2HSQA

Human vinculin (head domain, vh1, residues 1-258) in complex with shigella's ipaa vinculin binding site 2 (residues 565-587)
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
266
structure length
261
Chain Sequence
MEHHHHHHMPVFHTRTIESILEPVAQQISHLVIMHEEKAIPDLTAPVAAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVEKMSAEINEIIRVLQLTSWDEDAW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vinculin
publication title Shigella applies molecular mimicry to subvert vinculin and invade host cells.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion, structural protein
total genus 94
structure length 261
sequence length 266
ec nomenclature
pdb deposition date 2006-07-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 2hsqA02
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 2hsqA01
1YDIA 3ZDLA 1ZVZA 5FZTA 4E17A 1T01A 4DJ9A 3RF3A 5L0DA 5L0HA 1H6GA 1DOWA 1XWJA 2GDCA 5L0IA 1DOVA 2LQGA 3MYIA 1RKCA 4IGGA 4P9TA 4W8PA 3H2VA 5L0FA 2GWWA 3S90A 1L7CA 5L0CA 5L0GA 1U6HA 4E18A 2L7AA 3TJ5A 1TR2A 3VF0A 2IBFA 1QKRA 3H2UA 1ST6A 2B0HA 3TJ6A 1U89A 1RKEB 3T6GB 1SYQA 5L0JA 2HSQA 4ONSA 4EHPA 4PR9A 1RKEA 1ZW3A 4K1OA 2X0CA 1ZW2A
chains in the Genus database with same CATH superfamily
4ULVA 2QUPA 4ZLCA 1SMYF 3LESA 1I4ZA 4LLEA 2LCHA 4EBJA 1CGOA 2Y69C 1FNTc 1OXBA 3WODF 1YZAA 2KQ9A 2VCBA 3ASNC 4CX9A 4GQHA 2IXNA 1XWJA 3NKEA 2JPUA 4E0HA 2PF4E 4MTFA 4PFPA 1ORYA 4OIRF 3FMSA 3AGUA 4ER9A 4FAPB 1ZHZA 4DBQA 4E18A 5DQTA 5BUOA 2R03A 4CIHA 2Y3GA 3UNGC 5JT4A 2R7XA 1R4TA 1LI7A 1VMAA 4YT8A 1Q0FA 5KYYB 3JT1A 3EHNA 1YAUO 3DXJF 3B0VC 3UR3C 2PFDA 1ZYRF 4WJ0A 5KYYA 2P0NA 4YL3A 2VH3A 2P7VA 1Z7Qc 3EGXB 4K0DA 3HKKA 3F47A 3KYJA 1B68A 3C8GA 2W9YA 1OCZC 4I3MA 1LI5A 4YL0A 5COMA 1Q0GA 2OQMA 5T3TA 4JTAB 2R7RA 2XXAA 1K04A 2R7VA 2XS8A 1GS9A 3E70C 2LFFA 3B71A 1UFBA 3IQ6A 4PJMA 3TK0A 3ABMC 2LQGA 3LS0A 3W2VA 4CSAC 3GWNA 4O79A 4H54A 4YK5A 2MYSA 2H7OA 4O6NA 2XM0A 5L0GA 1L3PA 2AVKA 2Q4FA 3DAGA 1OXKA 4NTAA 4WGZA 3RQFA 1APCA 5A6BD 3GEHA 1JPNA 1ST6A 2IYLD 1BDJB 2B0HA 4U9EA 2A68F 4BEJA 3V5ZA 2EIMC 2J8WA 2MHRA 3K33A 3LLKA 3WHNA 4CS8C 2A6EF 2ZXPA 2KK1A 1K40A 2IXMA 4JCHA 1M2VA 4N06A 3S9OA 3IQCA 4CJGA 2P6VA 1D0XA 2XRHA 2YWAA 4OIPF 4BG0A 1QVXA 3LEVA 1VLSA 4KNVA 4JURI 4RD9A 4E17A 3TQOA 2RD9A 1Y4CA 4JEAA 4LACB 4BJ5A 4QI2A 3LNMB 3EFOA 2J9BA 2P1AA 3DWWA 1VOMA 2PX3A 3LAYA 5KYXA 1JAFA 1H6GA 4QDLA 5JLIA 1RKCA 4BJ6C 3U9JA 3QW1A 4C7OA 2EPNA 2AU5A 2YL3A 1H9GA 3A11A 4NTFA 3SEOA 3KPHA 4JIOA 5K0IA 4DVYP 5JS5A 2AWYA 1YZCA 4RDAA 4WABA 1U89A 3BRJA 1TFKB 3C8GD 3UMKA 4JJFA 3QTHA 1ORJA 2LSEA 4G0HA 1EA8A 1QSPA 4AL1A 2VC9A 