4IJJA

Structure of transcription factor dksa2 from pseudomonas aeruginosa
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
129
structure length
129
Chain Sequence
AEQELLAQPDAAYMDEAQQDFFRDLLLRQRQELQARIEGEFGELRDLERPSDEADLASREEQRQWQLRLLEREKKLLDKIDEALERLARGDYGWCQETGEPIGLRRLLLRPTATLCIEAKERQEKRERH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative C4-type zinc finger protein, DksA/TraR family
publication title DksA2, a zinc-independent structural analog of the transcription factor DksA.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
total genus 42
structure length 129
sequence length 129
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01258 zf-dskA_traR Prokaryotic dksA/traR C4-type zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.910 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4ijjA00
2KGOA 4IJJA 2KQ9A
chains in the Genus database with same CATH superfamily
4XPYA 3RF3A 1Y4CA 1VMAA 4KNWA 4BEJA 2CNWD 2DI3A 2CGEA 3EH2A 3CAXA 3HKKA 3I5PA 3U3FA 3EQLF 3C8ZA 3JTLO 1RKEB 4DXWA 4JW1A 5F5FA 2BC5A 4I1MA 2Q9BA 1TFKB 2LIGA 2YL0A 2YZSA 3U8VA 2NUPA 2W9YA 3ZIBA 3MBGA 3C63A 1SF8A 2R7UA 1ORSC 4G0HA 4KC9A 2B0JA 2L81A 3H2VA 1EI7A 2DYRC 5A6AA 4XQ1A 4J32B 5F28E 5COFA 2YKZA 4UDVA 4U5DE 5D92A 2DB4A 3L8JA 4Z9JA 2R02A 2XL8A 2J7PA 4YT5A 1OR2A 2JPUA 2NPUA 2YEVA 3G4ZA 5IY5C 1TFOB 3LAYA 1KNYA 1V74B 2LP4A 3T9OA 3GM2A 2YL3A 3LEOA 3RYLA 1IZMA 3ZQYA 5JLIA 1E85A 5JRAA 3IPMO 1SZIA 2EINC 1FNTc 3NKDA 1BR4A 2HJMA 1PD0A 2J9BA 5FCLA 3PHF2 4O6YA 1WATA 1Z7Qc 2W4MA 4CDYA 1VTMP 4MS2A 3CQZA 4ULVA 1IW7F 5KYXB 3SYNA 3FMSA 1T6QA 4OIQF 4JEAA 4CDVA 1ZYRF 3MX3A 3DE8A 3RH3A 1BR2A 3FOPA 1UG7A 2D4UA 3QVYA 2QTVA 3JYHA 3U2LA 1QKRA 2ICWG 2KNHA 4IARA 4R32A 2XM4A 4BJ1A 5B3IA 2L6GA 2UUIA 2VCBA 5KYWA 4IGGA 1DOVA 1PD1A 1BR1A 3KPHA 1AEPA 4U5EE 5L3QA 5L0HA 4C3DA 4U5GA 4CS9A 5A6KA 4JVSA 3RFYA 1ZHXA 4A4AA 3EJNA 1J8MF 3DZAA 3WAQA 2XSEA 3L1MA 3MFNA 4P6IC 4I1OB 4CDAA 3T6JA 2EPKX 1D0YA 5E33A 3U2MA 4MQ9F 2XRHA 5A6JA 5COMA 5EHHA 4A2NB 2CCYA 2R7QA 1NZEA 3BEHA 1C03A 5EK0A 4DOZA 2G3KA 1ZHYA 2YL1A 1MQVA 3ASOC 3LEVA 5CI8A 3SXYA 1WN0A 1QLEC 2YHSA 4CJGA 1TQGA 2XLWA 1Q0DA 3AGTA 4JC7A 5DS5A 2ZXPA 3K6BA 4JURI 1ZW2A 1Z6AA 1MMNA 3CEXA 3FXHA 3S9OA 2H8AA 5L0DA 3O10A 2AU5A 3DAFA 3GODA 2X0CA 3VM6A 4IAQA 1JMWA 2CNWA 2Y3HA 4LDKA 4PJLA 4NY3A 2F22A 5JS5A 3K1IC 1EA8A 4JJFA 3HNIA 3T6GB 4PK4A 4AL1A 3EPVA 4J7TA 1HW1A 2DYSC 1AUEA 1T5OA 3EG9B 4OD4A 4MW3A 4ONSA 1O3UA 3DM9B 1LIHA 1YYJA 2LCHA 2HS5A 4U5CE 4K1OA 1LE4A 2ZPAA 2FFHA 2KW3C 2IXNA 1ORYA 1MMAA 2UUHA 2M64A 3IEEA 5AGFA 2NUPB 2P7VA 3TOLA 1LS4A 4WJ0A 1L7CA 4YJWA 2R7VA 2KJGA 5L0FA 4CX9A 4O7GA 3OEOA 3ZTMA 2XLHA 4N6HA 5JUAA 4CIHA 2HJ3A 4FAPB 1XWJA 5T3TA 4CJOA 5B1BC 1WTYA 3TJ6A 4ZLDA 2PNOA 1TWGA 1TR2A 4ZLCA 1S05A 3JSEO 1E86A 3CZ6A 3POVA 1SR2A 3PCVA 3EZIA 1RJ9A 1V4AA 5F5HA 3ITFA 4PFOA 1QQ3A 2HUJA 3S27A 2R03A 4EIYA 3B9QA 3JT1A 3UGOA 5K0IA 3AJMA 2QUPA 3AQBA 4C3EA 2J9VA 1YVIA 3Q6NA 4BJ6A 5BQHA 1JR8A 2R7SA 1RCPA 4DBRA 3DJUB 2L6HA 2XS8A 4CS8A 4IB4A 2A6HF 4GYTA 3WG7C 3W2VA 1G4WR 1R4TA 1Q0MA 5B1AC 2WZLA 4BJ5C 3W4YA 2W45A 5L0JA 2Y39A 1KU2A 3EGXA 2ZXWC 2EPLX 1MNEA 3DMDA 3NMKA 4JZAA 4XPXA 1APCA 3EG9A 3PMRA 4IAOA 3QW0A 4YL0A 3Q7GA 4XTKA 5KYWB 3S84A 4E17A 2ZXOA 3A9CA 3AQCA 2LFFA 2GDCA 3HNKA 4IWBA 4DVZA 4XEVA 3O39A 1LKXA 5HV9A 4E7SA 4JCHA 3B29A 1PV3A 2IOQA 1QPUA 3JSZA 1RKCA 1ORJA 2H7OA 4MVQA 5D91A 4EBBA 2DGJA 2R25A 2C03A 4FWVA 4JCZA 4PJNA 4NTFA 4K0DA 4OINF 3SZRA 4WGZA 1B68A 1J8YF 3NYJA 1NFNA 2R7OA 4JEBA 2PP4A 