2ETSA

Crystal structure of a bacterial domain of unknown function from duf1798 family (mw1337) from staphylococcus aureus subsp. aureus at 2.25 a resolution
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
115
structure length
115
Chain Sequence
HHHHHMNDLVESLIYEVNNMQQNFENVKSQQQDHDFYQTVKPYTEHIDSILNEIKLHREFIIEVPYMNSRKFELLIANIEQLSVECHFKRTSRKLFIEKLKSVQYDLQNILDGVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords hypothetical protein
publication title Crystal structures of MW1337R and lin2004: representatives of a novel protein family that adopt a four-helical bundle fold.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
total genus 50
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2005-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08807 DUF1798 Bacterial domain of unknown function (DUF1798)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.440 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) YppE-like 2etsA00
2ETSA 2IM8A 2HFIA 2HUJA
chains in the Genus database with same CATH superfamily
2J9WA 1H9TA 3DXJF 1EI7A 4JEAA 2ETSA 2OOCA 5L0FA 3L8IA 4EBBA 3QZCA 1S7ZA 4I44A 2L6GA 3PHF2 1QLEC 1T6IA 3ABKC 3IHUA 1NFNA 2HZ8A 3IQCA 3TJ6A 3EGXB 3AG1C 4JKVA 1FTSA 3RQFA 5T3WA 4U5CE 4U5DE 3SXMA 4EWCA 3BRJA 2V26A 2Y3HA 2KGOA 3O10A 4MTFA 1Q0FA 1I4YA 4EIYA 2G3VA 2NUPB 3DI5A 3K33A 5KYYA 1KTMA 1SYQA 1NU9C 2C03A 3C8ZA 3NMJA 5FZTA 3C8GA 1VLSA 4ANJA 4DRJB 5A6JA 1JPNA 4BJ6C 3PDMP 1SMYF 1T6QA 3EZIA 4ULVA 2M64A 4JC7A 4C3DA 3EQLF 4E7ZA 3ABMC 4U9EA 4NQFA 1N1CA 2XRHA 4MQ9F 5A69A 3WG7C 1T5OA 2AWYA 2UUIA 4JIOA 2F22A 4YT2A 1Y6DA 4PR9A 2WVNA 1Z23A 3G4ZA 3S9OA 1YZCA 4YWQA 3K7DA 4DBQA 3GM1A 2J8WA 3M4CA 1OR3A 2DYSC 4IGGA 4CDYA 3TULA 1WATA 4DOZA 4C7OB 4IAQA 2A69F 2XLDA 1JAFA 1YA9A 1JR8A 1PV3A 3GM2A 4RBNA 1H6GA 4BPMA 2KW3C 4KNWA 5KYXB 5E2QA 1H9GA 3DAGA 3FMSA 2IXNA 1EKYA 4FESA 3RW0A 3K1IA 4AX2A 1C17M 1QZXA 3U2LA 3EGXA 3ZWIA 4CS8C 3H65A 3M4BA 4XPYA 3R7CA 2XXAB 3T6JA 3S0XA 3ABLC 1HW1A 4JCZA 4O6YA 3VF0A 5CIVA 3IQTA 2YWAA 3EG9B 4BJ1A 5AGFA 1GM5A 4HFFB 3RYLA 5IY5C 1WGWA 2E87A 3W4YA 1ZU5A 4XLNF 3JYYA 2V3CC 2R9RB 2NSFA 2D4UA 2VC9A 4E0HA 2KJGA 3S29A 3PCVA 5L0IA 3V5ZA 2MWQA 3NYJA 2HJ3A 2XSEA 3LUTB 2C04A 3ZC4A 3U3BA 5BUOA 3KL4A 4O6NA 1LM3B 4WGYA 3L1MA 4WJ0A 2OG2A 3ZG1A 4CS9C 3EFOA 2W4BA 2XM0A 5F28E 3K66A 3EHNA 2A0BA 4AL1A 2J7PA 4KC9A 1FNTc 1OW8A 1ZU4A 2HV7A 1JPJA 1R4TA 4U5GA 3ZQVA 4CIPA 1OKKA 1JOGA 