4IJJA

Structure of transcription factor dksa2 from pseudomonas aeruginosa
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
129
structure length
129
Chain Sequence
b'AEQELLAQPDAAYMDEAQQDFFRDLLLRQRQELQARIEGEFGELRDLERPSDEADLASREEQRQWQLRLLEREKKLLDKIDEALERLARGDYGWCQETGEPIGLRRLLLRPTATLCIEAKERQEKRERH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative C4-type zinc finger protein, DksA/TraR family
molecule tags Hydrolase
source organism Pseudomonas aeruginosa
publication title DksA2, a zinc-independent structural analog of the transcription factor DksA.
pubmed doi rcsb
total genus 42
structure length 129
sequence length 129
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01258 zf-dskA_traR Prokaryotic dksA/traR C4-type zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.910 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4ijjA00
2KGOA 4IJJA 2KQ9A
chains in the Genus database with same CATH superfamily
4I3MA 2AWYA 4JE9A 1RKEA 2LIGA 2P0NA 1VTMP 3C8ZA 2EIMC 3FOPA 1YAUO 2GA0A 4RBNA 1BZ4A 4JW1A 2IM8A 4P9FA 4EUKB 5KYYB 1K04A 2ZD9A 1SR2A 2XL6A 5CI9A 2ICWG 4XEVA 2C03A 5KYWB 4JKVA 2R7UA 4XQ1A 4X0RA 2WVNA 4CSAA 2DYRC 2IXNA 3M15A 3U2MA 2IYLD 2P6VA 3RIPA 2L6GA 2Q9BA 4HFFB 1D0XA 1ZHXA 1T6UA 1XWJA 3SXKA 4EHPA 1FR0A 5DQZA 2QE9A 2KSFA 3TJ6A 1D1BA 1EA8A 5JSLA 2H7VC 1CGNA 2YHSA 3AG4C 3E70C 3IQ5A 3QW0A 4IAOA 3UGOA 4E7ZA 2YKZA 2H7BA 2YVKA 1D0ZA 3G50A 3V5ZA 2CYDA 1HE9A 1VB5A 4IARA 4N4WA 1OCRC 2YL3A 1RKEB 2NPUA 4F4BA 4BEMJ 1NZEA 1KNYA 1MMGA 4LERA 1C17M 1H7IA 2PP4A 1ZHYA 3AGUA 256BA 4U5CE 3GEEA 1U89A 4JVSA 3RH3A 5L3VA 4D4NA 2YLGA 4RD9A 3ZWIA 4CS8A 3FHDA 1D0YA 4G78A 4XLNF 1YA9A 3EG9B 3U2LA 1YZCA 4C3DA 3GODA 3KMIA 2KNHA 1M2VB 3S27A 4Z9HA 1BR4A 1ST6A 2PFDA 2Q9CA 2QNLA 3K6BA 3TJ5A 3VRCA 3CAXA 4AK9A 3LS1A 1I5NA 3SXZA 1LM3B 2B0HA 4MTGA 3MLGA 3HJCA 4KNVA 4FWVA 4MS2A 2XRHA 3LLKA 4PJMA 1MMNA 2HMZA 4JURI 5A6JA 1UG7A 4ULVA 5JT4A 1AEPA 2EINC 4AL0A 2LSEA 1IZMA 1WATA 1L7CA 3JYHA 3O10A 4XEKA 4BJ1A 2R05A 2WZLA 1XZQA 3GM2A 2YLDA 2R7QA 3HNLA 3T4RA 1BR2A 3LESA 3VAYA 4FESA 2XLMA 5FZTA 3RW0A 2CW0F 4UDVA 5AC4A 3JRTA 1VOMA 1NU9C 1A41A 1H6GA 2IXPA 2NUTB 4PJJA 5BQIA 2LFFA 4MW3A 3ZTMA 1FAPB 5B1BC 3TOMA 3ASOC 4K7BA 3SP1A 4DRIB 2EPOA 1T9KA 3KPHA 1Z5ZA 2KJGA 1ZW3A 2XLOA 2R02A 3QW1A 4Q7CA 3S9OA 3JSZA 1CPQA 2CNWA 1QSPA 3ZVRA 3S0XA 2PF4E 2L6FA 1T6IA 2EIJC 2LK4A 4A4AA 5DVWA 3WAQA 3G4ZA 3RQFA 2HKVA 5K0IA 1KU2A 2BC5A 3ZQVA 2CNWD 1OQCA 3W2VA 3LEVA 3C8GA 4J7YA 3NKDA 5AC5A 3VM6A 5JS5A 1Z7Qc 3U0CA 4I1MA 2QTVA 2YL0A 4OIQF 3ZG1A 4CDVA 5KYWA 1BR1A 3PMRA 2OKUA 1MNDA 5DS5A 4FX5A 1SMYF 1RMVA 2Q7RA 4EBKA 3T9OA 3MFNA 3S29A 3ZDLA 2A0BA 3GM1A 1E84A 1RKCA 3K66A 2XL4A 4JTDB 1V74B 3ECSA 2KQ9A 3SNHA 4U5BE 3FDQA 2AP3A 3EFOB 3FAPB 2YLIA 1FNTc 3AG2C 2GDCA 4H4KC 2XXAB 4E7SA 2L9JA 2E87A 2Y3DA 3K1IC 3RYLA 1J8YF 4E17A 2EPLX 1U0BB 1U6HA 1SF8A 3US6A 1MQVA 3ABMC 3OA1A 4E0HA 1ZHWA 4FAPB 3UMIA 2NG1A 3A9CA 4YT2A 1I4YA 4CIHA 2YL7A 2BL2A 3EHNA 4DOZA 1GS9A 4C7OA 2X51A 2WZGA 4NCQA 3B29A 3K1HA 3G4XA 4YL1A 3UR3C 1YZAA 1S7ZA 3LLIA 4O7GA 1N1CA 4KI2A 2G62A 2PX3A 2H8AA 5F5HA 1YYJA 3DXJF 4U5DE 1TKNA 4PACA 4KNWA 1S05A 5T1DB 2JPUA 3S28A 1TWGA 3O39A 4O79A 2X0CA 4E18A 3O55A 5T3WA 1R5ID 2HMQA 3ZQYA 1LVKA 2VCBA 4J30B 4AE4B 2OQMA 5A69A 1MNEA 3DZAA 4HEAJ 4EBJA 3EZIA 3TQOA 2R7XA 4RDAA 1LKXA 5E3CA 3QVYA 5A6KA 4YL0A 3WG7C 1ORYA 4Q4ZF 4CJGA 3NMJA 1HMOA 2A68F 4DBRA 3IPMO 1LE2A 2NUPA 1EQ1A 5TJ5E 4C7OB 3R7CA 5B3SC 3HNJA 4MVOA 1FMVA 4ANJA 3S84A 2LD6A 2R7VA 2WVQA 4CDAA 3DM5A 2EPKX 