5JUAA

Nitric oxide complex of the l16i mutant of cytochrome c prime from alcaligenes xylosoxidans
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
126
structure length
126
Chain Sequence
EFAKPEDAVKYRQSAITLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Engineering proximal vs. distal heme-NO coordination via dinitrosyl dynamics: implications for NO sensor design.
pubmed doi rcsb
source organism Alcaligenes xylosoxydans xylosoxydans
molecule tags Electron transport
molecule keywords Cytochrome c'
total genus 49
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2016-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 5juaA00
1CPRA 3NMKA 3ZTMA 3C63A 4CDVA 3QW0A 2XLVA 4N4WA 2XLDA 4CJOA 3HNKA 5JS5A 3ZQYA 3QW1A 3DE8A 4NC3A 3NMIA 3L1MA 3FOOA 4N6HA 1YZAA 4ULVA 2YLGA 1E83A 2XLWA 1APCA 1YYXA 1YZCA 3ZWIA 1GQAA 1CPQA 4D4XA 1LM3B 3M4BA 4CDYA 1E84A 2YLIA 3IQ5A 3HNLA 5JVEA 2YLDA 3M15A 5B3IA 1EKYA 1QPUA 3TOLA 2BC5A 5JUAA 4JEAA 2YL7A 4JEBA 4WGYA 3ZTZA 5JLIA 2XL8A 3FOPA 3HNIA 2YL0A 2XLEA 4CIPA 256BA 4IAQA 1A7VA 3QVYA 2YL1A 2XLMA 4L6RA 2QLAA 2XLOA 3QVZA 1JAFA 3U8PA 5JT4A 1CGNA 4IB4A 4CJGA 2XM0A 1YYJA 5JSLA 5AGFA 2XLHA 2XL6A 1E85A 1S05A 4ER9A 5JRAA 3DE9A 1BBHA 2J9BA 5JP7A 4JKVA 4EIYA 4CDAA 1M6TA 3VRCA 3IQ6A 3HNJA 1CGOA 2J8WA 3ZQVA 4IARA 3M79A 2YKZA 3C62A 1RCPA 3NMJA 2XM4A 2YL3A 1E86A 1MQVA 4WGZA 4CX9A 4D4NA 4U9DA 3TOMA 1NBBA 2CCYA 4JE9A 3M4CA 4U9EA 1QQ3A
chains in the Genus database with same CATH superfamily
1Z63A 5KYXA 3UMIA 4OIQF 3KL4A 4AL1A 4FAPB 3O6XA 2L6FA 3NMKA 3RVZA 3F47A 4E0IA 4LACB 4ZLCA 2OCCC 3C63A 1T9KA 4CDVA 4E7ZA 4K1OA 4U5EE 4KBLA 1LS4A 4CBEA 3NDBB 3IPMO 2ICWG 3B71A 3DAFA 3W4YA 1SF8A 1V74B 4CJOA 2OOCA 4K7BA 3RF3A 2HJ3A 1OCOC 3T6GB 4MTOA 5F28E 4Z9JA 2WB7A 5DVWA 2LSEA 1S7ZA 3QW1A 3ZG1A 1VOMA 2VB6A 4NC3A 3J06A 3NMIA 5FZTA 1KU2A 2J7PA 3I4UA 3FOOA 2EPNA 3GM1A 3H65A 3LJBA 5COGA 4CS7A 1U89A 4DRHB 4CIHA 4C7OB 1YZAA 4C3BA 3FAPB 3JZ0A 2EPOA 3LLKA 4XQ1A 1H9GA 2L81A 1VMAA 1FNTc 2ZXWC 4AE4B 2LFFA 1EQ1A 1APCA 1YYXA 1LKXA 4YN0B 2JD3A 4G7HF 4XPYA 2ZD9A 4JIOA 4EIYA 4Q4ZF 1LM3B 3SXYA 1Q0FA 3S9OA 5B3SC 3IQ5A 3HNLA 5JVEA 2A0UA 1T6UA 2D5RB 2ZXPA 1Z3IX 2M64A 1Z5ZA 1AEPA 3GEEA 4XEFA 2NUTA 3TOLA 4BPMA 4KC9A 3AGUA 4DVYP 4PJLA 2HV7A 4MVSA 1M56C 3EZIA 4YL1A 3R2PA 1ZHWA 3AQBA 3K33A 1JR8A 4LLEA 1BDJB 2GA0A 3N0TA 3HNIA 2YL0A 3VYWA 1MNDA 3V5XA 2P61A 4JURI 4QDLA 4CIPA 256BA 1SZIA 5KYWA 1VTMP 1A7VA 1M2VB 2YL1A 4L6RA 4YK5A 3VAYA 2FAPB 2KC3A 3AG2C 1WN0A 3AOUA 2CYDA 1O5HA 2A0BA 3QVZA 4XLPF 3RQGA 4G0HA 1Z6AA 1BR1A 2EILC 2Y3BA 2OKUA 4HE8D 4RDAA 1T01A 3NYMA 4KI2A 1A7DA 3E9VA 4J30B 4DRIB 1VK5A 1QZXA 5JT4A 3DI5A 4A2NB 1XZQA 3WODF 1B68A 2LP4A 2OJED 1TR2A 1Q0GA 2DI3A 1ZHXA 3JRTA 5B1BC 1ZU5A 4OIOF 5DQTA 5AGFA 2Z15A 3GWNA 4LLCA 1YLMA 3EHMA 4AK9A 2FGYA 1E85A 1FFTC 3MX3A 4NTFA 4ER9A 1Q0KA 4MTFA 5L3QA 1O3UA 