 3AGUA 1CPRA 3NMJA 3QW1A 3PDMP 4JE9A 1RMVA 1YZCA 3I5PA 2P6VA 4IARA 3KH2A 3MBGA 1FFTC 4DBQA 1S7ZA 2EPOA 3EPVA 2H8AA 1QLEC 3AQBA 2LCHA 2XLDA 3LNRA 1OW7A 4GQHA 4CSAA 1RJ9A 1ZW2A 2CW0F 4MTOA 4MVOA 3Q6NA 3NG1A 2LIGA 4BJ5A 3EG9B 2IXNA 2XLMA 3KYJA 2XL6A 1SF8A 2AVKA 3AG3C 3AQCA 2BE5F 3ITFA 2R25A 5B3SC 2ZPAA 2IYLD 5KYWB 1RCPA 2KK1A 1J8MF 1FR0A 4MNDA 5EGYA 2PP4A 5B1AC 3NDBB 1U6HA 1AVOB 2R9RB 3H2UA 2HKVA 4LDKA 2LD6A 3K66A 2WVOA 3NMKA 3S29A 4CDVA 4K1OA 2KC3A 2J9VA 3DMDA 2OKUA 2VB6A 3AOUA 4AX2A 5L3QA 1ORJA 3C8ZA 3B0UX 2XM0A 1T6QA 3MLGA 3ASNC 4U5BE 3T6JA 1WTYA 3DJUB 4LDRA 3S0XA 3JT1A 4I44A 5L0GA 1E83A 3K1IA 2KQ9A 1PCXA 1ORYA 2YL0A 1Q0MA 4ONSA 2X51A 4N6CA 1RXQA 4EKWA 2VCBA 1Q0GA 2H7OA 3A9CA 4HEAJ 4KNVA 3S84A 1BDJB 4HE8D 1XWJA 2D5RB 4PJJA 2HV6A 3POVA 3EZHA 1SZIA 3IEEA 1K04A 2OJQA 3LESA 1LE4A 2NUTA 2XSEA 3M1CB 1DOVA 4JC7A 2O9XA 1VLTA 3RVZA 4CDAA 2KNHA 1CPQA 1JMWA 2YHSA 2JD3A 3JRTA 3SXZA 3WODF 4DRJB 3I4UA 3RKOF 4YN0B 3QZCA 4WGYA 5JUAA 5L0CA 3O10A 3KKBA 2ZD9A 3JSZA 3UMHA 1Y4CA 2R05A 4PK4A 4K7BA 4A2NB 3NYLA 3JZ0A 3V7OA 4O6NA 4F4BA 5JVEA 5A6JA 1OCCC 4H4KC 3C8GA 5A69A 3SNHA 2W4BA 2M64A 4C7OB 3FVYA 2GDCA 4ER9A 4CS9C 5L3VA 4XPWA 1ZHTA 4RDAA 1SYQA 2EIMC 2LQGA 4OIRF 3HNJA 1UFBA 2D4UA 4LLCA 1GQAA 1QPUA 3LS0A 2AP3A 5DVWA 3LEOA 1JOGA 1NG1A 5D92A 1QQ3A 1RKCA 2OQMA 2XLEA 4YT5A 1NU9C 3M4CA 3HJCA 3RYLA 1V4AA 3RF3A 1A7EA 5BQGA 4MQ9F 3BEHA 4BG0A 2IM8A 1CGME 3V5ZA 2HSBA 2NG1A 2R7QA 3Q7LA 1U0BB 3V5YA 2GAQA 3AGTA 3RFYA 4JRZA 3N2ZB 2Q00A 3R2PA 2FGYA 4PJMA 4E7ZA 4IB4A 2FFHA 2KJGA 5JRAA 1H9TA 3DM9B 3JYHA 2YQYA 3LS1A 4YT8A 4ULWA 3RW0A 1Q0DA 1OCRC 5EK0A 3O39A 4XEKA 1YLMA 3ABKC 4JTCB 5BQIA 1HMOA 1T6UA 2M4EA 4FX5A 3GORA 1YYXA 2DGJA 1M2VB 4EBKA 5AC5A 2GWWA 1ST6A 1WN0A 1M6TA 2L6FA 4JJFA 5AC4A 2Y3BA 3HTKC 4MVRA 1ZU5A 1S05A 1FTSA 1QVXA 3TULA 3RQGA 3W4YA 3T4RA 4R32A 3TQOA 5L0FA 5L0DA 1FMVA 3RVYA 4C7OA 1K05A 1QKRA 2FAPB 1HE9A 2A0UA 1XZPA 2OJED 2OEVA 4QI0A 3W8HA 1KTMA 1MMGA 3C8GB 2EIJC 2Y3DA 3QVZA 2QUPA 2R7VA 1H6GA 1T6IA 4GYTA 4XQ1A 2W9YA 3ZWIA 1YYJA 3CSKA 2YEVA 2HUJA 1IZMA 4CS8A 4HFFB 3GM3A 1TWCA 2A6HF 2EPMX 2P1AA 3EFOB 1TFKB 1Z3IX 3I5QA 3M15A 1VYKA 5AGFA 1OQCA 2XL8A 3GEHA 3TK0A 5KYYB 1EQ1A 3NMIA 1T9KA 4PFOA 1O3UA 1PD1A 1CGOA 1TWHA 2CGEA 2L9JA 2CDQA 5JP7A 3VYWA 3WAQA 5CIVA 3MYIA 4JVSA 4MVUA 3MYFA 2OOCA 5T1DB 5A6AA 4XWJA 2Y39A 1D1AA 2XLOA 5F5FA 3LUTB 4FWVA 3T9OA 5JSLA 2R7SA 2LFDA 4W8KA 5COGA 4KNWA 3ABLC 4YJWA 4MW8A 4IWBA 2P0NA 3KPHA 1FMWA 3RQEA 4A4AA 1I4ZA 1HMDA 2C03A 2EPKX 4X0RA 1R4TA 4D4XA 4EIYA 3UGOA 1G5ZA 1TWGA 1HY5A 1LIHA 2OCCC 4XPYA 2XXAB 3EHMA 3M4BA 3AG1C 1NFOA 