4IJJA

Structure of transcription factor dksa2 from pseudomonas aeruginosa
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
129
structure length
129
Chain Sequence
AEQELLAQPDAAYMDEAQQDFFRDLLLRQRQELQARIEGEFGELRDLERPSDEADLASREEQRQWQLRLLEREKKLLDKIDEALERLARGDYGWCQETGEPIGLRRLLLRPTATLCIEAKERQEKRERH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative C4-type zinc finger protein, DksA/TraR family
publication title DksA2, a zinc-independent structural analog of the transcription factor DksA.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
total genus 42
structure length 129
sequence length 129
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01258 zf-dskA_traR Prokaryotic dksA/traR C4-type zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.910 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4ijjA00
2KQ9A 2KGOA 4IJJA
chains in the Genus database with same CATH superfamily
1I4ZA 3NYJA 2VCBA 3EG9B 4CS8A 2OJED 1VYIA 1WOLA 2A0BA 3EFOB 2EPLX 3L8JA 4BJ5A 4G7OF 1YYJA 4BEMJ 4DOZA 1RXQA 2J8WA 3M4BA 1LPEA 1JAFA 2VC9A 2R25A 3JSEO 2HMZA 1EA8A 3FAPB 3MFNA 1CGME 1A0BA 3BRJA 4F4BA 1R5ID 1RJ9A 2W4MA 4NTFA 3DE8A 2E87A 1LE2A 3L34A 1FNTc 1XZQA 4MVUA 2J9VA 2PP4A 3W2WA 1JPJA 1NFOA 4RBNA 2LK4A 4XEKA 3DM9B 3DAGA 3LS1A 2LCHA 2PFDA 4HFKB 2R9RB 4KI2A 4BJ1A 1G4US 2R02A 2NUPB 2WVOA 3DXJF 3A9CA 4LDQA 1KU2A 1YAUO 3ECSA 3Q7GA 2XLHA 1M57C 1OW7A 3U8PA 4BG0A 3PMRA 4JIOA 1TR2A 2IXOA 4ANJA 2R7TA 2LIGA 2OJQA 2Y3HA 3I5QA 1VMAA 1Y6DA 2G3VA 3TJ6A 4C7OA 3ZC4A 2WZGA 1EI7A 1G4WR 1RKEA 3WHNA 3ZIBA 3QTHA 4FAPB 3WG7C 4MS2A 1SMYF 2OG2A 4Z9IA 2A0UA 3EHNA 2R7SA 3CZ6A 3HTKC 2R05A 2YL0A 3C62A 4PJMA 2CCYA 3EGXA 3JRTA 1L7CA 1ZYRF 2WL8A 5L0JA 2R7OA 3ZTZA 3S0XA 2WZFA 3WODF 2BL2A 3ABMC 4C7OB 4E0IA 1E2XA 3SXZA 3C18A 2L7AA 3C8GB 2H8AA 2PBEA 2KJGA 3AOUA 3EJNA 2Y3GA 4IAOA 4PFPA 1QKRA 2ETSA 2LFFA 4ULVA 3IQ5A 3NKDA 2NSFA 4WGYA 4JEAA 3TK0A 4YT4A 2XLVA 2KK1A 2XLDA 5L0DA 4JURI 5L3VA 2YZSA 3DKAA 3I5PA 3CAXA 3LNRA 4MVRA 2F22A 4HEAJ 4DVZA 5JT4A 5EHHA 2ICWG 2MHRA 4AK9A 2Y3DA 4JTAB 5AGFA 3RQGA 4AL1A 2QTVA 1NZEA 4YJWA 2IM8A 3U5SA 1GS9A 1MNEA 1I4YA 3GORA 3EG9A 3ABKC 2OEVA 3ITFA 1U6HA 2EIMC 2QLAA 5TJ5E 1BR1A 3SNHA 3V7OA 3EFOA 3Q6MA 4IARA 4PACA 3HNIA 1YYXA 2VB6A 3M1CB 5DS6A 3NRHA 2Q4FA 3B71A 3Q7LA 2ASRA 3DE9A 4D4XA 1D0XA 3PDMP 1WASA 1H6GA 2O9XA 2W45A 1M56C 1TWCA 2AU5A 5B1AC 2JPUA 3S9OA 5L0CA 2KSFA 3EGDA 3GEIA 5DQTA 2CGEA 2OEXA 3BEHA 1ZHWA 3GM2A 3T9OA 4LDKA 4A2NB 3ASNC 1E85A 2KC3A 2B0HA 3U0CA 1YA9A 2R7XA 4JW1A 2YL3A 2YLIA 4H4KC 5E3CA 4CS7A 4XLNF 1Z23A 3W2VA 3ZQVA 5L0HA 1G8XA 4Q5SF 3MX3A 5DQZA 3OA1A 4LACB 1AVOB 2YRFA 4YN0B 1JR8A 3DM5A 4JCZA 2LP4A 3HKKA 4O6NA 3ATPA 2A1DD 3RVZA 1LS1A 2VCAA 2XS8A 3WAQA 4FWVA 1OR2A 2QY9A 3DWWA 4JCHA 4EBKA 4FX5A 1Z5ZA 4XPXA 4CDVA 4MVMA 1E86A 2L9JA 2J9UA 4E7SA 4LERA 4QDLA 4BEJA 5BQHA 2WVNA 5A6BA 5JVEA 1YZAA 4MNDA 4U9EA 3RFYA 2OCCC 3NMKA 4NC3A 2XRHA 4DRIB 2IOQA 3KMIA 2P0NA 3GWLA 3W8IA 3G4XA 2EPNA 1SZIA 4CDYA 1NG1A 5BQIA 1T01A 1NLXA 2M4EA 1HMOA 1V54C 3FOPA 2G3KA 1WGWA 1ZHZA 4KNVA 2P61A 3R7CA 1Q0GA 4D4NA 2L6FA 4CIHA 1D0YA 4ZLCA 2BE5F 2W9YA 3PCVA 2NUTA 3IQCA 4JTCB 2XM4A 1AEPA 1TWHA 4C3EA 3NDBB 2I15A 5COFA 2G62A 3SEOA 2GFHA 4LDRA 5B3IA 2D5RB 3NKEA 3X2QC 4J32B 4CBEA 2VCCA 3E9VA 4I1MA 4IAQA 3U9JA 3CSKA 4BJTA 1QVXA 3KYJA 4KC9A 3B29A 4OIRF 1G5ZA 5DS4A 4Q4ZF 5F5FA 3GM1A 3POVA 4BJ6A 4W8KA 2R7RA 5COGA 2D4UA 2WB7A 1D1AA 3MLGA 4PJJA 2AP3A 1XZPA 2KGOA 4YT5A 3B0UX 3RVYA 3EGDB 4XEFA 1O5HA 4LLEA 3C8ZA 4PFOA 4CS9A 1AUEA 3AGUA 