3UGPA 3L34A 4H4KC 5HSWA 1A41A 2Y3BA 1NFOA 3OWTA 2KYHA 2ZXRA 3H2UA 1I4YA 1HW2A 4CSAC 3EZHA 5JSLA 1VLTA 1T6IA 5DLJA 1AVOB 1ZHWA 3SP1A 4DVYP 3SEOA 4Q7CA 5FZTA 2WVOA 1JAFA 2YVKA 2XLOA 2CW0F 1LPEA 5DQTA 4EKWA 1SMYF 2VASA 1LVKA 2OU6A 2WL8A 3C8GA 1VK5A 3EGDA 3IQTA 4NQFA 1NLXA 4BPMA 2H7VC 5DQZA 1D1AA 1D1BA 1MNDA 5L0CA 3U3BA 2QY9A 3IHUA 4NC3A 4XWJA 2GA0A 5T3WA 1XZPA 3K66A 3UMHA 2P6VA 1TWAA 4C3BA 2EPNA 3H65A 3ASNC 3TD7A 4W8PA 4U5HA 3O55A 3DAGA 4BG0A 4DRIB 1H9TA 2J45A 3NMJA 3JZ0A 3GEIA 4LLEA 1M6TA 4KBLA 2A68F 2PBEA 4MTFA 4MVUA 2CDQA 1D1CA 3KL4A 3B0VC 2LQGA 2Q9AA 1OR3A 3IQ6A 3VF0A 2LD6A 4DRJB 1LI7A 2RSEB 1D0XA 1YA9A 3FVYA 3LESA 2NUTA 4EUKB 1LE2A 1G8XA 1O5HA 4LDQA 1CGOA 1CGNA 3N24A 2D5RB 4YWQA 2L6FA 1NBBA 2IM8A 2A6EF 4O79A 4Q5SF 2JX0A 1SYQA 4JJGA 1CPRA 4BJ5A 2AWCA 2A0UA 4DJ9A 1RJ9B 3W2WA 1HE1A 3V5XA 1U6HA 2YQYA 2PFDA 2A0BA 3JCUQ 2KSFA 3DD7A 4I3MA 1C02A 5JP7A 4MVRA 4D4XA 2WB7A 2OG2A 1K04A 4MTGA 2R7RA 1I4ZA 4LERA 4OIOF 4QDLA 1E2XA 4XEKA 4B6IA 3S0XA 1BZ4A 2XM0A 5COGA 1Z5ZA 2WZGA 3MYFA 1V54C 1LI5A 1OW7A 3GORA 3W8HA 4U9EA 3ABKC 3SXZA 3ZSUA 3HJCA 3MYIA 1NSGB 1W2WA 2KQ9A 4OD5A 1A7VA 3Q6MA 3GEHA 3AG4C 3NYMA 4MNDA 1GS9A 3EGXB 1F1MA 2C04A 3C8GD 3GANA 3U9JA 2P61A 1GQAA 2Q00A 3US6A 2XL6A 5A6BD 1GGQA 3NYLA 1JRAA 3R7CA 4CSAA 5E3CA 2L7AA 3M15A 2KGOA 2HKVA 2X51A 1Z23A 1V55C 3AOUA 3DM5A 2EIJC 1A7DA 3LLKA 5DVWA 3T4RA 4BEMJ 1FFHA 5KYNA 3ZTZA 1TWHA 4HFFB 4N4WA 4G78A 2R7WA 4F4BA 1Q0KA 2A69F 4U5FE 2QNLA 2YLDA 2IYLD 5E3AA 3W8IA 3WHNA 1N1CA 4E18A 3C62A 1FTSA 1OCRC 3B0PA 3QW1A 4AE4A 5T1DB 2LFDA 3E70C 1CGME 2VB6A 4DBQA 1FMVA 2HMQA 4JRZA 2V3CC 4LDRA 4MVSA 5GPGB 3K33A 3VAYA 3C18A 4EWCA 1K40A 3X1OA 3N2ZB 2B0HA 3BRJA 1WGWA 2GAQA 4W8KA 4O6NA 3Q7LA 3TQOA 2ZD9A 3F46A 3NKEA 3M1CB 3FOOA 2YRFA 1OCZC 2I15A 2Q4FA 3C8GB 3EGDB 4J30B 3B0UX 3ZDLA 4OIRF 3E9VA 3CSKA 2EPMX 2IXOA 1A0BA 2YWAA 2KK1A 3G50A 1T6UA 3K1HA 4JE9A 1QZXA 3IQCA 2GFHA 3KYIA 4CIPA 3QMKA 3GWNA 3FDQA 4N06A 3LUTB 1RXQA 2J0WA 2OKUA 3DI5A 1VLSA 2WVNA 3SNHA 1A7EA 3HNLA 1NG1A 3RIPA 1EQ1A 1FFTC 1FMWA 2MYSA 5TJ5E 1LM3B 3TK0A 4BJTA 4CS9C 2V26A 2J9WA 2PX0A 5JT4A 3ZVRA 5BQGA 4U9DA 2Y3DA 4FX5A 3ZC4A 5E2QA 4AL0A 5JVEA 2NUTB 2Q9CA 3DKAA 2MWQA 4E0IA 3G4XA 3AG1C 1H6GA 3UNGC 4YT2A 1M57C 4C7OA 1YJGA 1HY5A 2J46A 4EBKA 4Q4ZF 1YARO 4G7ZF 2QLAA 3VRCA 2H7BA 1RMVA 1OXKA 1FR0A 3PDMP 1U89A 3K1IA 3LNMB 2WVQA 4FESA 4G7OF 1M56C 1Q0FA 3RQGA 1YLMA 2XXAB 2HZ8A 3RKOF 2EPOA 3LS0A 4QI0A 3M79A 2P1AA 2G62A 2HFIA 3NRHA 4E7ZA 3O6XA 1VYIA 2AP3A 2E87A 2HSBA 4JTAB 3UR3C 3WODF 4ER9A 1U0BB 1Q0GA 4WABA 4XEFA 5CI9A 2XLMA 4HEAJ 5AC4A 4JTCB 2HMZA 1OKKD 2KC3A 3I4UA 3V5YA 3ZWIA 5A6BA 2Z15A 3DJNB 2NG1A 3SXMA 1WWPA 2OOCA 1OXBA 2BE5F 1QSPA 3R2PA 4X0RA 3K7DA 3AG2C 1GM5A 1ZHZA 2YLGA 4MVMA 5DS4A 1Y6DA 4RBNA 2R7TA 3EHMA 1H9GA 4HE8D 4AK9A 2A1DD 4HFKB 4KNVA 3S29A 4CS7A 4OIPF 1ZHTA 3J06A 3U5SA 2W4BA 1Z63A 2WZFA 4E0HA 2NSFA 4O6MA 3NG1A 2FAPB 3GWLA 5BQIA 5KYYA 2HSQA 1TKNA 3X2QC 3ZQVA 3KH2A 1M2VA 1NU9C 1E84A 1T9KA 1YZCA 3DWWA 2IXMA 3DXJF 3LLIA 5L0IA 4G7HF 1KTMA 3F47A 3L8IA 1O87A 3M4BA 1R5ID 1VB5A 2EIMC 2VH3A 3C7JA 2AWYA 1G4US 2VCAA 4U5BE 4AE4B 4EBJA 2NSGA 5EGYA 4JTDB 3DE9A 1OCOC 3JRTA 4LACB 1EKYA 3LS1A 1ZU5A 4PACA 2ETSA 2XXAA 1UFBA 3TJ5A 1BDJB 1XZQA 3QTHA 1CPQA 3HTKC 256BA 3RQEA 1RKEA 4BJ6C 3A11A 3FHDA 2J0XA 3JYYA 4IJJA 5DS6A 4PR9A 4CS8C 1OCCC 2VCCA 3EH1A 4PJJA 5B3SC 2QE9A 2CYDA 2Q3TA 1FAPB 4N6CA 1HMDA 4NTBA 1OW6A 2P0NA 3FAJA 2YL7A 3EHNA 3LJBA 4Z9IA 4Z9HA 4RDAA 2VC9A 3MLGA 1BBHA 3T6BA 4DRHB 1JOGA 3IQ5A 3ZG1A 2Y3GA 3L0IA 4YN0B 4ULWA 