3DWWA 5FCLA 2MWQA 4E0HA 2J0XA 4IJJA 3JTLO 3LEVA 1VLSA 4EBJA 2G3VA 4C3BA 2Q4FA 2QTVA 4CIPA 3M79A 4U5GA 3H2VA 1VOMA 4O6YA 2CCYA 3ZQVA 4FAPB 5KYXA 1D1BA 2HFIA 3EGDB 3EZIA 4I1OB 1E2XA 2YZSA 4MVMA 2YLDA 4O79A 4PJLA 4AE4B 3GEIA 3ZC4A 3K33A 1JR8A 1OXBA 2G3KA 1GM5A 5KYUA 3C63A 1BZ4A 4G7ZF 1A0BA 1MNEA 2LFFA 2E87A 2V3CC 3EGXA 3IQTA 4I1MA 1A7VA 4LDQA 1V55C 3U5SA 3EH2A 4JEBA 4Z9HA 2CNWA 1YA7O 3GM2A 3UGPA 1LM3B 2I15A 5B1BC 2J0WA 1D1CA 4U5DE 3B9QA 4DVZA 1AEPA 1G4US 1H7IA 1A41A 2CNWD 2QLAA 1LS1A 3DM5A 5DLJA 4YT2A 2R7UA 4J30B 3L34A 2WVNA 4CS8C 2YVKA 3H65A 4XLPF 5DS5A 2C04A 4G0HA 3CEXA 3K1IC 2XS8A 3N24A 3U8VA 5F28E 5A6BA 4Q4ZF 1ZHZA 4U5FE 1J8YF 4NY3A 3SP1A 3HNIA 3LNMB 1KU2A 1M57C 4EHPA 2R03A 2DI3A 3V5XA 4OIOF 2KYHA 4DRIB 3HLZA 4I3MA 1HW2A 4XLNF 4KBLA 3QTHA 2V26A 2J7PA 3RIPA 2VCAA 5E3CA 3DXJF 4HFKB 4P6IC 2Y3GA 1TFOB 2A1DD 2NSFA 3R7CA 4JZAA 1E86A 1OCOC 2HZ8A 4Z9IA 3TOMA 3ZIBA 3DE9A 1HE1A 4BJ6C 4AE4A 4P9TA 4JTAB 3DI5A 2L81A 1L7CA 1YARO 4OD5A 4CX9A 4BPMA 2WVQA 2B0HA 4GEHA 3U9JA 4CDYA 3ABMC 2LP4A 1D0YA 4L6RA 1ZU4A 3ASOC 1EA8A 1OKKA 3JCUQ 1MQVA 3FAPB 3FHDA 3W2WA 3ZTMA 4DXWA 1OCZC 2KSFA 1K40A 3E70C 1OW8A 2A0BA 3A11A 1L3PA 5L0HA 3B71A 3OEOA 1MMAA 3KMIA 3G4XA 4LACB 4XPXA 1O5HA 4MTFA 4DVYP 1T01A 4BJ1A 2GA0A 2HMZA 2G62A 1EI7A 2RSEB 2WZLA 3CQZA 1E85A 4BJ5C 2EINC 5KYNA 3JYYA 4JJGA 1NBBA 1NLXA 1Z63A 1I5NA 3FXHA 1YJGA 4PACA 4Z9JA 1TQGA 3WG7C 3L0IA 5T3TA 3PHF2 2Q3TA 3KL4A 1T5OA 2VASA 2W45A 3LLKA 3DAFA 3O6XA 3RQFA 4MTGA 1WWPA 1ZHXA 4AL1A 2JPUA 3Q7GA 1JPNA 4WJ0A 4EUKB 5F5HA 1R5ID 2HS5A 3ZTZA 2EPLX 3HNLA 4RD9A 2MHRA 4JCHA 2EILC 2YLGA 4NQFA 3SXYA 1WASA 2A68F 3ZQYA 5CI8A 5CI9A 4O7GA 1QSPA 2YL3A 5COFA 3VRCA 3S90A 2CYDA 2YWAA 2XS1A 3F47A 4PFPA 2I8BA 1Q0KA 5DS4A 3L1MA 3PMRA 4NTFA 3TJ6A 2WZFA 1V74B 3IQ5A 3LLIA 2Q7RA 2IXOA 4QDLA 4JTDB 2R7TA 3MFNA 2QE9A 2R7WA 4MVSA 3GWNA 3JSEO 3L8JA 3NKEA 5KYYA 2PBEA 1D0ZA 2QNLA 4W8PA 3LAYA 2TMVP 1BR2A 4IAOA 5E3AA 3T6BA 3TOLA 3AG4C 3N0TA 4U9EA 2B0JA 2HMQA 2AU5A 4G7HF 4QI2A 1I4YA 2P7VA 1OR3A 1NSGB 3CAXA 2YKZA 3ECSA 2IXPA 3EGXB 4J7TA 4LLEA 3UNGC 2DYSC 4CJGA 5HV9A 2HSQA 1C02A 4MW3A 1SR2A 2WB7A 3ZG1A 2XLHA 1EKYA 2P61A 4C3EA 3O55A 4ZLCA 1OKKD 3IPMO 1GGQA 2EIKC 4JCZA 5COMA 3C18A 3SYNA 1MMDA 3U0CA 2GFHA 2XLVA 1HW1A 2PX0A 3SEOA 5JT4A 5BUOA 2BC5A 4EBBA 1Z5ZA 3U3BA 2Y3HA 5DS6A 4NTBA 4E0IA 1PD0A 4MS2A 1XZQA 1ZVZA 3EGDA 4K0DA 2PFDA 1Z7Qc 4UDVA 1JAFA 3CZ6A 3US6A 4ZLDA 1C17M 2AWYA 4N06A 1LI5A 4G78A 4DBRA 5A6KA 1V54C 2J7PD 4YL1A 2DB4A 2X0CA 3SXMA 1ZHWA 3DE8A 5HSWA 4N4WA 1NZEA 1ZZPA 3B29A 4XTKA 3C8GD 5T3WA 1YVIA 3FOPA 2NUPA 3G4ZA 4ANJA 