5L3VA 2RD9A 2P6VA 3VYWA 2YZSA 4LLCA 1ORSC 2HSBA 5B3IA 3B9QA 4ER9A 4ONSA 4C7OA 2AVKA 3GODA 3C18A 4QI0A 2ASRA 2R7QA 4U9DA 2CYDA 2NPUA 2P1AA 5GPGB 2I8BA 2VB6A 1I4ZA 3KYJA 3LLKA 2AWCA 4MW3A 2A0UA 4EUKB 3UGOA 2TMVP 4IARA 1NSGB 1VYIA 1VB5A 1M2OA 4OIQF 4IJJA 1ZW3A 4YL3A 4CX9A 4X0RA 2HMZA 3DZAA 2XL6A 4Q5SF 1D0YA 3LNMB 1CPRA 3EG9A 2FFHA 3DWWA 1A7DA 3F46A 3M1CB 2R03A 1NFOA 4K0DA 1A41A 1IZMA 3QW1A 4PJMA 2WZGA 4PFOA 2O9XA 3U9JA 4EKWA 3W8IA 5BQGA 3F47A 4MNDA 1ORYA 4BJTA 3K6BA 2LIGA 3R2PA 2J9BA 4K7BA 1WOLA 3SP1A 5BQIA 2R7XA 3JRMO 3CSKA 4CBEA 2YL7A 2IXPA 2BE5F 2IM8A 5F5FA 5KYWB 3C8GB 2Q9AA 1BZ4A 1XZQA 3LS1A 1I5NA 4QI2A 3QVYA 3K1HA 3GEEA 2B0HA 2WZFA 5E3CA 3T6BA 4E17A 5B1BC 1TFKB 2IYLD 1AVOB 2A1DD 3AOUA 3LJBA 4N06A 2R7VA 3DM9B 4MVMA 5COFA 1VOMA 2EIKC 4W8KA 3Q6MA 4MW8A 3LESA 2DYRC 4R32A 2Z15A 2IXMA 2LSEA 2ZXRA 3W8HA 2IXOA 1SF8A 3DJNB 3RFYA 4CJOA 1AEPA 3OA1A 4O79A 1YARO 2LFFA 3FVYA 4HEAJ 5E33A 3WODF 5AC4A 2YVKA 3LLIA 1ZHWA 1W2WA 1E85A 2KNHA 4PK4A 2VCBA 5DQZA 1V54C 1H7IA 2J9UA 4LACB 4IB4A 3TJ5A 1CGNA 4G7ZF 5D92A 1EA8A 2LK4A 4GQHA 2NUTB 2EINC 2YKZA 5DQTA 4J30B 1YZAA 3TK0A 1A7VA 2Q00A 4GEHA 3T4RA 3TOLA 1BBHA 2PP4A 3Q7LA 1BR1A 2ZXWC 3M15A 1XWJA 4RD9A 4GYTA 4XTKA 3IPMO 3SEOA 3T6GB 4G7OF 5B3SC 1VTMP 1CGOA 3C63A 1OCZC 1O5HA 4E0IA 1U6HA 2UUHA 5JT4A 5KYWA 3GANA 4NTAA 2CNWD 3DJUB 4PJJA 1VLTA 2J9VA 4QDLA 4OD5A 4Q7CA 4XWJA 2J46A 3U9MA 1F1MA 1LI7A 1VYKA 3G50A 4NCQA 3X2QC 4DVZA 2YL0A 2R25A 3B71A 3V5XA 2YLGA 1L3PA 1KU2A 3AG4C 3KPHA 3O39A 1OCCC 2X0CA 2ZXOA 1K05A 3EFOB 4E7SA 3SXKA 4AL0A 1G4WR 1JRAA 2WZLA 1BR4A 2W4MA 3DMDA 1E2XA 4U5BE 4L6RA 1MMDA 2OEVA 1L7CA 1HE9A 3KH2A 4H54A 1DOVA 5T1DB 1TKNA 2KQ9A 5A6BD 2CGEA 5A6AA 1APCA 4FX5A 3HNKA 4J7YA 4A4AA 5L0HA 3EGDB 3NRHA 4IRUA 5JRAA 1LI5A 4LDKA 2CW0F 1TWGA 3O55A 4JVSA 3PMRA 2R7UA 2QNLA 3X1OA 3UMHA 3RH3A 3UMIA 2HSQA 1NBBA 1QVXA 3A9CA 2NUTA 3ZDLA 3ZIBA 3POVA 3AQCA 3C7JA 1FMWA 1NU7D 4JEBA 2OQMA 2YLIA 1ZHXA 4A2NB 2PNOA 5AC5A 5L0DA 4Q4ZF 1YYXA 1OW7A 4MVSA 3B0PA 4N6CA 2XS8A 2W45A 2Q4FA 4XPWA 1B68A 2LFDA 1YA7O 3LS0A 1OW6A 1RKEA 2YQYA 3AJMA 3SZRA 1CGME 4NTFA 4KI2A 3VAYA 1U0BB 1Q0MA 3JTLO 3A11A 2QLAA 3UMKA 5TJ5E 2R7WA 2JX0A 1Q0DA 4YK5A 1C02A 1K40A 1TQGA 5L0GA 3MFNA 4FWVA 3AG2C 2VCCA 2PBEA 3B29A 1AUEA 3DE9A 2DI3A 3IEEA 2Y3GA 1LE2A 1J8MF 1R5ID 1S05A 2OCCC 4PACA 4CDAA 3K1IC 2CCYA 2B0JA 3AG3C 4RDAA 5L0CA 2GDCA 3US6A 4J7TA 4MS2A 3W2WA 4CDVA 1M2VA 4HFKB 5DS4A 1ST6A 4B6IA 1BR2A 3T9OA 