1Y6DA 3T4RA 4O6YA 2OJED 4PJNA 1OR2A 4JVSA 3I5PA 2LFDA 4IAOA 5B1BC 2L9JA 4EIYA 3QVYA 4XWJA 5DLJA 1VB5A 2BC5A 2M4EA 3AQBA 5F5HA 5DS5A 3K1HA 3VRCA 1WATA 2A0BA 3S28A 3SNHA 1A0BA 4DOZA 2R7TA 2PNOA 5JSLA 5EGYA 1YYXA 3U3BA 4OIQF 1MNEA 3KH2A 1HY5A 2J7PA 4YL1A 4JE9A 3JSEO 4PFOA 3SP1A 3UMIA 3CQZA 1D1AA 2XM4A 2B0JA 3ABKC 5D91A 1E84A 4U5EE 1QPUA 5L0JA 2R25A 1OR3A 3VM6A 4J32B 3RYLA 4LERA 3LNRA 1O3UA 2X0CA 1VLTA 2XLOA 3UMHA 2J9VA 3ZDLA 1GGQA 5JVEA 1KTMA 3U8VA 3UGOA 1D0ZA 5BQGA 2KNHA 3SZRA 4B6IA 3U2LA 4I1MA 4CS9A 3HNIA 1TWCA 4CDYA 1HW1A 3MYIA 2EPLX 3PMRA 4JZAA 5FCLA 3V5XA 1E86A 4MTOA 4JTDB 3DMDA 2OEXA 3U0CA 1NZEA 2LP4A 3AG3C 4HEAJ 1IW7F 1OQCA 3ATPA 3EQLF 3H2UA 3LUTB 1YVIA 3MYFA 4MVZA 2NUPA 4ULWA 1MNDA 1RKEB 3JZ0A 4P9FA 2EINC 3ITFA 1LE2A 1A7VA 1N1CA 2HSQA 4MVQA 1ZHXA 2Q3TA 3EHMA 3K7DA 3W8IA 2WZLA 1V54C 3EGDB 2VB6A 3S0XA 2Y3BA 1QLEC 5KYXB 5KYWA 4Z9JA 3NYLA 1UG7A 2L6HA 2Q9AA 1WGWA 1JRAA 4L6RA 4ANJA 4U9DA 4Q5SF 1D0YA 1FMWA 2J7PD 2M64A 3CEXA 3F46A 3HLZA 3OWTA 1ORSC 3EH2A 4JTCB 2BE5F 2WL8A 1E83A 4IGGA 5F5FA 1Z6AA 3K1IA 4C3BA 3V5YA 2JX0A 2PP4A 5A6JA 3AGTA 3AQCA 3C18A 4HFFB 2CGEA 2BL2A 2OCCC 3B0PA 4IJJA 4PJLA 1SZIA 3DKAA 4I1OB 4CIPA 1TWHA 1LKXA 3DD7A 3DJNB 3OA1A 1V4AA 1BR1A 3GM3A 4H4KC 1LE4A 2PBEA 4XPWA 4E0IA 4U5CE 4EBKA 4YWQA 4CSAA 2H7BA 4I44A 5E2QA 5AC4A 1O87A 2LD6A 1D1CA 2OOCA 2HZ8A 2YLDA 3KL4A 2Q9CA 4N4WA 3K66A 4CDAA 5L0DA 3L0IA 4CDVA 3NDBB 4JC7A 3G4ZA 1DOVA 1GM5A 3IEEA 4P9TA 4CS8A 4M63A 5BQIA 4A2NB 5B3SC 5JP7A 2ASRA 3L8JA 4FESA 3Q7GA 1C17M 4MVOA 3S90A 3ZQYA 2HV6A 1EQ1A 2UUHA 3PHF2 3M15A 1RJ9B 4W8KA 3T6JA 1MMGA 2XL8A 2Q00A 3IQ5A 4G7HF 3AG2C 4CS7A 1ZZPA 1JR8A 4AE4A 4MVUA 1C03A 3SYNA 4EUKB 2YLGA 4OIOF 1T6IA 1LM3B 1H7IA 3NYMA 3JTLO 3RQEA 3EZIA 3EG9B 3C8ZA 1A7EA 1PV3A 2HV7A 3MLGA 5KYUB 4BEMJ 3L1MA 3ZG1A 4U5HA 3K6BA 2WZGA 2Y39A 1E85A 1AUEA 1OKKD 3QVZA 3R7CA 3EZHA 2L6FA 3TD7A 3ASOC 5L0HA 1YA9A 4JW1A 1O5HA 3FOOA 3N0TA 4MW3A 2HFIA 1Z5ZA 2Q9BA 4E7ZA 1FMVA 2XLDA 2OEVA 4OD5A 4WGYA 3WG7C 2TMVP 2DYSC 1TR2A 3TJ5A 3DAFA 1M6TA 3PDMP 2FFHA 1ZHTA 2Z15A 2CNWD 1WOLA 2GA0A 3AJMA 3JCUQ 4PJJA 2LIGA 4C3DA 3JYYA 4XLPF 5KYWB 4LDKA 4G7OF 4Q4ZF 1CGNA 3MX3A 3LEOA 3U2MA 4JEBA 2WVNA 5D92A 3KYIA 2XL6A 4AL0A 1ZW2A 1J8YF 2KW3C 2OKUA 3VAYA 5A69A 1JMWA 1Q0MA 1WN0A 3AG4C 2EPKX 2HMQA 3NMKA 1K05A 4MVRA 1KNYA 3C63A 3GORA 2Q7RA 1G4US 1LVKA 2KJGA 2R7QA 5B3IA 1I5NA 2AWCA 3QMKA 4MVMA 4NQFA 1OW7A 1Q0KA 3Q7LA 1DOWA 2HJ3A 1SF8A 1XZPA 1M2OA 2J9WA 4J30B 2D4UA 2UUIA 1WTYA 2Y3DA 5T1DB 4E7SA 1A7DA 2RSEB 2R7WA 5L0CA 5EK0A 4BJ5C 1U6HA 3L8IA 3Q6NA 4OINF 3KKBA 2R7SA 1NLXA 1KU2A 3AG1C 3FDQA 3ZWIA 2DYRC 1YA7O 2WVQA 2CW0F 