4EIYA 4J7YA 2R7WA 4XWJA 1T6IA 1VTMP 1V4AA 4Z9JA 4DBRA 1VB5A 2YWAA 1ZU4A 2DB4A 3VM6A 3ZWIA 3MYFA 1S05A 1OKKD 1ORYA 2Y39A 4RD9A 3RQEA 2R7UA 1OCOC 1VLSA 3JYYA 4U5DE 2VASA 3SXYA 2HSBA 4XQ1A 2EILC 3CQZA 1ZVZA 1WATA 4JJFA 1HW1A 1O3UA 2ZXRA 4WABA 4MTGA 4CIPA 2LD6A 4JE9A 4MQ9F 3U2MA 4MVOA 5E2QA 3EQLF 3FDQA 1T9KA 1APCA 2UUHA 2XLEA 1OW6A 3FOOA 4I1OB 2C03A 4BPMA 3IPMO 1ST6A 4O6MA 1CPRA 5KYUA 1FTSA 4XLPF 4UDVA 2J7PA 2QNLA 2L6GA 4U5FE 5HV9A 5KYYA 1T6QA 4JC7A 3M15A 1M2OA 5B1BC 2Q3TA 3AJMA 5T3TA 2ZPAA 4EBJA 4YK5A 5T1DB 3N24A 1MQVA 3Q6NA 2W4BA 4CSAA 5JRAA 3U2LA 2FGYA 2WVQA 2J45A 3C8GD 3TJ5A 4B6IA 1OW8A 1A7VA 1UFBA 1YDIA 2GDCA 3S90A 2A69F 3O6XA 4WGZA 5JS5A 4G7ZF 2NUTB 4CS8C 4NY3A 4O6YA 2XLMA 1C02A 1TFOB 2MWQA 4P9TA 2H7OA 1K40A 2Y3BA 1FR0A 2DYSC 4BJ5C 2PF4E 3F47A 1JRAA 1NBBA 2KW3C 3GM3A 5CIVA 5JUAA 5A6JA 1UG7A 1U0BB 256BA 3FAJA 3A11A 3JYHA 3ZSUA 1C03A 3T4RA 1SF8A 4PJLA 4EUKB 5BUOA 4XPWA 4P6IC 1SYQA 1N1CA 4JTDB 3VF0A 1E83A 3LEVA 3EHMA 4G0HA 2OKUA 2X0CA 3G4ZA 4E17A 2HS5A 3E70C 1ORJA 2RSEB 2A6EF 1H9GA 3L0IA 2FAPB 2KQ9A 2YL7A 4AX2A 3B9QA 1MMGA 1VYKA 2J46A 4XPYA 1QSPA 2YL1A 3AG2C 3S28A 3UMHA 4MTOA 1U89A 2A6HF 3IQ6A 3KL4A 4GQHA 4J30B 5BQGA 4CJGA 2XL4A 4E0HA 1VLTA 2NG1A 2DI3A 3EZIA 1R4TA 2KYHA 5L0GA 4RDAA 4XTKA 4DRHB 1RCPA 3T6JA 2FFHA 4EKWA 3QVZA 2HJ3A 1O87A 1LE4A 3S29A 2AWYA 4ER9A 3K1HA 5L0FA 3ABLC 3K7DA 2R7QA 3NG1A 5HSWA 3U3FA 1A7EA 1YARO 1TWAA 3SXMA 1Z3IX 1T6UA 3AG1C 3PHF2 2R03A 4GYTA 1RKCA 3S27A 2WZLA 2XS1A 3AG3C 2X51A 3W8HA 1FFHA 2HUJA 2KNHA 1IW7F 1LIHA 1IZMA 1HY5A 5DVWA 2R7VA 4AL0A 5A6KA 4KBLA 3LAYA 2L6HA 1QPUA 2XM0A 3ASOC 5KYUB 2H7VC 1V55C 2XL6A 3GEHA 3K66A 3KPHA 1HE9A 4HFFB 2NSGA 3QMKA 2Q9AA 2RD9A 2ZXPA 1WTYA 3JT1A 4C3DA 1RMVA 2HV6A 2OU6A 3UGOA 2CYDA 4N6CA 4EBBA 5D92A 2EPMX 5COMA 3IHUA 1H9TA 2LSEA 2J7PD 1SR2A 4LLCA 3TOLA 4PR9A 2QE9A 3NMJA 3LLIA 1Q0DA 4U9DA 2PNOA 3HNKA 5EK0A 4AE4A 4R32A 3T6GB 1JPNA 2IXMA 2EPKX 3FXHA 2HMQA 3R2PA 2OOCA 1ZZPA 1BR2A 5F5HA 3V5YA 1FMWA 1LKXA 3JCUQ 3LJBA 3H2VA 1WWPA 1I5NA 3K1IC 3KYIA 3OWTA 3ZG1A 3QZCA 5L3QA 3GANA 4DBQA 5KYXB 1M6TA 1OR3A 3SYNA 2LFDA 5AC4A 1ZW2A 1ZW3A 2P7VA 4MTFA 2XL8A 3NYMA 4U5BE 3J06A 2EINC 3RKOF 3UGPA 3DZAA 3EZHA 1HMDA 5F28E 3U8VA 2J0WA 3DAFA 1YZCA 4ULWA 3VAYA 3W4YA 3US6A 2HKVA 4JRZA 2VH3A 5K0IA 2EIKC 2Z15A 3AGTA 1DOVA 3AQCA 2YEVA 2GAQA 4M63A 1NFNA 3DJUB 3HNLA 2EPOA 3RW0A 3IEEA 1LVKA 2AWCA 3ZVRA 3UNGC 5D91A 2GWWA 1LI5A 4OIPF 1ZHTA 4O7GA 5FZTA 2YVKA 1T5OA 5CI8A 3FHDA 2MYSA 3H2UA 5KYWB 1MNDA 4Q7CA 1MMNA 3LS0A 1ZU5A 4H54A 4NTAA 3C63A 3KKBA 5E33A 2XLOA 1NU7D 2A68F 3U3BA 3NYLA 2JX0A 1M2VA 1YJGA 3JSZA 2V3CC 4IWBA 3K6BA 1VOMA 3LUTB 1V74B 4IB4A 1Q0MA 2Q9CA 4JVSA 3VRCA 4DXWA 1NSGB 4OD4A 5GPGB 3N2ZB 4PK4A 2J9BA 2V26A 1Z63A 1CGNA 2H7BA 4NTBA 1HE1A 3HJCA 2IXNA 2ZXWC 3S84A 3JRMO 4U5GA 2YLGA 2HFIA 3RF3A 1OXBA 1VK5A 2LQGA 3RQFA 4DRJB 1K05A 4W8PA 1S7ZA 2YHSA 3O55A 4C3BA 5A6BD 1E84A 5DLJA 3EH1A 3O10A 4YL0A 4CDAA 3B0VC 4JEBA 3ZDLA 5EGYA 3TULA 1A41A 3LNMB 3G50A 5IY5C 1C17M 4I3MA 4MW3A 3HLZA 2Q9BA 4MVQA 1TKNA 2DGJA 4G78A 3L8IA 3HNJA 1NU9C 4HE8D 5JP7A 3DD7A 3U9MA 4AE4B 3UMKA 5DS5A 4EWCA 2GA0A 1ORSC 1QZXA 2QUPA 2NPUA 3FMSA 4FESA 3M4CA 2XXAB 2UUIA 1HW2A 4BJ6C 3B0PA 5JSLA 2C04A 3AG4C 3V5ZA 3MBGA 4P9FA 3M79A 5T3WA 2DYRC 1Z7Qc 4JJGA 1GM5A 2Y69C 5KYXA 2CDQA 3LLKA 2CNWA 2J9WA 1L3PA 1A7DA 2XSEA 3DMDA 4JKVA 4OD5A 3TOMA 4DJ9A 1CPQA 2L81A 4YL1A 3V5XA 4OINF 1Q0FA 3SZRA 4E18A 3CEXA 3ZTMA 5AC5A 2OQMA 5CI9A 4OIOF 4MVZA 1EKYA 1PD1A 3DJNB 4CS9C 4KNWA 5FCLA 1BDJB 4IRUA 3N0TA 5E3AA 2Q7RA 2EIJC 