2Q9BA 5JUAA 3EGDA 1YDIA 1YAUO 4YL1A 1G8XA 2P61A 3AQBA 3EZHA 2OEXA 4LDQA 1YJGA 2PX3A 3RF3A 5K0IA 2R7TA 4G78A 1QSPA 4JTDB 4BJ5A 3JCUQ 4NTBA 3ZQYA 1FFHA 2R05A 1G5ZA 3JSZA 5JLIA 4IWBA 2OU6A 3C62A 1ORJA 4MVRA 1ZYRF 3DAFA 4CSAA 4N4WA 3EHMA 2I15A 4ULWA 4LERA 4EBKA 3AGUA 3LEVA 4JE9A 1Z3IX 2EPNA 2YL1A 1MMAA 1FAPB 2YEVA 1J8YF 3NG1A 4KNVA 4JZAA 1OCOC 1OR2A 2ZXPA 2OJQA 3SYNA 1OQCA 2J45A 2PX0A 1MNDA 3HKKA 3QW0A 3VRCA 1ZHTA 3ECSA 4WGZA 1KNYA 1GS9A 2KYHA 1ZW2A 4MVOA 3I5PA 4BJ5C 3MYIA 4I1OB 1OXKA 2MHRA 1A7EA 3IQ6A 2A6HF 1YLMA 4NY3A 4CS7A 2A6EF 1ZVZA 3DE8A 1Z7Qc 2FGYA 1D0XA 4EBJA 2CNWA 4MTGA 1WTYA 4CSAC 3TD7A 1UG7A 256BA 2FAPB 1TWAA 2DB4A 2LCHA 3FHDA 5T3TA 1LVKA 1PD1A 3GWNA 4H4KC 2Y39A 3L0IA 3QTHA 3ZTZA 1E86A 3NYLA 2XLWA 3CQZA 2EILC 1T9KA 1TWCA 3RKOF 2P7VA 2EPOA 3DKAA 3ZVRA 5A6BA 4C3EA 4YN0B 5BQHA 3FOPA 5DVWA 1LS1A 3E9VA 3U8PA 1LKXA 4ZLCA 1D0ZA 2EPLX 1TR2A 3Q6NA 1JMWA 1HW2A 2GWWA 4N6HA 1Y4CA 4XEVA 1V74B 3U8VA 1PCXA 2LP4A 2XLVA 2ZD9A 1E83A 4DBRA 3MLGA 4O7GA 4U5EE 4YT5A 1O87A 1ZZPA 4MVQA 4YT8A 4KBLA 5JS5A 2D5RB 1EQ1A 4D4XA 4W8PA 2HJMA 1MMNA 1RJ9A 1VMAA 1RKEB 2OJED 2WVQA 3O6XA 4I1MA 4LDRA 2BL2A 4ZLDA 3BEHA 1T01A 2KC3A 3NKDA 4YJWA 5DS6A 1OXBA 1GGQA 3L8JA 3LNRA 3UGPA 4BJ6A 3I4UA 3FAJA 2EPKX 2ICWG 3EJNA 4U5FE 1K04A 2XLHA 4Z9HA 2Y3DA 3HNIA 1V55C 3MX3A 3KMIA 2AP3A 1Q0KA 1QPUA 1RCPA 1Z5ZA 2XM4A 5D91A 1TFOB 3V7OA 3GM3A 2EIJC 3HNJA 4FAPB 1Z63A 2PF4E 2VH3A 4MVZA 3UR3C 4JJFA 4G7HF 3G4XA 2P0NA 4K1OA 1SZIA 4P9TA 3RQGA 5E3AA 1M2VB 4UDVA 2YLDA 2L9JA 3EPVA 3HNLA 3JYHA 5A6KA 5COMA 5F5HA 3AGTA 2W9YA 1VK5A 4PFPA 2GFHA 1A0BA 2YL3A 3LEOA 3NYMA 1M57C 4NC3A 4JURI 1FFTC 2H7VC 4C3BA 1QKRA 3HLZA 3CEXA 4DRIB 2WVOA 3ASNC 4Z9JA 2H7BA 4CS8A 2JPUA 4M63A 3N24A 2XS1A 2VCAA 4XQ1A 3NKEA 3GEHA 4AK9A 4MTOA 2KSFA 1V4AA 3ASOC 3V5YA 1OCRC 3GEIA 4O6MA 2HMQA 1MMGA 5CI8A 1U89A 2HS5A 1C03A 2M4EA 3FXHA 1TWHA 4EHPA 2R7OA 4OINF 2DGJA 1Z6AA 3N0TA 1XZPA 2YHSA 2Q7RA 2L7AA 5JSLA 3S90A 1FR0A 3L34A 5EGYA 2G62A 4OIPF 3H2UA 2PFDA 3SNHA 4CS9A 4P6IC 3QVZA 4PJNA 5COGA 2IOQA 3HJCA 2XLEA 2Y3BA 1D1CA 3CZ6A 1PD0A 1HY5A 1FMVA 2HKVA 3EH2A 3QMKA 4I3MA 4MVUA 3GORA 4XEKA 4BEMJ 4XEFA 3OEOA 3C8GD 4DJ9A 1GQAA 2NUPA 4PJLA 4Z9IA 1UFBA 2WL8A 2Q3TA 4AE4B 4JRZA 3ZSUA 5JP7A 3SXYA 1YVIA 4G0HA 1NG1A 1M6TA 3E70C 4OD4A 2L6FA 5KYUB 4OIOF 2QE9A 1MQVA 4YL0A 2Q9CA 5L3QA 1HE1A 2J0WA 3N2ZB 1LIHA 1LPEA 2H8AA 5CI9A 3U3FA 4JTCB 3B0UX 5HSWA 3RIPA 3U2MA 1QQ3A 3RVYA 3MYFA 4XPXA 3MBGA 2Y69C 