5JUAA

Nitric oxide complex of the l16i mutant of cytochrome c prime from alcaligenes xylosoxidans
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
126
structure length
126
Chain Sequence
EFAKPEDAVKYRQSAITLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c'
publication title Engineering proximal vs. distal heme-NO coordination via dinitrosyl dynamics: implications for NO sensor design.
pubmed doi rcsb
source organism Alcaligenes xylosoxydans xylosoxydans
molecule tags Electron transport
total genus 49
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2016-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 5juaA00
4N6HA 3HNJA 3L1MA 1QQ3A 1EKYA 4IAQA 4CIPA 4EIYA 3ZTMA 3QW1A 3M4BA 2XL6A 3QW0A 3NMIA 5JLIA 3M79A 3QVYA 3DE8A 1GQAA 1M6TA 3QVZA 1E84A 4L6RA 2J8WA 4JE9A 4IARA 3C63A 2XL8A 2XLHA 2BC5A 2XLMA 5JUAA 1JAFA 1CGNA 4JEAA 5B3IA 2CCYA 2YL0A 3HNKA 5JP7A 1E86A 5JRAA 2XLDA 4JEBA 1E83A 2XLVA 3NMKA 2YLIA 4U9EA 3TOLA 2XM0A 4CDVA 1E85A 3FOPA 3U8PA 4CDAA 1LM3B 4CJGA 4CJOA 2YLDA 1BBHA 1QPUA 1YZAA 1MQVA 4CX9A 3IQ5A 3ZWIA 1S05A 3M15A 4N4WA 2XLOA 2XM4A 1CPQA 4WGZA 3NMJA 2YL7A 4JKVA 4D4NA 5JT4A 3ZTZA 2XLWA 3TOMA 1A7VA 4IB4A 4D4XA 256BA 1YYXA 3FOOA 3VRCA 5AGFA 1NBBA 1CGOA 2QLAA 3HNIA 2XLEA 4ULVA 2YLGA 3DE9A 4CDYA 2YL3A 1CPRA 3C62A 5JSLA 2J9BA 4U9DA 3HNLA 4WGYA 3M4CA 1YYJA 3ZQVA 4ER9A 1RCPA 5JVEA 1APCA 2YKZA 4NC3A 3ZQYA 1YZCA 2YL1A 5JS5A 3IQ6A
chains in the Genus database with same CATH superfamily
2G3VA 4Z9HA 4J7TA 2GDCA 4PR9A 1NU7D 1RJ9B 3EHMA 1H9GA 4XTKA 3US6A 4CIHA 1LKXA 1ORYA 3RW0A 2OOCA 4IAQA 3B0VC 5A6KA 3G4XA 2NUPA 4K7BA 1D1CA 1ZU4A 3ZVRA 4W8PA 1FMWA 3Q6NA 2R05A 3UMHA 3UMKA 1OXKA 1AUEA 2EPLX 3QW1A 3R7CA 4WABA 5D92A 2Y3HA 4I44A 1G5ZA 1JMWA 1T6IA 3FVYA 5T3WA 2R7OA 3L34A 3HTKC 4AL0A 5JLIA 4K1OA 3MLGA 3B0PA 1WTYA 2BE5F 3JTLO 3X2QC 2H7VC 3U0CA 1OR2A 2TMVP 1IZMA 5B1BC 2A6EF 2P7VA 2NG1A 1UFBA 1Z7Qc 3C63A 1VLTA 2IXNA 5COFA 3GEEA 3DJUB 1ZW3A 1PD1A 1Q0FA 5AC5A 4DVZA 1PD0A 2ETSA 1WOLA 2XLMA 4PJMA 2OKUA 2AWCA 4BEJA 2Q00A 3DM9B 1OR3A 2VB6A 2I15A 3MX3A 2IOQA 2B0HA 4Q5SF 3I5QA 5JP7A 3V5YA 4BJ5A 4BEMJ 1E86A 4G7ZF 5KYWA 1RKEB 5JRAA 3N0TA 2OEVA 2ZD9A 1HY5A 1T6QA 4JIOA 5CIVA 3IPMO 2ICWG 4LDQA 5E2QA 3T6JA 3TOLA 2XM0A 2L6GA 2Q9AA 3FOPA 2J46A 3LAYA 4CJGA 4DBRA 2YLDA 4JW1A 2R9RB 4E0HA 2J9UA 1VTMP 2OQMA 1QPUA 3EG9B 2HMZA 1MQVA 2H7BA 2Q3TA 1QSPA 4I1MA 2GFHA 4G0HA 1S05A 2EPNA 2LSEA 3AQBA 3ZWIA 4B6IA 4DBQA 1NLXA 4O79A 1T9KA 2VCAA 4N4WA 3SXMA 5A6BD 3AG2C 3AGUA 3HKKA 1CPQA 2EPMX 3ATPA 4AE4A 4JKVA 3AJMA 1I5NA 4AL1A 4D4NA 3RIPA 5KYYA 3ZTZA 3G4ZA 4RDAA 5KYUA 5DVWA 1WGWA 1VLSA 1R4TA 2YQYA 4ZLCA 1RXQA 4IGGA 2R7WA 2HJ3A 3AG3C 1BZ4A 2RSEB 3GWLA 2CW0F 5A6BA 4QI0A 5KYXA 4YT5A 5HSWA 4C7OB 2IXPA 2R7UA 1JPNA 1EA8A 2ZPAA 3O55A 3JYHA 2OJQA 1ORSC 3IEEA 1H6GA 4ULVA 3V7OA 3G50A 1T6UA 3CSKA 3TK0A 1BR4A 1YDIA 3ABKC 