3AGUA 3RVZA 1OQCA 1VYKA 2RD9A 2Y69C 3JRMO 4D4NA 2OEXA 1PCXA 3S90A 1L3PA 1ZZPA 3EFOB 1HE9A 2IBFA 2HV7A 2XLEA 2J7PD 3V7OA 4NTAA 2EIKC 4JKVA 3RQFA 1D0ZA 4YL1A 2J8WA 4WGYA 2L9JA 3V5ZA 5A69A 1Z3IX 4YT4A 1K05A 1ZW3A 1MMGA 5KYXA 3VYWA 3NDBB 2GWWA 3KKBA 2R7XA 4GEHA 2OCCC 3U8PA 4C7OB 1C17M 2OJQA 4EHPA 1G5ZA 2HV6A 1ZU4A 2OEVA 2XS1A 2I8BA 3KYJA 3GM3A 5KYUB 4XLNF 2AVKA 4M63A 2XLVA 4YT8A 4XPWA 1E83A 4XLPF 1DOWA 1I5NA 1YZAA 1OKKA 2LK4A 3LNRA 4GQHA 3GM1A 5CIVA 4PFPA 1M2OA 1OW8A 1JPNA 2EILC 2PX3A 3FAPB 4LLCA 1YA7O 3I5QA 2R9RB 4KI2A 4H54A 3UMKA 1S7ZA 3ABMC 1JPJA 2TMVP 3GEEA 3ABLC 4YK5A 4CBEA 1ST6A 1HMOA 2O9XA 3UMIA 1YDIA 5L3VA 1WOLA 1YYXA 3U0CA 5AC5A 2OQMA 1NU7D 2G3VA 3HNJA 4AX2A 2J9UA 2IXPA 2LSEA 4P9TA 5L0GA 3QZCA 3OA1A 3B71A 3QVZA 2BL2A 4MVZA 1H7IA 4YL3A 3RW0A 1T01A 3EFOA 3ATPA 4J7YA 2XLDA 4P9FA 4L6RA 4MW8A 1MMDA 2YLIA 3TULA 3NMIA 4NCQA 5KYYB 2XL4A 1TWCA 2M4EA 2OJED 3M4CA 1QVXA 3N0TA 1M2VB 1YAUO 4MTOA 2R05A 2Q7RA 4QI2A 1WASA 3KMIA 4MVOA 2MHRA 3AG3C 1ZVZA 2FGYA 3TOMA 2PF4E 4ANJA 3S28A 4PJMA 5BUOA 1LS1A 3ECSA 2JD3A 4JIOA 3RVYA 3SXKA 1VOMA 4I44A 4K7BA 5KYUA 3U9MA 4IRUA 3HLZA 2ASRA 4RD9A
chains in the Genus database with same CATH topology
1VMAA 4KNWA 4BEJA 2CNWD 3I5PA 2CGEA 3EH2A 3EQLF 4JW1A 5F5FA 4I1MA 2Q9BA 2YZSA 2NUPA 2W9YA 3ZIBA 1SF8A 2R7UA 4G0HA 4KC9A 2B0JA 2L81A 2DYRC 4J32B 4U5DE 5D92A 2J7PA 4YT5A 2YEVA 5IY5C 3LAYA 3RYLA 1IZMA 1SZIA 2EINC 3NKDA 1BR4A 1PD0A 3PHF2 5FCLA 4O6YA 2W4MA 3CQZA 1IW7F 5KYXB 3SYNA 4OIQF 1ZYRF 3MX3A 3RH3A 1BR2A 2QTVA 3JYHA 2KNHA 4BJ1A 5KYWA 1PD1A 1BR1A 4U5EE 5L3QA 4C3DA 4U5GA 4CS9A 4JVSA 3RFYA 1ZHXA 3EJNA 1J8MF 3DZAA 2XSEA 4P6IC 4I1OB 3T6JA 5E33A 1D0YA 4MQ9F 2XRHA 5EHHA 4A2NB 2R7QA 1NZEA 4DOZA 2G3KA 1ZHYA 3ASOC 3LEVA 5CI8A 1QLEC 2YHSA 5DS5A 2ZXPA 3K6BA 4JURI 1Z6AA 1MMNA 3DAFA 3GODA 2Y3HA 2CNWA 4PJLA 4NY3A 3K1IC 4JJFA 4PK4A 3EPVA 2DYSC 3EG9B 4OD4A 3DM9B 4U5CE 2ZPAA 2FFHA 2KW3C 2IXNA 3IEEA 1MMAA 2NUPB 2P7VA 4WJ0A 4YJWA 2R7VA 2KJGA 4O7GA 3OEOA 4CIHA 4ZLDA 5T3TA 5B1BC 1TWGA 1TR2A 4ZLCA 3POVA 3CZ6A 3EZIA 1RJ9A 5F5HA 3ITFA 4PFOA 3S27A 3B9QA 3JT1A 3UGOA 3AQBA 4C3EA 2J9VA 3Q6NA 4BJ6A 2R7SA 4DBRA 3DJUB 4CS8A 2A6HF 4GYTA 3WG7C 3W2VA 4BJ5C 5B1AC 2WZLA 2W45A 2Y39A 1KU2A 3EGXA 2ZXWC 3DMDA 1MNEA 4JZAA 3EG9A 3PMRA 4IAOA 3Q7GA 4XTKA 5KYWB 2ZXOA 3AQCA 4IWBA 4DVZA 3O39A 1LKXA 4E7SA 4JCHA 2IOQA 3JSZA 2H7OA 5D91A 4EBBA 2DGJA 2C03A 4FWVA 4PJNA 4K0DA 4OINF 3SZRA 1J8YF 3NYJA 2R7OA 3UGPA 2PP4A 3L34A 4H4KC 5HSWA 2Y3BA 3OWTA 2ZXRA 4CSAC 3EZHA 5DLJA 1ZHWA 3SP1A 4DVYP 3SEOA 4Q7CA 2WVOA 2CW0F 5DQTA 1SMYF 2VASA 1LVKA 2WL8A 1VK5A 3EGDA 2H7VC 5DQZA 1D1AA 1D1BA 1MNDA 2QY9A 4XWJA 5T3WA 3K66A 3UMHA 2P6VA 1TWAA 4C3BA 3H65A 3ASNC 3TD7A 4BG0A 4U5HA 3DAGA 2J45A 4LLEA 4KBLA 2A68F 2CDQA 1D1CA 3KL4A 3B0VC 2Q9AA 1D0XA 3FVYA 3LESA 2NUTA 1G8XA 1O5HA 3N24A 2D5RB 4YWQA 2A6EF 4O79A 4JJGA 4BJ5A 1RJ9B 3W2WA 2PFDA 3JCUQ 3DD7A 4I3MA 2WB7A 2OG2A 2R7RA 4LERA 4OIOF 4QDLA 3S0XA 4B6IA 1Z5ZA 2WZGA 1V54C 3W8HA 3ABKC 3ZSUA 3HJCA 1W2WA 2KQ9A 4OD5A 3Q6MA 3AG4C 3NYMA 4MNDA 3EGXB 2C04A 3GANA 3NYLA 4CSAA 5E3CA 2KGOA 3DM5A 2X51A 1Z23A 1V55C 5DVWA 3T4RA 2EIJC 5KYNA 3LLKA 1FFHA 1TWHA 4HFFB 2R7WA 4F4BA 2A69F 4U5FE 2IYLD 5E3AA 3W8IA 1N1CA 1FTSA 1OCRC 3B0PA 4AE4A 5T1DB 3E70C 2VB6A 4DBQA 1FMVA 2V3CC 3K33A 3VAYA 4EWCA 3X1OA 3N2ZB 1WGWA 4W8KA 4O6NA 3Q7LA 3F46A 3NKEA 3M1CB 1OCZC 3EGDB 4J30B 3B0UX 4OIRF 3E9VA 3CSKA 2IXOA 3K1HA 1QZXA 2GFHA 3FDQA 3QMKA 4N06A 2J0WA 2WVNA 3SNHA 1NG1A 3RIPA 1FFTC 1FMWA 2MYSA 4BJTA 4CS9C 2V26A 2J9WA 2PX0A 3ZVRA 2Y3DA 4FX5A 