3VM6A 3OWTA 1CPQA 3RQEA 1YYJA 3UNGC 3WAQA 1NLXA 3FAPB 3FOOA 3H2VA 3CAXA 2LQGA 3KKBA 1RJ9B 2RSEB 3TQOA 5EK0A 3ITFA 2BC5A 1O3UA 3JT1A 2HV6A 1D1AA 1Q0GA 4JCHA 3SXZA 3U5SA 5KYXA 2QUPA 2A68F 2IBFA 2OKUA 3IQ5A 2EPMX 4WABA 3JSEO 3TOMA 4BEJA 2R02A 2XXAA 3FDQA 1LS4A 5JVEA 2L81A 2R7SA 3U0CA 1ZHYA 5FCLA 2NG1A 1MNEA 1HMDA 3W2VA 1G4US 3ZTMA 1HMOA 2AU5A 2NSGA 3NMKA 3GWLA 1WN0A 5L0JA 1E84A 4F4BA 4E18A 3J06A 3DM5A 2VASA 4J32B 5B1AC 5DLJA 4YT4A 2YRFA 1DOWA 4AE4A 3EH1A 3JRTA 2XL4A 4JJGA 1SR2A 3ATPA 2WB7A 4OIRF 4XLPF 1RMVA 3B0VC 4D4NA 4JTAB 1WWPA 2XLOA 5KYYB 4DXWA 5KYUA 3S28A 3Q7GA 1T6UA 2KK1A 2HUJA 1LE4A 1ZHZA 2G3KA 2MYSA 2EIMC 2J7PD 2QY9A 1WASA 4HE8D 2ZPAA 4P9FA 3S27A 1IW7F 1NZEA 4IAOA 4U5HA 3RVZA 4DVYP 2LD6A 3M79A 4CIHA 3WHNA 5EHHA 2GAQA 1OKKD 2R7RA 3HTKC 2H7OA 4CJGA 1M56C 2L6HA 2X51A 2XL8A 3JZ0A 3KYIA 4BG0A 1BDJB 3NDBB 4LLEA 1RKCA 2J0XA 5HV9A 3S84A 2QTVA 4DRHB 5KYNA 1RXQA 2HFIA 3LAYA 2CDQA 2JD3A 3I5QA 2GA0A 3NMIA 3DD7A 1D1BA 5DS5A 4JW1A 2XLMA
chains in the Genus database with same CATH topology
2ETSA 2IM8A 2HFIA 2HUJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ETS A;  2IM8 A;  2HFI A;  2HUJ A; 
#chains in the Genus database with same CATH topology
 2J9W A;  1H9T A;  3DXJ F;  1EI7 A;  4JEA A;  2ETS A;  2OOC A;  5L0F A;  3L8I A;  4EBB A;  3QZC A;  1S7Z A;  4I44 A;  2L6G A;  3PHF 2;  1QLE C;  1T6I A;  3ABK C;  3IHU A;  1NFN A;  2HZ8 A;  3IQC A;  3TJ6 A;  3EGX B;  3AG1 C;  4JKV A;  1FTS A;  3RQF A;  5T3W A;  4U5C E;  4U5D E;  3SXM A;  4EWC A;  3BRJ A;  2V26 A;  2Y3H A;  2KGO A;  3O10 A;  4MTF A;  1Q0F A;  1I4Y A;  4EIY A;  2G3V A;  2NUP B;  3DI5 A;  3K33 A;  5KYY A;  1KTM A;  1SYQ A;  1NU9 C;  2C03 A;  3C8Z A;  3NMJ A;  5FZT A;  3C8G A;  1VLS A;  4ANJ A;  4DRJ B;  5A6J A;  1JPN A;  4BJ6 C;  3PDM P;  1SMY F;  1T6Q A;  3EZI A;  4ULV A;  2M64 A;  4JC7 A;  4C3D A;  3EQL F;  4E7Z A;  3ABM C;  4U9E A;  4NQF A;  1N1C A;  2XRH A;  4MQ9 F;  5A69 A;  3WG7 C;  1T5O A;  2AWY A;  2UUI A;  4JIO A;  2F22 A;  4YT2 A;  1Y6D A;  4PR9 A;  2WVN A;  1Z23 A;  3G4Z A;  3S9O A;  1YZC A;  4YWQ A;  3K7D A;  4DBQ A;  3GM1 A;  2J8W A;  3M4C A;  1OR3 A;  2DYS C;  4IGG A;  4CDY A;  3TUL A;  1WAT A;  4DOZ A;  4C7O B;  4IAQ A;  2A69 F;  2XLD A;  1JAF A;  1YA9 A;  1JR8 A;  1PV3 A;  3GM2 A;  4RBN A;  1H6G A;  4BPM A;  2KW3 C;  4KNW A;  5KYX B;  5E2Q A;  1H9G A;  3DAG A;  3FMS A;  2IXN A;  1EKY A;  4FES A;  3RW0 A;  3K1I A;  