3OWTA 1GS9A 3EQLF 3PCVA 2W4MA 3EJNA 4O6MA 4CBEA 1OW6A 2PX3A 5A6BD 2ASRA 2J9UA 4JIOA 3U8PA 1YA9A 3IHUA 3ZDLA 4DOZA 5KYUB 2A69F 3NKDA 3QMKA 4U5EE 1OXKA 3F46A 1M2OA 1ZYRF 3SZRA 4AK9A 1ZW3A 2KW3C 5DQZA 3X2QC 2ZXOA 3K7DA 2WZGA 3FOOA 4J32B 2IOQA 1TWAA 2F22A 4JEAA 4Q7CA 4KI2A 2DYRC 1FNTc 1OR2A 3ZSUA 1M2VA 3G50A 2R02A 2IBFA 2QY9A 4WGZA 4DRHB 3U2MA 1RKEB 1MNDA 4U9DA 1KNYA 4LERA 3QVYA 2YLIA 1RKEA 1UG7A 2HJMA 2J9BA 4WABA 3S27A 5L0JA 4NC3A 4OINF 3S9OA 2Q9BA 4YT4A 4CS7A 4OIPF 2PF4E 5JS5A 4B6IA 2VC9A 3GM1A 3W2VA 2J46A 1U89A 3C7JA 4CSAC 3GEEA 4E7SA 2HV7A 3NYJA 2YRFA 1VTMP 1E84A 4P9FA 1BBHA 2EPNA 2WL8A 3RH3A 2J9WA 3AG2C 3L8IA 4BEMJ 1BR4A 2ZXWC 2H7VC 2J8WA 3B0PA 4OD4A 1YZAA 1Q0FA 4XEFA 1RJ9B 5BQHA 2BL2A 4JKVA 5L0IA 1NU7D 256BA 3W8IA 2AWCA 2OU6A 4MVZA 4N6HA 5D91A 4CS9A 1VYIA 2L6GA 4YWQA 2H7BA 3FDQA 2R7RA 4YL0A 3GODA 1YAUO 3U2LA 2Q9CA 3T6GB 2XM4A 3TJ5A 3DJNB 3WHNA 4IGGA 5KYWA 2R7XA 1FFHA 3GANA 4IAQA 2XL4A 1JPJA 4E17A 1VB5A 1O87A 3HNKA 2OEXA 4J7YA 5GPGB 3B0VC 3SXKA 1W2WA 4E18A 3GWLA 1N1CA 3ZVRA 2XLWA 2XRHA 4M63A 3EH1A 1Z23A 2VH3A 2HJ3A 1C03A 2JX0A 5TJ5E 4JW1A 5EHHA 1APCA 4DJ9A 3TD7A 2LSEA 4Q5SF 2ETSA 3U9MA 4FESA 4PR9A 4RBNA 3NYMA 1ZHYA 3IQ6A 1Y6DA 4BEJA 5JLIA 3NRHA 1DOWA 1AUEA 2L6HA 3K6BA 4ULVA 1VK5A 1LS4A 3LJBA 2A6EF 4PJNA 4MVQA 4YK5A 3U3FA 1ORSC 5KYXB 4NTAA 3EHNA 3C62A 3DD7A 2Q9AA 2IXMA
chains in the Genus database with same CATH topology
5JT4A 3C63A 2BC5A 2YL1A 1A7VA 4JEBA 4ER9A 1LM3B 2YL7A 1JAFA 5B3IA 3HNJA 2QLAA 1GQAA 1QPUA 3DE8A 4N4WA 1QQ3A 2XLEA 3FOPA 3M4CA 4CJOA 1CGNA 3HNIA 4D4NA 3U8PA 4IB4A 3FOOA 4JEAA 5JRAA 1E86A 4WGZA 3TOMA 3DE9A 3QW0A 1YYXA 4U9DA 3QVYA 2YLIA 4CX9A 3QW1A 1CPRA 3NMJA 4JE9A 1M6TA 1YZCA 2J9BA 4NC3A 4IARA 1S05A 4CDYA 4L6RA 1MQVA 5JS5A 3ZTMA 2XLDA 3QVZA 2XLMA 3ZWIA 1YYJA 1E84A 2XL6A 1E85A 1BBHA 1NBBA 5AGFA 3M15A 2J8WA 2XL8A 1RCPA 1YZAA 3NMIA 1CGOA 4JKVA 256BA 3NMKA 4CDVA 5JP7A 4N6HA 5JVEA 3ZTZA 3HNLA 2XLOA 2XM0A 2YLGA 2XM4A 5JSLA 3ZQYA 4IAQA 1E83A 2YL3A 3VRCA 2YL0A 3HNKA 4EIYA 4D4XA 3L1MA 3IQ5A 2XLWA 3M4BA 1APCA 3TOLA 4U9EA 4CDAA 1CPQA 2YKZA 3IQ6A 3M79A 4CJGA 4CIPA 5JLIA 2CCYA 3ZQVA 2XLHA 4ULVA 5JUAA 1EKYA 4WGYA 2YLDA 3C62A 2XLVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JT4 A;  3C63 A;  2BC5 A;  2YL1 A;  1A7V A;  4JEB A;  4ER9 A;  1LM3 B;  2YL7 A;  1JAF A;  5B3I A;  3HNJ A;  2QLA A;  1GQA A;  1QPU A;  3DE8 A;  4N4W A;  1QQ3 A;  2XLE A;  3FOP A;  3M4C A;  4CJO A;  1CGN A;  3HNI A;  4D4N A;  3U8P A;  4IB4 A;  3FOO A;  4JEA A;  5JRA A;  1E86 A;  4WGZ A;  3TOM A;  3DE9 A;  3QW0 A;  1YYX A;  4U9D A;  3QVY A;  