4IJJA

Structure of transcription factor dksa2 from pseudomonas aeruginosa
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
129
structure length
129
Chain Sequence
AEQELLAQPDAAYMDEAQQDFFRDLLLRQRQELQARIEGEFGELRDLERPSDEADLASREEQRQWQLRLLEREKKLLDKIDEALERLARGDYGWCQETGEPIGLRRLLLRPTATLCIEAKERQEKRERH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Putative C4-type zinc finger protein, DksA/TraR family
publication title DksA2, a zinc-independent structural analog of the transcription factor DksA.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 42
structure length 129
sequence length 129
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01258 zf-dskA_traR Prokaryotic dksA/traR C4-type zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.910 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4ijjA00
2KGOA 4IJJA 2KQ9A
chains in the Genus database with same CATH superfamily
2BC5A 3LS0A 2WL8A 2L6FA 4JJFA 3RQFA 3SYNA 3I5PA 3L8JA 4O6NA 3HTKC 2IXMA 2JPUA 2YQYA 4HFFB 4WJ0A 1LE2A 1R5ID 3EJNA 1Y6DA 1KNYA 1QZXA 3C63A 3U9JA 4BJ6A 1SMYF 3SEOA 3IEEA 4KC9A 3EGDB 2C03A 2HMQA 5B3SC 5BUOA 2MYSA 1YYJA 4GQHA 4MVSA 1QPUA 1OKKD 3HNIA 1NFOA 3ZVRA 1SR2A 4ULVA 2R03A 1N1CA 2OU6A 1TWAA 4BJ6C 2J8WA 4BEJA 5KYYA 1TFOB 4O7GA 3DAGA 3FAJA 5KYUA 3IQCA 3NMIA 1E2XA 2KK1A 4BJTA 4FWVA 4J7TA 2NSFA 4N4WA 5DQZA 1TWCA 4EBBA 2NG1A 4CBEA 2G62A 1U6HA 3S28A 2Q3TA 4MVOA 1EI7A 4I44A 1M57C 2XM4A 4U5EE 1PV3A 3QW0A 5KYWB 1WOLA 4OIRF 3AG1C 1D1CA 2XLVA 2YRFA 3QTHA 5T1DB 5KYNA 2H7VC 1HW1A 3L1MA 2OKUA 4YL3A 4ER9A 4YL1A 2IYLD 1V54C 5AC4A 1LI7A 3ZSUA 4ZLDA 4PJMA 1S7ZA 1RKEB 1VK5A 1QQ3A 2IXNA 1NU9C 2XLHA 5FZTA 1V74B 2QTVA 3V5XA 1ZHTA 4MVRA 5A6JA 2I15A 5L3QA 3F46A 3WG7C 4BPMA 1T6QA 2MWQA 2KYHA 3A9CA 3G50A 4R32A 4YL0A 4JVSA 1VLTA 1YJGA 5JUAA 3DXJF 5DS5A 1F1MA 1I4YA 1OW8A 1SF8A 4IAQA 2FGYA 4JEBA 3U5SA 3T6GB 1LPEA 4XPWA 1T01A 2CGEA 4UDVA 5JRAA 1PD0A 1HW2A 1K40A 3B29A 1FFTC 2J7PA 3EGDA 3GWNA 5T3WA 3C8GA 3POVA 4AE4B 3IHUA 3K1IC 1A7DA 3SZRA 1M2OA 2GWWA 2VC9A 1WASA 2Y3GA 3DE9A 4NQFA 4P9TA 4OIPF 4Z9HA 1YLMA 4CJGA 3SXMA 2DGJA 5CI8A 3JRMO 4MVQA 2OCCC 5F5HA 2ZD9A 4G0HA 4XPXA 3DM5A 3NKDA 3UMKA 2E87A 2A6HF 2WZGA 3T6JA 1YZAA 3PCVA 2ZXPA 5T3TA 2XL8A 5JP7A 4W8PA 2LIGA 3IQTA 1H9GA 3LUTB 3GORA 1ZHWA 4P6IC 4MVZA 1ORSC 2AU5A 4A4AA 2W9YA 2J9VA 4GEHA 1ZHZA 2Y3BA 4FESA 1AEPA 2PF4E 3DM9B 1ST6A 2HJ3A 3FXHA 5KYWA 3J06A 1PCXA 4JURI 4JKVA 4IB4A 3IQ5A 3KYJA 5E33A 2TMVP 4CX9A 3FVYA 3RFYA 2PBEA 4K0DA 3H65A 3ABLC 4YN0B 1V55C 1FAPB 3M79A 4WGYA 4CS8A 1OCOC 1E85A 2A1DD 2LSEA 1RKEA 3MBGA 4U9DA 2KQ9A 4DXWA 2QNLA 1Q0GA 1HMDA 5JT4A 1LS4A 2ASRA 3W2VA 4B6IA 3G4ZA 1MNDA 2B0JA 3DJUB 4N6CA 2P7VA 1VTMP 3TJ5A 2R02A 4I3MA 1Z3IX 3LJBA 2XXAB 4CS7A 2RSEB 1ZZPA 2DYRC 3TK0A 1H6GA 3VAYA 4E7SA 2J9BA 3DMDA 5E2QA 4D4NA 5AC5A 3FOOA 4J30B 4C3DA 4U5GA 3TULA 2Q9AA 3U9MA 1A41A 1KU2A 4MS2A 1NFNA 4HFKB 3UNGC 2R05A 1TWHA 2YLDA 2VASA 1NU7D 2YEVA 4RD9A 3SP1A 3LESA 3C18A 4O6MA 3M4BA 3RYLA 3TOLA 4Q5SF 2L81A 3K1HA 1T5OA 4EIYA 2AWYA 1A0BA 1Q0KA 2C04A 3LEOA 3U8VA 4MVMA 1XWJA 5BQHA 2R7WA 3DD7A 4DBRA 2GA0A 2Q9CA 1Q0DA 3EH1A 4LLEA 5L0JA 3S0XA 2BE5F 2Q7RA 3C8GD 1VMAA 2UUHA 2CNWD 3CAXA 3FAPB 2EILC 3JRTA 3LEVA 2QUPA 4NY3A 1T6IA 2WVQA 4DVZA 5DS4A 3AOUA 4JC7A 1T9KA 1V4AA 4AX2A 4Q7CA 1FFHA 1MNEA 3JSEO 5CI9A 1GQAA 5A6KA 3OWTA 3VM6A 2LFDA 2W45A 3JTLO 1OR3A 3K33A 3Q6NA 1AUEA 2JX0A 5DQTA 3AG2C 1FMVA 1Q0MA 4PJLA 4O79A 5L0GA 2R7TA 3H2VA 3DWWA 2O9XA 3PMRA 4YT5A 2HUJA 2J0XA 1G5ZA 4NTAA 2Y69C 3F47A 2LFFA 3AQCA 1HMOA 