3JSZA 3RW0A 2VCCA 3QZCA 4BPMA 2A0UA 1LS4A 3EPVA 3M4CA 2VASA 4DRJB 4KBLA 2GAQA 1QQ3A 1TFOB 3C8GB 4JKVA 4PR9A 3NMIA 2ZXOA 3CZ6A 3HNLA 2ZXRA 3RVYA 1FR0A 2L81A 2R9RB 3I4UA 2XXAB 2YQYA 3JRTA 3S27A 2J46A 2A6HF 4PK4A 2G62A 2IXOA 3RIPA 2YLIA 1R5ID 4IAQA 3B0UX 3DM9B 3TOLA 1PD1A 1G4WR 1HW2A 3DJUB 4Z9IA 1C02A 1ZHWA 2EPOA 2QNLA 3EH1A 3QW0A 4R32A 1LPEA 1V74B 3W2WA 1CGME 3EJNA 1EI7A 4PACA 3W4YA 3GODA 2IBFA 3HTKC 4MVSA 4AE4B 3US6A 3G50A 4NCQA 2J0XA 1HMDA 1SR2A 2CYDA 3A9CA 3CSKA 3DE8A 1M2VB 3GM1A 3W8HA 3N2ZB 1A41A 2DGJA 2WVOA 2YL7A 5IY5C 3M79A 4C3EA 2CDQA 1RMVA 1HE9A 2R02A 2IM8A 3SXMA 3UGPA 1YDIA 2FGYA 2VCAA 1Q0DA 3EFOB 3GANA 4XLNF 1QZXA 1Z23A 5BQHA 1WWPA 4MW8A 3U3FA 3M4BA 3NG1A 4DRIB 2CCYA 5COGA 1T5OA 1Z63A 4C7OB 3LS1A 5E3CA 1F1MA 1I4YA 2GDCA 2OG2A 4EWCA 1YYJA 3MFNA 3E9VA 4MS2A 4XEFA 4D4NA 1S7ZA 1TWGA 2L6GA 4HE8D 4DVZA 2O9XA 3O55A 4YJWA 1TQGA 3T6BA 1OKKA 2L7AA 5HV9A 2HJMA 2HMZA 2X51A 1QKRA 2FAPB 4CS9C 3N24A 2A1DD 5HSWA 1BR2A 3ZTMA 3IQTA 3TOMA 4MNDA 4XEKA 4EHPA 3KMIA 1M57C 4U5FE 2EILC 2NG1A 2NPUA 4K1OA 5CI8A 3V7OA 1ZHYA 4BJ1A 5KYNA 4ZLDA 2YZSA 3Q6MA 4A4AA 2V26A 4U5GA 2CNWA 1CPQA 4XQ1A 5DS4A 2HUJA 4U5BE 2J9UA 2XLVA 2AP3A 3NKDA 3NMJA 3RH3A 4DJ9A 5CIVA 4U5DE 1NU9C 2G3KA 4W8PA 4BJTA 1T6QA 2IXPA 4GYTA 1PCXA 4IB4A 4P6IC 5L0FA 1U0BB 2EIKC 1PD0A 4X0RA 5A6AA 1IZMA 3VF0A 2ETSA 2XS1A 3ZTZA 1G5ZA 1MMAA 3ZC4A 2LK4A 2R05A 3FAJA 4NY3A 3TJ6A 3TULA 1LS1A 2Y3HA 3K1IC 4D4XA 2NSFA 1HE1A 2R7OA 2YL1A 4MTGA 5A6BA 4FWVA 2J45A 2NSGA 2OU6A 2E87A 2YRFA 4XPYA 1JPJA 5AGFA 2C03A 1T9KA 2ZXWC 5DQZA 4DBRA 1D1BA 3B29A 3FVYA 4IARA 1OCRC 3ZVRA 1NFNA 4JJGA 4BJ6A 1NFOA 3X1OA 1LIHA 1NSGB 3LLIA 3SXYA 4NTBA 2H7VC 4LDRA 2C04A 4N6CA 1VYKA 4XPXA 2GWWA 1NG1A 2NUPB 1ZU5A 4UDVA 1FAPB 1NU7D 3MBGA 5AC5A 1G8XA 1S05A 2ZPAA 3C7JA 4XEVA 3DE9A 3J06A 2ICWG 3DI5A 3GEEA 1NBBA 2YEVA 1AVOB 3FHDA 2QTVA 3ABLC 4DRHB 1HMOA 3R2PA 1JOGA 2NUTA 4EKWA 4Z9HA 3GWLA 1VK5A 4ONSA 3X2QC 2MWQA 1RKEA 2P61A 2GFHA 1RXQA 3L34A 3SXZA 4G78A 1E2XA 2XLWA 2YHSA 3EGDA 1AEPA 1T01A 4CBEA 5TJ5E 4KI2A 2OJQA 3VYWA 2YVKA 3RF3A 4LDQA 3IPMO 1BZ4A 4NC3A 3FAPB 4YT2A 4EBBA 5A6KA 5DS6A 3DZAA 2KSFA 3U5SA 1YARO 3O10A 1H9TA 4Q7CA 5GPGB 2QY9A 5E33A 5EHHA 4G7ZF 3LJBA 3SXKA 3IHUA 1MMDA 3RVZA 4AK9A 4GEHA 3FXHA 4YT4A 3ZQVA 2G3VA 3NYJA 3DM5A 4QI0A 2J0WA 3GM2A 3NRHA 2IOQA 4AX2A 5JUAA 3FOPA 4J7YA 3CAXA 2HS5A 1BBHA 5T3WA 2WZFA 1ZW3A 4CJOA 1RCPA 3RQGA 3GEIA 2W4BA 2W4MA 2H8AA 3I5QA 2YKZA 1EKYA 3B9QA 5L3VA 2XSEA 1OW8A 2KC3A 4O7GA 3S29A 5JRAA 2EPMX 2KGOA 3EGXA 1GQAA 3U9MA 3H65A 1FFTC 3OEOA 4MQ9F 3U8PA 5CI9A 1YLMA 1TKNA 2QLAA 1WASA 2A69F 2PX0A 3M1CB 1TWAA 2XLMA 1Z3IX 3ECSA 3H2VA 