4AX2 A;  1C17 M;  1QZX A;  3U2L A;  3EGX A;  3ZWI A;  4CS8 C;  3H65 A;  3M4B A;  4XPY A;  3R7C A;  2XXA B;  3T6J A;  3S0X A;  3ABL C;  1HW1 A;  4JCZ A;  4O6Y A;  3VF0 A;  5CIV A;  3IQT A;  2YWA A;  3EG9 B;  4BJ1 A;  5AGF A;  1GM5 A;  4HFF B;  3RYL A;  5IY5 C;  1WGW A;  2E87 A;  3W4Y A;  1ZU5 A;  4XLN F;  3JYY A;  2V3C C;  2R9R B;  2NSF A;  2D4U A;  2VC9 A;  4E0H A;  2KJG A;  3S29 A;  3PCV A;  5L0I A;  3V5Z A;  2MWQ A;  3NYJ A;  2HJ3 A;  2XSE A;  3LUT B;  2C04 A;  3ZC4 A;  3U3B A;  5BUO A;  3KL4 A;  4O6N A;  1LM3 B;  4WGY A;  3L1M A;  4WJ0 A;  2OG2 A;  3ZG1 A;  4CS9 C;  3EFO A;  2W4B A;  2XM0 A;  5F28 E;  3K66 A;  3EHN A;  2A0B A;  4AL1 A;  2J7P A;  4KC9 A;  1FNT c;  1OW8 A;  1ZU4 A;  2HV7 A;  1JPJ A;  1R4T A;  4U5G A;  3ZQV A;  4CIP A;  1OKK A;  1JOG A;  5L3V A;  2RD9 A;  2P6V A;  3VYW A;  2YZS A;  4LLC A;  1ORS C;  2HSB A;  5B3I A;  3B9Q A;  4ER9 A;  4ONS A;  4C7O A;  2AVK A;  3GOD A;  3C18 A;  4QI0 A;  2ASR A;  2R7Q A;  4U9D A;  2CYD A;  2NPU A;  2P1A A;  5GPG B;  2I8B A;  2VB6 A;  1I4Z A;  3KYJ A;  3LLK A;  2AWC A;  4MW3 A;  2A0U A;  4EUK B;  3UGO A;  2TMV P;  4IAR A;  1NSG B;  1VYI A;  1VB5 A;  1M2O A;  4OIQ F;  4IJJ A;  1ZW3 A;  4YL3 A;  4CX9 A;  4X0R A;  2HMZ A;  3DZA A;  2XL6 A;  4Q5S F;  1D0Y A;  3LNM B;  1CPR A;  3EG9 A;  2FFH A;  3DWW A;  1A7D A;  3F46 A;  3M1C B;  2R03 A;  1NFO A;  4K0D A;  1A41 A;  1IZM A;  3QW1 A;  4PJM A;  2WZG A;  4PFO A;  2O9X A;  3U9J A;  4EKW A;  3W8I A;  5BQG A;  3F47 A;  4MND A;  1ORY A;  4BJT A;  3K6B A;  2LIG A;  3R2P A;  2J9B A;  4K7B A;  1WOL A;  3SP1 A;  5BQI A;  2R7X A;  3JRM O;  3CSK A;  4CBE A;  2YL7 A;  2IXP A;  2BE5 F;  2IM8 A;  5F5F A;  5KYW B;  3C8G B;  2Q9A A;  1BZ4 A;  1XZQ A;  3LS1 A;  1I5N A;  4QI2 A;  3QVY A;  3K1H A;  3GEE A;  2B0H A;  2WZF A;  5E3C A;  3T6B A;  4E17 A;  5B1B C;  1TFK B;  2IYL D;  1AVO B;  2A1D D;  3AOU A;  3LJB A;  4N06 A;  2R7V A;  3DM9 B;  4MVM A;  5COF A;  1VOM A;  2EIK C;  4W8K A;  3Q6M A;  4MW8 A;  3LES A;  2DYR C;  4R32 A;  2Z15 A;  2IXM A;  2LSE A;  2ZXR A;  3W8H A;  2IXO A;  1SF8 A;  3DJN B;  3RFY A;  4CJO A;  1AEP A;  3OA1 A;  4O79 A;  1YAR O;  2LFF A;  3FVY A;  4HEA J;  5E33 A;  3WOD F;  5AC4 A;  2YVK A;  3LLI A;  1ZHW A;  1W2W A;  1E85 A;  2KNH A;  4PK4 A;  2VCB A;  5DQZ A;  1V54 C;  1H7I A;  2J9U A;  4LAC B;  4IB4 A;  3TJ5 A;  1CGN A;  4G7Z F;  5D92 A;  1EA8 A;  2LK4 A;  4GQH A;  2NUT B;  2EIN