3UMIA 4NCQA 4IGGA 3F46A 4N06A 4NQFA 1YVIA 4YT8A 1WN0A 5KYYB 4EHPA 4IJJA 2BC5A 2AVKA 3GODA 1GQAA 4U5CE 3T6BA 5B3SC 1FMVA 2I8BA 3L1MA 1Q0KA 3OEOA 5KYWA 2PX0A 4U5EE 1D0ZA 4OIQF 5L0IA 2HSQA 1QQ3A 1YLMA 4MW8A 2IYLD 1M2VB 4J7TA 1JOGA 4YL3A 4QI2A 3K1IA 4YWQA 1W2WA 1RJ9B 3QW1A 4G7HF 4MVSA 3SP1A 5A69A 2PX3A 3AQBA 3GWNA 1OKKA 4L6RA 3EH2A 1BZ4A 1LM3B 1EQ1A 1KNYA 4CSAC 1OCCC 2HJMA 4ONSA 4JZAA 2NUPA 2YQYA 1OQCA 1DOWA 1PV3A 4N6HA 3LEOA 4A4AA 1B68A 3C7JA 1QLEC 4CJOA 2IXPA 2YKZA 1PD0A 1PCXA 3RIPA 1TQGA 3ZQYA 2TMVP 4DVYP 3JZ0A 4X0RA 1TWGA 5JLIA 3JTLO 1RKEB 1FAPB 3IQTA 1J8MF 1OCZC 1ZHYA 2JD3A 1BR4A 3H65A 4I44A 3RYLA 2P1AA 4WJ0A 1J8YF 4K1OA 2Q00A 3TQOA 2B0JA 1Z6AA 3EPVA 4K7BA 5KYNA 3NMIA 4ZLDA 4YT2A 2CW0F 2HZ8A 3EGXB 4GEHA 2IBFA 1JMWA 3SXKA 3TD7A 2XXAA 1MMAA 1K04A 3K33A 5A6AA 1YA7O 3I4UA 4N4WA 3VYWA 3DI5A 3C8GA 3LESA 1OXKA 1CGOA 1D1BA 3GEEA 1BBHA 3KH2A 4QI0A 3X1OA 1OCRC 1GGQA 2ZD9A 1D1CA 3UR3C 2YLDA 1MMDA 1KTMA 1F1MA 1Y4CA 2HV7A 4K0DA 3QW0A 4O79A 1XWJA 3FVYA 2ZXOA 2CNWD 3O39A 4E7ZA 2P6VA 4CX9A 1ZHXA 1TFKB 4XEVA 2M64A 3QVYA 1LI7A 4PJNA 4Z9HA 1FFTC 3MYIA 3RH3A 4U5HA 1LS4A 2J0XA 1H7IA 2XLWA
chains in the Genus database with same CATH topology
3NYJA 3EG9B 4CS8A 1VYIA 3EFOB 4BJ5A 4G7OF 4DOZA 4F4BA 1RJ9A 2W4MA 2E87A 3L34A 2J9VA 2PP4A 3W2WA 1JPJA 4RBNA 3DM9B 3DAGA 3LS1A 2PFDA 4HFKB 4KI2A 4BJ1A 3DXJF 2NUPB 2WVOA 1KU2A 3ECSA 3Q7GA 4BG0A 1M57C 3PMRA 1TR2A 2IXOA 4ANJA 2R7TA 4C7OA 2Y3HA 3I5QA 1VMAA 2G3VA 3ZC4A 2WZGA 3ZIBA 3WG7C 1SMYF 2OG2A 3EHNA 2R7SA 3CZ6A 3HTKC 4PJMA 3EGXA 3JRTA 1ZYRF 2WL8A 3S0XA 2R7OA 2WZFA 3WODF 3ABMC 4IAOA 2KJGA 3EJNA 3S29A 2Y3GA 4PFPA 3NKDA 4YT4A 4JURI 5L3VA 2YZSA 3I5PA 3LNRA 4HEAJ 4DVZA 5EHHA 4AK9A 2Y3DA 2QTVA 1NZEA 4YJWA 1MNEA 3EG9A 3ABKC 3ITFA 2EIMC 3V7OA 3SNHA 1BR1A 3EFOA 3Q6MA 2VB6A 3M1CB 5DS6A 3NRHA 3Q7LA 1D0XA 2O9XA 2W45A 1M56C 1TWCA 5B1AC 3EGDA 5DQTA 2CGEA 4A2NB 1ZHWA 3ASNC 2R7XA 4JW1A 4H4KC 5E3CA 4CS7A 4XLNF 1Z23A 3W2VA 4Q5SF 1G8XA 3MX3A 5DQZA 3OA1A 4LACB 4YN0B 3DM5A 4O6NA 2A1DD 1LS1A 4C7OB 4FWVA 2QY9A 4JCHA 4FX5A 1Z5ZA 2L9JA 2J9UA 4E7SA 4LERA 4QDLA 4BEJA 2WVNA 4MNDA 3RFYA 2OCCC 2XRHA 2IOQA 3KMIA 3W8IA 1SZIA 1NG1A 2M4EA 1V54C 2G3KA 1WGWA 1ZHZA 4KNVA 4CIHA 1D0YA 4ZLCA 2BE5F 2W9YA 2NUTA 4C3EA 1TWHA 3NDBB 3SEOA 2G62A 2GFHA 2D5RB 3NKEA 3X2QC 4J32B 4CBEA 3E9VA 4I1MA 3CSKA 4BJTA 4KC9A 4Q4ZF 4OIRF 5F5FA 5DS4A 3POVA 4BJ6A 4W8KA 2R7RA 2WB7A 1D1AA 3MLGA 4PJJA 2KGOA 4YT5A 3B0UX 3EGDB 1O5HA 4LLEA 4PFOA 4CS9A 2R7WA 4XWJA 4DBRA 1ZU4A 4RD9A 1OKKD 2Y39A 2R7UA 1OCOC 4U5DE 2VASA 2EILC 3CQZA 4JJFA 2ZXRA 4MQ9F 5E2QA 3EQLF 3FDQA 4I1OB 2C03A 1ST6A 4O6MA 5KYUA 4XLPF 1FTSA 2J7PA 4U5FE 1M2OA 5B1BC 2Q3TA 5T3TA 2ZPAA 5T1DB 3N24A 3Q6NA 4CSAA 2W4BA 2FGYA 2WVQA 2J45A 4B6IA 4G7ZF 2A69F 3O6XA 2NUTB 4CS8C 4NY3A 4O6YA 2MWQA 2H7OA 2Y3BA 2DYSC 4BJ5C 2PF4E 3F47A 2KW3C 3FAJA 3ZSUA 3JYHA 3T4RA 1SF8A 4PJLA 5BUOA 4P6IC 1N1CA 3LEVA 3EHMA 4G0HA 3E70C 2A6EF 3L0IA 2KQ9A 4AX2A 3B9QA 1MMGA 1VYKA 2J46A 3AG2C 3S28A 3UMHA 3KL4A 2A6HF 4J30B 2XL4A 2NG1A 3EZIA 4RDAA 4XTKA 3T6JA 2FFHA 1O87A 3K1HA 5HSWA 3ABLC 3K7DA 2R7QA 3NG1A 1TWAA 3PHF2 1Z3IX 3AG1C 4GYTA 3S27A 2WZLA 3AG3C 2X51A 3W8HA 1FFHA 2KNHA 1IW7F 5DVWA 1IZMA 2R7VA 4KBLA 3LAYA 3ASOC 5KYUB 2H7VC 1V55C 3K66A 4HFFB 3QMKA 4C3DA 2Q9AA 2ZXPA 3JT1A 2HV6A 3UGOA 4EBBA 5D92A 2LSEA 2J7PD 4LLCA 3LLIA 4AE4A 1JPNA 2IXMA 5F5HA 1BR2A 1FMWA 1LKXA 3JCUQ 3LJBA 3K1IC 5L3QA 3OWTA 3ZG1A 3QZCA 5KYXB 3GANA 4DBQA 3SYNA 2P7VA 4U5BE 3NYMA 2EINC 3RKOF 3UGPA 3DZAA 3EZHA 2J0WA 3DAFA 4ULWA 3VAYA 2VH3A 2EIKC 2Z15A 