3O39A 3O6XA 1XZQA 2I8BA 1VTMP 2JD3A 4N6HA 2ZD9A 5F28E 4JRZA 4KC9A 3ZIBA 1FTSA 4HFKB 3HNKA 5E3AA 1FFHA 3ZSUA 4RBNA 4IRUA 4XTKA 1OCOC 1RJ9A 5B1AC 256BA 1OCCC 4O6MA 4OD4A 2R7UA 1BR4A 4IWBA 2XLHA 4J7TA 1ZU4A 2QE9A 4FX5A 2HSBA 2D5RB 1T6UA 1W2WA 2W45A 4K7BA 1ZVZA 2F22A 5DVWA 5FZTA 4DXWA 2V3CC 3EG9A 1M56C 1YJGA 2YL0A 4LLCA 5KYUA 3RKOF 3JYHA 2DI3A 2KYHA 3RFYA 5L0IA 1VYIA 3T9OA 4YT5A 1L7CA 2I15A 5L3QA 4YN0B 2NUTB 1V55C 3BEHA 3HNJA 2HKVA 3G4XA 4KNWA 1CPRA 2DB4A 5COFA 3JRMO 1OW6A 3T6GB 4F4BA 1SYQA 2EIJC 3C62A 2XL4A 1MQVA 1J8MF 3HJCA 1MMNA 4JCZA 2WB7A 3POVA 3PCVA 2XLEA 3S84A 3AOUA 3WAQA
chains in the Genus database with same CATH topology
1YDIA 3ZDLA 1ZVZA 5FZTA 4E17A 1T01A 4DJ9A 3RF3A 5L0DA 5L0HA 1H6GA 1DOWA 1XWJA 2GDCA 5L0IA 1DOVA 2LQGA 3MYIA 1RKCA 4IGGA 4P9TA 4W8PA 3H2VA 5L0FA 2GWWA 3S90A 1L7CA 5L0CA 5L0GA 1U6HA 4E18A 2L7AA 3TJ5A 1TR2A 3VF0A 2IBFA 1QKRA 3H2UA 1ST6A 2B0HA 3TJ6A 1U89A 1RKEB 3T6GB 1SYQA 5L0JA 2HSQA 4ONSA 4EHPA 4PR9A 1RKEA 1ZW3A 4K1OA 2X0CA 1ZW2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YDI A;  3ZDL A;  1ZVZ A;  5FZT A;  4E17 A;  1T01 A;  4DJ9 A;  3RF3 A;  5L0D A;  5L0H A;  1H6G A;  1DOW A;  1XWJ A;  2GDC A;  5L0I A;  1DOV A;  2LQG A;  3MYI A;  1RKC A;  4IGG A;  4P9T A;  4W8P A;  3H2V A;  5L0F A;  2GWW A;  3S90 A;  1L7C A;  5L0C A;  5L0G A;  1U6H A;  4E18 A;  2L7A A;  3TJ5 A;  1TR2 A;  3VF0 A;  2IBF A;  1QKR A;  3H2U A;  1ST6 A;  2B0H A;  3TJ6 A;  1U89 A;  1RKE B;  3T6G B;  1SYQ A;  5L0J A;  2HSQ A;  4ONS A;  4EHP A;  4PR9 A;  1RKE A;  1ZW3 A;  4K1O A;  2X0C A;  1ZW2 A; 
#chains in the Genus database with same CATH topology
 4ULV A;  2QUP A;  4ZLC A;  1SMY F;  3LES A;  1I4Z A;  4LLE A;  2LCH A;  4EBJ A;  1CGO A;  2Y69 C;  1FNT c;  1OXB A;  3WOD F;  1YZA A;  2KQ9 A;  2VCB A;  3ASN C;  4CX9 A;  4GQH A;  2IXN A;  1XWJ A;  3NKE A;  2JPU A;  4E0H A;  2PF4 E;  4MTF A;  4PFP A;  1ORY A;  4OIR F;  3FMS A;  3AGU A;  4ER9 A;  4FAP B;  1ZHZ A;  4DBQ A;  4E18 A;  5DQT A;  5BUO A;  2R03 A;  4CIH A;  2Y3G A;  3UNG C;  5JT4 A;  2R7X A;  1R4T A;  1LI7 A;  1VMA A;  4YT8 A;  1Q0F A;  5KYY B;  3JT1 A;  3EHN A;  1YAU O;  3DXJ F;  3B0V C;  3UR3 C;  2PFD A;  1ZYR F;  4WJ0 A;  5KYY A;  2P0N A;  4YL3 A;  2VH3 A;  2P7V A;  1Z7Q c;  3EGX B;  4K0D A;  3HKK A;  3F47 A;  3KYJ A;  1B68 A;  3C8G A;  2W9Y A;  1OCZ C;  4I3M A;  1LI5 A;  4YL0 A;  5COM A;  1Q0G A;  2OQM A;  5T3T A;  4JTA B;  2R7R A;  2XXA A;  1K04 A;  2R7V A;  2XS8 A;  1GS9 A;  3E70 C;  2LFF A;  3B71 A;  1UFB A;  3IQ6 A;  4PJM A;  3TK0 A;  3ABM C;  2LQG A;  3LS0 A;  3W2V A;  4CSA C;  3GWN A;  4O79 A;  