4CDYA 2RD9A 2WZGA 2DYRC 1WASA 4Z9IA 3RQEA 1A0BA 1R5ID 3LLKA 1Y4CA 3GANA 1V74B 3K1IC 3HNLA 3WG7C 2IM8A 2V26A 1V55C 4GEHA 1LVKA 2CYDA 4HE8D 3SXYA 4BG0A 5A6AA 5D91A 1U89A 1YVIA 3ZIBA 4MW8A 3T6GB 1DOWA 2E87A 4H4KC 4JC7A 1T5OA 3C18A 4YWQA 4G7HF 2MYSA 1D0YA 2KC3A 2PFDA 2EPKX 5L0CA 2CGEA 1TWGA 2WL8A 2B0JA 1Z63A 2HFIA 1RKCA 4I3MA 4ANJA 2LD6A 5DQTA 2QUPA 3K1IA 1QLEC 4MQ9F 1U0BB 1Z3IX 1V54C 3VF0A 5L3QA 3FAPB 4DXWA 1A7EA 3A9CA 1NU9C 3JCUQ 2EIMC 2DGJA 4HFFB 1EI7A 3IQCA 4JVSA 3NKEA 4J7YA 3ZTMA 1QZXA 1SR2A 3B9QA 4FAPB 2XL6A 4NTBA 2PX0A 2YHSA 1BR2A 1CGME 3QVYA 3EZIA 4MTGA 1W2WA 1A41A 3CAXA 2VCBA 3DE8A 3AQCA 1A7DA 1SYQA 4YT2A 2R7VA 3Q7GA 5GPGB 1D0ZA 1NZEA 1ZU5A 2WVOA 3KKBA 1TWCA 1ORJA 2HSQA 3SYNA 2J8WA 2NUTA 2HKVA 2PP4A 3C8GD 4IARA 3EGDA 2WZLA 3LNRA 1K04A 1ZHYA 1YARO 2EIKC 3IQTA 3S9OA 3KMIA 2Y3DA 1M57C 3H2UA 4OIRF 2OCCC 3JSEO 3L8IA 2GWWA 2LFDA 3LLIA 1OCZC 2DYSC 1CGNA 1JR8A 4JEAA 2ZXRA 4PFPA 4U5DE 3S90A 5A69A 3OWTA 3R2PA 3RVYA 2R02A 4P9TA 2XRHA 2IXMA 3C8GA 4BPMA 4I1OB 5IY5C 1E2XA 3IHUA 3WAQA 4P6IC 1N1CA 3PCVA 5L0FA 4PJJA 5DS5A 1WATA 1L3PA 2C04A 2A68F 2PX3A 3KYJA 3LS1A 2XL4A 4U9EA 3CZ6A 1HMDA 3DAFA 1TQGA 4NTAA 3RH3A 4MVMA 4BJ5C 4BJ1A 2GAQA 5B1AC 1PV3A 3U8PA 3HJCA 4DOZA 4JJFA 2R7XA 1M2VB 4ZLDA 3ECSA 3JZ0A 4JZAA 3NDBB 4EWCA 3K66A 2R7RA 2UUIA 1J8MF 1YZAA 2MWQA 2R25A 4U5FE 3IQ5A 4Z9JA 3KPHA 3RVZA 5AC4A 4EHPA 4YN0B 1FTSA 3W2WA 2XXAA 4YT4A 4JRZA 1M56C 3B29A 1I4YA 2ASRA 2I8BA 3FAJA 2VCCA 2J0WA 2D5RB 2XLOA 2XM4A 3GM1A 2G3KA 3O39A 2HUJA 3NMJA 2F22A 4O6MA 1HMOA 4EBKA 2BL2A 2ZXPA 3TOMA 1A7VA 4A2NB 2A0UA 3QTHA 2W4BA 3M1CB 4ONSA 3RQFA 3S84A 4R32A 4D4XA 2A1DD 3N2ZB 4RD9A 2DB4A 5EK0A 3EGXA 5L0DA 3DKAA 256BA 5FZTA 3T6BA 2J0XA 1OXBA 1VYKA 2W9YA 1KU2A 3EHNA 4X0RA 2Q9CA 4PK4A 4NY3A 5AGFA 1TKNA 2KNHA 1TFKB 1VOMA 1FMVA 3HNIA 1ZYRF 4YL3A 2NSGA 1FFHA 1D0XA 1G4US 3DE9A 2OG2A 3MYFA 5K0IA 2XS8A 2YZSA 1TFOB 1TWAA 4U5EE 5BQHA 1Y6DA 1MMDA 5JSLA 4CS7A 4EBBA 1L7CA 1LPEA 2HS5A 4E0IA 3K1HA 4G7OF 4WGYA 4ER9A 1Z23A 1YYJA 2GA0A 3SP1A 3UMIA 4E18A 2CNWD 1FNTc 3TULA 4MVQA 1MMAA 1FFTC 2HMQA 2J7PD 4YL1A 2VC9A 3MBGA 3B71A 4KBLA 4LDKA 1RCPA 4EBJA 5A6JA 3KYIA 3GORA 4NC3A 2NUPB 1M2OA 1YZCA 4KNVA 3S29A 3A11A 1VYIA 2C03A 3LEOA 5DLJA 3EH2A 3ABMC 3NYJA 1DOVA 1OW8A 4DRJB 1B68A 2CNWA 3HNJA 3LNMB 5L3VA 1QQ3A 3I4UA 4EUKB 1NFOA 1OQCA 1MNEA 2J7PA 2Y39A 3ABLC 4J30B 3UR3C 4CS9C 1EKYA 4IWBA 4U5CE 3EFOA 3NKDA 3WHNA 4U5GA 3OA1A 3OEOA 3NRHA 5COMA 4MS2A 5TJ5E 3TJ6A 3TD7A 3KL4A 3M4BA 3U2LA 3NMIA 2M4EA 1LI5A 1RJ9A 1LE4A 1NG1A 3M79A 4JTDB 3W8IA 1VK5A 2A69F 3ZDLA 1NSGB 2M64A 3H65A 5L0IA 4XQ1A 5T1DB 3TJ5A 3U8VA 5COGA 1GQAA 1OCOC 1G4WR 3S27A 2P0NA 1M6TA 3Q6MA 2HJMA 4CS9A 4LLCA 4HEAJ 1E84A 3BRJA 3LJBA 4E7ZA 4O7GA 1MNDA 5EGYA 5CI8A 2XLHA 1D1AA 5KYWB 2Y3BA 4CS8C 2Q9BA 3DD7A 1O5HA 3ZG1A 4LACB 4XLNF 3X1OA 3S28A 4OIQF 4LERA 4XLPF 5B3IA 4C3EA 3HNKA 5F28E 1JPJA 