C;  2YKZ A;  5DQT A;  4J30 B;  1YZA A;  3TK0 A;  1A7V A;  2Q00 A;  4GEH A;  3T4R A;  3TOL A;  1BBH A;  2PP4 A;  3Q7L A;  1BR1 A;  2ZXW C;  3M15 A;  1XWJ A;  4RD9 A;  4GYT A;  4XTK A;  3IPM O;  3SEO A;  3T6G B;  4G7O F;  5B3S C;  1VTM P;  1CGO A;  3C63 A;  1OCZ C;  1O5H A;  4E0I A;  1U6H A;  2UUH A;  5JT4 A;  5KYW A;  3GAN A;  4NTA A;  2CNW D;  3DJU B;  4PJJ A;  1VLT A;  2J9V A;  4QDL A;  4OD5 A;  4Q7C A;  4XWJ A;  2J46 A;  3U9M A;  1F1M A;  1LI7 A;  1VYK A;  3G50 A;  4NCQ A;  3X2Q C;  4DVZ A;  2YL0 A;  2R25 A;  3B71 A;  3V5X A;  2YLG A;  1L3P A;  1KU2 A;  3AG4 C;  3KPH A;  3O39 A;  1OCC C;  2X0C A;  2ZXO A;  1K05 A;  3EFO B;  4E7S A;  3SXK A;  4AL0 A;  1G4W R;  1JRA A;  2WZL A;  1BR4 A;  2W4M A;  3DMD A;  1E2X A;  4U5B E;  4L6R A;  1MMD A;  2OEV A;  1L7C A;  1HE9 A;  3KH2 A;  4H54 A;  1DOV A;  5T1D B;  1TKN A;  2KQ9 A;  5A6B D;  2CGE A;  5A6A A;  1APC A;  4FX5 A;  3HNK A;  4J7Y A;  4A4A A;  5L0H A;  3EGD B;  3NRH A;  4IRU A;  5JRA A;  1LI5 A;  4LDK A;  2CW0 F;  1TWG A;  3O55 A;  4JVS A;  3PMR A;  2R7U A;  2QNL A;  3X1O A;  3UMH A;  3RH3 A;  3UMI A;  2HSQ A;  1NBB A;  1QVX A;  3A9C A;  2NUT A;  3ZDL A;  3ZIB A;  3POV A;  3AQC A;  3C7J A;  1FMW A;  1NU7 D;  4JEB A;  2OQM A;  2YLI A;  1ZHX A;  4A2N B;  2PNO A;  5AC5 A;  5L0D A;  4Q4Z F;  1YYX A;  1OW7 A;  4MVS A;  3B0P A;  4N6C A;  2XS8 A;  2W45 A;  2Q4F A;  4XPW A;  1B68 A;  2LFD A;  1YA7 O;  3LS0 A;  1OW6 A;  1RKE A;  2YQY A;  3AJM A;  3SZR A;  1CGM E;  4NTF A;  4KI2 A;  3VAY A;  1U0B B;  1Q0M A;  3JTL O;  3A11 A;  2QLA A;  3UMK A;  5TJ5 E;  2R7W A;  2JX0 A;  1Q0D A;  4YK5 A;  1C02 A;  1K40 A;  1TQG A;  5L0G A;  3MFN A;  4FWV A;  3AG2 C;  2VCC A;  2PBE A;  3B29 A;  1AUE A;  3DE9 A;  2DI3 A;  3IEE A;  2Y3G A;  1LE2 A;  1J8M F;  1R5I D;  1S05 A;  2OCC C;  4PAC A;  4CDA A;  3K1I C;  2CCY A;  2B0J A;  3AG3 C;  4RDA A;  5L0C A;  2GDC A;  3US6 A;  4J7T A;  4MS2 A;  3W2W A;  4CDV A;  1M2V A;  4HFK B;  5DS4 A;  1ST6 A;  4B6I A;  1BR2 A;  3T9O A;  2Q9B A;  5JUA A;  3EGD A;  1YDI A;  1YAU O;  4YL1 A;  1G8X A;  2P61 A;  3AQB A;  3EZH A;  2OEX A;  4LDQ A;  1YJG A;  2PX3 A;  3RF3 A;  5K0I A;  2R7T A;  4G78 A;  1QSP A;  4JTD B;  4BJ5 A;  3JCU Q;  4NTB A;  3ZQY A;  1FFH A;  2R05 A;  1G5Z A;  3JSZ A;  5JLI A;  4IWB A;  2OU6 A;  3C62 A;  1ORJ A;  4MVR A;  1ZYR F;  3DAF A;  4CSA A;  4N4W A;  3EHM A;  2I15 A;  4ULW A;  4LER A;  4EBK A;  3AGU A;  3LEV