4H54 A;  4YK5 A;  2MYS A;  2H7O A;  4O6N A;  2XM0 A;  5L0G A;  1L3P A;  2AVK A;  2Q4F A;  3DAG A;  1OXK A;  4NTA A;  4WGZ A;  3RQF A;  1APC A;  5A6B D;  3GEH A;  1JPN A;  1ST6 A;  2IYL D;  1BDJ B;  2B0H A;  4U9E A;  2A68 F;  4BEJ A;  3V5Z A;  2EIM C;  2J8W A;  2MHR A;  3K33 A;  3LLK A;  3WHN A;  4CS8 C;  2A6E F;  2ZXP A;  2KK1 A;  1K40 A;  2IXM A;  4JCH A;  1M2V A;  4N06 A;  3S9O A;  3IQC A;  4CJG A;  2P6V A;  1D0X A;  2XRH A;  2YWA A;  4OIP F;  4BG0 A;  1QVX A;  3LEV A;  1VLS A;  4KNV A;  4JUR I;  4RD9 A;  4E17 A;  3TQO A;  2RD9 A;  1Y4C A;  4JEA A;  4LAC B;  4BJ5 A;  4QI2 A;  3LNM B;  3EFO A;  2J9B A;  2P1A A;  3DWW A;  1VOM A;  2PX3 A;  3LAY A;  5KYX A;  1JAF A;  1H6G A;  4QDL A;  5JLI A;  1RKC A;  4BJ6 C;  3U9J A;  3QW1 A;  4C7O A;  2EPN A;  2AU5 A;  2YL3 A;  1H9G A;  3A11 A;  4NTF A;  3SEO A;  3KPH A;  4JIO A;  5K0I A;  4DVY P;  5JS5 A;  2AWY A;  1YZC A;  4RDA A;  4WAB A;  1U89 A;  3BRJ A;  1TFK B;  3C8G D;  3UMK A;  4JJF A;  3QTH A;  1ORJ A;  2LSE A;  4G0H A;  1EA8 A;  1QSP A;  4AL1 A;  2VC9 A;  1Y6D A;  3T4R A;  4O6Y A;  2OJE D;  4PJN A;  1OR2 A;  4JVS A;  3I5P A;  2LFD A;  4IAO A;  5B1B C;  2L9J A;  4EIY A;  3QVY A;  4XWJ A;  5DLJ A;  1VB5 A;  2BC5 A;  2M4E A;  3AQB A;  5F5H A;  5DS5 A;  3K1H A;  3VRC A;  1WAT A;  2A0B A;  3S28 A;  3SNH A;  1A0B A;  4DOZ A;  2R7T A;  2PNO A;  5JSL A;  5EGY A;  1YYX A;  3U3B A;  4OIQ F;  1MNE A;  3KH2 A;  1HY5 A;  2J7P A;  4YL1 A;  4JE9 A;  3JSE O;  4PFO A;  3SP1 A;  3UMI A;  3CQZ A;  1D1A A;  2XM4 A;  2B0J A;  3ABK C;  5D91 A;  1E84 A;  4U5E E;  1QPU A;  5L0J A;  2R25 A;  1OR3 A;  3VM6 A;  4J32 B;  3RYL A;  4LER A;  3LNR A;  1O3U A;  2X0C A;  1VLT A;  2XLO A;  3UMH A;  2J9V A;  3ZDL A;  1GGQ A;  5JVE A;  1KTM A;  3U8V A;  3UGO A;  1D0Z A;  5BQG A;  2KNH A;  3SZR A;  4B6I A;  3U2L A;  4I1M A;  4CS9 A;  3HNI A;  1TWC A;  4CDY A;  1HW1 A;  3MYI A;  2EPL X;  3PMR A;  4JZA A;  5FCL A;  3V5X A;  1E86 A;  4MTO A;  4JTD B;  3DMD A;  2OEX A;  3U0C A;  1NZE A;  2LP4 A;  3AG3 C;  4HEA J;  1IW7 F;  1OQC A;  3ATP A;  3EQL F;  3H2U A;  3LUT B;  1YVI A;  3MYF A;  4MVZ A;  2NUP A;  4ULW A;  1MND A;  1RKE B;  3JZ0 A;  4P9F A;  2EIN C;  3ITF A;  1LE2 A;  1A7V A;  1N1C A;  2HSQ A;  4MVQ A;  1ZHX A;  2Q3T A;  3EHM A;  3K7D A;  3W8I A;  2WZL A;  1V54 C;  3EGD B;  2VB6 A;  3S0X A;  2Y3B A;  1QLE C;  5KYX B;  5KYW A;  4Z9J A;  3NYL A;  1UG7 A;  2L6H A;  2Q9A A;  1WGW A;  1JRA A;  4L6R A;  4ANJ A;  4U9D A;  4Q5S F;  1D0Y A;  1FMW A;  2J7P D;  2M64 A;  3CEX A;  3F46 A;  3HLZ A;  3OWT A;  1ORS C;  3EH2 A;  4JTC B;  2BE5 F;  2WL8 A;  