3EJNA 3Q7LA 1HW2A 3DAGA 1KNYA 2PBEA 2XLDA 2VASA 3C7JA 1OW7A 4QDLA 3V5ZA 4DRHB 2FFHA 4FX5A 4JTCB 4YK5A 3JT1A 3W8HA 4JURI 4OIOF 4NCQA 2NSFA 3MFNA 2LFFA 4DVYP 1KTMA 4CS8A 2LK4A 4C3BA 2KYHA 3PDMP 3TQOA 4BJ6A 5KYNA 1E85A 2KJGA 1RKEA 3U3BA 4CDAA 1HW1A 3SNHA 3POVA 5F5FA 2IYLD 3FHDA 3O6XA 1BBHA 4AE4B 1XWJA 2EILC 2CDQA 2QNLA 1LE2A 1T01A 1C02A 3GWNA 4XEVA 1BDJB 5KYUB 2X0CA 4PFOA 4CSAC 1H9TA 3UGOA 2WVNA 4AK9A 4XEFA 2YL7A 2YWAA 3GM2A 4K0DA 3DZAA 5KYXB 3EG9A 1AEPA 2A0BA 1GGQA 2XLWA 4A4AA 2JX0A 3ASNC 1YLMA 3CEXA 4IB4A 4KC9A 2EINC 2R7QA 3BEHA 4MTOA 3RYLA 2Q4FA 1Q0DA 1TR2A 1YJGA 3GEHA 5DQZA 4JJGA 1MMNA 1QVXA 1ZHTA 4MVZA 4NTFA 4MVSA 2A6HF 4N06A 3SXKA 1O3UA 3VRCA 3L8JA 4CSAA 3DI5A 1NBBA 1CGOA 2Q7RA 3I5PA 3AGTA 5BUOA 2QE9A 2Z15A 2V3CC 4RBNA 3QMKA 2YLGA 2KGOA 3C8ZA 1BR1A 2IXOA 4FESA 1C17M 1F1MA 4MVUA 3RF3A 4YL0A 4C7OA 3NYMA 2JD3A 3LESA 4F4BA 2J9BA 4C3DA 4U9DA 3JRTA 2W45A 3RFYA 3O10A 4XPXA 5E3CA 2HSBA 5HV9A 4M63A 4XPYA 2R7SA 1ZHWA 1HE1A 1EQ1A 3EZHA 2YKZA 1SZIA 2J9VA 2JPUA 4J32B 1Q0MA 2OJED 4N6CA 4ULWA 3SXZA 1J8YF 2YL1A 3JRMO 1H7IA 1Q0GA 2J45A 5CI9A 3DJNB 3VM6A 1FAPB 2L9JA 5E33A 4QI2A 3IQ6A 3T4RA 1LS1A 4N6HA 1JRAA 4IRUA 3L1MA 4Q4ZF 1OCCC 3U9MA 1LIHA 2YRFA 2LP4A 2P61A 2LIGA 3AG4C 3VAYA 4CIPA 1GM5A 1I4ZA 3U5SA 1QKRA 1TWHA 2X51A 3AOUA 4Q7CA 3UNGC 2H7OA 4EIYA 3CQZA 4O6YA 2YEVA 4YJWA 4EKWA 3QW0A 3NG1A 1S7ZA 3JSZA 5DS4A 2NUTB 4KI2A 2DI3A 3H2VA 1ZW2A 3EGDB 4PJNA 3U2MA 3JYYA 4FWVA 1YAUO 4MW3A 4P9FA 3W2VA 3AG1C 3J06A 1FR0A 3QVZA 4L6RA 2QTVA 5EHHA 3ZSUA 1K05A 4JE9A 5FCLA 4OIPF 2HV7A 1Q0KA 1ZHZA 3LUTB 3VYWA 3GODA 2XL8A 3C8GB 5DS6A 2FAPB 5B3SC 2VH3A 3U9JA 1LI7A 2BC5A 3N24A 2WZFA 3LS0A 5L0JA 1VMAA 4HFKB 5JUAA 3EQLF 1JAFA 2L7AA 1SF8A 2P6VA 1Z5ZA 1PCXA 2OEXA 1MMGA 2WVQA 4G78A 1D1BA 3V5XA 3FDQA 2R7TA 2CCYA 2YL0A 1JOGA 3SZRA 1VB5A 3DWWA 3KH2A 4NQFA 3S0XA 1OKKD 4JEBA 2NPUA 4XEKA 5L0HA 5F5HA 2KSFA 1XZQA 4W8KA 1E83A 3GEIA 4BJTA 2XLVA 2HZ8A 2QY9A 2OU6A 4PJLA 3NMKA 4UDVA 2YLIA 2KK1A 3HLZA 3B0UX 3E9VA 3F46A 2XXAB 1YA7O 4CDVA 1ZHXA 1V4AA 3LEVA 4JCHA 4KNWA 5T3TA 4PACA 1GS9A 1LM3B 2ZXWC 3RQGA 1C03A 2YVKA 3EH1A 4XPWA 3PMRA 4CJOA 1O87A 2LCHA 1OKKA 2P1AA 1XZPA 4JCZA 3SEOA 5BQGA 4CX9A 2HV6A 2PF4E 4DRIB 4BJ6C 2IBFA 4XWJA 5BQIA 3NYLA 1SMYF 1M2VA 2LQGA 3M15A 4GQHA 2WB7A 3FXHA 3T9OA 1ZVZA 3GM3A 4LLEA 1NFNA 3E70C 3EGXB 2XS1A 4JTAB 1AVOB 4WGZA 5E3AA 2KQ9A 3K33A 3PHF2 5JT4A 2EPOA 3EPVA 3L0IA 1WWPA 4O6NA 3ZC4A 3WODF 2Y69C 4IAOA 4DJ9A 4AX2A 4E7SA 1LS4A 2FGYA 4MTFA 2H8AA 2PNOA 1HE9A 1K40A 4U5HA 1YYXA 3DMDA 4E17A 1WN0A 1UG7A 1G8XA 3FOOA 2EIJC 2AWYA 4CBEA 1IW7F 2D4UA 2QLAA 2O9XA 2G62A 2XLEA 4H54A 4MNDA 4YT8A 2R03A 3W4YA 2Y3GA 5KYYB 2AU5A 2XSEA 2YL3A 1CPRA 4OINF 1YA9A 3C62A 1U6HA 2UUHA 4LDRA 4IJJA 4OD4A 2AVKA 1OW6A 4U5BE 2MHRA 2W4MA 1RMVA 1OCRC 2KW3C 4OD5A 3M4CA 3U3FA 3ZQVA 1ST6A 3QZCA 3MYIA 4MVOA 3UGPA 2L6FA 3DXJF 2L6HA 3F47A 1Z6AA 1ZZPA 1APCA 3RKOF 2AP3A 2ZXOA 3K7DA 3ASOC 4MVRA 4WJ0A 5JVEA 4GYTA 3DM5A 3EFOB 3FMSA 3ITFA 3ZQYA 5L0GA 3K6BA 5JS5A 2J9WA 2L81A