1A41A 1C02A 4MVMA 5BUOA 1HMOA 5FCLA 4W8KA 5BQIA 5KYUB 1K40A 4PFOA 3HNJA 2J7PD 4MNDA 2KW3C 5CI9A 3UGOA 1RJ9B 3A11A 2XL4A 2Q9CA 4IARA 3NYLA 3JTLO 2A68F 2J9VA 2YKZA 1OW6A 4MVOA 4UDVA 2R02A 2WZFA 1RCPA 1V55C 3I5PA 3R7CA 4DOZA 1Y4CA 4MTGA 3GORA 2YL3A 1E86A 3GWLA 3G50A 3VM6A 3JYHA 3LS0A 2XXAB 3ITFA 4R32A 3PDMP 4CSAA 1XZPA 3DKAA 3JSEO 3N2ZB 4DBRA 2RD9A 3DXJF 4XEVA 4MQ9F 1Y6DA 1QQ3A 3H2VA 3EQLF 2EPLX 5L0IA 5KYYB 1QSPA 3G4ZA 2YVKA 4Z9HA 2H8AA 1GM5A 3EGXA 2QUPA 4HFKB 2R7SA 1H7IA 4JCHA 2GAQA 4ANJA 1TWHA 2P1AA 3LNRA 1OXBA 3QMKA 1Q0MA 3L8JA 3O55A 1C03A 2FFHA 2HV6A 2O9XA 2OU6A 2J0WA 4H4KC 4CS9A 2LIGA 1MMNA 1OKKA 2IBFA 2PX0A 3EFOB 4GYTA 3HNKA 3U2MA 1NSGB 1QVXA 4AE4A 1JRAA 3C8GA 5A6JA 2V3CC 1VLTA 3SNHA 3ZQYA 2XS1A 3TJ6A 5EGYA 3UR3C 2PFDA 2BL2A 1MNEA 3BEHA 3ASOC 3ABMC 4JJFA 3JT1A 2IOQA 3UGPA 4N6HA 2J0XA 5K0IA 2YLGA 3LS1A 4NTBA 2J9UA 3NRHA 1OQCA 4PJMA 3WHNA 5BQHA 4JZAA 3B9QA 1ZZPA 5DS4A 2A1DD 1YZCA 2Q4FA 4J7TA 4MW3A 5A6KA 4OINF 2EINC 3AG3C 2R7VA 1CPQA 2MWQA 1D1CA 4D4XA 2MHRA 1KTMA 2A6HF 2F22A 3V7OA 1E84A 1D0XA 1JOGA 1UG7A 1WGWA 4C7OA 3BRJA 2YLDA 2Q9BA 3HKKA 1G8XA 1ZU4A 2WZLA 2HMQA 1IZMA 2H7OA 5JUAA 4G78A 4JEAA 2ZXOA 2H7BA 2YL7A 3U5SA 5KYNA 1D0ZA 1U0BB 1M2OA 3FOPA 2ZXRA 2DGJA 4KNWA 1L3PA 3DM5A 2NSGA 2L6GA 1J8YF 3KMIA 3QTHA 4G7OF 1ST6A 5CIVA 5T3WA 4BJ5A 1LVKA 3RW0A 1RJ9A 1EI7A 2C04A 4PK4A 5F5FA 3MLGA 2QLAA 4JW1A 4DXWA 4EBKA 1TFOB 4PACA 2PNOA 1L7CA 1JAFA 4CS8A 3EGDA 1DOVA 2XRHA 5IY5C 3GM3A 2L6HA 4O6NA 3JCUQ 5COFA 3T6JA 1NFNA 4EWCA 1HMDA 4WJ0A 1MMAA 4BEJA 4CJGA 2YWAA 5A69A 3DJUB 3ZDLA 4DVZA 2YZSA 3CEXA 4LDKA 2R7WA 1RMVA 3Q7LA 1BR2A 4YL0A 2XL6A 5L0HA 1F1MA 4FWVA 2NG1A 2PBEA 1IW7F 4F4BA 3DE9A 5JRAA 2E87A 1K04A 5JP7A 5KYUA 2R7XA 3LEVA 3GEIA 3N24A 3AGTA 4IRUA 4NY3A 1M6TA 2HUJA 2PP4A 4OIRF 2WVQA 3VRCA 2AP3A 1FFHA 3LAYA 3IQ6A 3DZAA 3V5ZA 4DRJB 4H54A 4BJ1A 1I4ZA 4YT2A 4KNVA 3V5YA 2J8WA 3ZQVA 4LDRA 2ETSA 2RSEB 4O6YA 1A0BA 1BZ4A 1SYQA 3OA1A 1QLEC 4MVZA 4BJ5C 2VCAA 3EG9A 2R7RA 2J45A 3Q7GA 1ORYA 3LESA 1LE2A 3NKDA 2XSEA 3CAXA 4E18A 5HSWA 4QI2A 4WABA 4WGZA 3S0XA 4D4NA 2BE5F 1YA7O 1KNYA 2VASA 1RXQA 2CCYA 3L34A 4I3MA 2R7QA 1FMWA 2GWWA 4O6MA 1FMVA 3A9CA 2M4EA 3LLIA 3S28A 4J7YA 4JRZA 5KYWB 3HTKC 1ZHYA 3S29A 3DM9B 2EPKX 1LI7A 2QE9A 3DD7A 1ZW2A 1CPRA 4DBQA 1LPEA 4EKWA 3ZTMA 4E0HA 3RKOF 2R05A 3B0UX 4MS2A 3EGXB 1HW2A 4NTAA 1JMWA 4E7SA 3RVYA 4A4AA 4HEAJ 1RKEA 4MVUA 1OCZC 5E33A 3TQOA 2KGOA 1TWGA 2NUTB 3C8GD 3QW0A 4RD9A 2XLVA 1R4TA 1U6HA 1WOLA 1UFBA 2P0NA 2XLDA 4N4WA 4O79A 4B6IA 1D1BA 4X0RA 2HFIA 3WG7C 2R7TA 2JPUA 2NPUA 3AG1C 2Y3HA 3IEEA 2X0CA 3KPHA 4MVQA 2G62A 1TWCA 3EH1A 5E2QA 1OXKA 3DE8A 3RH3A 2EIMC 4U5FE 2DYSC 3EH2A 1QKRA 2DB4A 3L1MA 3JRMO 3C18A 3KKBA 3B29A 2WL8A 2Y3DA 2VCCA 3FDQA 1TFKB 3C7JA 3MFNA 2C03A 4O7GA 3EGDB 4JTCB 4U5BE 4CSAC 4XEKA 3ZIBA 3FVYA 4U5DE 5HV9A 3TJ5A 3DWWA 3ECSA 4MVRA 5BQGA 3S84A 1G4WR 3W2VA 