1E83 A;  4IGG A;  5F5F A;  1Z6A A;  3K1I A;  4C3B A;  3V5Y A;  2JX0 A;  2PP4 A;  5A6J A;  3AGT A;  3AQC A;  3C18 A;  4HFF B;  2CGE A;  2BL2 A;  2OCC C;  3B0P A;  4IJJ A;  4PJL A;  1SZI A;  3DKA A;  4I1O B;  4CIP A;  1TWH A;  1LKX A;  3DD7 A;  3DJN B;  3OA1 A;  1V4A A;  1BR1 A;  3GM3 A;  4H4K C;  1LE4 A;  2PBE A;  4XPW A;  4E0I A;  4U5C E;  4EBK A;  4YWQ A;  4CSA A;  2H7B A;  4I44 A;  5E2Q A;  5AC4 A;  1O87 A;  2LD6 A;  1D1C A;  2OOC A;  2HZ8 A;  2YLD A;  3KL4 A;  2Q9C A;  4N4W A;  3K66 A;  4CDA A;  5L0D A;  3L0I A;  4CDV A;  3NDB B;  4JC7 A;  3G4Z A;  1DOV A;  1GM5 A;  3IEE A;  4P9T A;  4CS8 A;  4M63 A;  5BQI A;  4A2N B;  5B3S C;  5JP7 A;  2ASR A;  3L8J A;  4FES A;  3Q7G A;  1C17 M;  4MVO A;  3S90 A;  3ZQY A;  2HV6 A;  1EQ1 A;  2UUH A;  3PHF 2;  3M15 A;  1RJ9 B;  4W8K A;  3T6J A;  1MMG A;  2XL8 A;  2Q00 A;  3IQ5 A;  4G7H F;  3AG2 C;  4CS7 A;  1ZZP A;  1JR8 A;  4AE4 A;  4MVU A;  1C03 A;  3SYN A;  4EUK B;  2YLG A;  4OIO F;  1T6I A;  1LM3 B;  1H7I A;  3NYM A;  3JTL O;  3RQE A;  3EZI A;  3EG9 B;  3C8Z A;  1A7E A;  1PV3 A;  2HV7 A;  3MLG A;  5KYU B;  4BEM J;  3L1M A;  3ZG1 A;  4U5H A;  3K6B A;  2WZG A;  2Y39 A;  1E85 A;  1AUE A;  1OKK D;  3QVZ A;  3R7C A;  3EZH A;  2L6F A;  3TD7 A;  3ASO C;  5L0H A;  1YA9 A;  4JW1 A;  1O5H A;  3FOO A;  3N0T A;  4MW3 A;  2HFI A;  1Z5Z A;  2Q9B A;  4E7Z A;  1FMV A;  2XLD A;  2OEV A;  4OD5 A;  4WGY A;  3WG7 C;  2TMV P;  2DYS C;  1TR2 A;  3TJ5 A;  3DAF A;  1M6T A;  3PDM P;  2FFH A;  1ZHT A;  2Z15 A;  2CNW D;  1WOL A;  2GA0 A;  3AJM A;  3JCU Q;  4PJJ A;  2LIG A;  4C3D A;  3JYY A;  4XLP F;  5KYW B;  4LDK A;  4G7O F;  4Q4Z F;  1CGN A;  3MX3 A;  3LEO A;  3U2M A;  4JEB A;  2WVN A;  5D92 A;  3KYI A;  2XL6 A;  4AL0 A;  1ZW2 A;  1J8Y F;  2KW3 C;  2OKU A;  3VAY A;  5A69 A;  1JMW A;  1Q0M A;  1WN0 A;  3AG4 C;  2EPK X;  2HMQ A;  3NMK A;  1K05 A;  4MVR A;  1KNY A;  3C63 A;  3GOR A;  2Q7R A;  1G4U S;  1LVK A;  2KJG A;  2R7Q A;  5B3I A;  1I5N A;  2AWC A;  3QMK A;  4MVM A;  4NQF A;  1OW7 A;  1Q0K A;  3Q7L A;  1DOW A;  2HJ3 A;  1SF8 A;  1XZP A;  1M2O A;  2J9W A;  4J30 B;  2D4U A;  2UUI A;  1WTY A;  2Y3D A;  5T1D B;  4E7S A;  1A7D A;  2RSE B;  2R7W A;  5L0C A;  5EK0 A;  4BJ5 C;  1U6H A;  3L8I A;  3Q6N A;  4OIN F;  3KKB A;  2R7S A;  1NLX A;  1KU2 A;  3AG1 C;  3FDQ A;  3ZWI A;  2DYR C;  1YA7 O;  2WVQ A;  2CW0 F;  3JSZ A;  3RW0 A;  2VCC A;  3QZC A;  4BPM A;  2A0U A;  1LS4 A;  3EPV A;  3M4C A;  2VAS A;  4DRJ B;  4KBL A;  2GAQ A;  1QQ3 A;  1TFO B;  3C8G B;  4JKV A;  4PR9 A;  3NMI A;  2ZXO A;  3CZ6 A;  3HNL A;  2ZXR A;  3RVY A;  1FR0 A;  2L81 A;  