A;  4JE9 A;  1Z3I X;  2EPN A;  2YL1 A;  1MMA A;  1FAP B;  2YEV A;  1J8Y F;  3NG1 A;  4KNV A;  4JZA A;  1OCO C;  1OR2 A;  2ZXP A;  2OJQ A;  3SYN A;  1OQC A;  2J45 A;  2PX0 A;  1MND A;  3HKK A;  3QW0 A;  3VRC A;  1ZHT A;  3ECS A;  4WGZ A;  1KNY A;  1GS9 A;  2KYH A;  1ZW2 A;  4MVO A;  3I5P A;  4BJ5 C;  3MYI A;  4I1O B;  1OXK A;  2MHR A;  1A7E A;  3IQ6 A;  2A6H F;  1YLM A;  4NY3 A;  4CS7 A;  2A6E F;  1ZVZ A;  3DE8 A;  1Z7Q c;  2FGY A;  1D0X A;  4EBJ A;  2CNW A;  4MTG A;  1WTY A;  4CSA C;  3TD7 A;  1UG7 A;  256B A;  2FAP B;  1TWA A;  2DB4 A;  2LCH A;  3FHD A;  5T3T A;  1LVK A;  1PD1 A;  3GWN A;  4H4K C;  2Y39 A;  3L0I A;  3QTH A;  3ZTZ A;  1E86 A;  3NYL A;  2XLW A;  3CQZ A;  2EIL C;  1T9K A;  1TWC A;  3RKO F;  2P7V A;  2EPO A;  3DKA A;  3ZVR A;  5A6B A;  4C3E A;  4YN0 B;  5BQH A;  3FOP A;  5DVW A;  1LS1 A;  3E9V A;  3U8P A;  1LKX A;  4ZLC A;  1D0Z A;  2EPL X;  1TR2 A;  3Q6N A;  1JMW A;  1HW2 A;  2GWW A;  4N6H A;  1Y4C A;  4XEV A;  1V74 B;  3U8V A;  1PCX A;  2LP4 A;  2XLV A;  2ZD9 A;  1E83 A;  4DBR A;  3MLG A;  4O7G A;  4U5E E;  4YT5 A;  1O87 A;  1ZZP A;  4MVQ A;  4YT8 A;  4KBL A;  5JS5 A;  2D5R B;  1EQ1 A;  4D4X A;  4W8P A;  2HJM A;  1MMN A;  1RJ9 A;  1VMA A;  1RKE B;  2OJE D;  2WVQ A;  3O6X A;  4I1M A;  4LDR A;  2BL2 A;  4ZLD A;  3BEH A;  1T01 A;  2KC3 A;  3NKD A;  4YJW A;  5DS6 A;  1OXB A;  1GGQ A;  3L8J A;  3LNR A;  3UGP A;  4BJ6 A;  3I4U A;  3FAJ A;  2EPK X;  2ICW G;  3EJN A;  4U5F E;  1K04 A;  2XLH A;  4Z9H A;  2Y3D A;  3HNI A;  1V55 C;  3MX3 A;  3KMI A;  2AP3 A;  1Q0K A;  1QPU A;  1RCP A;  1Z5Z A;  2XM4 A;  5D91 A;  1TFO B;  3V7O A;  3GM3 A;  2EIJ C;  3HNJ A;  4FAP B;  1Z63 A;  2PF4 E;  2VH3 A;  4MVZ A;  3UR3 C;  4JJF A;  4G7H F;  3G4X A;  2P0N A;  4K1O A;  1SZI A;  4P9T A;  3RQG A;  5E3A A;  1M2V B;  4UDV A;  2YLD A;  2L9J A;  3EPV A;  3HNL A;  3JYH A;  5A6K A;  5COM A;  5F5H A;  3AGT A;  2W9Y A;  1VK5 A;  4PFP A;  2GFH A;  1A0B A;  2YL3 A;  3LEO A;  3NYM A;  1M57 C;  4NC3 A;  4JUR I;  1FFT C;  2H7V C;  4C3B A;  1QKR A;  3HLZ A;  3CEX A;  4DRI B;  2WVO A;  3ASN C;  4Z9J A;  2H7B A;  4CS8 A;  2JPU A;  4M63 A;  3N24 A;  2XS1 A;  2VCA A;  4XQ1 A;  3NKE A;  3GEH A;  4AK9 A;  4MTO A;  2KSF A;  1V4A A;  3ASO C;  3V5Y A;  1OCR C;  3GEI A;  4O6M A;  2HMQ A;  1MMG A;  5CI8 A;  1U89 A;  2HS5 A;  1C03 A;  2M4E A;  3FXH A;  1TWH A;  4EHP A;  2R7O A;  4OIN F;  2DGJ A;  1Z6A A;  3N0T A;  