2HSQA 1H9GA 1OCOC 3DE8A 3JRMO 2EIKC 3Q7LA 2KK1A 5E3AA 3WODF 5EHHA 3C7JA 4LDQA 4WABA 3DWWA 5BQHA 1Z3IX 2CGEA 2DGJA 2QLAA 2VCCA 3B0PA 3LS0A 3QZCA 3TD7A 4CJOA 1YA7O 2V26A 3DJNB 3LJBA 4I1OB 1B68A 3NRHA 1QQ3A 2W4BA 1YJGA 3DI5A 2OJQA 3K33A 1HMDA 3PHF2 2J45A 4BPMA 4DVZA 4YWQA 4QI2A 4NQFA 4AE4A 3U3FA 4BJ5A 2LQGA 4OD5A 2VH3A 2PNOA 4I44A 3GWNA 3ITFA 4OIOF 1M56C 1A7EA 3DAFA 3ABLC 2NSFA 2J7PD 1ZU4A 1OCZC 2MWQA 5EK0A 1PD0A 3X2QC 3RVZA 1OXBA 2XLVA 2NSGA 3M4BA 2J9UA 4EIYA 2UUHA 5HV9A 4CDYA 5EGYA 3U8PA 1E85A 1FMWA 2HV6A 2OJED 3F46A 4JTCB 1RCPA 2A6HF 3H65A 3DD7A 4O6MA 4N6HA 4G7ZF 1LS4A 1LIHA 2XL8A 2XM0A 4XPXA 3U3BA 2FFHA 2GFHA 2YEVA 1ZZPA 2G3VA 2XLHA 1OXKA 1Y6DA 2Y3BA 4WGYA 3RF3A 3N0TA 3EHMA 3M79A 3T6GB 4CSAC 4QDLA 1Z63A 1A7DA 1J8MF 3FXHA 3JTLO 4QI0A 4D4XA 2XLWA 3RKOF 4EBBA 5IY5C 1JR8A 4XEFA 4P6IC 3U8VA 3NMKA 4NTBA 1ORJA 2J0WA 3N2ZB 2OG2A 3HTKC 1F1MA 2D4UA 3L0IA 1DOWA 2YQYA 1VK5A 4GYTA 4KC9A 3SZRA 4LLCA 5BUOA 1ZYRF 2M64A 4PFPA 1WWPA 4PFOA 1LI5A 2Q3TA 5D91A 3CZ6A 3IEEA 4AL1A 2PBEA 3RQEA 2KW3C 2ZXOA 3LEOA 2GWWA 4U5FE 5JUAA 2VASA 1OKKA 3SXMA 1TQGA 1NG1A 1ZHZA 2B0JA 5BQGA 2MHRA 1TFOB 1EKYA 2J9BA 3L34A 2HJ3A 4IAQA 1M2VA 2EPNA 1WN0A 4CS9C 2HJMA 3QTHA 4GEHA 3NYJA 1K05A 1BDJB 1ORSC 4R32A 1G5ZA 1LE4A 3VYWA 2NUPB 3NKEA 2WB7A 4YT4A 3K7DA 5L3QA 4AX2A 5COFA 5COMA 2R7OA 3POVA 3DJUB 2L81A 3GEIA 3NDBB 2Q4FA 3AJMA 2AU5A 4PK4A 1PCXA 4PJLA 1G4WR 5E33A 3M4CA 1Q0MA 2A0UA 2FAPB 3R2PA 5FCLA 1O3UA 2EPMX 2IBFA 5A6BD 1M6TA 1MMAA 2Q9AA 5DQTA 3KYIA 2PX0A 4DXWA 2A1DD 4J32B 2IXMA 4G7HF 1WOLA 3RVYA 4BJ6A 3TK0A 2J9VA 3QVZA 3AG1C 2ETSA 2OU6A 3EGDA 4IB4A 4XWJA 3LAYA 1M2OA 3NYLA 2VC9A 1TWHA 3W2WA 4CBEA 5HSWA 3I5QA 4DRHB 1T5OA 4MVRA 1QPUA 1O87A 3T6JA 1GGQA 4ZLDA 5B3IA 2P7VA 1OKKD 4H54A 2R7WA 2RSEB 2XLDA 4MVQA 4NY3A 2ZXPA 3W8HA 1JPNA 3GANA 3GM3A 3JT1A 4U9DA 1FTSA 3C62A 5F5FA 1JAFA 1OR3A 1YYXA 3M1CB 3NG1A 4XLPF 4DJ9A 2Y39A 1RJ9B 2Z15A 3ABKC 1OCCC 1ZU5A 2HUJA 1QVXA 2P1AA 4C3EA 3CSKA 3E9VA 4JCHA 3B9QA 5KYXA 1NLXA 1JPJA 4KBLA 3JCUQ 3V5XA 3W8IA 4NTAA 1NBBA 3C8GD 5A6AA 1LI7A 2AWCA 5AGFA 3EH1A 4JCZA 4O6YA 4CX9A 2M4EA 3O6XA 1PV3A 4K1OA 5GPGB 2QUPA 3KKBA 4O6NA 4W8PA 4YN0B 4NTFA 1QKRA 1HE1A 3T6BA 1R4TA 3EGXA 3LNRA 4JJGA 1V55C 2R7RA 5CI8A 2WL8A 1YDIA 2XS1A 5JLIA 2W45A 4LDRA 4JEAA 4L6RA 4B6IA 1AUEA 3H2UA 4OINF 2F22A 1TWCA 3A11A 3LUTB 1ZHTA 1O5HA 1Y4CA 2GAQA 4M63A 4G7OF 3GEHA 4N6CA 3EZHA 2P61A 3IQTA 1H9TA 3UMKA 1OR2A 3JSEO 1OW8A 3AG3C 1D1AA 2HSBA 1NFNA 4MNDA 3TOLA 3MYFA 4MQ9F 1Z23A 2L7AA 3J06A 1TR2A 1JMWA 4MVSA 3Q6NA 1RXQA 3PDMP 1G8XA 2I15A 3V7OA 3EH2A 3L8JA 4IWBA 4J7TA 1T01A 4CS9A 2IOQA 5KYUB 3AQCA 2OOCA 3C63A 4E0IA 3HLZA 3EJNA 2BE5F 1Q0FA 2YZSA 1E83A 3IQ6A 3BRJA 2C04A 4LACB 2ASRA 2XM4A 1Z6AA 2XXAA 2H7OA 1VYIA 2R9RB 3ASNC 5T3TA 1ZVZA 4EWCA 3B0VC 2LCHA 3IHUA 4ZLCA 2J8WA 2A6EF 3SEOA 2YRFA 3UMHA 3JYYA 1QLEC 1VLSA 2AVKA 2D5RB 5F28E 3AOUA 2A69F 3UGPA 3L1MA 3U5SA 2KGOA 3NYMA 2EILC 4OD4A 1LS1A 2ZXWC 2YWAA 1FFHA 3GWLA 2HS5A 4MTOA 4BG0A 2I8BA 3ATPA 1CGOA 2OEXA 2WZFA 3DMDA 1C03A 4N06A 3VF0A 2DI3A 5DS4A 2XSEA 2R7SA 4IJJA 1OW7A 2JX0A 3GORA 1AVOB 1BBHA 1APCA 1E2XA 2FGYA 1JRAA 1VLTA 2KC3A 4ONSA 3SXYA 5KYNA 1HY5A 2CDQA 4CS7A 2Y3HA 1GM5A 1V4AA 4W8KA 1A7VA 4PR9A 4XPYA 2J7PA 1A0BA 2TMVP 1YVIA 3FAJA 4HE8D 1EI7A 1NU7D 1TFKB 3F47A 5COGA 3SYNA 2DB4A 4BEJA 2XS8A 2R03A 3ZTZA 4DBQA 3B0UX 5KYXB 3EFOA 1RJ9A 2ZXRA 1ZW2A 3C18A 2G3KA 3HKKA 1D1CA 3IQCA 4NC3A 4WGZA 4DVYP 3TULA 3K1IA 1E86A 1LPEA 2W9YA 5JVEA 4LLEA 3JZ0A 3MYIA 3Q6MA 3QMKA 3OEOA 1WTYA 4K0DA 4C3BA 5A6BA 4JZAA 3FVYA 3FOOA 