3AQCA 2YEVA 4M63A 3DJUB 3IEEA 1LVKA 3ZVRA 3UNGC 5D91A 4OIPF 1ZHTA 4O7GA 5CI8A 3FHDA 2MYSA 5KYWB 1MNDA 4Q7CA 1MMNA 3LS0A 1ZU5A 5E33A 3KKBA 1NU7D 2A68F 3NYLA 2V3CC 1M2VA 3JSZA 4IWBA 3K6BA 1VOMA 2Q9CA 4JVSA 4OD4A 3N2ZB 4PK4A 2V26A 1Z63A 2H7BA 3HJCA 2IXNA 2ZXWC 4U5GA 1VK5A 1S7ZA 2YHSA 4C3BA 5DLJA 3EH1A 3B0VC 5EGYA 5IY5C 4I3MA 3HLZA 2Q9BA 1TKNA 2DGJA 1NU9C 4HE8D 4AE4B 3DD7A 3UMKA 5DS5A 4EWCA 1QZXA 4FESA 2XXAB 4BJ6C 3B0PA 2C04A 3AG4C 5T3WA 2DYRC 4JJGA 2Y69C 5KYXA 2CDQA 3LLKA 2CNWA 2J9WA 4OD5A 2XSEA 3DMDA 2L81A 4OINF 3SZRA 5CI9A 4OIOF 1PD1A 3DJNB 4CS9C 4KNWA 5FCLA 4IRUA 3N0TA 5E3AA 2EIJC 3UMIA 3F46A 4N06A 4YT8A 5KYYB 4IJJA 3GODA 4U5CE 3T6BA 5B3SC 1FMVA 2I8BA 3OEOA 5KYWA 2PX0A 4U5EE 1D0ZA 4OIQF 2IYLD 1M2VB 4QI2A 4YWQA 1W2WA 1RJ9B 4G7HF 3SP1A 2PX3A 3AQBA 1OKKA 3EH2A 4CSAC 1OCCC 4JZAA 2NUPA 1QLEC 2IXPA 1PD0A 1PCXA 3RIPA 4DVYP 4X0RA 1TWGA 1J8MF 1OCZC 1ZHYA 2JD3A 1BR4A 3H65A 4I44A 3RYLA 4WJ0A 1J8YF 5KYNA 2B0JA 1Z6AA 3EPVA 4K7BA 4ZLDA 4YT2A 2CW0F 3EGXB 4GEHA 2XXAA 3TD7A 1MMAA 3K33A 3I4UA 3VYWA 3LESA 1D1BA 3KH2A 4QI0A 3X1OA 1OCRC 1D1CA 3UR3C 1MMDA 2HV7A 4K0DA 4O79A 3FVYA 2ZXOA 2CNWD 3O39A 4E7ZA 2P6VA 1ZHXA 4PJNA 1FFTC 3RH3A 4U5HA 2J0XA 5KYYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KQ9 A;  2KGO A;  4IJJ A; 
#chains in the Genus database with same CATH topology
 1I4Z A;  3NYJ A;  2VCB A;  3EG9 B;  4CS8 A;  2OJE D;  1VYI A;  1WOL A;  2A0B A;  3EFO B;  2EPL X;  3L8J A;  4BJ5 A;  4G7O F;  1YYJ A;  4BEM J;  4DOZ A;  1RXQ A;  2J8W A;  3M4B A;  1LPE A;  1JAF A;  2VC9 A;  2R25 A;  3JSE O;  2HMZ A;  1EA8 A;  3FAP B;  3MFN A;  1CGM E;  1A0B A;  3BRJ A;  4F4B A;  1R5I D;  1RJ9 A;  2W4M A;  4NTF A;  3DE8 A;  2E87 A;  1LE2 A;  3L34 A;  1FNT c;  1XZQ A;  4MVU A;  2J9V A;  2PP4 A;  3W2W A;  1JPJ A;  1NFO A;  4RBN A;  2LK4 A;  4XEK A;  3DM9 B;  3DAG A;  3LS1 A;  2LCH A;  2PFD A;  4HFK B;  2R9R B;  4KI2 A;  4BJ1 A;  1G4U S;  2R02 A;  2NUP B;  2WVO A;  3DXJ F;  3A9C A;  4LDQ A;  1KU2 A;  1YAU O;  3ECS A;  3Q7G A;  2XLH A;  1M57 C;  1OW7 A;  3U8P A;  4BG0 A;  3PMR A;  4JIO A;  1TR2 A;  2IXO A;  4ANJ A;  2R7T A;  2LIG A;  2OJQ A;  2Y3H A;  3I5Q A;  1VMA A;  1Y6D A;  2G3V A;  3TJ6 A;  4C7O A;  3ZC4 A;  2WZG A;  1EI7 A;  1G4W R;  1RKE A;  3WHN A;  3ZIB A;  3QTH A;  4FAP B;  3WG7 C;  4MS2 A;  1SMY F;  2OG2 A;  4Z9I A;  2A0U A;  3EHN A;  2R7S A;  3CZ6 A;  3HTK C;  2R05 A;  2YL0 A;  3C62 A;  4PJM A;  2CCY A;  3EGX A;  3JRT A;  1L7C A;  1ZYR F;  2WL8 A;  5L0J A;  2R7O A;  3ZTZ A;  3S0X A;  2WZF A;  3WOD F;  2BL2 A;  3ABM C;  4C7O B;  4E0I A;  1E2X A;  3SXZ A;  3C18 A;  2L7A A;  3C8G B;  2H8A A;  2PBE A;  2KJG A;  3AOU A;  3EJN A;  2Y3G A;  4IAO A;  4PFP A;  1QKR A;  2ETS A;  2LFF A;  4ULV A;  3IQ5 A;  3NKD A;  2NSF A;  4WGY A;  4JEA A;  3TK0 A;  4YT4 A;  2XLV A;  2KK1 A;  2XLD A;  5L0D A;  4JUR I;  5L3V A;  2YZS A;  3DKA A;  3I5P A;  3CAX A;  3LNR A;  4MVR A;  2F22 A;  4HEA J;  4DVZ A;  5JT4 A;  5EHH A;  2ICW G;  2MHR A;  4AK9 A;  2Y3D A;  4JTA B;  5AGF A;  3RQG A;  4AL1 A;  2QTV A;  1NZE A;  4YJW A;  2IM8 A;  3U5S A;  1GS9 A;  1MNE A;  1I4Y A;  3GOR A;  3EG9 A;  3ABK C;  2OEV A;  3ITF A;  1U6H A;  2EIM C;  2QLA A;  5TJ5 E;  1BR1 A;  3SNH A;  3V7O A;  3EFO A;  3Q6M A;  4IAR A;  4PAC A;  3HNI A;  1YYX A;  2VB6 A;  3M1C B;  5DS6 A;  3NRH A;  2Q4F A;  3B71 A;  3Q7L A;  2ASR A;  3DE9 A;  4D4X A;  1D0X A;  3PDM P;  1WAS A;  1H6G A;  2O9X A;  2W45 A;  1M56 C;  1TWC A;  2AU5 A;  5B1A C;  2JPU A;  3S9O A;  5L0C A;  