2YLI A;  4CX9 A;  3QW1 A;  1CPR A;  3NMJ A;  4JE9 A;  1M6T A;  1YZC A;  2J9B A;  4NC3 A;  4IAR A;  1S05 A;  4CDY A;  4L6R A;  1MQV A;  5JS5 A;  3ZTM A;  2XLD A;  3QVZ A;  2XLM A;  3ZWI A;  1YYJ A;  1E84 A;  2XL6 A;  1E85 A;  1BBH A;  1NBB A;  5AGF A;  3M15 A;  2J8W A;  2XL8 A;  1RCP A;  1YZA A;  3NMI A;  1CGO A;  4JKV A;  256B A;  3NMK A;  4CDV A;  5JP7 A;  4N6H A;  5JVE A;  3ZTZ A;  3HNL A;  2XLO A;  2XM0 A;  2YLG A;  2XM4 A;  5JSL A;  3ZQY A;  4IAQ A;  1E83 A;  2YL3 A;  3VRC A;  2YL0 A;  3HNK A;  4EIY A;  4D4X A;  3L1M A;  3IQ5 A;  2XLW A;  3M4B A;  1APC A;  3TOL A;  4U9E A;  4CDA A;  1CPQ A;  2YKZ A;  3IQ6 A;  3M79 A;  4CJG A;  4CIP A;  5JLI A;  2CCY A;  3ZQV A;  2XLH A;  4ULV A;  5JUA A;  1EKY A;  4WGY A;  2YLD A;  3C62 A;  2XLV A; 
#chains in the Genus database with same CATH topology
 1D0X A;  1LKX A;  2L7A A;  2YL1 A;  3UMK A;  3DKA A;  3FMS A;  2NUP B;  3DZA A;  3HKK A;  2ZXP A;  3Q6M A;  2J45 A;  3AJM A;  1LPE A;  3DAG A;  2NUT B;  3S28 A;  5IY5 C;  1WAT A;  2YL7 A;  3JRM O;  1F1M A;  2OG2 A;  1G8X A;  3K1H A;  5B3I A;  1PV3 A;  3BRJ A;  1IW7 F;  5E33 A;  1LVK A;  3J06 A;  2LK4 A;  2XXA A;  1NFN A;  4C3D A;  1B68 A;  5FZT A;  3X1O A;  1JRA A;  4AL0 A;  4NCQ A;  1LI7 A;  4CIH A;  1H9G A;  1BR1 A;  2RD9 A;  2VCC A;  3EG9 A;  1WOL A;  3VAY A;  2ICW G;  4CJO A;  1CGN A;  1Z6A A;  1MMN A;  4EWC A;  3E9V A;  4OIQ F;  1A7D A;  2NPU A;  1FAP B;  1VMA A;  1M56 C;  3FAJ A;  4D4N A;  2ZXR A;  5DQT A;  1TR2 A;  3ATP A;  2UUH A;  1QZX A;  2NSG A;  1TKN A;  2UUI A;  4G7O F;  3KYI A;  3OA1 A;  4YL3 A;  2Y69 C;  2R7O A;  2KGO A;  1YDI A;  1LE2 A;  2Z15 A;  1WGW A;  1SMY F;  4BJT A;  3MX3 A;  1G4W R;  5E2Q A;  3UR3 C;  4XEV A;  5K0I A;  4IRU A;  4KC9 A;  3VF0 A;  2MYS A;  4U5C E;  3IQC A;  3EFO A;  4BJ6 A;  4U5H A;  4JUR I;  3VM6 A;  3UMI A;  2PNO A;  3QW0 A;  4H54 A;  3AGU A;  1CPR A;  3NMJ A;  3QW1 A;  3PDM P;  4JE9 A;  1RMV A;  1YZC A;  3I5P A;  2P6V A;  4IAR A;  3KH2 A;  3MBG A;  1FFT C;  4DBQ A;  1S7Z A;  2EPO A;  3EPV A;  2H8A A;  1QLE C;  3AQB A;  2LCH A;  2XLD A;  3LNR A;  1OW7 A;  4GQH A;  4CSA A;  1RJ9 A;  1ZW2 A;  2CW0 F;  4MTO A;  4MVO A;  3Q6N A;  3NG1 A;  2LIG A;  4BJ5 A;  3EG9 B;  2IXN A;  2XLM A;  3KYJ A;  2XL6 A;  1SF8 A;  2AVK A;  3AG3 C;  3AQC A;  2BE5 F;  3ITF A;  2R25 A;  5B3S C;  2ZPA A;  2IYL D;  5KYW B;  1RCP A;  2KK1 A;  1J8M F;  1FR0 A;  4MND A;  5EGY A;  2PP4 A;  5B1A C;  3NDB B;  1U6H A;  1AVO B;  2R9R B;  3H2U A;  2HKV A;  4LDK A;  2LD6 A;  3K66 A;  2WVO A;  3NMK A;  3S29 A;  4CDV A;  4K1O A;  