chains in the Genus database with same CATH topology
4N6HA 3HNJA 3L1MA 1QQ3A 1EKYA 4IAQA 4CIPA 4EIYA 3ZTMA 3QW1A 3M4BA 2XL6A 3QW0A 3NMIA 5JLIA 3M79A 3QVYA 3DE8A 1GQAA 1M6TA 3QVZA 1E84A 4L6RA 2J8WA 4JE9A 4IARA 3C63A 2XL8A 2XLHA 2BC5A 2XLMA 5JUAA 1JAFA 1CGNA 4JEAA 5B3IA 2CCYA 2YL0A 3HNKA 5JP7A 1E86A 5JRAA 2XLDA 4JEBA 1E83A 2XLVA 3NMKA 2YLIA 4U9EA 3TOLA 2XM0A 4CDVA 1E85A 3FOPA 3U8PA 4CDAA 1LM3B 4CJGA 4CJOA 2YLDA 1BBHA 1QPUA 1YZAA 1MQVA 4CX9A 3IQ5A 3ZWIA 1S05A 3M15A 4N4WA 2XLOA 2XM4A 1CPQA 4WGZA 3NMJA 2YL7A 4JKVA 4D4NA 5JT4A 3ZTZA 2XLWA 3TOMA 1A7VA 4IB4A 4D4XA 256BA 1YYXA 3FOOA 3VRCA 5AGFA 1NBBA 1CGOA 2QLAA 3HNIA 2XLEA 4ULVA 2YLGA 3DE9A 4CDYA 2YL3A 1CPRA 3C62A 5JSLA 2J9BA 4U9DA 3HNLA 4WGYA 3M4CA 1YYJA 3ZQVA 4ER9A 1RCPA 5JVEA 1APCA 2YKZA 4NC3A 3ZQYA 1YZCA 2YL1A 5JS5A 3IQ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N6H A;  3HNJ A;  3L1M A;  1QQ3 A;  1EKY A;  4IAQ A;  4CIP A;  4EIY A;  3ZTM A;  3QW1 A;  3M4B A;  2XL6 A;  3QW0 A;  3NMI A;  5JLI A;  3M79 A;  3QVY A;  3DE8 A;  1GQA A;  1M6T A;  3QVZ A;  1E84 A;  4L6R A;  2J8W A;  4JE9 A;  4IAR A;  3C63 A;  2XL8 A;  2XLH A;  2BC5 A;  2XLM A;  5JUA A;  1JAF A;  1CGN A;  4JEA A;  5B3I A;  2CCY A;  2YL0 A;  3HNK A;  5JP7 A;  1E86 A;  5JRA A;  2XLD A;  4JEB A;  1E83 A;  2XLV A;  3NMK A;  2YLI A;  4U9E A;  3TOL A;  2XM0 A;  4CDV A;  1E85 A;  3FOP A;  3U8P A;  4CDA A;  1LM3 B;  4CJG A;  4CJO A;  2YLD A;  1BBH A;  1QPU A;  1YZA A;  1MQV A;  4CX9 A;  3IQ5 A;  3ZWI A;  1S05 A;  3M15 A;  4N4W A;  2XLO A;  2XM4 A;  1CPQ A;  4WGZ A;  3NMJ A;  2YL7 A;  4JKV A;  4D4N A;  5JT4 A;  3ZTZ A;  2XLW A;  3TOM A;  1A7V A;  4IB4 A;  4D4X A;  256B A;  1YYX A;  3FOO A;  3VRC A;  5AGF A;  1NBB A;  1CGO A;  2QLA A;  3HNI A;  2XLE A;  4ULV A;  2YLG A;  3DE9 A;  4CDY A;  2YL3 A;  1CPR A;  3C62 A;  5JSL A;  2J9B A;  4U9D A;  3HNL A;  4WGY A;  3M4C A;  1YYJ A;  3ZQV A;  4ER9 A;  1RCP A;  5JVE A;  1APC A;  2YKZ A;  4NC3 A;  3ZQY A;  1YZC A;  2YL1 A;  5JS5 A;  3IQ6 A; 
#chains in the Genus database with same CATH topology
 2G3V A;  4Z9H A;  4J7T A;  2GDC A;  4PR9 A;  1NU7 D;  1RJ9 B;  3EHM A;  1H9G A;  4XTK A;  3US6 A;  4CIH A;  1LKX A;  1ORY A;  3RW0 A;  2OOC A;  4IAQ A;  3B0V C;  5A6K A;  3G4X A;  2NUP A;  4K7B A;  1D1C A;  1ZU4 A;  3ZVR A;  4W8P A;  1FMW A;  3Q6N A;  2R05 A;  3UMH A;  3UMK A;  1OXK A;  1AUE A;  2EPL X;  3QW1 A;  3R7C A;  4WAB A;  5D92 A;  2Y3H A;  4I44 A;  1G5Z A;  1JMW A;  1T6I A;  3FVY A;  5T3W A;  2R7O A;  3L34 A;  3HTK C;  4AL0 A;  5JLI A;  4K1O A;  3MLG A;  3B0P A;  1WTY A;  2BE5 F;  3JTL O;  3X2Q C;  2H7V C;  3U0C A;  1OR2 A;  2TMV P;  1IZM A;  5B1B C;  2A6E F;  2P7V A;  2NG1 A;  1UFB A;  1Z7Q c;  3C63 