4NTFA 5EHHA 1D1BA 3V5ZA 3Q7LA 2LCHA 3I4UA 3LNRA 3RW0A 1I5NA 1TKNA 1JR8A 4BG0A 2KW3C 5D91A 4XEVA 4PFPA 4E17A 1IZMA 2FAPB 3L8IA 2XXAA 2XS1A 4CIPA 5B1AC 1ZYRF 1CPQA 1OQCA 3HNKA 4IGGA 3RH3A 1QVXA 2EPLX 1OR2A 5F28E 4JCHA 2EPNA 3M4CA 4H54A 3QW1A 2X0CA 1ORYA 2AWCA 3UGPA 2RD9A 1W2WA 3AQBA 2HFIA 3AGUA 1LIHA 2YVKA 3CZ6A 2R7VA 3JT1A 3U3BA 3B9QA 3JCUQ 2G3KA 4JJGA 3U8PA 3N2ZB 4QI2A 3QMKA 3S90A 1CGME 4U9EA 2HS5A 1T6UA 3EG9B 4MVUA 2UUIA 5L3VA 5COFA 3T9OA 4BEMJ 4RBNA 3X2QC 2ETSA 3NG1A 1AVOB 3K1IA 3QZCA 5FCLA 1PD1A 4CJOA 1YVIA 1ZW2A 1MMNA 2PFDA 5DVWA 3EGXB 2I8BA 1M2VB 4AL1A 1FR0A 2AVKA 3EHMA 2Z15A 4JRZA 1A7VA 3VF0A 1NSGB 4C3BA 5L0IA 3MYFA 3Q6MA 4MQ9F 2DI3A 3EHNA 4WABA 5DS6A 3ZTZA 3GM1A 4JEAA 5JSLA 2R7QA 2D5RB 2A6EF 3R7CA 2R25A 3UR3C 2R7OA 2PP4A 3ASNC 3ZDLA 2Y3HA 4YT4A 3US6A 3KYIA 4NCQA 4P9FA 1GM5A 4XTKA 3EFOB 3EZHA 4PJNA 1OW7A 1Z23A 5E3AA 3LLIA 4G7ZF 2NUPB 2KNHA 3V7OA 3S29A 1U89A 1MMDA 5KYYB 3C8ZA 5COMA 5K0IA 2KC3A 2X51A 4PR9A 2EPMX 2A0UA 3I5QA 3B71A 4LERA 5HV9A 4ZLCA 2KGOA 2H8AA 4XEKA 4DRJB 2VH3A 4EBKA 1YARO 3N0TA 4U5CE 2HSQA 3EPVA 1D1AA 1CGNA 1E83A 3CEXA 1ORJA 1IW7F 3L34A 2P0NA 3DAFA 3T4RA 3NDBB 1BR2A 1YDIA 4G78A 1L3PA 2YL7A 4JCZA 3BEHA 1RMVA 256BA 1B68A 2A69F 2CYDA 4RDAA 2EPOA 2P1AA 2VCAA 2LQGA 4EUKB 1LKXA 1VYIA 4EWCA 2IBFA 2HV6A 2XLWA 4U5FE 1J8YF 1SZIA 1YA9A 2D4UA 2HKVA 3EG9A 4J32B 3TOMA 1TFKB 3AG3C 4LDRA 3WODF 3ZG1A 4YJWA 2QLAA 3NMKA 5B3IA 2OEVA 3E70C 3S9OA 2H7BA 5BQIA 4G7HF 1G4WR 1MMAA 1OW6A 1TWGA 1C17M 1JOGA 2L9JA 3H2UA 2MHRA 4LACB 1LVKA 1HE9A 1APCA 3EGXA 3LAYA 1E84A 1M2VA 2YL3A 4CSAA 1NZEA 1D0ZA 1VYKA 1M6TA 5HSWA 2EIMC 4U5DE 1WGWA 2QY9A 3NMJA 1ZW3A 4AE4A 4IRUA 4E18A 1S05A 4LLCA 1MQVA 3EZIA 3M15A 4DRIB 1ZU5A 2XLEA 4JTDB 5KYUB 3Q7GA 4CSAC 4I1MA 3JYYA 3RF3A 1JAFA 4Z9IA 3SNHA 2NUTB 2VB6A 4CS9C 4Q4ZF 3FDQA 1SYQA 3KL4A 3EFOA 1UG7A 2W4MA 1GS9A 1RCPA 2A0BA 4DRHB 4F4BA 5A6AA 2CW0F 2ZXOA 5BQGA 2WVOA 2NUPA 2M4EA 2VCBA 2J9UA 1J8MF 2KSFA 4M63A 4W8KA 1XZQA 2J7PD 3NYMA 4H4KC 4KNVA 3U2MA 1NLXA 1C02A 2ICWG 2V26A 2NSGA 3S27A 3OEOA 1LI5A 3TD7A 2PX3A 3VRCA 4ANJA 5L0CA 3M1CB 4KBLA 5EK0A 3T6BA 2M64A 5TJ5E 4U5HA 2W4BA 4N6HA 3ZIBA 2YL0A 3GEEA 3MYIA 1FTSA 2XL4A 2AP3A 3WHNA 2XSEA 2F22A 2XL6A 4PFOA 4YT2A 5A6BA 3NKEA 3IPMO 1Z6AA 3W8IA 4EKWA 3O6XA 1U0BB 4KI2A 1VOMA 3O55A 2YHSA 2HMZA 4MW3A 4K1OA 3SXZA 4OIOF 3ZWIA 3X1OA 1HY5A 1EA8A 2HV7A 4E0HA 3E9VA 3FOPA 4AK9A 2EIJC 3LLKA 2FFHA 2JD3A 2IOQA 3K6BA 1JMWA 1G8XA 2PNOA 3G4XA 3ZQYA 2J46A 1FNTc 1QKRA 2Q9BA 3FMSA 4K7BA 2WB7A 4I1OB 3VYWA 4MW8A 4C3EA 4E7ZA 2B0HA 4OD4A 3PHF2 1MMGA 3S84A 4BJ1A 2YLIA 2R7SA 2G3VA 3BRJA 4PK4A 4MNDA 3L0IA 3DE8A 4OD5A 2OEXA 1D0XA 2XLDA 3C62A 2IM8A 3C8GB 3MFNA 4MTFA 4DOZA 4JIOA 4MTOA 5L0FA 1WN0A 4AL0A 4E0IA 2EPKX 2J45A 2OJED 3JZ0A 4IJJA 2XS8A 5COGA 1ZHXA 1O87A 5DLJA 3WAQA 1HE1A 4O6YA 4GYTA 5L0DA 5E3CA 3SXKA 3NYJA 2P6VA 4YT8A 1ZVZA 4OIQF 3DZAA 1YZCA 1L7CA 2ZXRA 4IAOA 2GAQA 4YK5A 5B1BC 3KKBA 1OCCC 2NUTA 4YWQA 2A68F 2R9RB 2Q4FA 3O10A 1RKCA 4XQ1A 3HKKA 3UMHA 3ZTMA 4CIHA 4NC3A 4D4XA 3EH2A 1Z5ZA 1BR4A 3FHDA 4KNWA 3ECSA 4XEFA 4DVYP 4CDYA 1H9TA 4IARA 1Q0FA 1K05A 3OA1A 1TQGA 2LP4A 3ATPA 4NTBA 3W2WA 3W8HA 1WWPA 3DI5A 3W4YA 4G7OF 3LS1A 4QDLA 1D0YA 3O39A 1NG1A 4MTGA 3ZQVA 3AJMA 3CQZA 1TR2A 3IQ6A 4BJ5A 1C03A 1CPRA 3ABMC 2H7OA 4PACA 2V3CC 2PX0A 4FAPB 1ZU4A 2J0WA 3NYLA 1LE4A 3HJCA 4WGZA 2WZLA 2DYSC 3HLZA 5EGYA 3CSKA 4JZAA 3DJNB 4BJ5C 2YKZA 5JLIA 1EKYA 4LDKA 1YA7O 3R2PA 4J7YA 2YZSA 1UFBA 4IWBA 3K7DA 2NPUA 3JYHA 2LK4A 4JTAB 3HNLA 1JPJA 1RXQA 1G4US 4JE9A 3B0VC 2WVNA 3ABKC 