3ZC4A 5E2QA 2NUTB 2Q9CA 2MWQA 3AG1C 3UNGC 4YT2A 1M57C 4C7OA 4G7ZF 4Q5SF 2J46A 4Q4ZF 2H7BA 4FESA 2WVQA 4G7OF 1M56C 2XXAB 3RKOF 3LS0A 4QI0A 2G62A 3NRHA 4E7ZA 3O6XA 1VYIA 2E87A 3UR3C 3WODF 5CI9A 4HEAJ 3I4UA 1OKKD 2Z15A 3DJNB 2NG1A 2BE5F 4X0RA 3K7DA 3AG2C 1ZHZA 5DS4A 2R7TA 4RBNA 3EHMA 4HE8D 4AK9A 2A1DD 4HFKB 4KNVA 3S29A 4CS7A 4OIPF 1ZHTA 2W4BA 1Z63A 2WZFA 4O6MA 3NG1A 5KYYA 1TKNA 3X2QC 3KH2A 1M2VA 1NU9C 4G7HF 3DXJF 2IXMA 3LLIA 3F47A 1O87A 2EIMC 2VH3A 5EGYA 4U5BE 4AE4B 1OCOC 3JRTA 4LACB 3LS1A 1ZU5A 2XXAA 3HTKC 4BJ6C 3FHDA 4IJJA 2J0XA 5DS6A 4CS8C 1OCCC 3EH1A 4PJJA 5B3SC 2Q3TA 3FAJA 3LJBA 3EHNA 4RDAA 3MLGA 3T6BA 3ZG1A 2Y3GA 3L0IA 4YN0B 4ULWA 1VYKA 2Y69C 1PCXA 3EFOB 2HV7A 2J7PD 3V7OA 2EIKC 1D0ZA 2L9JA 1Z3IX 4YT4A 1MMGA 5KYXA 3VYWA 3NDBB 3KKBA 2R7XA 4GEHA 2OCCC 4C7OB 2HV6A 1ZU4A 2I8BA 5KYUB 4XLNF 4M63A 4YT8A 4XLPF 1OKKA 3LNRA 4PFPA 1M2OA 4LLCA 1JPNA 2EILC 2PX3A 4KI2A 3I5QA 3UMKA 1S7ZA 3ABMC 1JPJA 3ABLC 1ST6A 2O9XA 3UMIA 5L3VA 1NU7D 2G3VA 4AX2A 2J9UA 2IXPA 2LSEA 3QZCA 3OA1A 3EFOA 1MMDA 5KYYB 2XL4A 1TWCA 2M4EA 3N0TA 1M2VB 4QI2A 3KMIA 3AG3C 2FGYA 2PF4E 4ANJA 3S28A 4PJMA 5BUOA 1LS1A 3ECSA 2JD3A 1VOMA 4I44A 4K7BA 5KYUA 4CBEA 4IRUA 3HLZA 4RD9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KGO A;  4IJJ A;  2KQ9 A; 
#chains in the Genus database with same CATH topology
 4XPY A;  3RF3 A;  1Y4C A;  1VMA A;  4KNW A;  4BEJ A;  2CNW D;  2DI3 A;  2CGE A;  3EH2 A;  3CAX A;  3HKK A;  3I5P A;  3U3F A;  3EQL F;  3C8Z A;  3JTL O;  1RKE B;  4DXW A;  4JW1 A;  5F5F A;  2BC5 A;  4I1M A;  2Q9B A;  1TFK B;  2LIG A;  2YL0 A;  2YZS A;  3U8V A;  2NUP A;  2W9Y A;  3ZIB A;  3MBG A;  3C63 A;  1SF8 A;  2R7U A;  1ORS C;  4G0H A;  4KC9 A;  2B0J A;  2L81 A;  3H2V A;  1EI7 A;  2DYR C;  5A6A A;  4XQ1 A;  4J32 B;  5F28 E;  5COF A;  2YKZ A;  4UDV A;  4U5D E;  5D92 A;  2DB4 A;  3L8J A;  4Z9J A;  2R02 A;  2XL8 A;  2J7P A;  4YT5 A;  1OR2 A;  2JPU A;  2NPU A;  2YEV A;  3G4Z A;  5IY5 C;  1TFO B;  3LAY A;  1KNY A;  1V74 B;  2LP4 A;  3T9O A;  3GM2 A;  2YL3 A;  3LEO A;  3RYL A;  1IZM A;  3ZQY A;  5JLI A;  1E85 A;  5JRA A;  3IPM O;  1SZI A;  2EIN C;  1FNT c;  3NKD A;  1BR4 A;  2HJM A;  1PD0 A;  2J9B A;  5FCL A;  3PHF 2;  4O6Y A;  1WAT A;  1Z7Q c;  2W4M A;  4CDY A;  1VTM P;  4MS2 A;  3CQZ A;  4ULV A;  1IW7 F;  5KYX B;  3SYN A;  3FMS A;  1T6Q A;  4OIQ F;  4JEA A;  4CDV A;  1ZYR F;  3MX3 A;  3DE8 A;  3RH3 A;  1BR2 A;  3FOP A;  1UG7 A;  2D4U A;  3QVY A;  2QTV A;  3JYH A;  3U2L A;  1QKR A;  2ICW G;  2KNH A;  4IAR A;  4R32 A;  2XM4 A;  4BJ1 A;  5B3I A;  2L6G A;  2UUI A;  2VCB A;  5KYW A;  4IGG A;  1DOV A;  1PD1 A;  1BR1 A;  3KPH A;  1AEP A;  4U5E E;  5L3Q A;  5L0H A;  4C3D A;  4U5G A;  4CS9 A;  5A6K A;  4JVS A;  3RFY A;  1ZHX A;  4A4A A;  3EJN A;  1J8M F;  3DZA A;  3WAQ A;  2XSE A;  3L1M A;  3MFN A;  4P6I C;  4I1O B;  4CDA A;  3T6J A;  2EPK X;  1D0Y A;  5E33 A;  3U2M A;  4MQ9 F;  2XRH A;  5A6J A;  5COM A;  5EHH A;  4A2N B;  2CCY A;  2R7Q A;  1NZE A;  3BEH A;  1C03 A;  5EK0 A;  4DOZ A;  2G3K A;  1ZHY A;  2YL1 A;  1MQV A;  3ASO C;  3LEV A;  5CI8 A;  3SXY A;  1WN0 A;  1QLE C;  2YHS A;  4CJG A;  1TQG A;  2XLW A;  1Q0D A;  3AGT A;  4JC7 A;  5DS5 A;  2ZXP A;  3K6B A;  4JUR I;  1ZW2 A;  1Z6A A;  1MMN A;  3CEX A;  3FXH A;  3S9O A;  2H8A A;  5L0D A;  3O10 A;  2AU5 A;  3DAF A;  3GOD A;  2X0C A;  3VM6 A;  4IAQ A;  1JMW A;  2CNW A;  2Y3H A;  4LDK A;  4PJL A;  4NY3 A;  2F22 A;  5JS5 A;  3K1I C;  1EA8 A;  4JJF A;  3HNI A;  3T6G B;  4PK4 A;  4AL1 A;  