2KSF A;  3EGD A;  3GEI A;  5DQT A;  2CGE A;  2OEX A;  3BEH A;  1ZHW A;  3GM2 A;  3T9O A;  4LDK A;  4A2N B;  3ASN C;  1E85 A;  2KC3 A;  2B0H A;  3U0C A;  1YA9 A;  2R7X A;  4JW1 A;  2YL3 A;  2YLI A;  4H4K C;  5E3C A;  4CS7 A;  4XLN F;  1Z23 A;  3W2V A;  3ZQV A;  5L0H A;  1G8X A;  4Q5S F;  3MX3 A;  5DQZ A;  3OA1 A;  4LAC B;  1AVO B;  2YRF A;  4YN0 B;  1JR8 A;  3DM5 A;  4JCZ A;  2LP4 A;  3HKK A;  4O6N A;  3ATP A;  2A1D D;  3RVZ A;  1LS1 A;  2VCA A;  2XS8 A;  3WAQ A;  4FWV A;  1OR2 A;  2QY9 A;  3DWW A;  4JCH A;  4EBK A;  4FX5 A;  1Z5Z A;  4XPX A;  4CDV A;  4MVM A;  1E86 A;  2L9J A;  2J9U A;  4E7S A;  4LER A;  4QDL A;  4BEJ A;  5BQH A;  2WVN A;  5A6B A;  5JVE A;  1YZA A;  4MND A;  4U9E A;  3RFY A;  2OCC C;  3NMK A;  4NC3 A;  2XRH A;  4DRI B;  2IOQ A;  3KMI A;  2P0N A;  3GWL A;  3W8I A;  3G4X A;  2EPN A;  1SZI A;  4CDY A;  1NG1 A;  5BQI A;  1T01 A;  1NLX A;  2M4E A;  1HMO A;  1V54 C;  3FOP A;  2G3K A;  1WGW A;  1ZHZ A;  4KNV A;  2P61 A;  3R7C A;  1Q0G A;  4D4N A;  2L6F A;  4CIH A;  1D0Y A;  4ZLC A;  2BE5 F;  2W9Y A;  3PCV A;  2NUT A;  3IQC A;  4JTC B;  2XM4 A;  1AEP A;  1TWH A;  4C3E A;  3NDB B;  2I15 A;  5COF A;  2G62 A;  3SEO A;  2GFH A;  4LDR A;  5B3I A;  2D5R B;  3NKE A;  3X2Q C;  4J32 B;  4CBE A;  2VCC A;  3E9V A;  4I1M A;  4IAQ A;  3U9J A;  3CSK A;  4BJT A;  1QVX A;  3KYJ A;  4KC9 A;  3B29 A;  4OIR F;  1G5Z A;  5DS4 A;  4Q4Z F;  5F5F A;  3GM1 A;  3POV A;  4BJ6 A;  4W8K A;  2R7R A;  5COG A;  2D4U A;  2WB7 A;  1D1A A;  3MLG A;  4PJJ A;  2AP3 A;  1XZP A;  2KGO A;  4YT5 A;  3B0U X;  3RVY A;  3EGD B;  4XEF A;  1O5H A;  4LLE A;  3C8Z A;  4PFO A;  4CS9 A;  1AUE A;  3AGU A;  4EIY A;  4J7Y A;  2R7W A;  4XWJ A;  1T6I A;  1VTM P;  1V4A A;  4Z9J A;  4DBR A;  1VB5 A;  2YWA A;  1ZU4 A;  2DB4 A;  3VM6 A;  3ZWI A;  3MYF A;  1S05 A;  1OKK D;  1ORY A;  2Y39 A;  4RD9 A;  3RQE A;  2R7U A;  1OCO C;  1VLS A;  3JYY A;  4U5D E;  2VAS A;  3SXY A;  2HSB A;  4XQ1 A;  2EIL C;  3CQZ A;  1ZVZ A;  1WAT A;  4JJF A;  1HW1 A;  1O3U A;  2ZXR A;  4WAB A;  4MTG A;  4CIP A;  2LD6 A;  4JE9 A;  4MQ9 F;  3U2M A;  4MVO A;  5E2Q A;  3EQL F;  3FDQ A;  1T9K A;  1APC A;  2UUH A;  2XLE A;  1OW6 A;  3FOO A;  4I1O B;  2C03 A;  4BPM A;  3IPM O;  1ST6 A;  4O6M A;  1CPR A;  5KYU A;  1FTS A;  4XLP F;  4UDV A;  2J7P A;  2QNL A;  2L6G A;  4U5F E;  5HV9 A;  5KYY A;  1T6Q A;  4JC7 A;  3M15 A;  1M2O A;  5B1B C;  2Q3T A;  3AJM A;  5T3T A;  2ZPA A;  4EBJ A;  4YK5 A;  5T1D B;  3N24 A;  1MQV A;  3Q6N A;  2W4B A;  4CSA A;  5JRA A;  3U2L A;  2FGY A;  2WVQ A;  2J45 A;  3C8G D;  3TJ5 A;  4B6I A;  1OW8 A;  1A7V A;  1UFB A;  1YDI A;  2GDC A;  3S90 A;  2A69 F;  3O6X A;  4WGZ A;  5JS5 A;  4G7Z F;  2NUT B;  4CS8 C;  4NY3 A;  4O6Y A;  2XLM A;  1C02 A;  1TFO B;  2MWQ A;  4P9T A;  2H7O A;  1K40 A;  2Y3B A;  1FR0 A;  2DYS C;  4BJ5 C;  2PF4 E;  3F47 A;  1JRA A;  1NBB A;  2KW3 C;  3GM3 A;  5CIV A;  5JUA A;  5A6J A;  1UG7 A;  1U0B B;  256B A;  3FAJ A;  3A11 A;  3JYH A;  3ZSU A;  1C03 A;  3T4R A;  1SF8 A;  4PJL A;  4EUK B;  5BUO A;  4XPW A;  4P6I C;  1SYQ A;  1N1C A;  4JTD B;  3VF0 A;  1E83 A;  3LEV A;  3EHM A;  4G0H A;  2OKU A;  2X0C A;  3G4Z A;  4E17 A;  2HS5 A;  3E70 C;  1ORJ A;  2RSE B;  2A6E F;  1H9G A;  3L0I A;  2FAP B;  2KQ9 A;  2YL7 A;  4AX2 A;  3B9Q A;  1MMG A;  1VYK A;  2J46 A;  4XPY A;  1QSP A;  2YL1 A;  3AG2 C;  3S28 A;  3UMH A;  4MTO A;  1U89 A;  2A6H F;  3IQ6 A;  3KL4 A;  4GQH A;  4J30 B;  5BQG A;  4CJG A;  2XL4 A;  4E0H A;  1VLT A;  2NG1 A;  2DI3 