2CGEA 3AG4C 2P6VA 1G5ZA 3M15A 3PMRA 4HFFB 4K0DA 1QPUA 4JTAB 4N6CA 4U5CE 3RYLA 5T3TA 5B3IA 2BC5A 2Y69C 3NG1A 5L0DA 1T6QA 3S90A 2YRFA 3VF0A 3FHDA 2L7AA 3M4CA 2LK4A 1LI5A 3UMKA 2LFDA 3UNGC 4WGYA 1FAPB 1D1AA 3ZTZA 5JLIA 4I1MA 3K6BA 2WVNA 3ZC4A 2VCBA 4IAOA 1E2XA 4PJNA 3US6A 4LDQA 3GEHA 3T4RA 1K05A 3IQCA 3O39A 4YL3A 3E70C 4IAQA 4Z9IA 3U9JA 4M63A 2PX3A 4OD5A 1H9TA 5COMA 1JPJA 4BJTA 5L0CA 5B1AC 2TMVP 4N06A 1YAUO 4P9TA 3RFYA 1Q0DA 3Q6NA 1YVIA 4FX5A 2EIJC 1NFOA 1CGNA 3KH2A 3QZCA 3ASNC 1SMYF 4IB4A 3K1IC 3L8IA 4JCZA 1VYIA 4P6IC 3NKEA 2Q00A 1YYJA 5JSLA 3PCVA 1T5OA 2HSBA 2ASRA 2IM8A 2Y39A 4I1OB 5A6BA 4G7ZF 2QTVA 2IXOA 1ZYRF 3W8IA 1S05A 1ORSC 1YDIA 1SR2A 4NQFA 4YT5A 3UMHA 3EZHA 2W4BA 1BBHA 1T6IA 2J9BA 2YQYA 5T1DB 1PD1A 4AX2A 4Q7CA 4C3DA 1C17M 1JPNA 3SXMA 2R7OA 3X2QC 3L0IA 4ULWA 4YT8A 4MW8A 3JYYA 4PFPA 4BG0A 1WASA 4DJ9A 2W45A 1CGOA 3K7DA 4YJWA 5D91A 3SEOA 4P9FA 4QI0A 3T6BA 1YJGA 3LNMB 2LCHA 1M57C 1MMDA 3T9OA 4AL0A 2HZ8A 2G3VA 1GS9A 2L9JA 2KK1A 3EFOA 1EA8A 4LERA 4XPWA 2DYRC 1ZHZA 2UUHA 4IJJA 4XPXA 3PHF2 5KYYA 2OG2A 2V26A 4JC7A 4CX9A 2H7VC 1ZW3A 5EHHA 5TJ5E 1H6GA 3MBGA 2A69F 5DS6A 2GDCA 2WZGA 3RQFA 5E3CA 1OW7A 3W8HA 3ZSUA 5F5HA 2NUPB 3POVA 1DOWA 4EUKB 2J46A 5AC4A 1FTSA 3I5QA 3DJNB 3SYNA 3U2LA 2IXNA 1LS1A 2Q9AA 1HY5A 2KNHA 3IHUA 2R7UA 1NG1A 2LQGA 2A6EF 2OEXA 1PD0A 2EPMX 2PF4E 4PR9A 2W9YA 1HW1A 5EK0A 3U3FA 5L0FA 5DQZA 1ZHTA 1G4US 1ORJA 3EPVA 4OD4A 1AVOB 2OQMA 2UUIA 2VH3A 3TK0A 1D0YA 3B0VC 5CI8A 1LE4A 5AC5A 5A6AA 4ONSA 4Q5SF 5JS5A 2P7VA 2IYLD 2JX0A 2I8BA 3KYIA 2R03A 2YHSA 3TD7A 1PCXA 3U9MA 1R5ID 5GPGB 3CZ6A 1BR4A 4I44A 1Z7Qc 1WATA 3G4XA 5L3VA 4ULVA 2NUPA 4CS8C 1E83A 1AUEA 2Q3TA 2XLWA 2GFHA 5D92A 3O10A 2HS5A 2B0HA 4W8PA 2D4UA 3ZWIA 3ATPA 1GQAA 3U0CA 3GANA 5L0GA 2G3KA 4YT4A 1OCCC 1NU7D 3K1HA 1OW8A 1YARO 3M4BA 4JJGA 3U8VA 4CDYA 2YLIA 3WAQA 1VB5A 2I15A 2ZPAA 4ZLDA 1EKYA 2EIKC 1YA9A 1LIHA 1M2VA 3ZVRA 4JVSA 1WWPA 4XLNF 1HE1A 1PV3A 1RKCA 3ABKC 1Z23A 3AJMA 1HE9A 1J8MF 1N1CA 1NLXA 1TWAA 3C8GB 3LUTB 2XL8A 4JEBA 4J32B 4U5GA 1MMGA 1W2WA 3MYFA 2VC9A 2XLEA 3RIPA 2AWYA 2OJQA 5DS5A 3EJNA 3QVYA 3C8ZA 4XTKA 3CSKA 4FESA 2XLMA 2W4MA 3B0PA 3U3BA 2AWCA 2IXPA 3MYIA 3W2WA 1I4YA 2XLOA 4XWJA 1I5NA 3GODA 3EG9B 2XS8A 2LD6A 3ABLC 3U8PA 3EHNA 4E17A 3HLZA 2OEVA 3S27A 2KYHA 5A6BD 2HKVA 2WVOA 2XM0A 3LEOA 3KYJA 2CW0F 5DLJA 3DAGA 1OR2A 2QNLA 3AQCA 3OEOA 1CGME 2XLHA 2HMZA 2YEVA 3X1OA 4PJJA 2KSFA 1OCRC 2AVKA 1TKNA 2KQ9A 2Y3GA 4C3EA 1A7EA 2R9RB 2MYSA 3JSZA 2IXMA 2KJGA 3HJCA 4BJ6A 1GGQA 1NU9C 2J9WA 3K1IA 2CNWA 3RQEA 4JKVA 3SZRA 4CS9C 4U5HA 4CDAA 2CNWD 4NCQA 4BEMJ 2HJMA 5E3AA 1V4AA 5L0JA 3IQTA 3FXHA 4EBBA 1NZEA 1TQGA 1O87A 3FAJA 2B0JA 3M79A 1FR0A 2QY9A 2NSFA 3C62A 3M1CB 4BJ6C 1WTYA 3K66A 2AU5A 3CQZA 2Q7RA 4EHPA 3TULA 1VLSA 2HSQA 3NMJA 5KYXB 2X51A 3GM2A 2XM4A 3Q6MA 1XWJA 3H2UA 4GQHA 3SXZA 2R25A 3SXKA 2CDQA 3DMDA 1MQVA 4IWBA 4IGGA 4OIPF 4GEHA 1OKKD 4JTDB 4U9DA 4YWQA 3TOMA 3NYJA 1NBBA 3FMSA 3SP1A 1VYKA 3OWTA 2XXAA 1V54C 4JE9A 1OR3A 4EBJA 3F46A 4U9EA 1RKEB 1ZVZA 4RBNA