2R9R B;  3I4U A;  2XXA B;  2YQY A;  3JRT A;  3S27 A;  2J46 A;  2A6H F;  4PK4 A;  2G62 A;  2IXO A;  3RIP A;  2YLI A;  1R5I D;  4IAQ A;  3B0U X;  3DM9 B;  3TOL A;  1PD1 A;  1G4W R;  1HW2 A;  3DJU B;  4Z9I A;  1C02 A;  1ZHW A;  2EPO A;  2QNL A;  3EH1 A;  3QW0 A;  4R32 A;  1LPE A;  1V74 B;  3W2W A;  1CGM E;  3EJN A;  1EI7 A;  4PAC A;  3W4Y A;  3GOD A;  2IBF A;  3HTK C;  4MVS A;  4AE4 B;  3US6 A;  3G50 A;  4NCQ A;  2J0X A;  1HMD A;  1SR2 A;  2CYD A;  3A9C A;  3CSK A;  3DE8 A;  1M2V B;  3GM1 A;  3W8H A;  3N2Z B;  1A41 A;  2DGJ A;  2WVO A;  2YL7 A;  5IY5 C;  3M79 A;  4C3E A;  2CDQ A;  1RMV A;  1HE9 A;  2R02 A;  2IM8 A;  3SXM A;  3UGP A;  1YDI A;  2FGY A;  2VCA A;  1Q0D A;  3EFO B;  3GAN A;  4XLN F;  1QZX A;  1Z23 A;  5BQH A;  1WWP A;  4MW8 A;  3U3F A;  3M4B A;  3NG1 A;  4DRI B;  2CCY A;  5COG A;  1T5O A;  1Z63 A;  4C7O B;  3LS1 A;  5E3C A;  1F1M A;  1I4Y A;  2GDC A;  2OG2 A;  4EWC A;  1YYJ A;  3MFN A;  3E9V A;  4MS2 A;  4XEF A;  4D4N A;  1S7Z A;  1TWG A;  2L6G A;  4HE8 D;  4DVZ A;  2O9X A;  3O55 A;  4YJW A;  1TQG A;  3T6B A;  1OKK A;  2L7A A;  5HV9 A;  2HJM A;  2HMZ A;  2X51 A;  1QKR A;  2FAP B;  4CS9 C;  3N24 A;  2A1D D;  5HSW A;  1BR2 A;  3ZTM A;  3IQT A;  3TOM A;  4MND A;  4XEK A;  4EHP A;  3KMI A;  1M57 C;  4U5F E;  2EIL C;  2NG1 A;  2NPU A;  4K1O A;  5CI8 A;  3V7O A;  1ZHY A;  4BJ1 A;  5KYN A;  4ZLD A;  2YZS A;  3Q6M A;  4A4A A;  2V26 A;  4U5G A;  2CNW A;  1CPQ A;  4XQ1 A;  5DS4 A;  2HUJ A;  4U5B E;  2J9U A;  2XLV A;  2AP3 A;  3NKD A;  3NMJ A;  3RH3 A;  4DJ9 A;  5CIV A;  4U5D E;  1NU9 C;  2G3K A;  4W8P A;  4BJT A;  1T6Q A;  2IXP A;  4GYT A;  1PCX A;  4IB4 A;  4P6I C;  5L0F A;  1U0B B;  2EIK C;  1PD0 A;  4X0R A;  5A6A A;  1IZM A;  3VF0 A;  2ETS A;  2XS1 A;  3ZTZ A;  1G5Z A;  1MMA A;  3ZC4 A;  2LK4 A;  2R05 A;  3FAJ A;  4NY3 A;  3TJ6 A;  3TUL A;  1LS1 A;  2Y3H A;  3K1I C;  4D4X A;  2NSF A;  1HE1 A;  2R7O A;  2YL1 A;  4MTG A;  5A6B A;  4FWV A;  2J45 A;  2NSG A;  2OU6 A;  2E87 A;  2YRF A;  4XPY A;  1JPJ A;  5AGF A;  2C03 A;  1T9K A;  2ZXW C;  5DQZ A;  4DBR A;  1D1B A;  3B29 A;  3FVY A;  4IAR A;  1OCR C;  3ZVR A;  1NFN A;  4JJG A;  4BJ6 A;  1NFO A;  3X1O A;  1LIH A;  1NSG B;  3LLI A;  3SXY A;  4NTB A;  2H7V C;  4LDR A;  2C04 A;  4N6C A;  1VYK A;  4XPX A;  2GWW A;  1NG1 A;  2NUP B;  1ZU5 A;  4UDV A;  1FAP B;  1NU7 D;  3MBG A;  5AC5 A;  1G8X A;  1S05 A;  2ZPA A;  3C7J A;  4XEV A;  3DE9 A;  3J06 A;  2ICW G;  3DI5 A;  3GEE A;  1NBB A;  2YEV A;  1AVO B;  3FHD A;  2QTV A;  3ABL C;  4DRH B;  1HMO A;  3R2P A;  1JOG A;  2NUT A;  4EKW A;  4Z9H A;  3GWL A;  1VK5 A;  