3EPV A;  4J7T A;  1HW1 A;  2DYS C;  1AUE A;  1T5O A;  3EG9 B;  4OD4 A;  4MW3 A;  4ONS A;  1O3U A;  3DM9 B;  1LIH A;  1YYJ A;  2LCH A;  2HS5 A;  4U5C E;  4K1O A;  1LE4 A;  2ZPA A;  2FFH A;  2KW3 C;  2IXN A;  1ORY A;  1MMA A;  2UUH A;  2M64 A;  3IEE A;  5AGF A;  2NUP B;  2P7V A;  3TOL A;  1LS4 A;  4WJ0 A;  1L7C A;  4YJW A;  2R7V A;  2KJG A;  5L0F A;  4CX9 A;  4O7G A;  3OEO A;  3ZTM A;  2XLH A;  4N6H A;  5JUA A;  4CIH A;  2HJ3 A;  4FAP B;  1XWJ A;  5T3T A;  4CJO A;  5B1B C;  1WTY A;  3TJ6 A;  4ZLD A;  2PNO A;  1TWG A;  1TR2 A;  4ZLC A;  1S05 A;  3JSE O;  1E86 A;  3CZ6 A;  3POV A;  1SR2 A;  3PCV A;  3EZI A;  1RJ9 A;  1V4A A;  5F5H A;  3ITF A;  4PFO A;  1QQ3 A;  2HUJ A;  3S27 A;  2R03 A;  4EIY A;  3B9Q A;  3JT1 A;  3UGO A;  5K0I A;  3AJM A;  2QUP A;  3AQB A;  4C3E A;  2J9V A;  1YVI A;  3Q6N A;  4BJ6 A;  5BQH A;  1JR8 A;  2R7S A;  1RCP A;  4DBR A;  3DJU B;  2L6H A;  2XS8 A;  4CS8 A;  4IB4 A;  2A6H F;  4GYT A;  3WG7 C;  3W2V A;  1G4W R;  1R4T A;  1Q0M A;  5B1A C;  2WZL A;  4BJ5 C;  3W4Y A;  2W45 A;  5L0J A;  2Y39 A;  1KU2 A;  3EGX A;  2ZXW C;  2EPL X;  1MNE A;  3DMD A;  3NMK A;  4JZA A;  4XPX A;  1APC A;  3EG9 A;  3PMR A;  4IAO A;  3QW0 A;  4YL0 A;  3Q7G A;  4XTK A;  5KYW B;  3S84 A;  4E17 A;  2ZXO A;  3A9C A;  3AQC A;  2LFF A;  2GDC A;  3HNK A;  4IWB A;  4DVZ A;  4XEV A;  3O39 A;  1LKX A;  5HV9 A;  4E7S A;  4JCH A;  3B29 A;  1PV3 A;  2IOQ A;  1QPU A;  3JSZ A;  1RKC A;  1ORJ A;  2H7O A;  4MVQ A;  5D91 A;  4EBB A;  2DGJ A;  2R25 A;  2C03 A;  4FWV A;  4JCZ A;  4PJN A;  4NTF A;  4K0D A;  4OIN F;  3SZR A;  4WGZ A;  1B68 A;  1J8Y F;  3NYJ A;  1NFN A;  2R7O A;  4JEB A;  2PP4 A;  3UGP A;  3L34 A;  4H4K C;  5HSW A;  1A41 A;  2Y3B A;  1NFO A;  3OWT A;  2KYH A;  2ZXR A;  3H2U A;  1I4Y A;  1HW2 A;  4CSA C;  3EZH A;  5JSL A;  1VLT A;  1T6I A;  5DLJ A;  1AVO B;  1ZHW A;  3SP1 A;  4DVY P;  3SEO A;  4Q7C A;  5FZT A;  2WVO A;  1JAF A;  2YVK A;  2XLO A;  2CW0 F;  1LPE A;  5DQT A;  4EKW A;  1SMY F;  2VAS A;  1LVK A;  2OU6 A;  2WL8 A;  3C8G A;  1VK5 A;  3EGD A;  3IQT A;  4NQF A;  1NLX A;  4BPM A;  2H7V C;  5DQZ A;  1D1A A;  1D1B A;  1MND A;  5L0C A;  3U3B A;  2QY9 A;  3IHU A;  4NC3 A;  4XWJ A;  2GA0 A;  5T3W A;  1XZP A;  3K66 A;  3UMH A;  2P6V A;  1TWA A;  4C3B A;  2EPN A;  3H65 A;  3ASN C;  3TD7 A;  4W8P A;  4U5H A;  3O55 A;  3DAG A;  4BG0 A;  4DRI B;  1H9T A;  2J45 A;  3NMJ A;  3JZ0 A;  3GEI A;  4LLE A;  1M6T A;  4KBL A;  2A68 F;  2PBE A;  4MTF A;  4MVU A;  2CDQ A;  1D1C A;  3KL4 A;  3B0V C;  2LQG A;  2Q9A A;  1OR3 A;  3IQ6 A;  3VF0 A;  2LD6 A;  4DRJ B;  1LI7 A;  2RSE B;  1D0X A;  1YA9 A;  3FVY A;  3LES A;  2NUT A;  4EUK B;  1LE2 A;  1G8X A;  1O5H A;  4LDQ A;  1CGO A;  1CGN A;  3N24 A;  2D5R B;  4YWQ A;  2L6F A;  1NBB A;  2IM8 A;  2A6E F;  4O79 A;  4Q5S F;  2JX0 A;  1SYQ A;  4JJG A;  1CPR A;  4BJ5 A;  2AWC A;  2A0U A;  4DJ9 A;  1RJ9 B;  3W2W A;  1HE1 A;  3V5X A;  1U6H A;  2YQY A;  2PFD A;  2A0B A;  3JCU Q;  2KSF A;  3DD7 A;  4I3M A;  1C02 A;  5JP7 A;  4MVR A;  4D4X A;  2WB7 A;  2OG2 A;  1K04 A;  4MTG A;  2R7R A;  1I4Z A;  4LER A;  4OIO F;  4QDL A;  1E2X A;  4XEK A;  4B6I A;  3S0X A;  1BZ4 A;  2XM0 A;  5COG A;  1Z5Z A;  2WZG A;  3MYF A;  1V54 C;  1LI5 A;  1OW7 A;  3GOR A;  3W8H A;  4U9E A;  3ABK C;  3SXZ A;  3ZSU A;  3HJC A;  3MYI A;  1NSG B;  1W2W A;  2KQ9 A;  4OD5 A;  1A7V A;  3Q6M A;  3GEH A;  3AG4 C;  3NYM A;  4MND A;  1GS9 A;  3EGX B;  1F1M A;  2C04 A;  3C8G D;  3GAN A;  3U9J A;  2P61 A;  1GQA A;  2Q00 