A;  1VLT A;  2IXN A;  5COF A;  3GEE A;  3DJU B;  1ZW3 A;  1PD1 A;  1Q0F A;  5AC5 A;  4DVZ A;  1PD0 A;  2ETS A;  1WOL A;  2XLM A;  4PJM A;  2OKU A;  2AWC A;  4BEJ A;  2Q00 A;  3DM9 B;  1OR3 A;  2VB6 A;  2I15 A;  3MX3 A;  2IOQ A;  2B0H A;  4Q5S F;  3I5Q A;  5JP7 A;  3V5Y A;  4BJ5 A;  4BEM J;  1E86 A;  4G7Z F;  5KYW A;  1RKE B;  5JRA A;  3N0T A;  2OEV A;  2ZD9 A;  1HY5 A;  1T6Q A;  4JIO A;  5CIV A;  3IPM O;  2ICW G;  4LDQ A;  5E2Q A;  3T6J A;  3TOL A;  2XM0 A;  2L6G A;  2Q9A A;  3FOP A;  2J46 A;  3LAY A;  4CJG A;  4DBR A;  2YLD A;  4JW1 A;  2R9R B;  4E0H A;  2J9U A;  1VTM P;  2OQM A;  1QPU A;  3EG9 B;  2HMZ A;  1MQV A;  2H7B A;  2Q3T A;  1QSP A;  4I1M A;  2GFH A;  4G0H A;  1S05 A;  2EPN A;  2LSE A;  3AQB A;  3ZWI A;  4B6I A;  4DBQ A;  1NLX A;  4O79 A;  1T9K A;  2VCA A;  4N4W A;  3SXM A;  5A6B D;  3AG2 C;  3AGU A;  3HKK A;  1CPQ A;  2EPM X;  3ATP A;  4AE4 A;  4JKV A;  3AJM A;  1I5N A;  4AL1 A;  4D4N A;  3RIP A;  5KYY A;  3ZTZ A;  3G4Z A;  4RDA A;  5KYU A;  5DVW A;  1WGW A;  1VLS A;  1R4T A;  2YQY A;  4ZLC A;  1RXQ A;  4IGG A;  2R7W A;  2HJ3 A;  3AG3 C;  1BZ4 A;  2RSE B;  3GWL A;  2CW0 F;  5A6B A;  4QI0 A;  5KYX A;  4YT5 A;  5HSW A;  4C7O B;  2IXP A;  2R7U A;  1JPN A;  1EA8 A;  2ZPA A;  3O55 A;  3JYH A;  2OJQ A;  1ORS C;  3IEE A;  1H6G A;  4ULV A;  3V7O A;  3G50 A;  1T6U A;  3CSK A;  3TK0 A;  1BR4 A;  1YDI A;  3ABK C;  4CDY A;  2RD9 A;  2WZG A;  2DYR C;  1WAS A;  4Z9I A;  3RQE A;  1A0B A;  1R5I D;  3LLK A;  1Y4C A;  3GAN A;  1V74 B;  3K1I C;  3HNL A;  3WG7 C;  2IM8 A;  2V26 A;  1V55 C;  4GEH A;  1LVK A;  2CYD A;  4HE8 D;  3SXY A;  4BG0 A;  5A6A A;  5D91 A;  1U89 A;  1YVI A;  3ZIB A;  4MW8 A;  3T6G B;  1DOW A;  2E87 A;  4H4K C;  4JC7 A;  1T5O A;  3C18 A;  4YWQ A;  4G7H F;  2MYS A;  1D0Y A;  2KC3 A;  2PFD A;  2EPK X;  5L0C A;  2CGE A;  1TWG A;  2WL8 A;  2B0J A;  1Z63 A;  2HFI A;  1RKC A;  4I3M A;  4ANJ A;  2LD6 A;  5DQT A;  2QUP A;  3K1I A;  1QLE C;  4MQ9 F;  1U0B B;  1Z3I X;  1V54 C;  3VF0 A;  5L3Q A;  3FAP B;  4DXW A;  1A7E A;  3A9C A;  1NU9 C;  3JCU Q;  2EIM C;  2DGJ A;  4HFF B;  1EI7 A;  3IQC A;  4JVS A;  3NKE A;  4J7Y A;  3ZTM A;  1QZX A;  1SR2 A;  3B9Q A;  4FAP B;  2XL6 A;  4NTB A;  2PX0 A;  2YHS A;  1BR2 A;  1CGM E;  3QVY A;  3EZI A;  4MTG A;  1W2W A;  1A41 A;  3CAX A;  2VCB A;  3DE8 A;  3AQC A;  1A7D A;  1SYQ A;  4YT2 A;  2R7V A;  3Q7G A;  5GPG B;  1D0Z A;  1NZE A;  1ZU5 A;  2WVO A;  3KKB A;  1TWC A;  1ORJ A;  2HSQ A;  3SYN A;  2J8W A;  2NUT A;  2HKV A;  2PP4 A;  3C8G D;  4IAR A;  3EGD A;  2WZL A;  3LNR A;  1K04 A;  1ZHY A;  1YAR O;  2EIK C;  3IQT A;  3S9O A;  3KMI A;  2Y3D A;  1M57 C;  3H2U A;  4OIR F;  2OCC C;  3JSE O;  3L8I A;  2GWW A;  2LFD A;  3LLI A;  1OCZ C;  2DYS C;  1CGN A;  1JR8 A;  4JEA A;  2ZXR A;  4PFP A;  4U5D E;  3S90 A;  5A69 A;  3OWT A;  3R2P A;  3RVY