1XZP A;  2YHS A;  2Q7R A;  2L7A A;  5JSL A;  3S90 A;  1FR0 A;  3L34 A;  5EGY A;  2G62 A;  4OIP F;  3H2U A;  2PFD A;  3SNH A;  4CS9 A;  4P6I C;  3QVZ A;  4PJN A;  5COG A;  2IOQ A;  3HJC A;  2XLE A;  2Y3B A;  1D1C A;  3CZ6 A;  1PD0 A;  1HY5 A;  1FMV A;  2HKV A;  3EH2 A;  3QMK A;  4I3M A;  4MVU A;  3GOR A;  4XEK A;  4BEM J;  4XEF A;  3OEO A;  3C8G D;  4DJ9 A;  1GQA A;  2NUP A;  4PJL A;  4Z9I A;  1UFB A;  2WL8 A;  2Q3T A;  4AE4 B;  4JRZ A;  3ZSU A;  5JP7 A;  3SXY A;  1YVI A;  4G0H A;  1NG1 A;  1M6T A;  3E70 C;  4OD4 A;  2L6F A;  5KYU B;  4OIO F;  2QE9 A;  1MQV A;  4YL0 A;  2Q9C A;  5L3Q A;  1HE1 A;  2J0W A;  3N2Z B;  1LIH A;  1LPE A;  2H8A A;  5CI9 A;  3U3F A;  4JTC B;  3B0U X;  5HSW A;  3RIP A;  3U2M A;  1QQ3 A;  3RVY A;  3MYF A;  4XPX A;  3MBG A;  2Y69 C;  3VM6 A;  3OWT A;  1CPQ A;  3RQE A;  1YYJ A;  3UNG C;  3WAQ A;  1NLX A;  3FAP B;  3FOO A;  3H2V A;  3CAX A;  2LQG A;  3KKB A;  1RJ9 B;  2RSE B;  3TQO A;  5EK0 A;  3ITF A;  2BC5 A;  1O3U A;  3JT1 A;  2HV6 A;  1D1A A;  1Q0G A;  4JCH A;  3SXZ A;  3U5S A;  5KYX A;  2QUP A;  2A68 F;  2IBF A;  2OKU A;  3IQ5 A;  2EPM X;  4WAB A;  3JSE O;  3TOM A;  4BEJ A;  2R02 A;  2XXA A;  3FDQ A;  1LS4 A;  5JVE A;  2L81 A;  2R7S A;  3U0C A;  1ZHY A;  5FCL A;  2NG1 A;  1MNE A;  1HMD A;  3W2V A;  1G4U S;  3ZTM A;  1HMO A;  2AU5 A;  2NSG A;  3NMK A;  3GWL A;  1WN0 A;  5L0J A;  1E84 A;  4F4B A;  4E18 A;  3J06 A;  3DM5 A;  2VAS A;  4J32 B;  5B1A C;  5DLJ A;  4YT4 A;  2YRF A;  1DOW A;  4AE4 A;  3EH1 A;  3JRT A;  2XL4 A;  4JJG A;  1SR2 A;  3ATP A;  2WB7 A;  4OIR F;  4XLP F;  1RMV A;  3B0V C;  4D4N A;  4JTA B;  1WWP A;  2XLO A;  5KYY B;  4DXW A;  5KYU A;  3S28 A;  3Q7G A;  1T6U A;  2KK1 A;  2HUJ A;  1LE4 A;  1ZHZ A;  2G3K A;  2MYS A;  2EIM C;  2J7P D;  2QY9 A;  1WAS A;  4HE8 D;  2ZPA A;  4P9F A;  3S27 A;  1IW7 F;  1NZE A;  4IAO A;  4U5H A;  3RVZ A;  4DVY P;  2LD6 A;  3M79 A;  4CIH A;  3WHN A;  5EHH A;  2GAQ A;  1OKK D;  2R7R A;  3HTK C;  2H7O A;  4CJG A;  1M56 C;  2L6H A;  2X51 A;  2XL8 A;  3JZ0 A;  3KYI A;  4BG0 A;  1BDJ B;  3NDB B;  4LLE A;  1RKC A;  2J0X A;  5HV9 A;  3S84 A;  2QTV A;  4DRH B;  5KYN A;  1RXQ A;  2HFI A;  3LAY A;  2CDQ A;  2JD3 A;  3I5Q A;  2GA0 A;  3NMI A;  3DD7 A;  1D1B A;  5DS5 A;  4JW1 A;  2XLM A; 
#chains in the Genus database with same CATH homology
 2ETS A;  2IM8 A;  2HFI A;  2HUJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...