3DKAA 4XPWA 3RFYA 5L0FA 3S90A 4WJ0A 3Q7GA 4BJTA 1PD1A 2XLEA 2Y3GA 2WVOA 4JIOA 4BJ6C 1YLMA 5L0HA 1G4US 1SYQA 2JD3A 3HNIA 1Q0DA 3KL4A 2DYSC 3LNMB 4LDKA 2IXOA 5DLJA 4OIPF 1KTMA 3C8GB 1SZIA 4MW8A 3RQGA 4U5GA 3ZSUA 5DS6A 4IGGA 3MBGA 1WGWA 3EQLF 4MTFA 3H2VA 4PJNA 4YJWA 3U9JA 1NFOA 3EGDB 4Z9JA 2HV7A 5KYUA 2KYHA 2LP4A 2OEVA 4XTKA 4OIRF 2O9XA 5L0CA 3DM9B 2LFDA 1CPRA 3AQBA 3DAGA 1XZPA 4IRUA 4A2NB 1C02A 5JP7A 3DE9A 4CS8C 2QY9A 2VB6A 1IW7F 4G0HA 1M57C 4MVMA 4P9TA 1T6QA 2Y69C 3N24A 4YT5A 3V5YA 2HZ8A 1Q0KA 3KH2A 4JTAB 4JRZA 2NUTA 1Q0GA 3BEHA 3U9MA 1V54C 1FFTC 3NMIA 4GQHA 3X1OA 1I4ZA 1DOVA 3L8IA 1HW2A 4EKWA 4YT8A 3PCVA 1UFBA 3W4YA 3CQZA 1L3PA 1W2WA 1TWAA 4ULWA 2J0XA 1VYKA 4MVUA 2MYSA 3KYJA 2J46A 4U9EA 2RD9A 4DRJB 3FMSA 1K40A 4U5HA 3ZIBA 3CEXA 2HFIA 1HW1A 1OW6A 3EPVA 2W4MA 4ER9A 2R25A 2YL1A 3MX3A 4MVZA 2Q00A 4U5EE 1MMDA 1NSGB 5L0IA 5E2QA 1CGME 2V3CC 4YL3A 2UUIA 1QZXA 3EGXB 3AGTA 2CCYA 3WHNA 2OCCC 4BJ5C 5L0JA 1GQAA 2L6HA 3I4UA 4JJFA 4YK5A 4JC7A 3ZC4A 3UNGC 5CIVA 5L0DA 1VMAA 5D92A 4Z9IA 4Q5SF 3EG9A 2VCAA 5B1AC 5KYYA 1JOGA 3OWTA 2R7TA 1WASA 2J9WA 4HFKB 1YARO 5JRAA 3I5PA 2ZPAA 4CIPA 5L0GA 4JEBA 3HNKA 3B71A
chains in the Genus database with same CATH topology
4I3MA 2EIMC 4RBNA 4JW1A 5KYYB 5CI9A 5KYWB 2C03A 2R7UA 4X0RA 2WVNA 4CSAA 2DYRC 2IXNA 2IYLD 2P6VA 3RIPA 2Q9BA 4HFFB 1D0XA 1ZHXA 5DQZA 3UNGC 1D1BA 4BJ6A 5KYXA 2H7VC 3AG4C 2YHSA 4IAOA 3E70C 3UGOA 4E7ZA 2H7BA 1D0ZA 1OCRC 4F4BA 1NZEA 1MMGA 4LERA 2PP4A 4U5CE 1ZHYA 5L3VA 4JVSA 3RH3A 4RD9A 4CS8A 3FHDA 1D0YA 4XLNF 3EG9B 4C3DA 3GODA 3KMIA 2KNHA 1M2VB 3S27A 1BR4A 1ST6A 2PFDA 2Q9CA 3K6BA 4AK9A 3LS1A 3MLGA 3HJCA 4KNVA 4FWVA 2XRHA 3LLKA 4PJMA 1MMNA 4JURI 2EINC 2LSEA 1IZMA 3JYHA 4BJ1A 2WZLA 2R7QA 3T4RA 1BR2A 3LESA 3VAYA 4FESA 2CW0F 3JRTA 1VOMA 1NU9C 2NUTB 2IXPA 4PJJA 5B1BC 3ASOC 4K7BA 3SP1A 1Z5ZA 2KJGA 4Q7CA 3JSZA 2CNWA 3ZVRA 3S0XA 2PF4E 2EIJC 5DVWA 1KU2A 2CNWD 3W2VA 3LEVA 3NKDA 4I1MA 2QTVA 4OIQF 3ZG1A 5KYWA 1BR1A 3PMRA 5DS5A 1MNDA 4FX5A 1SMYF 3S29A 3K66A 2XL4A 3ECSA 2KQ9A 3SNHA 4U5BE 3FDQA 3EFOB 3AG2C 4H4KC 2XXAB 4E7SA 2L9JA 2E87A 2Y3DA 3K1IC 3RYLA 1J8YF 1SF8A 3ABMC 3OA1A 1ZHWA 3UMIA 2NG1A 4YT2A 4CIHA 3EHNA 4DOZA 4C7OA 2X51A 2WZGA 3K1HA 3UR3C 3LLIA 1S7ZA 4O7GA 1N1CA 4KI2A 2G62A 2PX3A 5F5HA 3DXJF 4U5DE 1TKNA 4KNWA 5T1DB 3S28A 1TWGA 3O39A 4O79A 5T3WA 1LVKA 4AE4B 4J30B 1MNEA 3DZAA 4HEAJ 3EZIA 2R7XA 4RDAA 1LKXA 5E3CA 3WG7C 4Q4ZF 2A68F 4DBRA 2NUPA 4C7OB 5B3SC 1FMVA 4ANJA 2R7VA 2WVQA 3DM5A 1OCOC 2EIKC 3Q7LA 5E3AA 3WODF 5EHHA 1Z3IX 2CGEA 2DGJA 3LS0A 3B0PA 3QZCA 3TD7A 2V26A 3DJNB 3LJBA 4I1OB 3NRHA 2W4BA 3K33A 3PHF2 2J45A 4DVZA 4YWQA 4QI2A 4AE4A 4BJ5A 4OD5A 2VH3A 4I44A 3ITFA 4OIOF 1M56C 3DAFA 3ABLC 2J7PD 1ZU4A 1OCZC 2MWQA 1PD0A 3X2QC 2J9UA 5EGYA 1FMWA 2HV6A 3F46A 2A6HF 3H65A 3DD7A 4O6MA 4G7ZF 2FFHA 2GFHA 2YEVA 2G3VA 2Y3BA 3N0TA 3EHMA 4CSAC 4QDLA 1Z63A 1J8MF 4QI0A 3RKOF 4EBBA 5IY5C 4P6IC 2J0WA 3N2ZB 2OG2A 3HTKC 3L0IA 4KC9A 3SZRA 4GYTA 1VK5A 5BUOA 4LLCA 1ZYRF 4PFPA 4PFOA 2Q3TA 5D91A 3CZ6A 3IEEA 2KW3C 2ZXOA 4U5FE 2VASA 1OKKA 1NG1A 1ZHZA 2B0JA 3L34A 1M2VA 4CS9C 4GEHA 3NYJA 3VYWA 2NUPB 3NKEA 2WB7A 4YT4A 3K7DA 5L3QA 4AX2A 2R7OA 3POVA 3DJUB 2L81A 3NDBB 4PK4A 1PCXA 4PJLA 5E33A 5FCLA 1MMAA 2Q9AA 5DQTA 2PX0A 2A1DD 4J32B 2IXMA 4G7HF 5KYUB 2J9VA 3AG1C 3EGDA 4XWJA 3LAYA 1M2OA 3NYLA 3W2WA 1TWHA 4CBEA 5HSWA 3I5QA 1O87A 3T6JA 4ZLDA 2P7VA 1OKKD 2R7WA 4NY3A 2ZXPA 3W8HA 1JPNA 3GANA 3JT1A 1FTSA 5F5FA 4XLPF 3M1CB 3NG1A 2Y39A 1RJ9B 2Z15A 3ABKC 1OCCC 1ZU5A 4C3EA 3CSKA 3E9VA 4JCHA 3B9QA 1JPJA 4KBLA 