5A6BD 4C7OB 1BR1A 1RJ9B 1FMWA 2XLOA 2Y39A 3C7JA 2CDQA 1O3UA 1ZHYA 2XLMA 3HNJA 2CNWA 3GODA 3MLGA 1E86A 3UGOA 1QLEC 1WATA 3GM3A 5L0HA 3V5YA 3TQOA 2OG2A 4XWJA 3K66A 3RQGA 5GPGB 1LM3B 3MX3A 4X0RA 3AGTA 2BL2A 1OKKA 1JPNA 4DJ9A 5KYXB 1DOVA 1WTYA 2R7UA 3DKAA 3QVYA 2CCYA 2YL1A 2DB4A 1H7IA 4Z9JA 4CS8C 5D92A 4JW1A 1LS1A 2WZFA 3KPHA 1KTMA 1QSPA 1NBBA 1A7EA 3A11A 1XZPA 3EQLF 1BZ4A 2ZXWC 2L6HA 3SXYA 4DBQA 4XLNF 4A2NB 3NRHA 3ITFA 4CS9A 2IXPA 2HSBA 3JSZA 2R7XA 5CIVA 1JRAA 3UMIA 2EIKC 3RIPA 3RQEA 4HEAJ 5JS5A 2OJQA 3LNMB 3KH2A 1OCRC 2J9WA 4CDVA 4JTCB 1VB5A 2IXOA 2KJGA 3RVZA 3B0UX 2Q00A 1YAUO 2YWAA 2GDCA 1OCZC 2QE9A 3GEHA 1EQ1A 1OXBA 3QVZA 2R7RA 3ASOC 4EBJA 2GFHA 5F5FA 1I4ZA 3AG4C 3KMIA 4L6RA 2YLGA 3GWLA 4N06A 1OXKA 4OINF 1Z7Qc 1YYXA 3ZC4A 4FX5A 4LDQA 2L7AA 3GANA 3GM2A 1BBHA 4HE8D 3GEIA 2EINC 4U5BE 3B0PA 1GGQA 2Y3DA 2LD6A 2XM0A 4XLPF 4C7OA 1RJ9A 2P61A 1VLSA 1Z63A 4XPYA 1O5HA 2VCCA 2XRHA 3PDMP 4PJJA 5AGFA 4ONSA 5JVEA 1DOWA 3N24A 3U2LA 5IY5C 1Y4CA 4QI0A 3RVYA 1BDJB 3TJ6A 1CGOA 2OQMA 1R4TA 1M56C 2HZ8A 1K04A 2OOCA 2ZPAA 4ULWA 3RKOF 2L6GA 4EHPA 2HJMA 5A69A 5KYXA 3U0CA 3U3FA 4CDAA
chains in the Genus database with same CATH topology
3LS0A 3SYNA 2WL8A 4JJFA 3I5PA 4O6NA 3HTKC 2IXMA 4HFFB 4WJ0A 3EJNA 1QZXA 4BJ6A 1SMYF 3SEOA 3IEEA 4KC9A 3EGDB 2C03A 5B3SC 5BUOA 2MYSA 1OKKD 1N1CA 1TWAA 4BJ6C 4BEJA 4O7GA 3DAGA 3FAJA 5KYUA 4BJTA 4FWVA 5DQZA 1TWCA 4EBBA 2NG1A 4CBEA 2G62A 3S28A 2Q3TA 4I44A 1M57C 4U5EE 5KYWB 4OIRF 3AG1C 1D1CA 5T1DB 5KYNA 2H7VC 2IYLD 1V54C 3ZSUA 4ZLDA 4PJMA 1S7ZA 1VK5A 2IXNA 1NU9C 2QTVA 1ZHTA 5L3QA 3F46A 3WG7C 2MWQA 4JVSA 3DXJF 5DS5A 1SF8A 2FGYA 2CGEA 1PD0A 3EGDA 1FFTC 2J7PA 5T3WA 3POVA 4AE4B 3K1IC 3SZRA 1M2OA 2Y3GA 4OIPF 2DGJA 5CI8A 2OCCC 5F5HA 3UMKA 4G0HA 3DM5A 3NKDA 2E87A 2A6HF 2WZGA 3T6JA 2ZXPA 5T3TA 1ZHWA 4P6IC 2W9YA 2J9VA 4GEHA 1ZHZA 2Y3BA 4FESA 2PF4E 3DM9B 1ST6A 5KYWA 1PCXA 4JURI 5E33A 3FVYA 3RFYA 4K0DA 3H65A 3ABLC 4YN0B 1V55C 4CS8A 1OCOC 2A1DD 2LSEA 2KQ9A 3W2VA 4B6IA 1MNDA 2B0JA 3DJUB 2P7VA 4I3MA 1Z3IX 3LJBA 2XXAB 4CS7A 2DYRC 3VAYA 4E7SA 3DMDA 5E2QA 4C3DA 4J30B 4U5GA 2Q9AA 1KU2A 4HFKB 3UNGC 1TWHA 2VASA 1NU7D 2YEVA 4RD9A 3SP1A 3LESA 4O6MA 3RYLA 4Q5SF 2L81A 3K1HA 2C04A 2R7WA 3DD7A 4DBRA 2Q9CA 3EH1A 4LLEA 3S0XA 2BE5F 1VMAA 2CNWD 2EILC 3JRTA 3LEVA 4NY3A 2WVQA 4DVZA 5DS4A 4AX2A 4Q7CA 1FFHA 1MNEA 5CI9A 3OWTA 2W45A 3K33A 3Q6NA 5DQTA 3AG2C 1FMVA 4PJLA 4O79A 2R7TA 2O9XA 3PMRA 4YT5A 2J0XA 2Y69C 3F47A 3AQCA 5EHHA 1D1BA 3Q7LA 3I4UA 3LNRA 4BG0A 1TKNA 2KW3C 5D91A 4PFPA 1IZMA 2XXAA 5B1AC 1ZYRF 3RH3A 4JCHA 3UGPA 1W2WA 3AQBA 3CZ6A 2R7VA 3JT1A 3B9QA 3JCUQ 2G3KA 4JJGA 3N2ZB 4QI2A 3QMKA 3EG9B 5L3VA 4RBNA 3X2QC 3NG1A 3QZCA 5FCLA 1PD1A 2PFDA 1MMNA 5DVWA 3EGXB 2I8BA 1M2VB 3EHMA 2Z15A 4C3BA 3Q6MA 4MQ9F 3EHNA 5DS6A 2R7QA 2D5RB 2A6EF 3UR3C 2R7OA 2PP4A 3ASNC 2Y3HA 4YT4A 4XTKA 3EFOB 3EZHA 4PJNA 1Z23A 5E3AA 3LLIA 4G7ZF 2NUPB 2KNHA 3V7OA 3S29A 1MMDA 5KYYB 2X51A 3I5QA 4LERA 4ZLCA 2KGOA 2VH3A 3N0TA 4U5CE 3EPVA 1D1AA 1IW7F 3L34A 3DAFA 3T4RA 3NDBB 1BR2A 2A69F 4RDAA 1LKXA 1VYIA 4EWCA 4U5FE 2HV6A 1J8YF 1SZIA 3EG9A 4J32B 3WODF 3AG3C 3ZG1A 4YJWA 3E70C 4G7HF 2H7BA 1MMAA 4LACB 2L9JA 1TWGA 3ZVRA 1LVKA 3LAYA 3EGXA 4CSAA 1M2VA 1NZEA 1D0ZA 1VYKA 5HSWA 2EIMC 4U5DE 1WGWA 2QY9A 4AE4A 4IRUA 4LLCA 3EZIA 1ZU5A 4CSAC 5KYUB 3Q7GA 4I1MA 4CS9C 4Q4ZF 3SNHA 2NUTB 2VB6A 3FDQA 3KL4A 3EFOA 2W4MA 2CW0F 2ZXOA 2WVOA 2NUPA 2M4EA 2J9UA 1J8MF 4M63A 4W8KA 2J7PD 3NYMA 4H4KC 4KNVA 5KYYA 3S27A 2V26A 3OEOA 3TD7A 4ANJA 2PX3A 3M1CB 4KBLA 3T6BA 4U5HA 2W4BA 3ZIBA 