A;  2R02 A;  4P9T A;  2XRH A;  2IXM A;  3C8G A;  4BPM A;  4I1O B;  5IY5 C;  1E2X A;  3IHU A;  3WAQ A;  4P6I C;  1N1C A;  3PCV A;  5L0F A;  4PJJ A;  5DS5 A;  1WAT A;  1L3P A;  2C04 A;  2A68 F;  2PX3 A;  3KYJ A;  3LS1 A;  2XL4 A;  4U9E A;  3CZ6 A;  1HMD A;  3DAF A;  1TQG A;  4NTA A;  3RH3 A;  4MVM A;  4BJ5 C;  4BJ1 A;  2GAQ A;  5B1A C;  1PV3 A;  3U8P A;  3HJC A;  4DOZ A;  4JJF A;  2R7X A;  1M2V B;  4ZLD A;  3ECS A;  3JZ0 A;  4JZA A;  3NDB B;  4EWC A;  3K66 A;  2R7R A;  2UUI A;  1J8M F;  1YZA A;  2MWQ A;  2R25 A;  4U5F E;  3IQ5 A;  4Z9J A;  3KPH A;  3RVZ A;  5AC4 A;  4EHP A;  4YN0 B;  1FTS A;  3W2W A;  2XXA A;  4YT4 A;  4JRZ A;  1M56 C;  3B29 A;  1I4Y A;  2ASR A;  2I8B A;  3FAJ A;  2VCC A;  2J0W A;  2D5R B;  2XLO A;  2XM4 A;  3GM1 A;  2G3K A;  3O39 A;  2HUJ A;  3NMJ A;  2F22 A;  4O6M A;  1HMO A;  4EBK A;  2BL2 A;  2ZXP A;  3TOM A;  1A7V A;  4A2N B;  2A0U A;  3QTH A;  2W4B A;  3M1C B;  4ONS A;  3RQF A;  3S84 A;  4R32 A;  4D4X A;  2A1D D;  3N2Z B;  4RD9 A;  2DB4 A;  5EK0 A;  3EGX A;  5L0D A;  3DKA A;  256B A;  5FZT A;  3T6B A;  2J0X A;  1OXB A;  1VYK A;  2W9Y A;  1KU2 A;  3EHN A;  4X0R A;  2Q9C A;  4PK4 A;  4NY3 A;  5AGF A;  1TKN A;  2KNH A;  1TFK B;  1VOM A;  1FMV A;  3HNI A;  1ZYR F;  4YL3 A;  2NSG A;  1FFH A;  1D0X A;  1G4U S;  3DE9 A;  2OG2 A;  3MYF A;  5K0I A;  2XS8 A;  2YZS A;  1TFO B;  1TWA A;  4U5E E;  5BQH A;  1Y6D A;  1MMD A;  5JSL A;  4CS7 A;  4EBB A;  1L7C A;  1LPE A;  2HS5 A;  4E0I A;  3K1H A;  4G7O F;  4WGY A;  4ER9 A;  1Z23 A;  1YYJ A;  2GA0 A;  3SP1 A;  3UMI A;  4E18 A;  2CNW D;  1FNT c;  3TUL A;  4MVQ A;  1MMA A;  1FFT C;  2HMQ A;  2J7P D;  4YL1 A;  2VC9 A;  3MBG A;  3B71 A;  4KBL A;  4LDK A;  1RCP A;  4EBJ A;  5A6J A;  3KYI A;  3GOR A;  4NC3 A;  2NUP B;  1M2O A;  1YZC A;  4KNV A;  3S29 A;  3A11 A;  1VYI A;  2C03 A;  3LEO A;  5DLJ A;  3EH2 A;  3ABM C;  3NYJ A;  1DOV A;  1OW8 A;  4DRJ B;  1B68 A;  2CNW A;  3HNJ A;  3LNM B;  5L3V A;  1QQ3 A;  3I4U A;  4EUK B;  1NFO A;  1OQC A;  1MNE A;  2J7P A;  2Y39 A;  3ABL C;  4J30 B;  3UR3 C;  4CS9 C;  1EKY A;  4IWB A;  4U5C E;  3EFO A;  3NKD A;  3WHN A;  4U5G A;  3OA1 A;  3OEO A;  3NRH A;  5COM A;  4MS2 A;  5TJ5 E;  3TJ6 A;  3TD7 A;  3KL4 A;  3M4B A;  3U2L A;  3NMI A;  2M4E A;  1LI5 A;  1RJ9 A;  1LE4 A;  1NG1 A;  3M79 A;  4JTD B;  3W8I A;  1VK5 A;  2A69 F;  3ZDL A;  1NSG B;  2M64 A;  3H65 A;  5L0I A;  4XQ1 A;  5T1D B;  3TJ5 A;  3U8V A;  5COG A;  1GQA A;  1OCO C;  1G4W R;  3S27 A;  2P0N A;  1M6T A;  3Q6M A;  2HJM A;  4CS9 A;  4LLC A;  4HEA J;  1E84 A;  3BRJ A;  3LJB A;  4E7Z A;  4O7G A;  1MND A;  5EGY A;  5CI8 A;  2XLH A;  1D1A A;  5KYW B;  2Y3B A;  4CS8 C;  2Q9B A;  3DD7 A;  1O5H A;  3ZG1 A;  4LAC B;  4XLN F;  3X1O A;  3S28 A;  4OIQ F;  4LER A;  4XLP F;  5B3I A;  4C3E A;  3HNK A;  5F28 E;  1JPJ A;  3EJN A;  3Q7L A;  1HW2 