A;  3EZI A;  1R4T A;  2KYH A;  5L0G A;  4RDA A;  4XTK A;  4DRH B;  1RCP A;  3T6J A;  2FFH A;  4EKW A;  3QVZ A;  2HJ3 A;  1O87 A;  1LE4 A;  3S29 A;  2AWY A;  4ER9 A;  3K1H A;  5L0F A;  3ABL C;  3K7D A;  2R7Q A;  3NG1 A;  5HSW A;  3U3F A;  1A7E A;  1YAR O;  1TWA A;  3SXM A;  1Z3I X;  1T6U A;  3AG1 C;  3PHF 2;  2R03 A;  4GYT A;  1RKC A;  3S27 A;  2WZL A;  2XS1 A;  3AG3 C;  2X51 A;  3W8H A;  1FFH A;  2HUJ A;  2KNH A;  1IW7 F;  1LIH A;  1IZM A;  1HY5 A;  5DVW A;  2R7V A;  4AL0 A;  5A6K A;  4KBL A;  3LAY A;  2L6H A;  1QPU A;  2XM0 A;  3ASO C;  5KYU B;  2H7V C;  1V55 C;  2XL6 A;  3GEH A;  3K66 A;  3KPH A;  1HE9 A;  4HFF B;  2NSG A;  3QMK A;  2Q9A A;  2RD9 A;  2ZXP A;  1WTY A;  3JT1 A;  4C3D A;  1RMV A;  2HV6 A;  2OU6 A;  3UGO A;  2CYD A;  4N6C A;  4EBB A;  5D92 A;  2EPM X;  5COM A;  3IHU A;  1H9T A;  2LSE A;  2J7P D;  1SR2 A;  4LLC A;  3TOL A;  4PR9 A;  2QE9 A;  3NMJ A;  3LLI A;  1Q0D A;  4U9D A;  2PNO A;  3HNK A;  5EK0 A;  4AE4 A;  4R32 A;  3T6G B;  1JPN A;  2IXM A;  2EPK X;  3FXH A;  2HMQ A;  3R2P A;  2OOC A;  1ZZP A;  1BR2 A;  5F5H A;  3V5Y A;  1FMW A;  1LKX A;  3JCU Q;  3LJB A;  3H2V A;  1WWP A;  1I5N A;  3K1I C;  3KYI A;  3OWT A;  3ZG1 A;  3QZC A;  5L3Q A;  3GAN A;  4DBQ A;  5KYX B;  1M6T A;  1OR3 A;  3SYN A;  2LFD A;  5AC4 A;  1ZW2 A;  1ZW3 A;  2P7V A;  4MTF A;  2XL8 A;  3NYM A;  4U5B E;  3J06 A;  2EIN C;  3RKO F;  3UGP A;  3DZA A;  3EZH A;  1HMD A;  5F28 E;  3U8V A;  2J0W A;  3DAF A;  1YZC A;  4ULW A;  3VAY A;  3W4Y A;  3US6 A;  2HKV A;  4JRZ A;  2VH3 A;  5K0I A;  2EIK C;  2Z15 A;  3AGT A;  1DOV A;  3AQC A;  2YEV A;  2GAQ A;  4M63 A;  1NFN A;  3DJU B;  3HNL A;  2EPO A;  3RW0 A;  3IEE A;  1LVK A;  2AWC A;  3ZVR A;  3UNG C;  5D91 A;  2GWW A;  1LI5 A;  4OIP F;  1ZHT A;  4O7G A;  5FZT A;  2YVK A;  1T5O A;  5CI8 A;  3FHD A;  2MYS A;  3H2U A;  5KYW B;  1MND A;  4Q7C A;  1MMN A;  3LS0 A;  1ZU5 A;  4H54 A;  4NTA A;  3C63 A;  3KKB A;  5E33 A;  2XLO A;  1NU7 D;  2A68 F;  3U3B A;  3NYL A;  2JX0 A;  1M2V A;  1YJG A;  3JSZ A;  2V3C C;  4IWB A;  3K6B A;  1VOM A;  3LUT B;  1V74 B;  4IB4 A;  1Q0M A;  2Q9C A;  4JVS A;  3VRC A;  4DXW A;  1NSG B;  4OD4 A;  5GPG B;  3N2Z B;  4PK4 A;  2J9B A;  2V26 A;  1Z63 A;  1CGN A;  2H7B A;  4NTB A;  1HE1 A;  3HJC A;  2IXN A;  2ZXW C;  3S84 A;  3JRM O;  4U5G A;  2YLG A;  2HFI A;  3RF3 A;  1OXB A;  1VK5 A;  2LQG A;  3RQF A;  4DRJ B;  1K05 A;  4W8P A;  1S7Z A;  2YHS A;  3O55 A;  4C3B A;  5A6B D;  1E84 A;  5DLJ A;  3EH1 A;  3O10 A;  4YL0 A;  4CDA A;  3B0V C;  4JEB A;  3ZDL A;  5EGY A;  3TUL A;  1A41 A;  3LNM B;  3G50 A;  5IY5 C;  1C17 M;  4I3M A;  4MW3 A;  3HLZ A;  2Q9B A;  4MVQ A;  1TKN A;  2DGJ A;  4G78 A;  3L8I A;  3HNJ A;  1NU9 C;  4HE8 D;  5JP7 A;  3DD7 A;  3U9M A;  4AE4 B;  3UMK A;  5DS5 A;  4EWC A;  2GA0 A;  1ORS C;  1QZX A;  2QUP A;  2NPU A;  3FMS A;  4FES A;  3M4C A;  2XXA B;  2UUI A;  1HW2 A;  4BJ6 C;  3B0P A;  5JSL A;  2C04 A;  3AG4 C;  3V5Z A;  3MBG A;  4P9F A;  3M79 A;  5T3W A;  2DYR C;  1Z7Q c;  4JJG A;  1GM5 A;  2Y69 C;  5KYX A;  2CDQ A;  3LLK A;  2CNW A;  2J9W A;  1L3P A;  1A7D A;  2XSE A;  3DMD A;  4JKV A;  4OD5 A;  3TOM A;  4DJ9 A;  1CPQ A;  2L81 A;  4YL1 A;  3V5X A;  4OIN F;  1Q0F A;  3SZR A;  4E18 A;  3CEX A;  3ZTM A;  5AC5 A;  2OQM A;  5CI9 A;  4OIO F;  4MVZ A;  1EKY A;  1PD1 A;  3DJN B;  4CS9 C;  4KNW A;  5FCL A;  1BDJ B;  4IRU A;  3N0T A;  5E3A A;  2Q7R A;  2EIJ C;  3UMI A;  4NCQ A;  4IGG A;  3F46 A;  4N06 A;  4NQF A;  1YVI A;  4YT8 A;  1WN0 A;  