3JCUQ 3W8IA 3EH1A 4O6YA 2M4EA 3O6XA 3KKBA 4O6NA 4YN0B 3T6BA 3LNRA 3EGXA 4JJGA 1V55C 2R7RA 5CI8A 2WL8A 2W45A 4B6IA 4OINF 1TWCA 1ZHTA 1O5HA 4M63A 4G7OF 3EZHA 3UMKA 3AG3C 1D1AA 4MNDA 4MQ9F 1Z23A 1TR2A 3Q6NA 1G8XA 3V7OA 3EH2A 4IWBA 4CS9A 2IOQA 3AQCA 3HLZA 3EJNA 2BE5F 2YZSA 2C04A 4LACB 1Z6AA 2XXAA 2H7OA 1VYIA 3ASNC 5T3TA 4EWCA 3B0VC 4ZLCA 2A6EF 3SEOA 3UMHA 1QLEC 2D5RB 2A69F 3UGPA 2KGOA 3NYMA 2EILC 4OD4A 1LS1A 2ZXWC 1FFHA 4BG0A 2I8BA 2WZFA 3DMDA 4N06A 5DS4A 2XSEA 2R7SA 4IJJA 2FGYA 5KYNA 2CDQA 4CS7A 2Y3HA 4W8KA 2J7PA 3FAJA 4HE8D 1NU7D 3F47A 4DBQA 3SYNA 4BEJA 3B0UX 5KYXB 3EFOA 1RJ9A 2ZXRA 4DVYP 2G3KA 1D1CA 2W9YA 4LLEA 3Q6MA 3QMKA 4K0DA 4C3BA 3OEOA 4JZAA 3FVYA 3RFYA 4WJ0A 3Q7GA 4BJTA 1PD1A 2Y3GA 2WVOA 4BJ6C 2JD3A 5DLJA 3KL4A 4OIPF 2DYSC 2IXOA 1SZIA 3ZSUA 4U5GA 5DS6A 1WGWA 3EQLF 4PJNA 4YJWA 3EGDB 2HV7A 5KYUA 4XTKA 4OIRF 2O9XA 3DM9B 3AQBA 3DAGA 4A2NB 4IRUA 4CS8C 2QY9A 2VB6A 1IW7F 4G0HA 1M57C 4YT5A 2Y69C 3N24A 3KH2A 2NUTA 1V54C 1FFTC 3X1OA 4YT8A 3CQZA 1W2WA 1TWAA 4ULWA 2J0XA 1VYKA 2MYSA 2J46A 3ZIBA 4U5HA 3EPVA 2W4MA 3MX3A 4U5EE 1MMDA 5E2QA 2V3CC 1QZXA 3EGXB 2OCCC 4BJ5C 3I4UA 4JJFA 3ZC4A 1VMAA 5D92A 4Q5SF 2R7TA 3EG9A 5B1AC 5KYYA 3OWTA 2J9WA 4HFKB 3I5PA 2ZPAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KGO A;  4IJJ A;  2KQ9 A; 
#chains in the Genus database with same CATH topology
 4I3M A;  2AWY A;  4JE9 A;  1RKE A;  2LIG A;  2P0N A;  1VTM P;  3C8Z A;  2EIM C;  3FOP A;  1YAU O;  2GA0 A;  4RBN A;  1BZ4 A;  4JW1 A;  2IM8 A;  4P9F A;  4EUK B;  5KYY B;  1K04 A;  2ZD9 A;  1SR2 A;  2XL6 A;  5CI9 A;  2ICW G;  4XEV A;  2C03 A;  5KYW B;  4JKV A;  2R7U A;  4XQ1 A;  4X0R A;  2WVN A;  4CSA A;  2DYR C;  2IXN A;  3M15 A;  3U2M A;  2IYL D;  2P6V A;  3RIP A;  2L6G A;  2Q9B A;  4HFF B;  1D0X A;  1ZHX A;  1T6U A;  1XWJ A;  3SXK A;  4EHP A;  1FR0 A;  5DQZ A;  2QE9 A;  2KSF A;  3TJ6 A;  1D1B A;  1EA8 A;  5JSL A;  2H7V C;  1CGN A;  2YHS A;  3AG4 C;  3E70 C;  3IQ5 A;  3QW0 A;  4IAO A;  3UGO A;  4E7Z A;  2YKZ A;  2H7B A;  2YVK A;  1D0Z A;  3G50 A;  3V5Z A;  2CYD A;  1HE9 A;  1VB5 A;  4IAR A;  4N4W A;  1OCR C;  2YL3 A;  1RKE B;  2NPU A;  4F4B A;  4BEM J;  1NZE A;  1KNY A;  1MMG A;  4LER A;  1C17 M;  1H7I A;  2PP4 A;  1ZHY A;  3AGU A;  256B A;  4U5C E;  3GEE A;  1U89 A;  4JVS A;  3RH3 A;  5L3V A;  4D4N A;  2YLG A;  4RD9 A;  3ZWI A;  4CS8 A;  3FHD A;  1D0Y A;  4G78 A;  4XLN F;  1YA9 A;  3EG9 B;  3U2L A;  1YZC A;  4C3D A;  3GOD A;  3KMI A;  2KNH A;  1M2V B;  3S27 A;  4Z9H A;  1BR4 A;  1ST6 A;  2PFD A;  2Q9C A;  2QNL A;  3K6B A;  3TJ5 A;  3VRC A;  3CAX A;  4AK9 A;  3LS1 A;  1I5N A;  3SXZ A;  1LM3 B;  2B0H A;  4MTG A;  3MLG A;  3HJC A;  4KNV A;  4FWV A;  4MS2 A;  2XRH A;  3LLK A;  4PJM A;  1MMN A;  2HMZ A;  4JUR I;  5A6J A;  1UG7 A;  4ULV A;  5JT4 A;  1AEP A;  2EIN C;  4AL0 A;  2LSE A;  1IZM A;  1WAT A;  1L7C A;  3JYH A;  3O10 A;  4XEK A;  4BJ1 A;  2R05 A;  2WZL A;  1XZQ A;  3GM2 A;  2YLD A;  2R7Q A;  3HNL A;  3T4R A;  1BR2 A;  3LES A;  3VAY A;  4FES A;  2XLM A;  5FZT A;  3RW0 A;  2CW0 F;  4UDV A;  5AC4 A;  3JRT A;  1VOM A;  1NU9 C;  1A41 A;  1H6G A;  2IXP A;  2NUT B;  4PJJ A;  5BQI A;  2LFF A;  4MW3 A;  3ZTM A;  1FAP B;  5B1B C;  3TOM A;  3ASO C;  4K7B A;  3SP1 A;  4DRI B;  2EPO A;  1T9K A;  3KPH A;  1Z5Z A;  2KJG A;  1ZW3 A;  2XLO A;  2R02 A;  3QW1 A;  4Q7C A;  3S9O A;  3JSZ A;  1CPQ A;  2CNW A;  1QSP A;  3ZVR A;  3S0X A;  2PF4 E;  2L6F A;  1T6I A;  2EIJ C;  2LK4 A;  4A4A A;  5DVW A;  3WAQ A;  3G4Z A;  3RQF A;  2HKV