A;  3DAG A;  1KNY A;  2PBE A;  2XLD A;  2VAS A;  3C7J A;  1OW7 A;  4QDL A;  3V5Z A;  4DRH B;  2FFH A;  4FX5 A;  4JTC B;  4YK5 A;  3JT1 A;  3W8H A;  4JUR I;  4OIO F;  4NCQ A;  2NSF A;  3MFN A;  2LFF A;  4DVY P;  1KTM A;  4CS8 A;  2LK4 A;  4C3B A;  2KYH A;  3PDM P;  3TQO A;  4BJ6 A;  5KYN A;  1E85 A;  2KJG A;  1RKE A;  3U3B A;  4CDA A;  1HW1 A;  3SNH A;  3POV A;  5F5F A;  2IYL D;  3FHD A;  3O6X A;  1BBH A;  4AE4 B;  1XWJ A;  2EIL C;  2CDQ A;  2QNL A;  1LE2 A;  1T01 A;  1C02 A;  3GWN A;  4XEV A;  1BDJ B;  5KYU B;  2X0C A;  4PFO A;  4CSA C;  1H9T A;  3UGO A;  2WVN A;  4AK9 A;  4XEF A;  2YL7 A;  2YWA A;  3GM2 A;  4K0D A;  3DZA A;  5KYX B;  3EG9 A;  1AEP A;  2A0B A;  1GGQ A;  2XLW A;  4A4A A;  2JX0 A;  3ASN C;  1YLM A;  3CEX A;  4IB4 A;  4KC9 A;  2EIN C;  2R7Q A;  3BEH A;  4MTO A;  3RYL A;  2Q4F A;  1Q0D A;  1TR2 A;  1YJG A;  3GEH A;  5DQZ A;  4JJG A;  1MMN A;  1QVX A;  1ZHT A;  4MVZ A;  4NTF A;  4MVS A;  2A6H F;  4N06 A;  3SXK A;  1O3U A;  3VRC A;  3L8J A;  4CSA A;  3DI5 A;  1NBB A;  1CGO A;  2Q7R A;  3I5P A;  3AGT A;  5BUO A;  2QE9 A;  2Z15 A;  2V3C C;  4RBN A;  3QMK A;  2YLG A;  2KGO A;  3C8Z A;  1BR1 A;  2IXO A;  4FES A;  1C17 M;  1F1M A;  4MVU A;  3RF3 A;  4YL0 A;  4C7O A;  3NYM A;  2JD3 A;  3LES A;  4F4B A;  2J9B A;  4C3D A;  4U9D A;  3JRT A;  2W45 A;  3RFY A;  3O10 A;  4XPX A;  5E3C A;  2HSB A;  5HV9 A;  4M63 A;  4XPY A;  2R7S A;  1ZHW A;  1HE1 A;  1EQ1 A;  3EZH A;  2YKZ A;  1SZI A;  2J9V A;  2JPU A;  4J32 B;  1Q0M A;  2OJE D;  4N6C A;  4ULW A;  3SXZ A;  1J8Y F;  2YL1 A;  3JRM O;  1H7I A;  1Q0G A;  2J45 A;  5CI9 A;  3DJN B;  3VM6 A;  1FAP B;  2L9J A;  5E33 A;  4QI2 A;  3IQ6 A;  3T4R A;  1LS1 A;  4N6H A;  1JRA A;  4IRU A;  3L1M A;  4Q4Z F;  1OCC C;  3U9M A;  1LIH A;  2YRF A;  2LP4 A;  2P61 A;  2LIG A;  3AG4 C;  3VAY A;  4CIP A;  1GM5 A;  1I4Z A;  3U5S A;  1QKR A;  1TWH A;  2X51 A;  3AOU A;  4Q7C A;  3UNG C;  2H7O A;  4EIY A;  3CQZ A;  4O6Y A;  2YEV A;  4YJW A;  4EKW A;  3QW0 A;  3NG1 A;  1S7Z A;  3JSZ A;  5DS4 A;  2NUT B;  4KI2 A;  2DI3 A;  3H2V A;  1ZW2 A;  3EGD B;  4PJN A;  3U2M A;  3JYY A;  4FWV A;  1YAU O;  4MW3 A;  4P9F A;  3W2V A;  3AG1 C;  3J06 A;  1FR0 A;  3QVZ A;  4L6R A;  2QTV A;  5EHH A;  3ZSU A;  1K05 A;  4JE9 A;  5FCL A;  4OIP F;  2HV7 A;  1Q0K A;  1ZHZ A;  3LUT B;  3VYW A;  3GOD A;  2XL8 A;  3C8G B;  5DS6 A;  2FAP B;  5B3S C;  2VH3 A;  3U9J A;  1LI7 A;  2BC5 A;  3N24 A;  2WZF A;  3LS0 A;  5L0J A;  1VMA A;  4HFK B;  5JUA A;  3EQL F;  1JAF A;  2L7A A;  1SF8 A;  2P6V A;  1Z5Z A;  1PCX A;  2OEX A;  1MMG A;  2WVQ A;  4G78 A;  1D1B A;  3V5X A;  3FDQ A;  2R7T A;  2CCY A;  2YL0 A;  1JOG A;  3SZR A;  1VB5 A;  3DWW A;  3KH2 A;  4NQF A;  3S0X A;  1OKK D;  4JEB A;  2NPU A;  4XEK A;  5L0H A;  5F5H A;  2KSF A;  1XZQ A;  4W8K A;  1E83 A;  3GEI A;  4BJT A;  2XLV A;  2HZ8 