A;  3US6 A;  2XL6 A;  5A6B D;  1GGQ A;  3NYL A;  1JRA A;  3R7C A;  4CSA A;  5E3C A;  2L7A A;  3M15 A;  2KGO A;  2HKV A;  2X51 A;  1Z23 A;  1V55 C;  3AOU A;  3DM5 A;  2EIJ C;  1A7D A;  3LLK A;  5DVW A;  3T4R A;  4BEM J;  1FFH A;  5KYN A;  3ZTZ A;  1TWH A;  4HFF B;  4N4W A;  4G78 A;  2R7W A;  4F4B A;  1Q0K A;  2A69 F;  4U5F E;  2QNL A;  2YLD A;  2IYL D;  5E3A A;  3W8I A;  3WHN A;  1N1C A;  4E18 A;  3C62 A;  1FTS A;  1OCR C;  3B0P A;  3QW1 A;  4AE4 A;  5T1D B;  2LFD A;  3E70 C;  1CGM E;  2VB6 A;  4DBQ A;  1FMV A;  2HMQ A;  4JRZ A;  2V3C C;  4LDR A;  4MVS A;  5GPG B;  3K33 A;  3VAY A;  3C18 A;  4EWC A;  1K40 A;  3X1O A;  3N2Z B;  2B0H A;  3BRJ A;  1WGW A;  2GAQ A;  4W8K A;  4O6N A;  3Q7L A;  3TQO A;  2ZD9 A;  3F46 A;  3NKE A;  3M1C B;  3FOO A;  2YRF A;  1OCZ C;  2I15 A;  2Q4F A;  3C8G B;  3EGD B;  4J30 B;  3B0U X;  3ZDL A;  4OIR F;  3E9V A;  3CSK A;  2EPM X;  2IXO A;  1A0B A;  2YWA A;  2KK1 A;  3G50 A;  1T6U A;  3K1H A;  4JE9 A;  1QZX A;  3IQC A;  2GFH A;  3KYI A;  4CIP A;  3QMK A;  3GWN A;  3FDQ A;  4N06 A;  3LUT B;  1RXQ A;  2J0W A;  2OKU A;  3DI5 A;  1VLS A;  2WVN A;  3SNH A;  1A7E A;  3HNL A;  1NG1 A;  3RIP A;  1EQ1 A;  1FFT C;  1FMW A;  2MYS A;  5TJ5 E;  1LM3 B;  3TK0 A;  4BJT A;  4CS9 C;  2V26 A;  2J9W A;  2PX0 A;  5JT4 A;  3ZVR A;  5BQG A;  4U9D A;  2Y3D A;  4FX5 A;  3ZC4 A;  5E2Q A;  4AL0 A;  5JVE A;  2NUT B;  2Q9C A;  3DKA A;  2MWQ A;  4E0I A;  3G4X A;  3AG1 C;  1H6G A;  3UNG C;  4YT2 A;  1M57 C;  4C7O A;  1YJG A;  1HY5 A;  2J46 A;  4EBK A;  4Q4Z F;  1YAR O;  4G7Z F;  2QLA A;  3VRC A;  2H7B A;  1RMV A;  1OXK A;  1FR0 A;  3PDM P;  1U89 A;  3K1I A;  3LNM B;  2WVQ A;  4FES A;  4G7O F;  1M56 C;  1Q0F A;  3RQG A;  1YLM A;  2XXA B;  2HZ8 A;  3RKO F;  2EPO A;  3LS0 A;  4QI0 A;  3M79 A;  2P1A A;  2G62 A;  2HFI A;  3NRH A;  4E7Z A;  3O6X A;  1VYI A;  2AP3 A;  2E87 A;  2HSB A;  4JTA B;  3UR3 C;  3WOD F;  4ER9 A;  1U0B B;  1Q0G A;  4WAB A;  4XEF A;  5CI9 A;  2XLM A;  4HEA J;  5AC4 A;  4JTC B;  2HMZ A;  1OKK D;  2KC3 A;  3I4U A;  3V5Y A;  3ZWI A;  5A6B A;  2Z15 A;  3DJN B;  2NG1 A;  3SXM A;  1WWP A;  2OOC A;  1OXB A;  2BE5 F;  1QSP A;  3R2P A;  4X0R A;  3K7D A;  3AG2 C;  1GM5 A;  1ZHZ A;  2YLG A;  4MVM A;  5DS4 A;  1Y6D A;  4RBN A;  2R7T A;  3EHM A;  1H9G A;  4HE8 D;  4AK9 A;  2A1D D;  4HFK B;  4KNV A;  3S29 A;  4CS7 A;  4OIP F;  1ZHT A;  3J06 A;  3U5S A;  2W4B A;  1Z63 A;  2WZF A;  4E0H A;  2NSF A;  4O6M A;  3NG1 A;  2FAP B;  3GWL A;  5BQI A;  5KYY A;  2HSQ A;  1TKN A;  3X2Q C;  3ZQV A;  3KH2 A;  1M2V A;  1NU9 C;  1E84 A;  1T9K A;  1YZC A;  3DWW A;  2IXM A;  3DXJ F;  3LLI A;  5L0I A;  4G7H F;  1KTM A;  3F47 A;  3L8I A;  1O87 A;  3M4B A;  1R5I D;  1VB5 A;  2EIM C;  2VH3 A;  3C7J A;  2AWY A;  1G4U S;  2VCA A;  4U5B E;  4AE4 B;  4EBJ A;  2NSG A;  5EGY A;  4JTD B;  3DE9 A;  1OCO C;  3JRT A;  4LAC B;  1EKY A;  3LS1 A;  1ZU5 A;  4PAC A;  2ETS A;  2XXA A;  1UFB A;  3TJ5 A;  1BDJ B;  1XZQ A;  3QTH A;  1CPQ A;  3HTK C;  256B A;  3RQE A;  1RKE A;  4BJ6 C;  3A11 A;  3FHD A;  2J0X A;  3JYY A;  4IJJ A;  5DS6 A;  4PR9 A;  4CS8 C;  1OCC C;  2VCC A;  3EH1 A;  4PJJ A;  5B3S C;  2QE9 A;  2CYD A;  2Q3T A;  1FAP B;  4N6C A;  1HMD A;  4NTB A;  1OW6 A;  2P0N A;  3FAJ A;  2YL7 A;  3EHN A;  3LJB A;  4Z9I A;  4Z9H A;  4RDA A;  2VC9 A;  3MLG A;  1BBH A;  3T6B A;  4DRH B;  1JOG A;  3IQ5 A;  3ZG1 A;  2Y3G A;  3L0I A;  4YN0 B;  4ULW A;  3AGU A;  3RVZ A;  1OQC A;  1VYK A;  2RD9 A;  2Y69 C;  3JRM O;  4D4N A;  2OEX A;  