A;  5K0I A;  1KU2 A;  2BC5 A;  3ZQV A;  2CNW D;  1OQC A;  3W2V A;  3LEV A;  3C8G A;  4J7Y A;  3NKD A;  5AC5 A;  3VM6 A;  5JS5 A;  1Z7Q c;  3U0C A;  4I1M A;  2QTV A;  2YL0 A;  4OIQ F;  3ZG1 A;  4CDV A;  5KYW A;  1BR1 A;  3PMR A;  2OKU A;  1MND A;  5DS5 A;  4FX5 A;  1SMY F;  1RMV A;  2Q7R A;  4EBK A;  3T9O A;  3MFN A;  3S29 A;  3ZDL A;  2A0B A;  3GM1 A;  1E84 A;  1RKC A;  3K66 A;  2XL4 A;  4JTD B;  1V74 B;  3ECS A;  2KQ9 A;  3SNH A;  4U5B E;  3FDQ A;  2AP3 A;  3EFO B;  3FAP B;  2YLI A;  1FNT c;  3AG2 C;  2GDC A;  4H4K C;  2XXA B;  4E7S A;  2L9J A;  2E87 A;  2Y3D A;  3K1I C;  3RYL A;  1J8Y F;  4E17 A;  2EPL X;  1U0B B;  1U6H A;  1SF8 A;  3US6 A;  1MQV A;  3ABM C;  3OA1 A;  4E0H A;  1ZHW A;  4FAP B;  3UMI A;  2NG1 A;  3A9C A;  4YT2 A;  1I4Y A;  4CIH A;  2YL7 A;  2BL2 A;  3EHN A;  4DOZ A;  1GS9 A;  4C7O A;  2X51 A;  2WZG A;  4NCQ A;  3B29 A;  3K1H A;  3G4X A;  4YL1 A;  3UR3 C;  1YZA A;  1S7Z A;  3LLI A;  4O7G A;  1N1C A;  4KI2 A;  2G62 A;  2PX3 A;  2H8A A;  5F5H A;  1YYJ A;  3DXJ F;  4U5D E;  1TKN A;  4PAC A;  4KNW A;  1S05 A;  5T1D B;  2JPU A;  3S28 A;  1TWG A;  3O39 A;  4O79 A;  2X0C A;  4E18 A;  3O55 A;  5T3W A;  1R5I D;  2HMQ A;  3ZQY A;  1LVK A;  2VCB A;  4J30 B;  4AE4 B;  2OQM A;  5A69 A;  1MNE A;  3DZA A;  4HEA J;  4EBJ A;  3EZI A;  3TQO A;  2R7X A;  4RDA A;  1LKX A;  5E3C A;  3QVY A;  5A6K A;  4YL0 A;  3WG7 C;  1ORY A;  4Q4Z F;  4CJG A;  3NMJ A;  1HMO A;  2A68 F;  4DBR A;  3IPM O;  1LE2 A;  2NUP A;  1EQ1 A;  5TJ5 E;  4C7O B;  3R7C A;  5B3S C;  3HNJ A;  4MVO A;  1FMV A;  4ANJ A;  3S84 A;  2LD6 A;  2R7V A;  2WVQ A;  4CDA A;  3DM5 A;  2EPK X;  2HSQ A;  1H9G A;  1OCO C;  3DE8 A;  3JRM O;  2EIK C;  3Q7L A;  2KK1 A;  5E3A A;  3WOD F;  5EHH A;  3C7J A;  4LDQ A;  4WAB A;  3DWW A;  5BQH A;  1Z3I X;  2CGE A;  2DGJ A;  2QLA A;  2VCC A;  3B0P A;  3LS0 A;  3QZC A;  3TD7 A;  4CJO A;  1YA7 O;  2V26 A;  3DJN B;  3LJB A;  4I1O B;  1B68 A;  3NRH A;  1QQ3 A;  2W4B A;  1YJG A;  3DI5 A;  2OJQ A;  3K33 A;  1HMD A;  3PHF 2;  2J45 A;  4BPM A;  4DVZ A;  4YWQ A;  4QI2 A;  4NQF A;  4AE4 A;  3U3F A;  4BJ5 A;  2LQG A;  4OD5 A;  2VH3 A;  2PNO A;  4I44 A;  3GWN A;  3ITF A;  4OIO F;  1M56 C;  1A7E A;  3DAF A;  3ABL C;  2NSF A;  2J7P D;  1ZU4 A;  1OCZ C;  2MWQ A;  5EK0 A;  1PD0 A;  3X2Q C;  3RVZ A;  1OXB A;  2XLV A;  2NSG A;  3M4B A;  2J9U A;  4EIY A;  2UUH A;  5HV9 A;  4CDY A;  5EGY A;  3U8P A;  1E85 A;  1FMW A;  2HV6 A;  2OJE D;  3F46 A;  4JTC B;  1RCP A;  2A6H F;  3H65 A;  3DD7 A;  4O6M A;  4N6H A;  4G7Z F;  1LS4 A;  1LIH A;  2XL8 A;  2XM0 A;  4XPX A;  3U3B A;  2FFH A;  2GFH A;  2YEV A;  1ZZP A;  2G3V A;  2XLH A;  1OXK A;  1Y6D A;  2Y3B A;  4WGY A;  3RF3 A;  3N0T A;  3EHM A;  3M79 A;  3T6G B;  4CSA C;  4QDL A;  1Z63 A;  1A7D A;  1J8M F;  3FXH A;  3JTL O;  4QI0 A;  4D4X A;  2XLW A;  3RKO F;  4EBB A;  5IY5 C;  1JR8 A;  4XEF A;  4P6I C;  3U8V A;  3NMK A;  4NTB A;  1ORJ A;  2J0W A;  3N2Z B;  2OG2 A;  3HTK C;  1F1M A;  2D4U A;  3L0I A;  1DOW A;  2YQY A;  1VK5 A;  4GYT A;  4KC9 A;  3SZR A;  4LLC A;  5BUO A;  1ZYR F;  2M64 A;  4PFP A;  1WWP A;  4PFO A;  1LI5 A;  2Q3T A;  5D91 A;  3CZ6 A;  3IEE A;  4AL1 A;  2PBE A;  3RQE A;  2KW3 C;  2ZXO A;  3LEO A;  2GWW A;  4U5F E;  5JUA A;  2VAS A;  1OKK A;  3SXM A;  1TQG A;  1NG1 A;  1ZHZ A;  2B0J A;  5BQG A;  2MHR A;  1TFO B;  1EKY A;  2J9B A;  3L34 A;  2HJ3 A;  4IAQ A;  1M2V A;  2EPN A;  1WN0 A;  4CS9 C;  2HJM A;  3QTH A;  4GEH A;  3NYJ A;  1K05 A;  1BDJ B;  1ORS C;  4R32 A;  1G5Z