chains in the Genus database with same CATH topology
1CPRA 3NMKA 3ZTMA 3C63A 4CDVA 3QW0A 2XLVA 4N4WA 2XLDA 4CJOA 3HNKA 5JS5A 3ZQYA 3QW1A 3DE8A 4NC3A 3NMIA 3L1MA 3FOOA 4N6HA 1YZAA 4ULVA 2YLGA 1E83A 2XLWA 1APCA 1YYXA 1YZCA 3ZWIA 1GQAA 1CPQA 4D4XA 1LM3B 3M4BA 4CDYA 1E84A 2YLIA 3IQ5A 3HNLA 5JVEA 2YLDA 3M15A 5B3IA 1EKYA 1QPUA 3TOLA 2BC5A 5JUAA 4JEAA 2YL7A 4JEBA 4WGYA 3ZTZA 5JLIA 2XL8A 3FOPA 3HNIA 2YL0A 2XLEA 4CIPA 256BA 4IAQA 1A7VA 3QVYA 2YL1A 2XLMA 4L6RA 2QLAA 2XLOA 3QVZA 1JAFA 3U8PA 5JT4A 1CGNA 4IB4A 4CJGA 2XM0A 1YYJA 5JSLA 5AGFA 2XLHA 2XL6A 1E85A 1S05A 4ER9A 5JRAA 3DE9A 1BBHA 2J9BA 5JP7A 4JKVA 4EIYA 4CDAA 1M6TA 3VRCA 3IQ6A 3HNJA 1CGOA 2J8WA 3ZQVA 4IARA 3M79A 2YKZA 3C62A 1RCPA 3NMJA 2XM4A 2YL3A 1E86A 1MQVA 4WGZA 4CX9A 4D4NA 4U9DA 3TOMA 1NBBA 2CCYA 4JE9A 3M4CA 4U9EA 1QQ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CPR A;  3NMK A;  3ZTM A;  3C63 A;  4CDV A;  3QW0 A;  2XLV A;  4N4W A;  2XLD A;  4CJO A;  3HNK A;  5JS5 A;  3ZQY A;  3QW1 A;  3DE8 A;  4NC3 A;  3NMI A;  3L1M A;  3FOO A;  4N6H A;  1YZA A;  4ULV A;  2YLG A;  1E83 A;  2XLW A;  1APC A;  1YYX A;  1YZC A;  3ZWI A;  1GQA A;  1CPQ A;  4D4X A;  1LM3 B;  3M4B A;  4CDY A;  1E84 A;  2YLI A;  3IQ5 A;  3HNL A;  5JVE A;  2YLD A;  3M15 A;  5B3I A;  1EKY A;  1QPU A;  3TOL A;  2BC5 A;  5JUA A;  4JEA A;  2YL7 A;  4JEB A;  4WGY A;  3ZTZ A;  5JLI A;  2XL8 A;  3FOP A;  3HNI A;  2YL0 A;  2XLE A;  4CIP A;  256B A;  4IAQ A;  1A7V A;  3QVY A;  2YL1 A;  2XLM A;  4L6R A;  2QLA A;  2XLO A;  3QVZ A;  1JAF A;  3U8P A;  5JT4 A;  1CGN A;  4IB4 A;  4CJG A;  2XM0 A;  1YYJ A;  5JSL A;  5AGF A;  2XLH A;  2XL6 A;  1E85 A;  1S05 A;  4ER9 A;  5JRA A;  3DE9 A;  1BBH A;  2J9B A;  5JP7 A;  4JKV A;  4EIY A;  4CDA A;  1M6T A;  3VRC A;  3IQ6 A;  3HNJ A;  1CGO A;  2J8W A;  3ZQV A;  4IAR A;  3M79 A;  2YKZ A;  3C62 A;  1RCP A;  3NMJ A;  2XM4 A;  2YL3 A;  1E86 A;  1MQV A;  4WGZ A;  4CX9 A;  4D4N A;  4U9D A;  3TOM A;  1NBB A;  2CCY A;  4JE9 A;  3M4C A;  4U9E A;  1QQ3 A; 
#chains in the Genus database with same CATH topology
 1Z63 A;  5KYX A;  3UMI A;  4OIQ F;  3KL4 A;  4AL1 A;  4FAP B;  3O6X A;  2L6F A;  3NMK A;  3RVZ A;  3F47 A;  4E0I A;  4LAC B;  4ZLC A;  2OCC C;  3C63 A;  1T9K A;  4CDV A;  4E7Z A;  4K1O A;  4U5E E;  4KBL A;  1LS4 A;  4CBE A;  3NDB B;  3IPM O;  2ICW G;  3B71 A;  3DAF A;  3W4Y A;  1SF8 A;  1V74 B;  4CJO A;  2OOC A;  4K7B A;  3RF3 A;  2HJ3 A;  1OCO C;  3T6G B;  4MTO A;  5F28 E;  4Z9J A;  2WB7 A;  5DVW A;  2LSE A;  1S7Z A;  3QW1 A;  3ZG1 A;  1VOM A;  2VB6 A;  4NC3 A;  3J06 A;  3NMI A;  5FZT A;  1KU2 A;  2J7P A;  3I4U A;  3FOO A;  2EPN A;  3GM1 A;  3H65 A;  3LJB A;  5COG A;  4CS7 A;  1U89 A;  4DRH B;  4CIH A;  