1PCX A;  3S90 A;  1L3P A;  1ZZP A;  3EFO B;  1HE9 A;  2IBF A;  2HV7 A;  2XLE A;  2J7P D;  3V7O A;  4NTA A;  2EIK C;  4JKV A;  3RQF A;  1D0Z A;  4YL1 A;  2J8W A;  4WGY A;  2L9J A;  3V5Z A;  5A69 A;  1Z3I X;  4YT4 A;  1K05 A;  1ZW3 A;  1MMG A;  5KYX A;  3VYW A;  3NDB B;  2GWW A;  3KKB A;  2R7X A;  4GEH A;  2OCC C;  3U8P A;  4C7O B;  1C17 M;  2OJQ A;  4EHP A;  1G5Z A;  2HV6 A;  1ZU4 A;  2OEV A;  2XS1 A;  2I8B A;  3KYJ A;  3GM3 A;  5KYU B;  4XLN F;  2AVK A;  4M63 A;  2XLV A;  4YT8 A;  4XPW A;  1E83 A;  4XLP F;  1DOW A;  1I5N A;  1YZA A;  1OKK A;  2LK4 A;  3LNR A;  4GQH A;  3GM1 A;  5CIV A;  4PFP A;  1M2O A;  1OW8 A;  1JPN A;  2EIL C;  2PX3 A;  3FAP B;  4LLC A;  1YA7 O;  3I5Q A;  2R9R B;  4KI2 A;  4H54 A;  3UMK A;  1S7Z A;  3ABM C;  1JPJ A;  2TMV P;  3GEE A;  3ABL C;  4YK5 A;  4CBE A;  1ST6 A;  1HMO A;  2O9X A;  3UMI A;  1YDI A;  5L3V A;  1WOL A;  1YYX A;  3U0C A;  5AC5 A;  2OQM A;  1NU7 D;  2G3V A;  3HNJ A;  4AX2 A;  2J9U A;  2IXP A;  2LSE A;  4P9T A;  5L0G A;  3QZC A;  3OA1 A;  3B71 A;  3QVZ A;  2BL2 A;  4MVZ A;  1H7I A;  4YL3 A;  3RW0 A;  1T01 A;  3EFO A;  3ATP A;  4J7Y A;  2XLD A;  4P9F A;  4L6R A;  4MW8 A;  1MMD A;  2YLI A;  3TUL A;  3NMI A;  4NCQ A;  5KYY B;  2XL4 A;  1TWC A;  2M4E A;  2OJE D;  3M4C A;  1QVX A;  3N0T A;  1M2V B;  1YAU O;  4MTO A;  2R05 A;  2Q7R A;  4QI2 A;  1WAS A;  3KMI A;  4MVO A;  2MHR A;  3AG3 C;  1ZVZ A;  2FGY A;  3TOM A;  2PF4 E;  4ANJ A;  3S28 A;  4PJM A;  5BUO A;  1LS1 A;  3ECS A;  2JD3 A;  4JIO A;  3RVY A;  3SXK A;  1VOM A;  4I44 A;  4K7B A;  5KYU A;  3U9M A;  4IRU A;  3HLZ A;  2ASR A;  4RD9 A; 
#chains in the Genus database with same CATH homology
 1VMA A;  4KNW A;  4BEJ A;  2CNW D;  3I5P A;  2CGE A;  3EH2 A;  3EQL F;  4JW1 A;  5F5F A;  4I1M A;  2Q9B A;  2YZS A;  2NUP A;  2W9Y A;  3ZIB A;  1SF8 A;  2R7U A;  4G0H A;  4KC9 A;  2B0J A;  2L81 A;  2DYR C;  4J32 B;  4U5D E;  5D92 A;  2J7P A;  4YT5 A;  2YEV A;  5IY5 C;  3LAY A;  3RYL A;  1IZM A;  1SZI A;  2EIN C;  3NKD A;  1BR4 A;  1PD0 A;  3PHF 2;  5FCL A;  4O6Y A;  2W4M A;  3CQZ A;  1IW7 F;  5KYX B;  3SYN A;  4OIQ F;  1ZYR F;  3MX3 A;  3RH3 A;  1BR2 A;  2QTV A;  3JYH A;  2KNH A;  4BJ1 A;  5KYW A;  1PD1 A;  1BR1 A;  4U5E E;  5L3Q A;  4C3D A;  4U5G A;  4CS9 A;  4JVS A;  3RFY A;  1ZHX A;  3EJN A;  1J8M F;  3DZA A;  2XSE A;  4P6I C;  4I1O B;  3T6J A;  5E33 A;  1D0Y A;  4MQ9 F;  2XRH A;  5EHH A;  4A2N B;  2R7Q A;  1NZE A;  4DOZ A;  2G3K A;  1ZHY A;  3ASO C;  3LEV A;  5CI8 A;  1QLE C;  2YHS A;  5DS5 A;  2ZXP A;  3K6B A;  4JUR I;  1Z6A A;  1MMN A;  3DAF A;  3GOD A;  2Y3H A;  2CNW A;  4PJL A;  4NY3 A;  3K1I C;  4JJF A;  4PK4 A;  3EPV A;  2DYS C;  3EG9 B;  4OD4 A;  3DM9 B;  4U5C E;  2ZPA A;  2FFH A;  2KW3 C;  2IXN A;  3IEE A;  1MMA A;  2NUP B;  2P7V A;  4WJ0 A;  4YJW A;  2R7V A;  2KJG A;  4O7G A;  3OEO A;  4CIH A;  4ZLD A;  5T3T A;  5B1B C;  1TWG A;  1TR2 A;  4ZLC A;  3POV A;  3CZ6 A;  3EZI A;  1RJ9 A;  5F5H A;  3ITF A;  4PFO A;  3S27 A;  3B9Q A;  3JT1 A;  3UGO A;  3AQB A;  4C3E A;  2J9V A;  3Q6N A;  4BJ6 A;  2R7S A;  4DBR A;  3DJU B;  4CS8 A;  2A6H F;  4GYT A;  3WG7 C;  3W2V A;  4BJ5 C;  5B1A C;  2WZL A;  2W45 A;  2Y39 A;  1KU2 A;  3EGX A;  2ZXW C;  3DMD A;  1MNE A;  4JZA A;  3EG9 A;  3PMR A;  4IAO A;  3Q7G A;  4XTK A;  5KYW B;  2ZXO A;  3AQC A;  4IWB A;  4DVZ A;  3O39 A;  1LKX A;  4E7S A;  4JCH A;  2IOQ A;  3JSZ A;  2H7O A;  5D91 A;  4EBB A;  2DGJ A;  2C03 A;  4FWV A;  4PJN A;  4K0D A;  4OIN F;  3SZR A;  1J8Y F;  