1FTSA 2XL4A 2XSEA 4PFOA 4YT2A 3NKEA 3W8IA 1Z6AA 3O6XA 1VOMA 2YHSA 4OIOF 3X1OA 2HV7A 3E9VA 4AK9A 2EIJC 3LLKA 2FFHA 2JD3A 2IOQA 3K6BA 1G8XA 2J46A 2Q9BA 4K7BA 3VYWA 4C3EA 2WB7A 4I1OB 4E7ZA 2R7SA 3PHF2 4OD4A 1MMGA 4BJ1A 2G3VA 4PK4A 4MNDA 3L0IA 4OD5A 1D0XA 4DOZA 2J45A 4IJJA 5DLJA 1ZHXA 1O87A 4O6YA 4GYTA 5E3CA 4YT8A 3NYJA 2P6VA 4OIQF 3DZAA 2ZXRA 4IAOA 5B1BC 2NUTA 3KKBA 1OCCC 4YWQA 2A68F 3UMHA 4CIHA 3EH2A 1Z5ZA 1BR4A 3FHDA 4KNWA 3ECSA 4DVYP 3OA1A 3W2WA 3W8HA 4G7OF 3LS1A 4QDLA 1D0YA 3O39A 1NG1A 3CQZA 1TR2A 4BJ5A 3ABMC 2H7OA 2V3CC 2PX0A 1ZU4A 2J0WA 3NYLA 3HJCA 2WZLA 2DYSC 3HLZA 5EGYA 3CSKA 4JZAA 3DJNB 4BJ5C 2YZSA 4IWBA 3K7DA 3JYHA 3B0VC 1JPJA 4C7OB 2WVNA 3ABKC 1BR1A 1RJ9B 1FMWA 2Y39A 2CDQA 1ZHYA 2CNWA 3GODA 3MLGA 3UGOA 1QLEC 2OG2A 4XWJA 3K66A 4X0RA 3MX3A 1OKKA 1JPNA 5KYXB 2R7UA 5D92A 4JW1A 1LS1A 2WZFA 3EQLF 2ZXWC 4DBQA 4XLNF 4A2NB 3NRHA 3ITFA 4CS9A 2IXPA 3JSZA 2R7XA 3UMIA 2EIKC 3RIPA 4HEAJ 3KH2A 1OCRC 2J9WA 2IXOA 2KJGA 3B0UX 1OCZC 2R7RA 3ASOC 2GFHA 5F5FA 3AG4C 3KMIA 4N06A 4OINF 4CS8C 3ZC4A 4FX5A 3GANA 4HE8D 2EINC 4U5BE 3B0PA 2Y3DA 4XLPF 4C7OA 1RJ9A 1Z63A 1O5HA 2XRHA 4PJJA 3N24A 5IY5C 4QI0A 1M56C 2ZPAA 4F4BA 4ULWA 3RKOF 4KI2A 5KYXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KGO A;  4IJJ A;  2KQ9 A; 
#chains in the Genus database with same CATH topology
 2BC5 A;  3LS0 A;  2WL8 A;  2L6F A;  4JJF A;  3RQF A;  3SYN A;  3I5P A;  3L8J A;  4O6N A;  3HTK C;  2IXM A;  2JPU A;  2YQY A;  4HFF B;  4WJ0 A;  1LE2 A;  1R5I D;  3EJN A;  1Y6D A;  1KNY A;  1QZX A;  3C63 A;  3U9J A;  4BJ6 A;  1SMY F;  3SEO A;  3IEE A;  4KC9 A;  3EGD B;  2C03 A;  2HMQ A;  5B3S C;  5BUO A;  2MYS A;  1YYJ A;  4GQH A;  4MVS A;  1QPU A;  1OKK D;  3HNI A;  1NFO A;  3ZVR A;  1SR2 A;  4ULV A;  2R03 A;  1N1C A;  2OU6 A;  1TWA A;  4BJ6 C;  2J8W A;  4BEJ A;  5KYY A;  1TFO B;  4O7G A;  3DAG A;  3FAJ A;  5KYU A;  3IQC A;  3NMI A;  1E2X A;  2KK1 A;  4BJT A;  4FWV A;  4J7T A;  2NSF A;  4N4W A;  5DQZ A;  1TWC A;  4EBB A;  2NG1 A;  4CBE A;  2G62 A;  1U6H A;  3S28 A;  2Q3T A;  4MVO A;  1EI7 A;  4I44 A;  1M57 C;  2XM4 A;  4U5E E;  1PV3 A;  3QW0 A;  5KYW B;  1WOL A;  4OIR F;  3AG1 C;  1D1C A;  2XLV A;  2YRF A;  3QTH A;  5T1D B;  5KYN A;  2H7V C;  1HW1 A;  3L1M A;  2OKU A;  4YL3 A;  4ER9 A;  4YL1 A;  2IYL D;  1V54 C;  5AC4 A;  1LI7 A;  3ZSU A;  4ZLD A;  4PJM A;  1S7Z A;  1RKE B;  1VK5 A;  1QQ3 A;  2IXN A;  1NU9 C;  2XLH A;  5FZT A;  1V74 B;  2QTV A;  3V5X A;  1ZHT A;  4MVR A;  5A6J A;  2I15 A;  5L3Q A;  3F46 A;  3WG7 C;  4BPM A;  1T6Q A;  2MWQ A;  2KYH A;  3A9C A;  3G50 A;  4R32 A;  4YL0 A;  4JVS A;  1VLT A;  1YJG A;  5JUA A;  3DXJ F;  5DS5 A;  1F1M A;  1I4Y A;  1OW8 A;  1SF8 A;  4IAQ A;  2FGY A;  4JEB A;  3U5S A;  3T6G B;  1LPE A;  4XPW A;  1T01 A;  2CGE A;  4UDV A;  5JRA A;  1PD0 A;  1HW2 A;  1K40 A;  3B29 A;  1FFT C;  2J7P A;  3EGD A;  3GWN A;  5T3W A;  3C8G A;  3POV A;  4AE4 B;  3IHU A;  3K1I C;  1A7D A;  3SZR A;  1M2O A;  2GWW A;  2VC9 A;  1WAS A;  2Y3G A;  3DE9 A;  4NQF A;  4P9T A;  4OIP F;  4Z9H A;  1YLM A;  4CJG A;  3SXM A;  2DGJ A;  5CI8 A;  3JRM O;  4MVQ A;  2OCC C;  5F5H A;  2ZD9 A;  4G0H A;  4XPX A;  3DM5 A;  3NKD A;  3UMK A;  2E87 A;  2A6H F;  2WZG A;  3T6J A;  1YZA A;  3PCV A;  2ZXP A;  5T3T A;  2XL8 A;  5JP7 A;  4W8P A;  2LIG A;  3IQT A;  1H9G A;  3LUT B;  3GOR A;  1ZHW A;  4P6I C;  4MVZ A;  1ORS C;  2AU5 A;  4A4A A;  2W9Y A;  2J9V A;  4GEH A;  1ZHZ A;  2Y3B A;  4FES A;  1AEP A;  2PF4 E;  3DM9 B;  1ST6 A;  2HJ3 A;  3FXH