5KYY B;  4EHP A;  4IJJ A;  2BC5 A;  2AVK A;  3GOD A;  1GQA A;  4U5C E;  3T6B A;  5B3S C;  1FMV A;  2I8B A;  3L1M A;  1Q0K A;  3OEO A;  5KYW A;  2PX0 A;  4U5E E;  1D0Z A;  4OIQ F;  5L0I A;  2HSQ A;  1QQ3 A;  1YLM A;  4MW8 A;  2IYL D;  1M2V B;  4J7T A;  1JOG A;  4YL3 A;  4QI2 A;  3K1I A;  4YWQ A;  1W2W A;  1RJ9 B;  3QW1 A;  4G7H F;  4MVS A;  3SP1 A;  5A69 A;  2PX3 A;  3AQB A;  3GWN A;  1OKK A;  4L6R A;  3EH2 A;  1BZ4 A;  1LM3 B;  1EQ1 A;  1KNY A;  4CSA C;  1OCC C;  2HJM A;  4ONS A;  4JZA A;  2NUP A;  2YQY A;  1OQC A;  1DOW A;  1PV3 A;  4N6H A;  3LEO A;  4A4A A;  1B68 A;  3C7J A;  1QLE C;  4CJO A;  2IXP A;  2YKZ A;  1PD0 A;  1PCX A;  3RIP A;  1TQG A;  3ZQY A;  2TMV P;  4DVY P;  3JZ0 A;  4X0R A;  1TWG A;  5JLI A;  3JTL O;  1RKE B;  1FAP B;  3IQT A;  1J8M F;  1OCZ C;  1ZHY A;  2JD3 A;  1BR4 A;  3H65 A;  4I44 A;  3RYL A;  2P1A A;  4WJ0 A;  1J8Y F;  4K1O A;  2Q00 A;  3TQO A;  2B0J A;  1Z6A A;  3EPV A;  4K7B A;  5KYN A;  3NMI A;  4ZLD A;  4YT2 A;  2CW0 F;  2HZ8 A;  3EGX B;  4GEH A;  2IBF A;  1JMW A;  3SXK A;  3TD7 A;  2XXA A;  1MMA A;  1K04 A;  3K33 A;  5A6A A;  1YA7 O;  3I4U A;  4N4W A;  3VYW A;  3DI5 A;  3C8G A;  3LES A;  1OXK A;  1CGO A;  1D1B A;  3GEE A;  1BBH A;  3KH2 A;  4QI0 A;  3X1O A;  1OCR C;  1GGQ A;  2ZD9 A;  1D1C A;  3UR3 C;  2YLD A;  1MMD A;  1KTM A;  1F1M A;  1Y4C A;  2HV7 A;  4K0D A;  3QW0 A;  4O79 A;  1XWJ A;  3FVY A;  2ZXO A;  2CNW D;  3O39 A;  4E7Z A;  2P6V A;  4CX9 A;  1ZHX A;  1TFK B;  4XEV A;  2M64 A;  3QVY A;  1LI7 A;  4PJN A;  4Z9H A;  1FFT C;  3MYI A;  3RH3 A;  4U5H A;  1LS4 A;  2J0X A;  1H7I A;  2XLW A; 
#chains in the Genus database with same CATH homology
 3NYJ A;  3EG9 B;  4CS8 A;  1VYI A;  3EFO B;  4BJ5 A;  4G7O F;  4DOZ A;  4F4B A;  1RJ9 A;  2W4M A;  2E87 A;  3L34 A;  2J9V A;  2PP4 A;  3W2W A;  1JPJ A;  4RBN A;  3DM9 B;  3DAG A;  3LS1 A;  2PFD A;  4HFK B;  4KI2 A;  4BJ1 A;  3DXJ F;  2NUP B;  2WVO A;  1KU2 A;  3ECS A;  3Q7G A;  4BG0 A;  1M57 C;  3PMR A;  1TR2 A;  2IXO A;  4ANJ A;  2R7T A;  4C7O A;  2Y3H A;  3I5Q A;  1VMA A;  2G3V A;  3ZC4 A;  2WZG A;  3ZIB A;  3WG7 C;  1SMY F;  2OG2 A;  3EHN A;  2R7S A;  3CZ6 A;  3HTK C;  4PJM A;  3EGX A;  3JRT A;  1ZYR F;  2WL8 A;  3S0X A;  2R7O A;  2WZF A;  3WOD F;  3ABM C;  4IAO A;  2KJG A;  3EJN A;  3S29 A;  2Y3G A;  4PFP A;  3NKD A;  4YT4 A;  4JUR I;  5L3V A;  2YZS A;  3I5P A;  3LNR A;  4HEA J;  4DVZ A;  5EHH A;  4AK9 A;  2Y3D A;  2QTV A;  1NZE A;  4YJW A;  1MNE A;  3EG9 A;  3ABK C;  3ITF A;  2EIM C;  3V7O A;  3SNH A;  1BR1 A;  3EFO A;  3Q6M A;  2VB6 A;  3M1C B;  5DS6 A;  3NRH A;  3Q7L A;  1D0X A;  2O9X A;  2W45 A;  1M56 C;  1TWC A;  5B1A C;  3EGD A;  5DQT A;  2CGE A;  4A2N B;  1ZHW A;  3ASN C;  2R7X A;  4JW1 A;  4H4K C;  5E3C A;  4CS7 A;  4XLN F;  1Z23 A;  3W2V A;  4Q5S F;  1G8X A;  3MX3 A;  5DQZ A;  3OA1 A;  4LAC B;  4YN0 B;  3DM5 A;  4O6N A;  2A1D D;  1LS1 A;  4C7O B;  4FWV A;  2QY9 A;  4JCH A;  4FX5 A;  1Z5Z A;  2L9J A;  2J9U A;  4E7S A;  4LER A;  4QDL A;  4BEJ A;  2WVN A;  4MND A;  3RFY A;  2OCC C;  2XRH A;  2IOQ A;  3KMI A;  3W8I A;  1SZI A;  1NG1 A;  2M4E A;  1V54 C;  2G3K A;  1WGW A;  1ZHZ A;  4KNV A;  4CIH A;  1D0Y A;  4ZLC A;  2BE5 F;  2W9Y A;  2NUT A;  4C3E A;  1TWH A;  3NDB B;  3SEO A;  2G62 A;  2GFH A;  2D5R B;  3NKE A;  3X2Q C;  4J32 B;  4CBE A;  3E9V A;  4I1M A;  3CSK A;  4BJT A;  4KC9 A;  4Q4Z F;  4OIR F;  5F5F A;  5DS4 A;  3POV A;  4BJ6 A;  4W8K A;  2R7R A;  2WB7 A;  1D1A A;  3MLG A;  4PJJ A;  2KGO A;  