3NYJ A;  2R7O A;  3UGP A;  2PP4 A;  3L34 A;  4H4K C;  5HSW A;  2Y3B A;  3OWT A;  2ZXR A;  4CSA C;  3EZH A;  5DLJ A;  1ZHW A;  3SP1 A;  4DVY P;  3SEO A;  4Q7C A;  2WVO A;  2CW0 F;  5DQT A;  1SMY F;  2VAS A;  1LVK A;  2WL8 A;  1VK5 A;  3EGD A;  2H7V C;  5DQZ A;  1D1A A;  1D1B A;  1MND A;  2QY9 A;  4XWJ A;  5T3W A;  3K66 A;  3UMH A;  2P6V A;  1TWA A;  4C3B A;  3H65 A;  3ASN C;  3TD7 A;  4BG0 A;  4U5H A;  3DAG A;  2J45 A;  4LLE A;  4KBL A;  2A68 F;  2CDQ A;  1D1C A;  3KL4 A;  3B0V C;  2Q9A A;  1D0X A;  3FVY A;  3LES A;  2NUT A;  1G8X A;  1O5H A;  3N24 A;  2D5R B;  4YWQ A;  2A6E F;  4O79 A;  4JJG A;  4BJ5 A;  1RJ9 B;  3W2W A;  2PFD A;  3JCU Q;  3DD7 A;  4I3M A;  2WB7 A;  2OG2 A;  2R7R A;  4LER A;  4OIO F;  4QDL A;  3S0X A;  4B6I A;  1Z5Z A;  2WZG A;  1V54 C;  3W8H A;  3ABK C;  3ZSU A;  3HJC A;  1W2W A;  2KQ9 A;  4OD5 A;  3Q6M A;  3AG4 C;  3NYM A;  4MND A;  3EGX B;  2C04 A;  3GAN A;  3NYL A;  4CSA A;  5E3C A;  2KGO A;  3DM5 A;  2X51 A;  1Z23 A;  1V55 C;  5DVW A;  3T4R A;  2EIJ C;  5KYN A;  3LLK A;  1FFH A;  1TWH A;  4HFF B;  2R7W A;  4F4B A;  2A69 F;  4U5F E;  2IYL D;  5E3A A;  3W8I A;  1N1C A;  1FTS A;  1OCR C;  3B0P A;  4AE4 A;  5T1D B;  3E70 C;  2VB6 A;  4DBQ A;  1FMV A;  2V3C C;  3K33 A;  3VAY A;  4EWC A;  3X1O A;  3N2Z B;  1WGW A;  4W8K A;  4O6N A;  3Q7L A;  3F46 A;  3NKE A;  3M1C B;  1OCZ C;  3EGD B;  4J30 B;  3B0U X;  4OIR F;  3E9V A;  3CSK A;  2IXO A;  3K1H A;  1QZX A;  2GFH A;  3FDQ A;  3QMK A;  4N06 A;  2J0W A;  2WVN A;  3SNH A;  1NG1 A;  3RIP A;  1FFT C;  1FMW A;  2MYS A;  4BJT A;  4CS9 C;  2V26 A;  2J9W A;  2PX0 A;  3ZVR A;  2Y3D A;  4FX5 A;  3ZC4 A;  5E2Q A;  2NUT B;  2Q9C A;  2MWQ A;  3AG1 C;  3UNG C;  4YT2 A;  1M57 C;  4C7O A;  4G7Z F;  4Q5S F;  2J46 A;  4Q4Z F;  2H7B A;  4FES A;  2WVQ A;  4G7O F;  1M56 C;  2XXA B;  3RKO F;  3LS0 A;  4QI0 A;  2G62 A;  3NRH A;  4E7Z A;  3O6X A;  1VYI A;  2E87 A;  3UR3 C;  3WOD F;  5CI9 A;  4HEA J;  3I4U A;  1OKK D;  2Z15 A;  3DJN B;  2NG1 A;  2BE5 F;  4X0R A;  3K7D A;  3AG2 C;  1ZHZ A;  5DS4 A;  2R7T A;  4RBN A;  3EHM A;  4HE8 D;  4AK9 A;  2A1D D;  4HFK B;  4KNV A;  3S29 A;  4CS7 A;  4OIP F;  1ZHT A;  2W4B A;  1Z63 A;  2WZF A;  4O6M A;  3NG1 A;  5KYY A;  1TKN A;  3X2Q C;  3KH2 A;  1M2V A;  1NU9 C;  4G7H F;  3DXJ F;  2IXM A;  3LLI A;  3F47 A;  1O87 A;  2EIM C;  2VH3 A;  5EGY A;  4U5B E;  4AE4 B;  1OCO C;  3JRT A;  4LAC B;  3LS1 A;  1ZU5 A;  2XXA A;  3HTK C;  4BJ6 C;  3FHD A;  4IJJ A;  2J0X A;  5DS6 A;  4CS8 C;  1OCC C;  3EH1 A;  4PJJ A;  5B3S C;  2Q3T A;  3FAJ A;  3LJB A;  3EHN A;  4RDA A;  3MLG A;  3T6B A;  3ZG1 A;  2Y3G A;  3L0I A;  4YN0 B;  4ULW A;  1VYK A;  2Y69 C;  1PCX A;  3EFO B;  2HV7 A;  2J7P D;  3V7O A;  2EIK C;  1D0Z A;  2L9J A;  1Z3I X;  4YT4 A;  1MMG A;  5KYX A;  3VYW A;  3NDB B;  3KKB A;  2R7X A;  4GEH A;  2OCC C;  4C7O B;  2HV6 A;  1ZU4 A;  2I8B A;  5KYU B;  4XLN F;  4M63 A;  4YT8 A;  4XLP F;  1OKK A;  3LNR A;  4PFP A;  1M2O A;  4LLC A;  1JPN A;  2EIL C;  2PX3 A;  4KI2 A;  3I5Q A;  3UMK A;  1S7Z A;  3ABM C;  1JPJ A;  3ABL C;  1ST6 A;  2O9X A;  3UMI A;  5L3V A;  1NU7 D;  2G3V A;  4AX2 A;  2J9U A;  2IXP A;  2LSE A;  3QZC A;  3OA1 A;  3EFO A;  1MMD A;  5KYY B;  2XL4 A;  1TWC A;  2M4E A;  3N0T A;  1M2V B;  4QI2 A;  3KMI A;  3AG3 C;  2FGY A;  2PF4 E;  4ANJ A;  3S28 A;  4PJM A;  5BUO A;  1LS1 A;  3ECS A;  2JD3 A;  1VOM A;  4I44 A;  4K7B A;  5KYU A;  4CBE A;  4IRU A;  3HLZ A;  4RD9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...