A;  2QY9 A;  2OU6 A;  4PJL A;  3NMK A;  4UDV A;  2YLI A;  2KK1 A;  3HLZ A;  3B0U X;  3E9V A;  3F46 A;  2XXA B;  1YA7 O;  4CDV A;  1ZHX A;  1V4A A;  3LEV A;  4JCH A;  4KNW A;  5T3T A;  4PAC A;  1GS9 A;  1LM3 B;  2ZXW C;  3RQG A;  1C03 A;  2YVK A;  3EH1 A;  4XPW A;  3PMR A;  4CJO A;  1O87 A;  2LCH A;  1OKK A;  2P1A A;  1XZP A;  4JCZ A;  3SEO A;  5BQG A;  4CX9 A;  2HV6 A;  2PF4 E;  4DRI B;  4BJ6 C;  2IBF A;  4XWJ A;  5BQI A;  3NYL A;  1SMY F;  1M2V A;  2LQG A;  3M15 A;  4GQH A;  2WB7 A;  3FXH A;  3T9O A;  1ZVZ A;  3GM3 A;  4LLE A;  1NFN A;  3E70 C;  3EGX B;  2XS1 A;  4JTA B;  1AVO B;  4WGZ A;  5E3A A;  2KQ9 A;  3K33 A;  3PHF 2;  5JT4 A;  2EPO A;  3EPV A;  3L0I A;  1WWP A;  4O6N A;  3ZC4 A;  3WOD F;  2Y69 C;  4IAO A;  4DJ9 A;  4AX2 A;  4E7S A;  1LS4 A;  2FGY A;  4MTF A;  2H8A A;  2PNO A;  1HE9 A;  1K40 A;  4U5H A;  1YYX A;  3DMD A;  4E17 A;  1WN0 A;  1UG7 A;  1G8X A;  3FOO A;  2EIJ C;  2AWY A;  4CBE A;  1IW7 F;  2D4U A;  2QLA A;  2O9X A;  2G62 A;  2XLE A;  4H54 A;  4MND A;  4YT8 A;  2R03 A;  3W4Y A;  2Y3G A;  5KYY B;  2AU5 A;  2XSE A;  2YL3 A;  1CPR A;  4OIN F;  1YA9 A;  3C62 A;  1U6H A;  2UUH A;  4LDR A;  4IJJ A;  4OD4 A;  2AVK A;  1OW6 A;  4U5B E;  2MHR A;  2W4M A;  1RMV A;  1OCR C;  2KW3 C;  4OD5 A;  3M4C A;  3U3F A;  3ZQV A;  1ST6 A;  3QZC A;  3MYI A;  4MVO A;  3UGP A;  2L6F A;  3DXJ F;  2L6H A;  3F47 A;  1Z6A A;  1ZZP A;  1APC A;  3RKO F;  2AP3 A;  2ZXO A;  3K7D A;  3ASO C;  4MVR A;  4WJ0 A;  5JVE A;  4GYT A;  3DM5 A;  3EFO B;  3FMS A;  3ITF A;  3ZQY A;  5L0G A;  3K6B A;  5JS5 A;  2J9W A;  2L81 A; 
#chains in the Genus database with same CATH homology
 4N6H A;  3HNJ A;  3L1M A;  1QQ3 A;  1EKY A;  4IAQ A;  4CIP A;  4EIY A;  3ZTM A;  3QW1 A;  3M4B A;  2XL6 A;  3QW0 A;  3NMI A;  5JLI A;  3M79 A;  3QVY A;  3DE8 A;  1GQA A;  1M6T A;  3QVZ A;  1E84 A;  4L6R A;  2J8W A;  4JE9 A;  4IAR A;  3C63 A;  2XL8 A;  2XLH A;  2BC5 A;  2XLM A;  5JUA A;  1JAF A;  1CGN A;  4JEA A;  5B3I A;  2CCY A;  2YL0 A;  3HNK A;  5JP7 A;  1E86 A;  5JRA A;  2XLD A;  4JEB A;  1E83 A;  2XLV A;  3NMK A;  2YLI A;  4U9E A;  3TOL A;  2XM0 A;  4CDV A;  1E85 A;  3FOP A;  3U8P A;  4CDA A;  1LM3 B;  4CJG A;  4CJO A;  2YLD A;  1BBH A;  1QPU A;  1YZA A;  1MQV A;  4CX9 A;  3IQ5 A;  3ZWI A;  1S05 A;  3M15 A;  4N4W A;  2XLO A;  2XM4 A;  1CPQ A;  4WGZ A;  3NMJ A;  2YL7 A;  4JKV A;  4D4N A;  5JT4 A;  3ZTZ A;  2XLW A;  3TOM A;  1A7V A;  4IB4 A;  4D4X A;  256B A;  1YYX A;  3FOO A;  3VRC A;  5AGF A;  1NBB A;  1CGO A;  2QLA A;  3HNI A;  2XLE A;  4ULV A;  2YLG A;  3DE9 A;  4CDY A;  2YL3 A;  1CPR A;  3C62 A;  5JSL A;  2J9B A;  4U9D A;  3HNL A;  4WGY A;  3M4C A;  1YYJ A;  3ZQV A;  4ER9 A;  1RCP A;  5JVE A;  1APC A;  2YKZ A;  4NC3 A;  3ZQY A;  1YZC A;  2YL1 A;  5JS5 A;  3IQ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...