4C7O B;  1YZA A;  4C3B A;  3FAP B;  3JZ0 A;  2EPO A;  3LLK A;  4XQ1 A;  1H9G A;  2L81 A;  1VMA A;  1FNT c;  2ZXW C;  4AE4 B;  2LFF A;  1EQ1 A;  1APC A;  1YYX A;  1LKX A;  4YN0 B;  2JD3 A;  4G7H F;  4XPY A;  2ZD9 A;  4JIO A;  4EIY A;  4Q4Z F;  1LM3 B;  3SXY A;  1Q0F A;  3S9O A;  5B3S C;  3IQ5 A;  3HNL A;  5JVE A;  2A0U A;  1T6U A;  2D5R B;  2ZXP A;  1Z3I X;  2M64 A;  1Z5Z A;  1AEP A;  3GEE A;  4XEF A;  2NUT A;  3TOL A;  4BPM A;  4KC9 A;  3AGU A;  4DVY P;  4PJL A;  2HV7 A;  4MVS A;  1M56 C;  3EZI A;  4YL1 A;  3R2P A;  1ZHW A;  3AQB A;  3K33 A;  1JR8 A;  4LLE A;  1BDJ B;  2GA0 A;  3N0T A;  3HNI A;  2YL0 A;  3VYW A;  1MND A;  3V5X A;  2P61 A;  4JUR I;  4QDL A;  4CIP A;  256B A;  1SZI A;  5KYW A;  1VTM P;  1A7V A;  1M2V B;  2YL1 A;  4L6R A;  4YK5 A;  3VAY A;  2FAP B;  2KC3 A;  3AG2 C;  1WN0 A;  3AOU A;  2CYD A;  1O5H A;  2A0B A;  3QVZ A;  4XLP F;  3RQG A;  4G0H A;  1Z6A A;  1BR1 A;  2EIL C;  2Y3B A;  2OKU A;  4HE8 D;  4RDA A;  1T01 A;  3NYM A;  4KI2 A;  1A7D A;  3E9V A;  4J30 B;  4DRI B;  1VK5 A;  1QZX A;  5JT4 A;  3DI5 A;  4A2N B;  1XZQ A;  3WOD F;  1B68 A;  2LP4 A;  2OJE D;  1TR2 A;  1Q0G A;  2DI3 A;  1ZHX A;  3JRT A;  5B1B C;  1ZU5 A;  4OIO F;  5DQT A;  5AGF A;  2Z15 A;  3GWN A;  4LLC A;  1YLM A;  3EHM A;  4AK9 A;  2FGY A;  1E85 A;  1FFT C;  3MX3 A;  4NTF A;  4ER9 A;  1Q0K A;  4MTF A;  5L3Q A;  1O3U A;  1A41 A;  1C02 A;  4MVM A;  5BUO A;  1HMO A;  5FCL A;  4W8K A;  5BQI A;  5KYU B;  1K40 A;  4PFO A;  3HNJ A;  2J7P D;  4MND A;  2KW3 C;  5CI9 A;  3UGO A;  1RJ9 B;  3A11 A;  2XL4 A;  2Q9C A;  4IAR A;  3NYL A;  3JTL O;  2A68 F;  2J9V A;  2YKZ A;  1OW6 A;  4MVO A;  4UDV A;  2R02 A;  2WZF A;  1RCP A;  1V55 C;  3I5P A;  3R7C A;  4DOZ A;  1Y4C A;  4MTG A;  3GOR A;  2YL3 A;  1E86 A;  3GWL A;  3G50 A;  3VM6 A;  3JYH A;  3LS0 A;  2XXA B;  3ITF A;  4R32 A;  3PDM P;  4CSA A;  1XZP A;  3DKA A;  3JSE O;  3N2Z B;  4DBR A;  2RD9 A;  3DXJ F;  4XEV A;  4MQ9 F;  1Y6D A;  1QQ3 A;  3H2V A;  3EQL F;  2EPL X;  5L0I A;  5KYY B;  1QSP A;  3G4Z A;  2YVK A;  4Z9H A;  2H8A A;  1GM5 A;  3EGX A;  2QUP A;  4HFK B;  2R7S A;  1H7I A;  4JCH A;  2GAQ A;  4ANJ A;  1TWH A;  2P1A A;  3LNR A;  1OXB A;  3QMK A;  1Q0M A;  3L8J A;  3O55 A;  1C03 A;  2FFH A;  2HV6 A;  2O9X A;  2OU6 A;  2J0W A;  4H4K C;  4CS9 A;  2LIG A;  1MMN A;  1OKK A;  2IBF A;  2PX0 A;  3EFO B;  4GYT A;  3HNK A;  3U2M A;  1NSG B;  1QVX A;  4AE4 A;  1JRA A;  3C8G A;  5A6J A;  2V3C C;  1VLT A;  3SNH A;  3ZQY A;  2XS1 A;  3TJ6 A;  5EGY A;  3UR3 C;  2PFD A;  2BL2 A;  1MNE A;  3BEH A;  3ASO C;  3ABM C;  4JJF A;  3JT1 A;  2IOQ A;  3UGP A;  4N6H A;  2J0X A;  5K0I A;  2YLG A;  3LS1 A;  4NTB A;  2J9U A;  3NRH A;  1OQC A;  4PJM A;  3WHN A;  5BQH A;  4JZA A;  3B9Q A;  1ZZP A;  5DS4 A;  2A1D D;  1YZC A;  2Q4F A;  4J7T A;  4MW3 A;  5A6K A;  4OIN F;  2EIN C;  