2KC3 A;  2J9V A;  3DMD A;  2OKU A;  2VB6 A;  3AOU A;  4AX2 A;  5L3Q A;  1ORJ A;  3C8Z A;  3B0U X;  2XM0 A;  1T6Q A;  3MLG A;  3ASN C;  4U5B E;  3T6J A;  1WTY A;  3DJU B;  4LDR A;  3S0X A;  3JT1 A;  4I44 A;  5L0G A;  1E83 A;  3K1I A;  2KQ9 A;  1PCX A;  1ORY A;  2YL0 A;  1Q0M A;  4ONS A;  2X51 A;  4N6C A;  1RXQ A;  4EKW A;  2VCB A;  1Q0G A;  2H7O A;  3A9C A;  4HEA J;  4KNV A;  3S84 A;  1BDJ B;  4HE8 D;  1XWJ A;  2D5R B;  4PJJ A;  2HV6 A;  3POV A;  3EZH A;  1SZI A;  3IEE A;  1K04 A;  2OJQ A;  3LES A;  1LE4 A;  2NUT A;  2XSE A;  3M1C B;  1DOV A;  4JC7 A;  2O9X A;  1VLT A;  3RVZ A;  4CDA A;  2KNH A;  1CPQ A;  1JMW A;  2YHS A;  2JD3 A;  3JRT A;  3SXZ A;  3WOD F;  4DRJ B;  3I4U A;  3RKO F;  4YN0 B;  3QZC A;  4WGY A;  5JUA A;  5L0C A;  3O10 A;  3KKB A;  2ZD9 A;  3JSZ A;  3UMH A;  1Y4C A;  2R05 A;  4PK4 A;  4K7B A;  4A2N B;  3NYL A;  3JZ0 A;  3V7O A;  4O6N A;  4F4B A;  5JVE A;  5A6J A;  1OCC C;  4H4K C;  3C8G A;  5A69 A;  3SNH A;  2W4B A;  2M64 A;  4C7O B;  3FVY A;  2GDC A;  4ER9 A;  4CS9 C;  5L3V A;  4XPW A;  1ZHT A;  4RDA A;  1SYQ A;  2EIM C;  2LQG A;  4OIR F;  3HNJ A;  1UFB A;  2D4U A;  4LLC A;  1GQA A;  1QPU A;  3LS0 A;  2AP3 A;  5DVW A;  3LEO A;  1JOG A;  1NG1 A;  5D92 A;  1QQ3 A;  1RKC A;  2OQM A;  2XLE A;  4YT5 A;  1NU9 C;  3M4C A;  3HJC A;  3RYL A;  1V4A A;  3RF3 A;  1A7E A;  5BQG A;  4MQ9 F;  3BEH A;  4BG0 A;  2IM8 A;  1CGM E;  3V5Z A;  2HSB A;  2NG1 A;  2R7Q A;  3Q7L A;  1U0B B;  3V5Y A;  2GAQ A;  3AGT A;  3RFY A;  4JRZ A;  3N2Z B;  2Q00 A;  3R2P A;  2FGY A;  4PJM A;  4E7Z A;  4IB4 A;  2FFH A;  2KJG A;  5JRA A;  1H9T A;  3DM9 B;  3JYH A;  2YQY A;  3LS1 A;  4YT8 A;  4ULW A;  3RW0 A;  1Q0D A;  1OCR C;  5EK0 A;  3O39 A;  4XEK A;  1YLM A;  3ABK C;  4JTC B;  5BQI A;  1HMO A;  1T6U A;  2M4E A;  4FX5 A;  3GOR A;  1YYX A;  2DGJ A;  1M2V B;  4EBK A;  5AC5 A;  2GWW A;  1ST6 A;  1WN0 A;  1M6T A;  2L6F A;  4JJF A;  5AC4 A;  2Y3B A;  3HTK C;  4MVR A;  1ZU5 A;  1S05 A;  1FTS A;  1QVX A;  3TUL A;  3RQG A;  3W4Y A;  3T4R A;  4R32 A;  3TQO A;  5L0F A;  5L0D A;  1FMV A;  3RVY A;  4C7O A;  1K05 A;  1QKR A;  2FAP B;  1HE9 A;  2A0U A;  1XZP A;  2OJE D;  2OEV A;  4QI0 A;  3W8H A;  1KTM A;  1MMG A;  3C8G B;  2EIJ C;  2Y3D A;  3QVZ A;  2QUP A;  2R7V A;  1H6G A;  1T6I A;  4GYT A;  4XQ1 A;  2W9Y A;  3ZWI A;  1YYJ A;  3CSK A;  2YEV A;  2HUJ A;  1IZM A;  4CS8 A;  4HFF B;  3GM3 A;  1TWC A;  2A6H F;  2EPM X;  2P1A A;  3EFO B;  1TFK B;  1Z3I X;  3I5Q A;  3M15 A;  1VYK A;  5AGF A;  1OQC A;  2XL8 A;  3GEH A;  3TK0 A;  5KYY B;  1EQ1 A;  3NMI A;  