A;  5KYW A;  3J06 A;  1PCX A;  4JUR I;  4JKV A;  4IB4 A;  3IQ5 A;  3KYJ A;  5E33 A;  2TMV P;  4CX9 A;  3FVY A;  3RFY A;  2PBE A;  4K0D A;  3H65 A;  3ABL C;  4YN0 B;  1V55 C;  1FAP B;  3M79 A;  4WGY A;  4CS8 A;  1OCO C;  1E85 A;  2A1D D;  2LSE A;  1RKE A;  3MBG A;  4U9D A;  2KQ9 A;  4DXW A;  2QNL A;  1Q0G A;  1HMD A;  5JT4 A;  1LS4 A;  2ASR A;  3W2V A;  4B6I A;  3G4Z A;  1MND A;  2B0J A;  3DJU B;  4N6C A;  2P7V A;  1VTM P;  3TJ5 A;  2R02 A;  4I3M A;  1Z3I X;  3LJB A;  2XXA B;  4CS7 A;  2RSE B;  1ZZP A;  2DYR C;  3TK0 A;  1H6G A;  3VAY A;  4E7S A;  2J9B A;  3DMD A;  5E2Q A;  4D4N A;  5AC5 A;  3FOO A;  4J30 B;  4C3D A;  4U5G A;  3TUL A;  2Q9A A;  3U9M A;  1A41 A;  1KU2 A;  4MS2 A;  1NFN A;  4HFK B;  3UNG C;  2R05 A;  1TWH A;  2YLD A;  2VAS A;  1NU7 D;  2YEV A;  4RD9 A;  3SP1 A;  3LES A;  3C18 A;  4O6M A;  3M4B A;  3RYL A;  3TOL A;  4Q5S F;  2L81 A;  3K1H A;  1T5O A;  4EIY A;  2AWY A;  1A0B A;  1Q0K A;  2C04 A;  3LEO A;  3U8V A;  4MVM A;  1XWJ A;  5BQH A;  2R7W A;  3DD7 A;  4DBR A;  2GA0 A;  2Q9C A;  1Q0D A;  3EH1 A;  4LLE A;  5L0J A;  3S0X A;  2BE5 F;  2Q7R A;  3C8G D;  1VMA A;  2UUH A;  2CNW D;  3CAX A;  3FAP B;  2EIL C;  3JRT A;  3LEV A;  2QUP A;  4NY3 A;  1T6I A;  2WVQ A;  4DVZ A;  5DS4 A;  3AOU A;  4JC7 A;  1T9K A;  1V4A A;  4AX2 A;  4Q7C A;  1FFH A;  1MNE A;  3JSE O;  5CI9 A;  1GQA A;  5A6K A;  3OWT A;  3VM6 A;  2LFD A;  2W45 A;  3JTL O;  1OR3 A;  3K33 A;  3Q6N A;  1AUE A;  2JX0 A;  5DQT A;  3AG2 C;  1FMV A;  1Q0M A;  4PJL A;  4O79 A;  5L0G A;  2R7T A;  3H2V A;  3DWW A;  2O9X A;  3PMR A;  4YT5 A;  2HUJ A;  2J0X A;  1G5Z A;  4NTA A;  2Y69 C;  3F47 A;  2LFF A;  3AQC A;  1HMO A;  4NTF A;  5EHH A;  1D1B A;  3V5Z A;  3Q7L A;  2LCH A;  3I4U A;  3LNR A;  3RW0 A;  1I5N A;  1TKN A;  1JR8 A;  4BG0 A;  2KW3 C;  5D91 A;  4XEV A;  4PFP A;  4E17 A;  1IZM A;  2FAP B;  3L8I A;  2XXA A;  2XS1 A;  4CIP A;  5B1A C;  1ZYR F;  1CPQ A;  1OQC A;  3HNK A;  4IGG A;  3RH3 A;  1QVX A;  2EPL X;  1OR2 A;  5F28 E;  4JCH A;  2EPN A;  3M4C A;  4H54 A;  3QW1 A;  2X0C A;  1ORY A;  2AWC A;  3UGP A;  2RD9 A;  1W2W A;  3AQB A;  2HFI A;  3AGU A;  1LIH A;  2YVK A;  3CZ6 A;  2R7V A;  3JT1 A;  3U3B A;  3B9Q A;  3JCU Q;  2G3K A;  4JJG A;  3U8P A;  3N2Z B;  4QI2 A;  3QMK A;  3S90 A;  1CGM E;  4U9E A;  2HS5 A;  1T6U A;  3EG9 B;  4MVU A;  2UUI A;  5L3V A;  5COF A;  3T9O A;  4BEM J;  4RBN A;  3X2Q C;  2ETS A;  3NG1 A;  1AVO B;  3K1I A;  3QZC A;  5FCL A;  1PD1 A;  4CJO A;  1YVI A;  1ZW2 A;  1MMN A;  2PFD A;  5DVW A;  3EGX B;  2I8B A;  1M2V B;  4AL1 A;  1FR0 A;  2AVK A;  3EHM A;  2Z15 A;  4JRZ A;  1A7V A;  3VF0 A;  1NSG B;  4C3B A;  5L0I A;  3MYF A;  3Q6M A;  4MQ9 F;  2DI3 A;  3EHN A;  4WAB A;  5DS6 A;  3ZTZ A;  3GM1 A;  4JEA A;  5JSL A;  2R7Q A;  2D5R B;  2A6E F;  3R7C A;  2R25 A;  3UR3 C;  2R7O A;  2PP4 A;  3ASN C;  3ZDL A;  2Y3H A;  4YT4 A;  3US6 A;  3KYI A;  4NCQ A;  4P9F A;  1GM5 A;  4XTK A;  3EFO B;  3EZH A;  4PJN A;  1OW7 A;  1Z23 A;  5E3A A;  3LLI A;  4G7Z F;  2NUP B;  2KNH A;  3V7O A;  3S29 A;  1U89 A;  1MMD A;  5KYY B;  3C8Z A;  5COM A;  5K0I A;  2KC3 A;  2X51 A;  4PR9 A;  2EPM X;  2A0U A;  3I5Q A;  3B71 A;  4LER A;  5HV9 A;  4ZLC A;  2KGO A;  2H8A A;  4XEK A;  4DRJ B;  2VH3 A;  4EBK A;  1YAR O;  3N0T A;  4U5C E;  2HSQ A;  3EPV A;  1D1A A;  1CGN A;  1E83 A;  3CEX A;  1ORJ A;  1IW7 F;  3L34 A;  2P0N A;  3DAF A;  3T4R A;  3NDB B;  1BR2 A;  1YDI A;  4G78 A;  1L3P A;  2YL7 A;  4JCZ A;  3BEH A;  1RMV A;  256B A;  1B68 A;  