3AG3 C;  2R7V A;  1CPQ A;  2MWQ A;  1D1C A;  4D4X A;  2MHR A;  1KTM A;  2A6H F;  2F22 A;  3V7O A;  1E84 A;  1D0X A;  1JOG A;  1UG7 A;  1WGW A;  4C7O A;  3BRJ A;  2YLD A;  2Q9B A;  3HKK A;  1G8X A;  1ZU4 A;  2WZL A;  2HMQ A;  1IZM A;  2H7O A;  5JUA A;  4G78 A;  4JEA A;  2ZXO A;  2H7B A;  2YL7 A;  3U5S A;  5KYN A;  1D0Z A;  1U0B B;  1M2O A;  3FOP A;  2ZXR A;  2DGJ A;  4KNW A;  1L3P A;  3DM5 A;  2NSG A;  2L6G A;  1J8Y F;  3KMI A;  3QTH A;  4G7O F;  1ST6 A;  5CIV A;  5T3W A;  4BJ5 A;  1LVK A;  3RW0 A;  1RJ9 A;  1EI7 A;  2C04 A;  4PK4 A;  5F5F A;  3MLG A;  2QLA A;  4JW1 A;  4DXW A;  4EBK A;  1TFO B;  4PAC A;  2PNO A;  1L7C A;  1JAF A;  4CS8 A;  3EGD A;  1DOV A;  2XRH A;  5IY5 C;  3GM3 A;  2L6H A;  4O6N A;  3JCU Q;  5COF A;  3T6J A;  1NFN A;  4EWC A;  1HMD A;  4WJ0 A;  1MMA A;  4BEJ A;  4CJG A;  2YWA A;  5A69 A;  3DJU B;  3ZDL A;  4DVZ A;  2YZS A;  3CEX A;  4LDK A;  2R7W A;  1RMV A;  3Q7L A;  1BR2 A;  4YL0 A;  2XL6 A;  5L0H A;  1F1M A;  4FWV A;  2NG1 A;  2PBE A;  1IW7 F;  4F4B A;  3DE9 A;  5JRA A;  2E87 A;  1K04 A;  5JP7 A;  5KYU A;  2R7X A;  3LEV A;  3GEI A;  3N24 A;  3AGT A;  4IRU A;  4NY3 A;  1M6T A;  2HUJ A;  2PP4 A;  4OIR F;  2WVQ A;  3VRC A;  2AP3 A;  1FFH A;  3LAY A;  3IQ6 A;  3DZA A;  3V5Z A;  4DRJ B;  4H54 A;  4BJ1 A;  1I4Z A;  4YT2 A;  4KNV A;  3V5Y A;  2J8W A;  3ZQV A;  4LDR A;  2ETS A;  2RSE B;  4O6Y A;  1A0B A;  1BZ4 A;  1SYQ A;  3OA1 A;  1QLE C;  4MVZ A;  4BJ5 C;  2VCA A;  3EG9 A;  2R7R A;  2J45 A;  3Q7G A;  1ORY A;  3LES A;  1LE2 A;  3NKD A;  2XSE A;  3CAX A;  4E18 A;  5HSW A;  4QI2 A;  4WAB A;  4WGZ A;  3S0X A;  4D4N A;  2BE5 F;  1YA7 O;  1KNY A;  2VAS A;  1RXQ A;  2CCY A;  3L34 A;  4I3M A;  2R7Q A;  1FMW A;  2GWW A;  4O6M A;  1FMV A;  3A9C A;  2M4E A;  3LLI A;  3S28 A;  4J7Y A;  4JRZ A;  5KYW B;  3HTK C;  1ZHY A;  3S29 A;  3DM9 B;  2EPK X;  1LI7 A;  2QE9 A;  3DD7 A;  1ZW2 A;  1CPR A;  4DBQ A;  1LPE A;  4EKW A;  3ZTM A;  4E0H A;  3RKO F;  2R05 A;  3B0U X;  4MS2 A;  3EGX B;  1HW2 A;  4NTA A;  1JMW A;  4E7S A;  3RVY A;  4A4A A;  4HEA J;  1RKE A;  4MVU A;  1OCZ C;  5E33 A;  3TQO A;  2KGO A;  1TWG A;  2NUT B;  3C8G D;  3QW0 A;  4RD9 A;  2XLV A;  1R4T A;  1U6H A;  1WOL A;  1UFB A;  2P0N A;  2XLD A;  4N4W A;  4O79 A;  4B6I A;  1D1B A;  4X0R A;  2HFI A;  3WG7 C;  2R7T A;  2JPU A;  2NPU A;  3AG1 C;  2Y3H A;  3IEE A;  2X0C A;  3KPH A;  4MVQ A;  2G62 A;  1TWC A;  3EH1 A;  5E2Q A;  1OXK A;  3DE8 A;  3RH3 A;  2EIM C;  4U5F E;  2DYS C;  3EH2 A;  1QKR A;  2DB4 A;  3L1M A;  3JRM O;  3C18 A;  3KKB A;  3B29 A;  2WL8 A;  2Y3D A;  2VCC A;  3FDQ A;  1TFK B;  3C7J A;  3MFN A;  2C03 A;  4O7G A;  3EGD B;  4JTC B;  4U5B E;  4CSA C;  4XEK A;  3ZIB A;  3FVY A;  4U5D E;  5HV9 A;  3TJ5 A;  3DWW A;  3ECS A;  4MVR A;  5BQG A;  3S84 A;  1G4W R;  3W2V A;  2CGE A;  3AG4 C;  2P6V A;  1G5Z A;  3M15 