1T9K A;  4PFO A;  1O3U A;  1PD1 A;  1CGO A;  1TWH A;  2CGE A;  2L9J A;  2CDQ A;  5JP7 A;  3VYW A;  3WAQ A;  5CIV A;  3MYI A;  4JVS A;  4MVU A;  3MYF A;  2OOC A;  5T1D B;  5A6A A;  4XWJ A;  2Y39 A;  1D1A A;  2XLO A;  5F5F A;  3LUT B;  4FWV A;  3T9O A;  5JSL A;  2R7S A;  2LFD A;  4W8K A;  5COG A;  4KNW A;  3ABL C;  4YJW A;  4MW8 A;  4IWB A;  2P0N A;  3KPH A;  1FMW A;  3RQE A;  4A4A A;  1I4Z A;  1HMD A;  2C03 A;  2EPK X;  4X0R A;  1R4T A;  4D4X A;  4EIY A;  3UGO A;  1G5Z A;  1TWG A;  1HY5 A;  1LIH A;  2OCC C;  4XPY A;  2XXA B;  3EHM A;  3M4B A;  3AG1 C;  1NFO A;  3DWW A;  5FCL A;  2MWQ A;  4E0H A;  2J0X A;  4IJJ A;  3JTL O;  3LEV A;  1VLS A;  4EBJ A;  2G3V A;  4C3B A;  2Q4F A;  2QTV A;  4CIP A;  3M79 A;  4U5G A;  3H2V A;  1VOM A;  4O6Y A;  2CCY A;  3ZQV A;  4FAP B;  5KYX A;  1D1B A;  2HFI A;  3EGD B;  3EZI A;  4I1O B;  1E2X A;  2YZS A;  4MVM A;  2YLD A;  4O79 A;  4PJL A;  4AE4 B;  3GEI A;  3ZC4 A;  3K33 A;  1JR8 A;  1OXB A;  2G3K A;  1GM5 A;  5KYU A;  3C63 A;  1BZ4 A;  4G7Z F;  1A0B A;  1MNE A;  2LFF A;  2E87 A;  2V3C C;  3EGX A;  3IQT A;  4I1M A;  1A7V A;  4LDQ A;  1V55 C;  3U5S A;  3EH2 A;  4JEB A;  4Z9H A;  2CNW A;  1YA7 O;  3GM2 A;  3UGP A;  1LM3 B;  2I15 A;  5B1B C;  2J0W A;  1D1C A;  4U5D E;  3B9Q A;  4DVZ A;  1AEP A;  1G4U S;  1H7I A;  1A41 A;  2CNW D;  2QLA A;  1LS1 A;  3DM5 A;  5DLJ A;  4YT2 A;  2R7U A;  4J30 B;  3L34 A;  2WVN A;  4CS8 C;  2YVK A;  3H65 A;  4XLP F;  5DS5 A;  2C04 A;  4G0H A;  3CEX A;  3K1I C;  2XS8 A;  3N24 A;  3U8V A;  5F28 E;  5A6B A;  4Q4Z F;  1ZHZ A;  4U5F E;  1J8Y F;  4NY3 A;  3SP1 A;  3HNI A;  3LNM B;  1KU2 A;  1M57 C;  4EHP A;  2R03 A;  2DI3 A;  3V5X A;  4OIO F;  2KYH A;  4DRI B;  3HLZ A;  4I3M A;  1HW2 A;  4XLN F;  4KBL A;  3QTH A;  2V26 A;  2J7P A;  3RIP A;  2VCA A;  5E3C A;  3DXJ F;  4HFK B;  4P6I C;  2Y3G A;  1TFO B;  2A1D D;  2NSF A;  3R7C A;  4JZA A;  1E86 A;  1OCO C;  2HZ8 A;  4Z9I A;  3TOM A;  3ZIB A;  3DE9 A;  1HE1 A;  4BJ6 C;  4AE4 A;  4P9T A;  4JTA B;  3DI5 A;  2L81 A;  1L7C A;  1YAR O;  4OD5 A;  4CX9 A;  4BPM A;  2WVQ A;  2B0H A;  4GEH A;  3U9J A;  4CDY A;  3ABM C;  2LP4 A;  1D0Y A;  4L6R A;  1ZU4 A;  3ASO C;  1EA8 A;  1OKK A;  3JCU Q;  1MQV A;  3FAP B;  3FHD A;  3W2W A;  3ZTM A;  4DXW A;  1OCZ C;  2KSF A;  1K40 A;  3E70 C;  1OW8 A;  2A0B A;  3A11 A;  1L3P A;  5L0H A;  3B71 A;  3OEO A;  1MMA A;  3KMI A;  3G4X A;  4LAC B;  4XPX A;  1O5H A;  4MTF A;  4DVY P;  1T01 A;  4BJ1 A;  2GA0 A;  2HMZ A;  2G62 A;  1EI7 A;  2RSE B;  2WZL A;  3CQZ A;  1E85 A;  4BJ5 C;  2EIN C;  5KYN A;  3JYY