2A69 F;  2CYD A;  4RDA A;  2EPO A;  2P1A A;  2VCA A;  2LQG A;  4EUK B;  1LKX A;  1VYI A;  4EWC A;  2IBF A;  2HV6 A;  2XLW A;  4U5F E;  1J8Y F;  1SZI A;  1YA9 A;  2D4U A;  2HKV A;  3EG9 A;  4J32 B;  3TOM A;  1TFK B;  3AG3 C;  4LDR A;  3WOD F;  3ZG1 A;  4YJW A;  2QLA A;  3NMK A;  5B3I A;  2OEV A;  3E70 C;  3S9O A;  2H7B A;  5BQI A;  4G7H F;  1G4W R;  1MMA A;  1OW6 A;  1TWG A;  1C17 M;  1JOG A;  2L9J A;  3H2U A;  2MHR A;  4LAC B;  1LVK A;  1HE9 A;  1APC A;  3EGX A;  3LAY A;  1E84 A;  1M2V A;  2YL3 A;  4CSA A;  1NZE A;  1D0Z A;  1VYK A;  1M6T A;  5HSW A;  2EIM C;  4U5D E;  1WGW A;  2QY9 A;  3NMJ A;  1ZW3 A;  4AE4 A;  4IRU A;  4E18 A;  1S05 A;  4LLC A;  1MQV A;  3EZI A;  3M15 A;  4DRI B;  1ZU5 A;  2XLE A;  4JTD B;  5KYU B;  3Q7G A;  4CSA C;  4I1M A;  3JYY A;  3RF3 A;  1JAF A;  4Z9I A;  3SNH A;  2NUT B;  2VB6 A;  4CS9 C;  4Q4Z F;  3FDQ A;  1SYQ A;  3KL4 A;  3EFO A;  1UG7 A;  2W4M A;  1GS9 A;  1RCP A;  2A0B A;  4DRH B;  4F4B A;  5A6A A;  2CW0 F;  2ZXO A;  5BQG A;  2WVO A;  2NUP A;  2M4E A;  2VCB A;  2J9U A;  1J8M F;  2KSF A;  4M63 A;  4W8K A;  1XZQ A;  2J7P D;  3NYM A;  4H4K C;  4KNV A;  3U2M A;  1NLX A;  1C02 A;  2ICW G;  2V26 A;  2NSG A;  3S27 A;  3OEO A;  1LI5 A;  3TD7 A;  2PX3 A;  3VRC A;  4ANJ A;  5L0C A;  3M1C B;  4KBL A;  5EK0 A;  3T6B A;  2M64 A;  5TJ5 E;  4U5H A;  2W4B A;  4N6H A;  3ZIB A;  2YL0 A;  3GEE A;  3MYI A;  1FTS A;  2XL4 A;  2AP3 A;  3WHN A;  2XSE A;  2F22 A;  2XL6 A;  4PFO A;  4YT2 A;  5A6B A;  3NKE A;  3IPM O;  1Z6A A;  3W8I A;  4EKW A;  3O6X A;  1U0B B;  4KI2 A;  1VOM A;  3O55 A;  2YHS A;  2HMZ A;  4MW3 A;  4K1O A;  3SXZ A;  4OIO F;  3ZWI A;  3X1O A;  1HY5 A;  1EA8 A;  2HV7 A;  4E0H A;  3E9V A;  3FOP A;  4AK9 A;  2EIJ C;  3LLK A;  2FFH A;  2JD3 A;  2IOQ A;  3K6B A;  1JMW A;  1G8X A;  2PNO A;  3G4X A;  3ZQY A;  2J46 A;  1FNT c;  1QKR A;  2Q9B A;  3FMS A;  4K7B A;  2WB7 A;  4I1O B;  3VYW A;  4MW8 A;  4C3E A;  4E7Z A;  2B0H A;  4OD4 A;  3PHF 2;  1MMG A;  3S84 A;  4BJ1 A;  2YLI A;  2R7S A;  2G3V A;  3BRJ A;  4PK4 A;  4MND A;  3L0I A;  3DE8 A;  4OD5 A;  2OEX A;  1D0X A;  2XLD A;  3C62 A;  2IM8 A;  3C8G B;  3MFN A;  4MTF A;  4DOZ A;  4JIO A;  4MTO A;  5L0F A;  1WN0 A;  4AL0 A;  4E0I A;  2EPK X;  2J45 A;  2OJE D;  3JZ0 A;  4IJJ A;  2XS8 A;  5COG A;  1ZHX A;  1O87 A;  5DLJ A;  3WAQ A;  1HE1 A;  4O6Y A;  4GYT A;  5L0D A;  5E3C A;  3SXK A;  3NYJ A;  2P6V A;  4YT8 A;  1ZVZ A;  4OIQ F;  3DZA A;  1YZC A;  1L7C A;  2ZXR A;  4IAO A;  2GAQ A;  4YK5 A;  5B1B C;  3KKB A;  1OCC C;  2NUT A;  4YWQ A;  2A68 F;  2R9R B;  2Q4F A;  3O10 A;  1RKC A;  4XQ1 A;  3HKK A;  3UMH A;  3ZTM A;  4CIH A;  4NC3 A;  4D4X A;  3EH2 A;  1Z5Z A;  1BR4 A;  3FHD A;  4KNW A;  3ECS A;  4XEF A;  4DVY P;  4CDY A;  1H9T A;  4IAR A;  1Q0F A;  1K05 A;  3OA1 A;  1TQG A;  2LP4 A;  3ATP A;  4NTB A;  3W2W A;  3W8H A;  1WWP A;  3DI5 A;  3W4Y A;  4G7O F;  3LS1 A;  4QDL A;  1D0Y A;  3O39 A;  1NG1 A;  4MTG A;  3ZQV A;  3AJM A;  3CQZ A;  1TR2 A;  3IQ6 A;  4BJ5 A;  1C03 A;  1CPR A;  3ABM C;  2H7O A;  4PAC A;  2V3C C;  2PX0 A;  4FAP B;  1ZU4 A;  2J0W A;  3NYL A;  1LE4 A;  3HJC A;  4WGZ A;  2WZL A;  2DYS C;  3HLZ A;  5EGY A;  3CSK A;  4JZA A;  3DJN B;  4BJ5 C;  2YKZ A;  5JLI A;  1EKY A;  4LDK A;  1YA7 O;  3R2P A;  4J7Y A;  2YZS A;  1UFB A;  4IWB A;  3K7D A;  2NPU A;  3JYH A;  2LK4 A;  4JTA B;  3HNL A;  1JPJ A;  1RXQ A;  1G4U S;  4JE9 A;  3B0V C;  2WVN A;  3ABK C;  5A6B D;  4C7O B;  1BR1 A;  1RJ9 B;  1FMW A;  2XLO A;  2Y39 A;  