A;  1LE4 A;  3VYW A;  2NUP B;  3NKE A;  2WB7 A;  4YT4 A;  3K7D A;  5L3Q A;  4AX2 A;  5COF A;  5COM A;  2R7O A;  3POV A;  3DJU B;  2L81 A;  3GEI A;  3NDB B;  2Q4F A;  3AJM A;  2AU5 A;  4PK4 A;  1PCX A;  4PJL A;  1G4W R;  5E33 A;  3M4C A;  1Q0M A;  2A0U A;  2FAP B;  3R2P A;  5FCL A;  1O3U A;  2EPM X;  2IBF A;  5A6B D;  1M6T A;  1MMA A;  2Q9A A;  5DQT A;  3KYI A;  2PX0 A;  4DXW A;  2A1D D;  4J32 B;  2IXM A;  4G7H F;  1WOL A;  3RVY A;  4BJ6 A;  3TK0 A;  2J9V A;  3QVZ A;  3AG1 C;  2ETS A;  2OU6 A;  3EGD A;  4IB4 A;  4XWJ A;  3LAY A;  1M2O A;  3NYL A;  2VC9 A;  1TWH A;  3W2W A;  4CBE A;  5HSW A;  3I5Q A;  4DRH B;  1T5O A;  4MVR A;  1QPU A;  1O87 A;  3T6J A;  1GGQ A;  4ZLD A;  5B3I A;  2P7V A;  1OKK D;  4H54 A;  2R7W A;  2RSE B;  2XLD A;  4MVQ A;  4NY3 A;  2ZXP A;  3W8H A;  1JPN A;  3GAN A;  3GM3 A;  3JT1 A;  4U9D A;  1FTS A;  3C62 A;  5F5F A;  1JAF A;  1OR3 A;  1YYX A;  3M1C B;  3NG1 A;  4XLP F;  4DJ9 A;  2Y39 A;  1RJ9 B;  2Z15 A;  3ABK C;  1OCC C;  1ZU5 A;  2HUJ A;  1QVX A;  2P1A A;  4C3E A;  3CSK A;  3E9V A;  4JCH A;  3B9Q A;  5KYX A;  1NLX A;  1JPJ A;  4KBL A;  3JCU Q;  3V5X A;  3W8I A;  4NTA A;  1NBB A;  3C8G D;  5A6A A;  1LI7 A;  2AWC A;  5AGF A;  3EH1 A;  4JCZ A;  4O6Y A;  4CX9 A;  2M4E A;  3O6X A;  1PV3 A;  4K1O A;  5GPG B;  2QUP A;  3KKB A;  4O6N A;  4W8P A;  4YN0 B;  4NTF A;  1QKR A;  1HE1 A;  3T6B A;  1R4T A;  3EGX A;  3LNR A;  4JJG A;  1V55 C;  2R7R A;  5CI8 A;  2WL8 A;  1YDI A;  2XS1 A;  5JLI A;  2W45 A;  4LDR A;  4JEA A;  4L6R A;  4B6I A;  1AUE A;  3H2U A;  4OIN F;  2F22 A;  1TWC A;  3A11 A;  3LUT B;  1ZHT A;  1O5H A;  1Y4C A;  2GAQ A;  4M63 A;  4G7O F;  3GEH A;  4N6C A;  3EZH A;  2P61 A;  3IQT A;  1H9T A;  3UMK A;  1OR2 A;  3JSE O;  1OW8 A;  3AG3 C;  1D1A A;  2HSB A;  1NFN A;  4MND A;  3TOL A;  3MYF A;  4MQ9 F;  1Z23 A;  2L7A A;  3J06 A;  1TR2 A;  1JMW A;  4MVS A;  3Q6N A;  1RXQ A;  3PDM P;  1G8X A;  2I15 A;  3V7O A;  3EH2 A;  3L8J A;  4IWB A;  4J7T A;  1T01 A;  4CS9 A;  2IOQ A;  5KYU B;  3AQC A;  2OOC A;  3C63 A;  4E0I A;  3HLZ A;  3EJN A;  2BE5 F;  1Q0F A;  2YZS A;  1E83 A;  3IQ6 A;  3BRJ A;  2C04 A;  4LAC B;  2ASR A;  2XM4 A;  1Z6A A;  2XXA A;  2H7O A;  1VYI A;  2R9R B;  3ASN C;  5T3T A;  1ZVZ A;  4EWC A;  3B0V C;  2LCH A;  3IHU A;  4ZLC A;  2J8W A;  2A6E F;  3SEO A;  2YRF A;  3UMH A;  3JYY A;  1QLE C;  1VLS A;  2AVK A;  2D5R B;  5F28 E;  3AOU A;  2A69 F;  3UGP A;  3L1M A;  3U5S A;  2KGO A;  3NYM A;  2EIL C;  4OD4 A;  1LS1 A;  2ZXW C;  2YWA A;  1FFH A;  3GWL A;  2HS5 A;  4MTO A;  4BG0 A;  2I8B A;  3ATP A;  1CGO A;  2OEX A;  2WZF A;  3DMD A;  1C03 A;  4N06 A;  3VF0 A;  2DI3 A;  5DS4 A;  2XSE A;  2R7S A;  4IJJ A;  1OW7 A;  2JX0 A;  3GOR A;  1AVO B;  1BBH A;  1APC A;  1E2X A;  2FGY A;  1JRA A;  1VLT A;  2KC3 A;  4ONS A;  3SXY A;  5KYN A;  1HY5 A;  2CDQ A;  4CS7 A;  2Y3H A;  1GM5 A;  1V4A A;  4W8K A;  1A7V A;  4PR9 A;  4XPY A;  2J7P A;  1A0B A;  2TMV P;  1YVI A;  3FAJ A;  4HE8 D;  1EI7 A;  1NU7 D;  1TFK B;  3F47 A;  5COG A;  3SYN A;  2DB4 A;  4BEJ A;  2XS8 A;  2R03 A;  3ZTZ A;  4DBQ A;  3B0U X;  5KYX B;  3EFO A;  1RJ9 A;  2ZXR A;  1ZW2 A;  3C18 A;  2G3K A;  3HKK A;  1D1C A;  3IQC A;  4NC3 A;  4WGZ A;  4DVY P;  3TUL A;  3K1I A;  1E86 A;  1LPE A;  2W9Y A;  5JVE A;  4LLE A;  3JZ0 A;  3MYI A;  3Q6M A;  3QMK A;  3OEO A;  1WTY A;  4K0D A;  4C3B A;  5A6B A;  4JZA A;  3FVY A;  3FOO A;  3DKA A;  4XPW A;  3RFY A;  5L0F A;  3S90 A;  4WJ0 A;  3Q7G A;  4BJT A;  1PD1 A;  2XLE A;  2Y3G A;  