A;  3PMR A;  4HFF B;  4K0D A;  1QPU A;  4JTA B;  4N6C A;  4U5C E;  3RYL A;  5T3T A;  5B3I A;  2BC5 A;  2Y69 C;  3NG1 A;  5L0D A;  1T6Q A;  3S90 A;  2YRF A;  3VF0 A;  3FHD A;  2L7A A;  3M4C A;  2LK4 A;  1LI5 A;  3UMK A;  2LFD A;  3UNG C;  4WGY A;  1FAP B;  1D1A A;  3ZTZ A;  5JLI A;  4I1M A;  3K6B A;  2WVN A;  3ZC4 A;  2VCB A;  4IAO A;  1E2X A;  4PJN A;  3US6 A;  4LDQ A;  3GEH A;  3T4R A;  1K05 A;  3IQC A;  3O39 A;  4YL3 A;  3E70 C;  4IAQ A;  4Z9I A;  3U9J A;  4M63 A;  2PX3 A;  4OD5 A;  1H9T A;  5COM A;  1JPJ A;  4BJT A;  5L0C A;  5B1A C;  2TMV P;  4N06 A;  1YAU O;  4P9T A;  3RFY A;  1Q0D A;  3Q6N A;  1YVI A;  4FX5 A;  2EIJ C;  1NFO A;  1CGN A;  3KH2 A;  3QZC A;  3ASN C;  1SMY F;  4IB4 A;  3K1I C;  3L8I A;  4JCZ A;  1VYI A;  4P6I C;  3NKE A;  2Q00 A;  1YYJ A;  5JSL A;  3PCV A;  1T5O A;  2HSB A;  2ASR A;  2IM8 A;  2Y39 A;  4I1O B;  5A6B A;  4G7Z F;  2QTV A;  2IXO A;  1ZYR F;  3W8I A;  1S05 A;  1ORS C;  1YDI A;  1SR2 A;  4NQF A;  4YT5 A;  3UMH A;  3EZH A;  2W4B A;  1BBH A;  1T6I A;  2J9B A;  2YQY A;  5T1D B;  1PD1 A;  4AX2 A;  4Q7C A;  4C3D A;  1C17 M;  1JPN A;  3SXM A;  2R7O A;  3X2Q C;  3L0I A;  4ULW A;  4YT8 A;  4MW8 A;  3JYY A;  4PFP A;  4BG0 A;  1WAS A;  4DJ9 A;  2W45 A;  1CGO A;  3K7D A;  4YJW A;  5D91 A;  3SEO A;  4P9F A;  4QI0 A;  3T6B A;  1YJG A;  3LNM B;  2LCH A;  1M57 C;  1MMD A;  3T9O A;  4AL0 A;  2HZ8 A;  2G3V A;  1GS9 A;  2L9J A;  2KK1 A;  3EFO A;  1EA8 A;  4LER A;  4XPW A;  2DYR C;  1ZHZ A;  2UUH A;  4IJJ A;  4XPX A;  3PHF 2;  5KYY A;  2OG2 A;  2V26 A;  4JC7 A;  4CX9 A;  2H7V C;  1ZW3 A;  5EHH A;  5TJ5 E;  1H6G A;  3MBG A;  2A69 F;  5DS6 A;  2GDC A;  2WZG A;  3RQF A;  5E3C A;  1OW7 A;  3W8H A;  3ZSU A;  5F5H A;  2NUP B;  3POV A;  1DOW A;  4EUK B;  2J46 A;  5AC4 A;  1FTS A;  3I5Q A;  3DJN B;  3SYN A;  3U2L A;  2IXN A;  1LS1 A;  2Q9A A;  1HY5 A;  2KNH A;  3IHU A;  2R7U A;  1NG1 A;  2LQG A;  2A6E F;  2OEX A;  1PD0 A;  2EPM X;  2PF4 E;  4PR9 A;  2W9Y A;  1HW1 A;  5EK0 A;  3U3F A;  5L0F A;  5DQZ A;  1ZHT A;  1G4U S;  1ORJ A;  3EPV A;  4OD4 A;  1AVO B;  2OQM A;  2UUI A;  2VH3 A;  3TK0 A;  1D0Y A;  3B0V C;  5CI8 A;  1LE4 A;  5AC5 A;  5A6A A;  4ONS A;  4Q5S F;  5JS5 A;  2P7V A;  2IYL D;  2JX0 A;  2I8B A;  3KYI A;  2R03 A;  2YHS A;  3TD7 A;  1PCX A;  3U9M A;  1R5I D;  5GPG B;  3CZ6 A;  1BR4 A;  4I44 A;  1Z7Q c;  1WAT A;  3G4X A;  5L3V A;  4ULV A;  2NUP A;  4CS8 C;  1E83 A;  1AUE A;  2Q3T A;  2XLW A;  2GFH A;  5D92 A;  3O10 A;  2HS5 A;  2B0H A;  4W8P A;  2D4U A;  3ZWI A;  3ATP A;  1GQA A;  3U0C A;  3GAN A;  5L0G A;  2G3K A;  4YT4 A;  1OCC C;  1NU7 D;  3K1H A;  1OW8 A;  1YAR O;  3M4B A;  4JJG A;  3U8V A;  4CDY A;  2YLI A;  3WAQ A;  1VB5 A;  2I15 A;  2ZPA A;  4ZLD A;  1EKY A;  2EIK C;  1YA9 A;  1LIH A;  1M2V A;  3ZVR A;  4JVS A;  1WWP A;  4XLN F;  1HE1 A;  1PV3 A;  1RKC