3C7J A;  2CDQ A;  1O3U A;  1ZHY A;  2XLM A;  3HNJ A;  2CNW A;  3GOD A;  3MLG A;  1E86 A;  3UGO A;  1QLE C;  1WAT A;  3GM3 A;  5L0H A;  3V5Y A;  3TQO A;  2OG2 A;  4XWJ A;  3K66 A;  3RQG A;  5GPG B;  1LM3 B;  3MX3 A;  4X0R A;  3AGT A;  2BL2 A;  1OKK A;  1JPN A;  4DJ9 A;  5KYX B;  1DOV A;  1WTY A;  2R7U A;  3DKA A;  3QVY A;  2CCY A;  2YL1 A;  2DB4 A;  1H7I A;  4Z9J A;  4CS8 C;  5D92 A;  4JW1 A;  1LS1 A;  2WZF A;  3KPH A;  1KTM A;  1QSP A;  1NBB A;  1A7E A;  3A11 A;  1XZP A;  3EQL F;  1BZ4 A;  2ZXW C;  2L6H A;  3SXY A;  4DBQ A;  4XLN F;  4A2N B;  3NRH A;  3ITF A;  4CS9 A;  2IXP A;  2HSB A;  3JSZ A;  2R7X A;  5CIV A;  1JRA A;  3UMI A;  2EIK C;  3RIP A;  3RQE A;  4HEA J;  5JS5 A;  2OJQ A;  3LNM B;  3KH2 A;  1OCR C;  2J9W A;  4CDV A;  4JTC B;  1VB5 A;  2IXO A;  2KJG A;  3RVZ A;  3B0U X;  2Q00 A;  1YAU O;  2YWA A;  2GDC A;  1OCZ C;  2QE9 A;  3GEH A;  1EQ1 A;  1OXB A;  3QVZ A;  2R7R A;  3ASO C;  4EBJ A;  2GFH A;  5F5F A;  1I4Z A;  3AG4 C;  3KMI A;  4L6R A;  2YLG A;  3GWL A;  4N06 A;  1OXK A;  4OIN F;  1Z7Q c;  1YYX A;  3ZC4 A;  4FX5 A;  4LDQ A;  2L7A A;  3GAN A;  3GM2 A;  1BBH A;  4HE8 D;  3GEI A;  2EIN C;  4U5B E;  3B0P A;  1GGQ A;  2Y3D A;  2LD6 A;  2XM0 A;  4XLP F;  4C7O A;  1RJ9 A;  2P61 A;  1VLS A;  1Z63 A;  4XPY A;  1O5H A;  2VCC A;  2XRH A;  3PDM P;  4PJJ A;  5AGF A;  4ONS A;  5JVE A;  1DOW A;  3N24 A;  3U2L A;  5IY5 C;  1Y4C A;  4QI0 A;  3RVY A;  1BDJ B;  3TJ6 A;  1CGO A;  2OQM A;  1R4T A;  1M56 C;  2HZ8 A;  1K04 A;  2OOC A;  2ZPA A;  4ULW A;  3RKO F;  2L6G A;  4EHP A;  2HJM A;  5A69 A;  5KYX A;  3U0C A;  3U3F A;  4CDA A; 
#chains in the Genus database with same CATH homology
 3LS0 A;  3SYN A;  2WL8 A;  4JJF A;  3I5P A;  4O6N A;  3HTK C;  2IXM A;  4HFF B;  4WJ0 A;  3EJN A;  1QZX A;  4BJ6 A;  1SMY F;  3SEO A;  3IEE A;  4KC9 A;  3EGD B;  2C03 A;  5B3S C;  5BUO A;  2MYS A;  1OKK D;  1N1C A;  1TWA A;  4BJ6 C;  4BEJ A;  4O7G A;  3DAG A;  3FAJ A;  5KYU A;  4BJT A;  4FWV A;  5DQZ A;  1TWC A;  4EBB A;  2NG1 A;  4CBE A;  2G62 A;  3S28 A;  2Q3T A;  4I44 A;  1M57 C;  4U5E E;  5KYW B;  4OIR F;  3AG1 C;  1D1C A;  5T1D B;  5KYN A;  2H7V C;  2IYL D;  1V54 C;  3ZSU A;  4ZLD A;  4PJM A;  1S7Z A;  1VK5 A;  2IXN A;  1NU9 C;  2QTV A;  1ZHT A;  5L3Q A;  3F46 A;  3WG7 C;  2MWQ A;  4JVS A;  3DXJ F;  5DS5 A;  1SF8 A;  2FGY A;  2CGE A;  1PD0 A;  3EGD A;  1FFT C;  2J7P A;  5T3W A;  3POV A;  4AE4 B;  3K1I C;  3SZR A;  1M2O A;  2Y3G A;  4OIP F;  2DGJ A;  5CI8 A;  2OCC C;  5F5H A;  3UMK A;  4G0H A;  3DM5 A;  3NKD A;  2E87 A;  2A6H F;  2WZG A;  3T6J A;  2ZXP A;  5T3T A;  1ZHW A;  4P6I C;  2W9Y A;  2J9V A;  4GEH A;  1ZHZ A;  2Y3B A;  4FES A;  2PF4 E;  3DM9 B;  1ST6 A;  5KYW A;  1PCX A;  4JUR I;  5E33 A;  3FVY A;  3RFY A;  4K0D A;  3H65 A;  3ABL C;  4YN0 B;  1V55 C;  4CS8 A;  1OCO C;  2A1D D;  2LSE A;  2KQ9 A;  3W2V A;  4B6I A;  1MND A;  2B0J A;  3DJU B;  2P7V A;  4I3M A;  1Z3I X;  3LJB A;  2XXA B;  4CS7 A;  2DYR C;  3VAY A;  4E7S A;  3DMD A;  5E2Q A;  4C3D A;  4J30 B;  4U5G A;  2Q9A A;  1KU2 A;  4HFK B;  3UNG C;  1TWH A;  2VAS A;  1NU7 D;  2YEV A;  4RD9 A;  3SP1 A;  3LES A;  4O6M A;  3RYL A;  4Q5S F;  2L81 A;  3K1H A;  2C04 A;  2R7W A;  3DD7 A;  4DBR A;  2Q9C A;  3EH1 A;  4LLE A;  3S0X A;  2BE5 F;  1VMA A;  2CNW D;  2EIL C;  3JRT A;  3LEV A;  4NY3 A;  2WVQ A;  4DVZ A;  5DS4 A;  4AX2 A;  4Q7C A;  1FFH A;  1MNE A;  5CI9 A;  3OWT A;  2W45 A;  3K33 A;  3Q6N A;  5DQT A;  3AG2 C;  1FMV A;  4PJL A;  4O79 A;  2R7T A;  2O9X