2WVO A;  4JIO A;  4BJ6 C;  1YLM A;  5L0H A;  1G4U S;  1SYQ A;  2JD3 A;  3HNI A;  1Q0D A;  3KL4 A;  2DYS C;  3LNM B;  4LDK A;  2IXO A;  5DLJ A;  4OIP F;  1KTM A;  3C8G B;  1SZI A;  4MW8 A;  3RQG A;  4U5G A;  3ZSU A;  5DS6 A;  4IGG A;  3MBG A;  1WGW A;  3EQL F;  4MTF A;  3H2V A;  4PJN A;  4YJW A;  3U9J A;  1NFO A;  3EGD B;  4Z9J A;  2HV7 A;  5KYU A;  2KYH A;  2LP4 A;  2OEV A;  4XTK A;  4OIR F;  2O9X A;  5L0C A;  3DM9 B;  2LFD A;  1CPR A;  3AQB A;  3DAG A;  1XZP A;  4IRU A;  4A2N B;  1C02 A;  5JP7 A;  3DE9 A;  4CS8 C;  2QY9 A;  2VB6 A;  1IW7 F;  4G0H A;  1M57 C;  4MVM A;  4P9T A;  1T6Q A;  2Y69 C;  3N24 A;  4YT5 A;  3V5Y A;  2HZ8 A;  1Q0K A;  3KH2 A;  4JTA B;  4JRZ A;  2NUT A;  1Q0G A;  3BEH A;  3U9M A;  1V54 C;  1FFT C;  3NMI A;  4GQH A;  3X1O A;  1I4Z A;  1DOV A;  3L8I A;  1HW2 A;  4EKW A;  4YT8 A;  3PCV A;  1UFB A;  3W4Y A;  3CQZ A;  1L3P A;  1W2W A;  1TWA A;  4ULW A;  2J0X A;  1VYK A;  4MVU A;  2MYS A;  3KYJ A;  2J46 A;  4U9E A;  2RD9 A;  4DRJ B;  3FMS A;  1K40 A;  4U5H A;  3ZIB A;  3CEX A;  2HFI A;  1HW1 A;  1OW6 A;  3EPV A;  2W4M A;  4ER9 A;  2R25 A;  2YL1 A;  3MX3 A;  4MVZ A;  2Q00 A;  4U5E E;  1MMD A;  1NSG B;  5L0I A;  5E2Q A;  1CGM E;  2V3C C;  4YL3 A;  2UUI A;  1QZX A;  3EGX B;  3AGT A;  2CCY A;  3WHN A;  2OCC C;  4BJ5 C;  5L0J A;  1GQA A;  2L6H A;  3I4U A;  4JJF A;  4YK5 A;  4JC7 A;  3ZC4 A;  3UNG C;  5CIV A;  5L0D A;  1VMA A;  5D92 A;  4Z9I A;  4Q5S F;  3EG9 A;  2VCA A;  5B1A C;  5KYY A;  1JOG A;  3OWT A;  2R7T A;  1WAS A;  2J9W A;  4HFK B;  1YAR O;  5JRA A;  3I5P A;  2ZPA A;  4CIP A;  5L0G A;  4JEB A;  3HNK A;  3B71 A; 
#chains in the Genus database with same CATH homology
 4I3M A;  2EIM C;  4RBN A;  4JW1 A;  5KYY B;  5CI9 A;  5KYW B;  2C03 A;  2R7U A;  4X0R A;  2WVN A;  4CSA A;  2DYR C;  2IXN A;  2IYL D;  2P6V A;  3RIP A;  2Q9B A;  4HFF B;  1D0X A;  1ZHX A;  5DQZ A;  3UNG C;  1D1B A;  4BJ6 A;  5KYX A;  2H7V C;  3AG4 C;  2YHS A;  4IAO A;  3E70 C;  3UGO A;  4E7Z A;  2H7B A;  1D0Z A;  1OCR C;  4F4B A;  1NZE A;  1MMG A;  4LER A;  2PP4 A;  4U5C E;  1ZHY A;  5L3V A;  4JVS A;  3RH3 A;  4RD9 A;  4CS8 A;  3FHD A;  1D0Y A;  4XLN F;  3EG9 B;  4C3D A;  3GOD A;  3KMI A;  2KNH A;  1M2V B;  3S27 A;  1BR4 A;  1ST6 A;  2PFD A;  2Q9C A;  3K6B A;  4AK9 A;  3LS1 A;  3MLG A;  3HJC A;  4KNV A;  4FWV A;  2XRH A;  3LLK A;  4PJM A;  1MMN A;  4JUR I;  2EIN C;  2LSE A;  1IZM A;  3JYH A;  4BJ1 A;  2WZL A;  2R7Q A;  3T4R A;  1BR2 A;  3LES A;  3VAY A;  4FES A;  2CW0 F;  3JRT A;  1VOM A;  1NU9 C;  2NUT B;  2IXP A;  4PJJ A;  5B1B C;  3ASO C;  4K7B A;  3SP1 A;  1Z5Z A;  2KJG A;  4Q7C A;  3JSZ A;  2CNW A;  3ZVR A;  3S0X A;  2PF4 E;  2EIJ C;  5DVW A;  1KU2 A;  2CNW D;  3W2V A;  3LEV A;  3NKD A;  4I1M A;  2QTV A;  4OIQ F;  3ZG1 A;  5KYW A;  1BR1 A;  3PMR A;  5DS5 A;  1MND A;  4FX5 A;  1SMY F;  3S29 A;  3K66 A;  2XL4 A;  3ECS A;  2KQ9 A;  3SNH A;  4U5B E;  3FDQ A;  3EFO B;  3AG2 C;  4H4K C;  2XXA B;  4E7S A;  2L9J A;  2E87 A;  2Y3D A;  3K1I C;  3RYL A;  1J8Y F;  1SF8 A;  3ABM C;  3OA1 A;  1ZHW A;  3UMI A;  2NG1 A;  4YT2 A;  4CIH A;  3EHN A;  4DOZ A;  4C7O A;  2X51 A;  2WZG A;  3K1H A;  3UR3 C;  3LLI A;  1S7Z A;  4O7G A;  1N1C A;  4KI2 A;  2G62 A;  2PX3 A;  5F5H A;  3DXJ F;  4U5D E;  1TKN A;  4KNW A;  5T1D B;  3S28 A;  1TWG A;  3O39 A;  4O79 A;  5T3W A;  1LVK A;  4AE4 B;  4J30 B;  1MNE A;  3DZA A;  4HEA J;  3EZI A;  2R7X A;  4RDA A;  1LKX A;  5E3C A;  3WG7 C;  4Q4Z F;  2A68 F;  4DBR A;  2NUP A;  4C7O B;  5B3S C;  