A;  4JJG A;  1NBB A;  1NLX A;  1Z63 A;  1I5N A;  3FXH A;  1YJG A;  4PAC A;  4Z9J A;  1TQG A;  3WG7 C;  3L0I A;  5T3T A;  3PHF 2;  2Q3T A;  3KL4 A;  1T5O A;  2VAS A;  2W45 A;  3LLK A;  3DAF A;  3O6X A;  3RQF A;  4MTG A;  1WWP A;  1ZHX A;  4AL1 A;  2JPU A;  3Q7G A;  1JPN A;  4WJ0 A;  4EUK B;  5F5H A;  1R5I D;  2HS5 A;  3ZTZ A;  2EPL X;  3HNL A;  4RD9 A;  2MHR A;  4JCH A;  2EIL C;  2YLG A;  4NQF A;  3SXY A;  1WAS A;  2A68 F;  3ZQY A;  5CI8 A;  5CI9 A;  4O7G A;  1QSP A;  2YL3 A;  5COF A;  3VRC A;  3S90 A;  2CYD A;  2YWA A;  2XS1 A;  3F47 A;  4PFP A;  2I8B A;  1Q0K A;  5DS4 A;  3L1M A;  3PMR A;  4NTF A;  3TJ6 A;  2WZF A;  1V74 B;  3IQ5 A;  3LLI A;  2Q7R A;  2IXO A;  4QDL A;  4JTD B;  2R7T A;  3MFN A;  2QE9 A;  2R7W A;  4MVS A;  3GWN A;  3JSE O;  3L8J A;  3NKE A;  5KYY A;  2PBE A;  1D0Z A;  2QNL A;  4W8P A;  3LAY A;  2TMV P;  1BR2 A;  4IAO A;  5E3A A;  3T6B A;  3TOL A;  3AG4 C;  3N0T A;  4U9E A;  2B0J A;  2HMQ A;  2AU5 A;  4G7H F;  4QI2 A;  1I4Y A;  2P7V A;  1OR3 A;  1NSG B;  3CAX A;  2YKZ A;  3ECS A;  2IXP A;  3EGX B;  4J7T A;  4LLE A;  3UNG C;  2DYS C;  4CJG A;  5HV9 A;  2HSQ A;  1C02 A;  4MW3 A;  1SR2 A;  2WB7 A;  3ZG1 A;  2XLH A;  1EKY A;  2P61 A;  4C3E A;  3O55 A;  4ZLC A;  1OKK D;  3IPM O;  1GGQ A;  2EIK C;  4JCZ A;  5COM A;  3C18 A;  3SYN A;  1MMD A;  3U0C A;  2GFH A;  2XLV A;  1HW1 A;  2PX0 A;  3SEO A;  5JT4 A;  5BUO A;  2BC5 A;  4EBB A;  1Z5Z A;  3U3B A;  2Y3H A;  5DS6 A;  4NTB A;  4E0I A;  1PD0 A;  4MS2 A;  1XZQ A;  1ZVZ A;  3EGD A;  4K0D A;  2PFD A;  1Z7Q c;  4UDV A;  1JAF A;  3CZ6 A;  3US6 A;  4ZLD A;  1C17 M;  2AWY A;  4N06 A;  1LI5 A;  4G78 A;  4DBR A;  5A6K A;  1V54 C;  2J7P D;  4YL1 A;  2DB4 A;  2X0C A;  3SXM A;  1ZHW A;  3DE8 A;  5HSW A;  4N4W A;  1NZE A;  1ZZP A;  3B29 A;  4XTK A;  3C8G D;  5T3W A;  1YVI A;  3FOP A;  2NUP A;  3G4Z A;  4ANJ A;  3OWT A;  1GS9 A;  3EQL F;  3PCV A;  2W4M A;  3EJN A;  4O6M A;  4CBE A;  1OW6 A;  2PX3 A;  5A6B D;  2ASR A;  2J9U A;  4JIO A;  3U8P A;  1YA9 A;  3IHU A;  3ZDL A;  4DOZ A;  5KYU B;  2A69 F;  3NKD A;  3QMK A;  4U5E E;  1OXK A;  3F46 A;  1M2O A;  1ZYR F;  3SZR A;  4AK9 A;  1ZW3 A;  2KW3 C;  5DQZ A;  3X2Q C;  2ZXO A;  3K7D A;  2WZG A;  3FOO A;  4J32 B;  2IOQ A;  1TWA A;  2F22 A;  4JEA A;  4Q7C A;  4KI2 A;  2DYR C;  1FNT c;  1OR2 A;  3ZSU A;  1M2V A;  3G50 A;  2R02 A;  2IBF A;  2QY9 A;  4WGZ A;  4DRH B;  3U2M A;  1RKE B;  1MND A;  4U9D A;  1KNY A;  4LER A;  3QVY A;  2YLI A;  1RKE A;  1UG7 A;  2HJM A;  2J9B A;  4WAB A;  3S27 A;  5L0J A;  4NC3 A;  4OIN F;  3S9O A;  2Q9B