A;  3ABK C;  1Z23 A;  3AJM A;  1HE9 A;  1J8M F;  1N1C A;  1NLX A;  1TWA A;  3C8G B;  3LUT B;  2XL8 A;  4JEB A;  4J32 B;  4U5G A;  1MMG A;  1W2W A;  3MYF A;  2VC9 A;  2XLE A;  3RIP A;  2AWY A;  2OJQ A;  5DS5 A;  3EJN A;  3QVY A;  3C8Z A;  4XTK A;  3CSK A;  4FES A;  2XLM A;  2W4M A;  3B0P A;  3U3B A;  2AWC A;  2IXP A;  3MYI A;  3W2W A;  1I4Y A;  2XLO A;  4XWJ A;  1I5N A;  3GOD A;  3EG9 B;  2XS8 A;  2LD6 A;  3ABL C;  3U8P A;  3EHN A;  4E17 A;  3HLZ A;  2OEV A;  3S27 A;  2KYH A;  5A6B D;  2HKV A;  2WVO A;  2XM0 A;  3LEO A;  3KYJ A;  2CW0 F;  5DLJ A;  3DAG A;  1OR2 A;  2QNL A;  3AQC A;  3OEO A;  1CGM E;  2XLH A;  2HMZ A;  2YEV A;  3X1O A;  4PJJ A;  2KSF A;  1OCR C;  2AVK A;  1TKN A;  2KQ9 A;  2Y3G A;  4C3E A;  1A7E A;  2R9R B;  2MYS A;  3JSZ A;  2IXM A;  2KJG A;  3HJC A;  4BJ6 A;  1GGQ A;  1NU9 C;  2J9W A;  3K1I A;  2CNW A;  3RQE A;  4JKV A;  3SZR A;  4CS9 C;  4U5H A;  4CDA A;  2CNW D;  4NCQ A;  4BEM J;  2HJM A;  5E3A A;  1V4A A;  5L0J A;  3IQT A;  3FXH A;  4EBB A;  1NZE A;  1TQG A;  1O87 A;  3FAJ A;  2B0J A;  3M79 A;  1FR0 A;  2QY9 A;  2NSF A;  3C62 A;  3M1C B;  4BJ6 C;  1WTY A;  3K66 A;  2AU5 A;  3CQZ A;  2Q7R A;  4EHP A;  3TUL A;  1VLS A;  2HSQ A;  3NMJ A;  5KYX B;  2X51 A;  3GM2 A;  2XM4 A;  3Q6M A;  1XWJ A;  3H2U A;  4GQH A;  3SXZ A;  2R25 A;  3SXK A;  2CDQ A;  3DMD A;  1MQV A;  4IWB A;  4IGG A;  4OIP F;  4GEH A;  1OKK D;  4JTD B;  4U9D A;  4YWQ A;  3TOM A;  3NYJ A;  1NBB A;  3FMS A;  3SP1 A;  1VYK A;  3OWT A;  2XXA A;  1V54 C;  4JE9 A;  1OR3 A;  4EBJ A;  3F46 A;  4U9E A;  1RKE B;  1ZVZ A;  4RBN A; 
#chains in the Genus database with same CATH homology
 1CPR A;  3NMK A;  3ZTM A;  3C63 A;  4CDV A;  3QW0 A;  2XLV A;  4N4W A;  2XLD A;  4CJO A;  3HNK A;  5JS5 A;  3ZQY A;  3QW1 A;  3DE8 A;  4NC3 A;  3NMI A;  3L1M A;  3FOO A;  4N6H A;  1YZA A;  4ULV A;  2YLG A;  1E83 A;  2XLW A;  1APC A;  1YYX A;  1YZC A;  3ZWI A;  1GQA A;  1CPQ A;  4D4X A;  1LM3 B;  3M4B A;  4CDY A;  1E84 A;  2YLI A;  3IQ5 A;  3HNL A;  5JVE A;  2YLD A;  3M15 A;  5B3I A;  1EKY A;  1QPU A;  3TOL A;  2BC5 A;  5JUA A;  4JEA A;  2YL7 A;  4JEB A;  4WGY A;  3ZTZ A;  5JLI A;  2XL8 A;  3FOP A;  3HNI A;  2YL0 A;  2XLE A;  4CIP A;  256B A;  4IAQ A;  1A7V A;  3QVY A;  2YL1 A;  2XLM A;  4L6R A;  2QLA A;  2XLO A;  3QVZ A;  1JAF A;  3U8P A;  5JT4 A;  1CGN A;  4IB4 A;  4CJG A;  2XM0 A;  1YYJ A;  5JSL A;  5AGF A;  2XLH A;  2XL6 A;  1E85 A;  1S05 A;  4ER9 A;  5JRA A;  3DE9 A;  1BBH A;  2J9B A;  5JP7 A;  4JKV A;  4EIY A;  4CDA A;  1M6T A;  3VRC A;  3IQ6 A;  3HNJ A;  1CGO A;  2J8W A;  3ZQV A;  4IAR A;  3M79 A;  2YKZ A;  3C62 A;  1RCP A;  3NMJ A;  2XM4 A;  2YL3 A;  1E86 A;  1MQV A;  4WGZ A;  4CX9 A;  4D4N A;  4U9D A;  3TOM A;  1NBB A;  2CCY A;  4JE9 A;  3M4C A;  4U9E A;  1QQ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...