1FMV A;  4ANJ A;  2R7V A;  2WVQ A;  3DM5 A;  1OCO C;  2EIK C;  3Q7L A;  5E3A A;  3WOD F;  5EHH A;  1Z3I X;  2CGE A;  2DGJ A;  3LS0 A;  3B0P A;  3QZC A;  3TD7 A;  2V26 A;  3DJN B;  3LJB A;  4I1O B;  3NRH A;  2W4B A;  3K33 A;  3PHF 2;  2J45 A;  4DVZ A;  4YWQ A;  4QI2 A;  4AE4 A;  4BJ5 A;  4OD5 A;  2VH3 A;  4I44 A;  3ITF A;  4OIO F;  1M56 C;  3DAF A;  3ABL C;  2J7P D;  1ZU4 A;  1OCZ C;  2MWQ A;  1PD0 A;  3X2Q C;  2J9U A;  5EGY A;  1FMW A;  2HV6 A;  3F46 A;  2A6H F;  3H65 A;  3DD7 A;  4O6M A;  4G7Z F;  2FFH A;  2GFH A;  2YEV A;  2G3V A;  2Y3B A;  3N0T A;  3EHM A;  4CSA C;  4QDL A;  1Z63 A;  1J8M F;  4QI0 A;  3RKO F;  4EBB A;  5IY5 C;  4P6I C;  2J0W A;  3N2Z B;  2OG2 A;  3HTK C;  3L0I A;  4KC9 A;  3SZR A;  4GYT A;  1VK5 A;  5BUO A;  4LLC A;  1ZYR F;  4PFP A;  4PFO A;  2Q3T A;  5D91 A;  3CZ6 A;  3IEE A;  2KW3 C;  2ZXO A;  4U5F E;  2VAS A;  1OKK A;  1NG1 A;  1ZHZ A;  2B0J A;  3L34 A;  1M2V A;  4CS9 C;  4GEH A;  3NYJ A;  3VYW A;  2NUP B;  3NKE A;  2WB7 A;  4YT4 A;  3K7D A;  5L3Q A;  4AX2 A;  2R7O A;  3POV A;  3DJU B;  2L81 A;  3NDB B;  4PK4 A;  1PCX A;  4PJL A;  5E33 A;  5FCL A;  1MMA A;  2Q9A A;  5DQT A;  2PX0 A;  2A1D D;  4J32 B;  2IXM A;  4G7H F;  5KYU B;  2J9V A;  3AG1 C;  3EGD A;  4XWJ A;  3LAY A;  1M2O A;  3NYL A;  3W2W A;  1TWH A;  4CBE A;  5HSW A;  3I5Q A;  1O87 A;  3T6J A;  4ZLD A;  2P7V A;  1OKK D;  2R7W A;  4NY3 A;  2ZXP A;  3W8H A;  1JPN A;  3GAN A;  3JT1 A;  1FTS A;  5F5F A;  4XLP F;  3M1C B;  3NG1 A;  2Y39 A;  1RJ9 B;  2Z15 A;  3ABK C;  1OCC C;  1ZU5 A;  4C3E A;  3CSK A;  3E9V A;  4JCH A;  3B9Q A;  1JPJ A;  4KBL A;  3JCU Q;  3W8I A;  3EH1 A;  4O6Y A;  2M4E A;  3O6X A;  3KKB A;  4O6N A;  4YN0 B;  3T6B A;  3LNR A;  3EGX A;  4JJG A;  1V55 C;  2R7R A;  5CI8 A;  2WL8 A;  2W45 A;  4B6I A;  4OIN F;  1TWC A;  1ZHT A;  1O5H A;  4M63 A;  4G7O F;  3EZH A;  3UMK A;  3AG3 C;  1D1A A;  4MND A;  4MQ9 F;  1Z23 A;  1TR2 A;  3Q6N A;  1G8X A;  3V7O A;  3EH2 A;  4IWB A;  4CS9 A;  2IOQ A;  3AQC A;  3HLZ A;  3EJN A;  2BE5 F;  2YZS A;  2C04 A;  4LAC B;  1Z6A A;  2XXA A;  2H7O A;  1VYI A;  3ASN C;  5T3T A;  4EWC A;  3B0V C;  4ZLC A;  2A6E F;  3SEO A;  3UMH A;  1QLE C;  2D5R B;  2A69 F;  3UGP A;  2KGO A;  3NYM A;  2EIL C;  4OD4 A;  1LS1 A;  2ZXW C;  1FFH A;  4BG0 A;  2I8B A;  2WZF A;  3DMD A;  4N06 A;  5DS4 A;  2XSE A;  2R7S A;  4IJJ A;  2FGY A;  5KYN A;  2CDQ A;  4CS7 A;  2Y3H A;  4W8K A;  2J7P A;  3FAJ A;  4HE8 D;  1NU7 D;  3F47 A;  4DBQ A;  3SYN A;  4BEJ A;  3B0U X;  5KYX B;  3EFO A;  1RJ9 A;  2ZXR A;  4DVY P;  2G3K A;  1D1C A;  2W9Y A;  4LLE A;  3Q6M A;  3QMK A;  4K0D A;  4C3B A;  3OEO A;  4JZA A;  3FVY A;  3RFY A;  4WJ0 A;  3Q7G A;  4BJT A;  1PD1 A;  2Y3G A;  2WVO A;  4BJ6 C;  2JD3 A;  5DLJ A;  3KL4 A;  4OIP F;  2DYS C;  2IXO A;  1SZI A;  3ZSU A;  4U5G A;  5DS6 A;  1WGW A;  3EQL F;  4PJN A;  4YJW A;  3EGD B;  2HV7 A;  5KYU A;  4XTK A;  4OIR F;  2O9X A;  3DM9 B;  3AQB A;  3DAG A;  4A2N B;  4IRU A;  4CS8 C;  2QY9 A;  2VB6 A;  1IW7 F;  4G0H A;  1M57 C;  4YT5 A;  2Y69 C;  3N24 A;  3KH2 A;  2NUT A;  1V54 C;  1FFT C;  3X1O A;  4YT8 A;  3CQZ A;  1W2W A;  1TWA A;  4ULW A;  2J0X A;  1VYK A;  2MYS A;  2J46 A;  3ZIB A;  4U5H A;  3EPV A;  2W4M A;  3MX3 A;  4U5E E;  1MMD A;  5E2Q A;  2V3C C;  1QZX A;  3EGX B;  2OCC C;  4BJ5 C;  3I4U A;  4JJF A;  3ZC4 A;  1VMA A;  5D92 A;  4Q5S F;  2R7T A;  3EG9 A;  5B1A C;  5KYY A;  3OWT A;  2J9W A;  4HFK B;  3I5P A;  2ZPA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...