4ONS A;  3X2Q C;  2MWQ A;  1RKE A;  2P61 A;  2GFH A;  1RXQ A;  3L34 A;  3SXZ A;  4G78 A;  1E2X A;  2XLW A;  2YHS A;  3EGD A;  1AEP A;  1T01 A;  4CBE A;  5TJ5 E;  4KI2 A;  2OJQ A;  3VYW A;  2YVK A;  3RF3 A;  4LDQ A;  3IPM O;  1BZ4 A;  4NC3 A;  3FAP B;  4YT2 A;  4EBB A;  5A6K A;  5DS6 A;  3DZA A;  2KSF A;  3U5S A;  1YAR O;  3O10 A;  1H9T A;  4Q7C A;  5GPG B;  2QY9 A;  5E33 A;  5EHH A;  4G7Z F;  3LJB A;  3SXK A;  3IHU A;  1MMD A;  3RVZ A;  4AK9 A;  4GEH A;  3FXH A;  4YT4 A;  3ZQV A;  2G3V A;  3NYJ A;  3DM5 A;  4QI0 A;  2J0W A;  3GM2 A;  3NRH A;  2IOQ A;  4AX2 A;  5JUA A;  3FOP A;  4J7Y A;  3CAX A;  2HS5 A;  1BBH A;  5T3W A;  2WZF A;  1ZW3 A;  4CJO A;  1RCP A;  3RQG A;  3GEI A;  2W4B A;  2W4M A;  2H8A A;  3I5Q A;  2YKZ A;  1EKY A;  3B9Q A;  5L3V A;  2XSE A;  1OW8 A;  2KC3 A;  4O7G A;  3S29 A;  5JRA A;  2EPM X;  2KGO A;  3EGX A;  1GQA A;  3U9M A;  3H65 A;  1FFT C;  3OEO A;  4MQ9 F;  3U8P A;  5CI9 A;  1YLM A;  1TKN A;  2QLA A;  1WAS A;  2A69 F;  2PX0 A;  3M1C B;  1TWA A;  2XLM A;  1Z3I X;  3ECS A;  3H2V A;  3O39 A;  3O6X A;  1XZQ A;  2I8B A;  1VTM P;  2JD3 A;  4N6H A;  2ZD9 A;  5F28 E;  4JRZ A;  4KC9 A;  3ZIB A;  1FTS A;  4HFK B;  3HNK A;  5E3A A;  1FFH A;  3ZSU A;  4RBN A;  4IRU A;  4XTK A;  1OCO C;  1RJ9 A;  5B1A C;  256B A;  1OCC C;  4O6M A;  4OD4 A;  2R7U A;  1BR4 A;  4IWB A;  2XLH A;  4J7T A;  1ZU4 A;  2QE9 A;  4FX5 A;  2HSB A;  2D5R B;  1T6U A;  1W2W A;  2W45 A;  4K7B A;  1ZVZ A;  2F22 A;  5DVW A;  5FZT A;  4DXW A;  2V3C C;  3EG9 A;  1M56 C;  1YJG A;  2YL0 A;  4LLC A;  5KYU A;  3RKO F;  3JYH A;  2DI3 A;  2KYH A;  3RFY A;  5L0I A;  1VYI A;  3T9O A;  4YT5 A;  1L7C A;  2I15 A;  5L3Q A;  4YN0 B;  2NUT B;  1V55 C;  3BEH A;  3HNJ A;  2HKV A;  3G4X A;  4KNW A;  1CPR A;  2DB4 A;  5COF A;  3JRM O;  1OW6 A;  3T6G B;  4F4B A;  1SYQ A;  2EIJ C;  3C62 A;  2XL4 A;  1MQV A;  1J8M F;  3HJC A;  1MMN A;  4JCZ A;  2WB7 A;  3POV A;  3PCV A;  2XLE A;  3S84 A;  3AOU A;  3WAQ A; 
#chains in the Genus database with same CATH homology
 1YDI A;  3ZDL A;  1ZVZ A;  5FZT A;  4E17 A;  1T01 A;  4DJ9 A;  3RF3 A;  5L0D A;  5L0H A;  1H6G A;  1DOW A;  1XWJ A;  2GDC A;  5L0I A;  1DOV A;  2LQG A;  3MYI A;  1RKC A;  4IGG A;  4P9T A;  4W8P A;  3H2V A;  5L0F A;  2GWW A;  3S90 A;  1L7C A;  5L0C A;  5L0G A;  1U6H A;  4E18 A;  2L7A A;  3TJ5 A;  1TR2 A;  3VF0 A;  2IBF A;  1QKR A;  3H2U A;  1ST6 A;  2B0H A;  3TJ6 A;  1U89 A;  1RKE B;  3T6G B;  1SYQ A;  5L0J A;  2HSQ A;  4ONS A;  4EHP A;  4PR9 A;  1RKE A;  1ZW3 A;  4K1O A;  2X0C A;  1ZW2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...