4YT5 A;  3B0U X;  3EGD B;  1O5H A;  4LLE A;  4PFO A;  4CS9 A;  2R7W A;  4XWJ A;  4DBR A;  1ZU4 A;  4RD9 A;  1OKK D;  2Y39 A;  2R7U A;  1OCO C;  4U5D E;  2VAS A;  2EIL C;  3CQZ A;  4JJF A;  2ZXR A;  4MQ9 F;  5E2Q A;  3EQL F;  3FDQ A;  4I1O B;  2C03 A;  1ST6 A;  4O6M A;  5KYU A;  4XLP F;  1FTS A;  2J7P A;  4U5F E;  1M2O A;  5B1B C;  2Q3T A;  5T3T A;  2ZPA A;  5T1D B;  3N24 A;  3Q6N A;  4CSA A;  2W4B A;  2FGY A;  2WVQ A;  2J45 A;  4B6I A;  4G7Z F;  2A69 F;  3O6X A;  2NUT B;  4CS8 C;  4NY3 A;  4O6Y A;  2MWQ A;  2H7O A;  2Y3B A;  2DYS C;  4BJ5 C;  2PF4 E;  3F47 A;  2KW3 C;  3FAJ A;  3ZSU A;  3JYH A;  3T4R A;  1SF8 A;  4PJL A;  5BUO A;  4P6I C;  1N1C A;  3LEV A;  3EHM A;  4G0H A;  3E70 C;  2A6E F;  3L0I A;  2KQ9 A;  4AX2 A;  3B9Q A;  1MMG A;  1VYK A;  2J46 A;  3AG2 C;  3S28 A;  3UMH A;  3KL4 A;  2A6H F;  4J30 B;  2XL4 A;  2NG1 A;  3EZI A;  4RDA A;  4XTK A;  3T6J A;  2FFH A;  1O87 A;  3K1H A;  5HSW A;  3ABL C;  3K7D A;  2R7Q A;  3NG1 A;  1TWA A;  3PHF 2;  1Z3I X;  3AG1 C;  4GYT A;  3S27 A;  2WZL A;  3AG3 C;  2X51 A;  3W8H A;  1FFH A;  2KNH A;  1IW7 F;  5DVW A;  1IZM A;  2R7V A;  4KBL A;  3LAY A;  3ASO C;  5KYU B;  2H7V C;  1V55 C;  3K66 A;  4HFF B;  3QMK A;  4C3D A;  2Q9A A;  2ZXP A;  3JT1 A;  2HV6 A;  3UGO A;  4EBB A;  5D92 A;  2LSE A;  2J7P D;  4LLC A;  3LLI A;  4AE4 A;  1JPN A;  2IXM A;  5F5H A;  1BR2 A;  1FMW A;  1LKX A;  3JCU Q;  3LJB A;  3K1I C;  5L3Q A;  3OWT A;  3ZG1 A;  3QZC A;  5KYX B;  3GAN A;  4DBQ A;  3SYN A;  2P7V A;  4U5B E;  3NYM A;  2EIN C;  3RKO F;  3UGP A;  3DZA A;  3EZH A;  2J0W A;  3DAF A;  4ULW A;  3VAY A;  2VH3 A;  2EIK C;  2Z15 A;  3AQC A;  2YEV A;  4M63 A;  3DJU B;  3IEE A;  1LVK A;  3ZVR A;  3UNG C;  5D91 A;  4OIP F;  1ZHT A;  4O7G A;  5CI8 A;  3FHD A;  2MYS A;  5KYW B;  1MND A;  4Q7C A;  1MMN A;  3LS0 A;  1ZU5 A;  5E33 A;  3KKB A;  1NU7 D;  2A68 F;  3NYL A;  2V3C C;  1M2V A;  3JSZ A;  4IWB A;  3K6B A;  1VOM A;  2Q9C A;  4JVS A;  4OD4 A;  3N2Z B;  4PK4 A;  2V26 A;  1Z63 A;  2H7B A;  3HJC A;  2IXN A;  2ZXW C;  4U5G A;  1VK5 A;  1S7Z A;  2YHS A;  4C3B A;  5DLJ A;  3EH1 A;  3B0V C;  5EGY A;  5IY5 C;  4I3M A;  3HLZ A;  2Q9B A;  1TKN A;  2DGJ A;  1NU9 C;  4HE8 D;  4AE4 B;  3DD7 A;  3UMK A;  5DS5 A;  4EWC A;  1QZX A;  4FES A;  2XXA B;  4BJ6 C;  3B0P A;  2C04 A;  3AG4 C;  5T3W A;  2DYR C;  4JJG A;  2Y69 C;  5KYX A;  2CDQ A;  3LLK A;  2CNW A;  2J9W A;  4OD5 A;  2XSE A;  3DMD A;  2L81 A;  4OIN F;  3SZR A;  5CI9 A;  4OIO F;  1PD1 A;  3DJN B;  4CS9 C;  4KNW A;  5FCL A;  4IRU A;  3N0T A;  5E3A A;  2EIJ C;  3UMI A;  3F46 A;  4N06 A;  4YT8 A;  5KYY B;  4IJJ A;  3GOD A;  4U5C E;  3T6B A;  5B3S C;  1FMV A;  2I8B A;  3OEO A;  5KYW A;  2PX0 A;  4U5E E;  1D0Z A;  4OIQ F;  2IYL D;  1M2V B;  4QI2 A;  4YWQ A;  1W2W A;  1RJ9 B;  4G7H F;  3SP1 A;  2PX3 A;  3AQB A;  1OKK A;  3EH2 A;  4CSA C;  1OCC C;  4JZA A;  2NUP A;  1QLE C;  2IXP A;  1PD0 A;  1PCX A;  3RIP A;  4DVY P;  4X0R A;  1TWG A;  1J8M F;  1OCZ C;  1ZHY A;  2JD3 A;  1BR4 A;  3H65 A;  4I44 A;  3RYL A;  4WJ0 A;  1J8Y F;  5KYN A;  2B0J A;  1Z6A A;  3EPV A;  4K7B A;  4ZLD A;  4YT2 A;  2CW0 F;  3EGX B;  4GEH A;  2XXA A;  3TD7 A;  1MMA A;  3K33 A;  3I4U A;  3VYW A;  3LES A;  1D1B A;  3KH2 A;  4QI0 A;  3X1O A;  1OCR C;  1D1C A;  3UR3 C;  1MMD A;  2HV7 A;  4K0D A;  4O79 A;  3FVY A;  2ZXO A;  2CNW D;  3O39 A;  4E7Z A;  2P6V A;  1ZHX A;  4PJN A;  1FFT C;  3RH3 A;  4U5H A;  2J0X A;  5KYY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...