A;  3PMR A;  4YT5 A;  2J0X A;  2Y69 C;  3F47 A;  3AQC A;  5EHH A;  1D1B A;  3Q7L A;  3I4U A;  3LNR A;  4BG0 A;  1TKN A;  2KW3 C;  5D91 A;  4PFP A;  1IZM A;  2XXA A;  5B1A C;  1ZYR F;  3RH3 A;  4JCH A;  3UGP A;  1W2W A;  3AQB A;  3CZ6 A;  2R7V A;  3JT1 A;  3B9Q A;  3JCU Q;  2G3K A;  4JJG A;  3N2Z B;  4QI2 A;  3QMK A;  3EG9 B;  5L3V A;  4RBN A;  3X2Q C;  3NG1 A;  3QZC A;  5FCL A;  1PD1 A;  2PFD A;  1MMN A;  5DVW A;  3EGX B;  2I8B A;  1M2V B;  3EHM A;  2Z15 A;  4C3B A;  3Q6M A;  4MQ9 F;  3EHN A;  5DS6 A;  2R7Q A;  2D5R B;  2A6E F;  3UR3 C;  2R7O A;  2PP4 A;  3ASN C;  2Y3H A;  4YT4 A;  4XTK A;  3EFO B;  3EZH A;  4PJN A;  1Z23 A;  5E3A A;  3LLI A;  4G7Z F;  2NUP B;  2KNH A;  3V7O A;  3S29 A;  1MMD A;  5KYY B;  2X51 A;  3I5Q A;  4LER A;  4ZLC A;  2KGO A;  2VH3 A;  3N0T A;  4U5C E;  3EPV A;  1D1A A;  1IW7 F;  3L34 A;  3DAF A;  3T4R A;  3NDB B;  1BR2 A;  2A69 F;  4RDA A;  1LKX A;  1VYI A;  4EWC A;  4U5F E;  2HV6 A;  1J8Y F;  1SZI A;  3EG9 A;  4J32 B;  3WOD F;  3AG3 C;  3ZG1 A;  4YJW A;  3E70 C;  4G7H F;  2H7B A;  1MMA A;  4LAC B;  2L9J A;  1TWG A;  3ZVR A;  1LVK A;  3LAY A;  3EGX A;  4CSA A;  1M2V A;  1NZE A;  1D0Z A;  1VYK A;  5HSW A;  2EIM C;  4U5D E;  1WGW A;  2QY9 A;  4AE4 A;  4IRU A;  4LLC A;  3EZI A;  1ZU5 A;  4CSA C;  5KYU B;  3Q7G A;  4I1M A;  4CS9 C;  4Q4Z F;  3SNH A;  2NUT B;  2VB6 A;  3FDQ A;  3KL4 A;  3EFO A;  2W4M A;  2CW0 F;  2ZXO A;  2WVO A;  2NUP A;  2M4E A;  2J9U A;  1J8M F;  4M63 A;  4W8K A;  2J7P D;  3NYM A;  4H4K C;  4KNV A;  5KYY A;  3S27 A;  2V26 A;  3OEO A;  3TD7 A;  4ANJ A;  2PX3 A;  3M1C B;  4KBL A;  3T6B A;  4U5H A;  2W4B A;  3ZIB A;  1FTS A;  2XL4 A;  2XSE A;  4PFO A;  4YT2 A;  3NKE A;  3W8I A;  1Z6A A;  3O6X A;  1VOM A;  2YHS A;  4OIO F;  3X1O A;  2HV7 A;  3E9V A;  4AK9 A;  2EIJ C;  3LLK A;  2FFH A;  2JD3 A;  2IOQ A;  3K6B A;  1G8X A;  2J46 A;  2Q9B A;  4K7B A;  3VYW A;  4C3E A;  2WB7 A;  4I1O B;  4E7Z A;  2R7S A;  3PHF 2;  4OD4 A;  1MMG A;  4BJ1 A;  2G3V A;  4PK4 A;  4MND A;  3L0I A;  4OD5 A;  1D0X A;  4DOZ A;  2J45 A;  4IJJ A;  5DLJ A;  1ZHX A;  1O87 A;  4O6Y A;  4GYT A;  5E3C A;  4YT8 A;  3NYJ A;  2P6V A;  4OIQ F;  3DZA A;  2ZXR A;  4IAO A;  5B1B C;  2NUT A;  3KKB A;  1OCC C;  4YWQ A;  2A68 F;  3UMH A;  4CIH A;  3EH2 A;  1Z5Z A;  1BR4 A;  3FHD A;  4KNW A;  3ECS A;  4DVY P;  3OA1 A;  3W2W A;  3W8H A;  4G7O F;  3LS1 A;  4QDL A;  1D0Y A;  3O39 A;  1NG1 A;  3CQZ A;  1TR2 A;  4BJ5 A;  3ABM C;  2H7O A;  2V3C C;  2PX0 A;  1ZU4 A;  2J0W A;  3NYL A;  3HJC A;  2WZL A;  2DYS C;  3HLZ A;  5EGY A;  3CSK A;  4JZA A;  3DJN B;  4BJ5 C;  2YZS A;  4IWB A;  3K7D A;  3JYH A;  3B0V C;  1JPJ A;  4C7O B;  2WVN A;  3ABK C;  1BR1 A;  1RJ9 B;  1FMW A;  2Y39 A;  2CDQ A;  1ZHY A;  2CNW A;  3GOD A;  3MLG A;  3UGO A;  1QLE C;  2OG2 A;  4XWJ A;  3K66 A;  4X0R A;  3MX3 A;  1OKK A;  1JPN A;  5KYX B;  2R7U A;  5D92 A;  4JW1 A;  1LS1 A;  2WZF A;  3EQL F;  2ZXW C;  4DBQ A;  4XLN F;  4A2N B;  3NRH A;  3ITF A;  4CS9 A;  2IXP A;  3JSZ A;  2R7X A;  3UMI A;  2EIK C;  3RIP A;  4HEA J;  3KH2 A;  1OCR C;  2J9W A;  2IXO A;  2KJG A;  3B0U X;  1OCZ C;  2R7R A;  3ASO C;  2GFH A;  5F5F A;  3AG4 C;  3KMI A;  4N06 A;  4OIN F;  4CS8 C;  3ZC4 A;  4FX5 A;  3GAN A;  4HE8 D;  2EIN C;  4U5B E;  3B0P A;  2Y3D A;  4XLP F;  4C7O A;  1RJ9 A;  1Z63 A;  1O5H A;  2XRH A;  4PJJ A;  3N24 A;  5IY5 C;  4QI0 A;  1M56 C;  2ZPA A;  4F4B A;  4ULW A;  3RKO F;  4KI2 A;  5KYX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...