A;  4YT4 A;  4CS7 A;  4OIP F;  2PF4 E;  5JS5 A;  4B6I A;  2VC9 A;  3GM1 A;  3W2V A;  2J46 A;  1U89 A;  3C7J A;  4CSA C;  3GEE A;  4E7S A;  2HV7 A;  3NYJ A;  2YRF A;  1VTM P;  1E84 A;  4P9F A;  1BBH A;  2EPN A;  2WL8 A;  3RH3 A;  2J9W A;  3AG2 C;  3L8I A;  4BEM J;  1BR4 A;  2ZXW C;  2H7V C;  2J8W A;  3B0P A;  4OD4 A;  1YZA A;  1Q0F A;  4XEF A;  1RJ9 B;  5BQH A;  2BL2 A;  4JKV A;  5L0I A;  1NU7 D;  256B A;  3W8I A;  2AWC A;  2OU6 A;  4MVZ A;  4N6H A;  5D91 A;  4CS9 A;  1VYI A;  2L6G A;  4YWQ A;  2H7B A;  3FDQ A;  2R7R A;  4YL0 A;  3GOD A;  1YAU O;  3U2L A;  2Q9C A;  3T6G B;  2XM4 A;  3TJ5 A;  3DJN B;  3WHN A;  4IGG A;  5KYW A;  2R7X A;  1FFH A;  3GAN A;  4IAQ A;  2XL4 A;  1JPJ A;  4E17 A;  1VB5 A;  1O87 A;  3HNK A;  2OEX A;  4J7Y A;  5GPG B;  3B0V C;  3SXK A;  1W2W A;  4E18 A;  3GWL A;  1N1C A;  3ZVR A;  2XLW A;  2XRH A;  4M63 A;  3EH1 A;  1Z23 A;  2VH3 A;  2HJ3 A;  1C03 A;  2JX0 A;  5TJ5 E;  4JW1 A;  5EHH A;  1APC A;  4DJ9 A;  3TD7 A;  2LSE A;  4Q5S F;  2ETS A;  3U9M A;  4FES A;  4PR9 A;  4RBN A;  3NYM A;  1ZHY A;  3IQ6 A;  1Y6D A;  4BEJ A;  5JLI A;  3NRH A;  1DOW A;  1AUE A;  2L6H A;  3K6B A;  4ULV A;  1VK5 A;  1LS4 A;  3LJB A;  2A6E F;  4PJN A;  4MVQ A;  4YK5 A;  3U3F A;  1ORS C;  5KYX B;  4NTA A;  3EHN A;  3C62 A;  3DD7 A;  2Q9A A;  2IXM A; 
#chains in the Genus database with same CATH homology
 5JT4 A;  3C63 A;  2BC5 A;  2YL1 A;  1A7V A;  4JEB A;  4ER9 A;  1LM3 B;  2YL7 A;  1JAF A;  5B3I A;  3HNJ A;  2QLA A;  1GQA A;  1QPU A;  3DE8 A;  4N4W A;  1QQ3 A;  2XLE A;  3FOP A;  3M4C A;  4CJO A;  1CGN A;  3HNI A;  4D4N A;  3U8P A;  4IB4 A;  3FOO A;  4JEA A;  5JRA A;  1E86 A;  4WGZ A;  3TOM A;  3DE9 A;  3QW0 A;  1YYX A;  4U9D A;  3QVY A;  2YLI A;  4CX9 A;  3QW1 A;  1CPR A;  3NMJ A;  4JE9 A;  1M6T A;  1YZC A;  2J9B A;  4NC3 A;  4IAR A;  1S05 A;  4CDY A;  4L6R A;  1MQV A;  5JS5 A;  3ZTM A;  2XLD A;  3QVZ A;  2XLM A;  3ZWI A;  1YYJ A;  1E84 A;  2XL6 A;  1E85 A;  1BBH A;  1NBB A;  5AGF A;  3M15 A;  2J8W A;  2XL8 A;  1RCP A;  1YZA A;  3NMI A;  1CGO A;  4JKV A;  256B A;  3NMK A;  4CDV A;  5JP7 A;  4N6H A;  5JVE A;  3ZTZ A;  3HNL A;  2XLO A;  2XM0 A;  2YLG A;  2XM4 A;  5JSL A;  3ZQY A;  4IAQ A;  1E83 A;  2YL3 A;  3VRC A;  2YL0 A;  3HNK A;  4EIY A;  4D4X A;  3L1M A;  3IQ5 A;  2XLW A;  3M4B A;  1APC A;  3TOL A;  4U9E A;  4CDA A;  1CPQ A;  2YKZ A;  3IQ6 A;  3M79 A;  4CJG A;  4CIP A;  5JLI A;  2CCY A;  3ZQV A;  2XLH A;  4ULV A;  5JUA A;  1EKY A;  4WGY A;  2YLD A;  3C62 A;  2XLV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...