2HSQA

Human vinculin (head domain, vh1, residues 1-258) in complex with shigella's ipaa vinculin binding site 2 (residues 565-587)
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
266
structure length
261
Chain Sequence
MEHHHHHHMPVFHTRTIESILEPVAQQISHLVIMHEEKAIPDLTAPVAAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVEKMSAEINEIIRVLQLTSWDEDAW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vinculin
publication title Shigella applies molecular mimicry to subvert vinculin and invade host cells.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion, structural protein
total genus 94
structure length 261
sequence length 266
ec nomenclature
pdb deposition date 2006-07-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 2hsqA02
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 2hsqA01
5L0JA 1RKCA 4IGGA 3TJ5A 1T01A 1DOVA 3MYIA 4ONSA 5L0IA 2HSQA 2GDCA 4PR9A 1DOWA 4E17A 1U89A 3H2UA 1U6HA 3ZDLA 1RKEA 5L0CA 2B0HA 1RKEB 2L7AA 3T6GB 3TJ6A 5L0DA 4K1OA 4P9TA 3VF0A 4E18A 1SYQA 5FZTA 1L7CA 1ZVZA 1YDIA 5L0HA 2X0CA 1ZW3A 5L0GA 1ST6A 1ZW2A 3RF3A 4W8PA 2LQGA 4DJ9A 1TR2A 1XWJA 2GWWA 4EHPA 3H2VA 1QKRA 1H6GA 3S90A 2IBFA 5L0FA
chains in the Genus database with same CATH superfamily
2EPMX 3UMKA 1WN0A 4YL3A 3WG7C 2RD9A 1HE9A 3DE8A 3GWLA 4O6MA 4N06A 4YL0A 3M15A 3U8VA 2HKVA 2CYDA 3U2MA 2YL3A 4Z9IA 1G5ZA 1T6UA 5KYUB 1VLTA 2MYSA 2Q00A 3MLGA 4JCHA 1SF8A 4XWJA 4D4NA 2KQ9A 1RKEA 4N4WA 4KI2A 4CX9A 3EZHA 1JOGA 1QPUA 3A9CA 5A6AA 3G4ZA 4XPXA 4NQFA 4JE9A 5AGFA 3ITFA 3SXYA 4AL1A 2VCCA 5KYYA 1D1BA 2VH3A 3V5YA 1FTSA 3V5XA 1D0XA 1LE4A 3Q6MA 3AOUA 2ZXOA 4W8KA 4I1MA 1VOMA 1T9KA 4CIPA 5D92A 3QMKA 4A2NB 2ASRA 2HUJA 3NYMA 1YA7O 2Q9AA 2IXPA 1I5NA 2VC9A 3EGXB 4YL1A 4U5DE 3EHMA 3ASOC 3FAJA 3TJ5A 2BC5A 1T01A 3LNRA 2EIJC 2XLHA 4EUKB 2WB7A 4CS8A 4LDRA 2CNWD 3T4RA 3IEEA 4KNWA 2L9JA 4XLNF 2G3KA 3DMDA 4E18A 3UGPA 2YWAA 2DB4A 1T6IA 3C62A 5FZTA 5L3VA 1YJGA 1RMVA 3LAYA 4LLEA 2P61A 4NTAA 4PJMA 4XPWA 2YZSA 1OCZC 4J30B 4LDQA 4E0IA 2JX0A 4MVOA 3TOMA 1OW7A 2YKZA 4I3MA 3NKDA 1ZZPA 2LFDA 3ECSA 3GANA 2MHRA 1T5OA 2R05A 4YT5A 2YL1A 5L0JA 2BL2A 4XPYA 4EBJA 5B3SC 3PDMP 4KNVA 1VTMP 3GEHA 5JUAA 2R7UA 1FR0A 5KYXB 1WOLA 4DVZA 2EPOA 3RVYA 3F46A 3QW0A 1IZMA 2D4UA 4PACA 4E17A 3TQOA 5K0IA 3U0CA 3I5PA 3NMIA 4CJGA 1S05A 3RFYA 4JC7A 4JW1A 4G0HA 1A0BA 1YZAA 1K04A 2A6HF 2R7QA 4P9TA 4YWQA 3KYJA 4YK5A 4G7ZF 4YN0B 3Q6NA 2XLOA 3W8HA 4CS9A 1FFHA 1O5HA 1M57C 1ZW2A 3C8GD 1BDJB 3EZIA 1LS4A 1MQVA 1BR2A 2XLWA 3FMSA 4U9EA 1Q0GA 1Z5ZA 3U9MA 2EPKX 2J45A 1QKRA 2NG1A 2J46A 3H65A 1JPNA 3U5SA 4C3DA 3EH2A 4CDAA 3JTLO 1YYJA 3B71A 3FDQA 3OA1A 2WZLA 2J7PA 2Y69C 3SXKA 5KYUA 3TOLA 2G3VA 3ABLC 1XZQA 2PP4A 3FOOA 3KL4A 1TWCA 1KU2A 2XLVA 1YA9A 1OXBA 2R9RB 3M1CB 1UG7A 1NU9C 1OXKA 2LFFA 4MVMA 4RBNA 3H2UA 1N1CA 3ATPA 4XLPF 3CZ6A 2WVNA 2YQYA 3FOPA 3X1OA 2L6GA 3WODF 2F22A 3T6GB 4K0DA 3NMJA 4MVUA 4CDYA 1LVKA 1PV3A 1ZU5A 1OW6A 2VB6A 3LNMB 4UDVA 2IXOA 3W8IA 3NYLA 5DLJA 2IM8A 1YYXA 2E87A 3FHDA 4J32B 3KH2A 2VASA 3C8ZA 4MVSA 4IB4A 4MQ9F 1TR2A 3B29A 1XWJA 1LS1A 4HE8D 1MMDA 3S9OA 3CAXA 2J9VA 3BRJA 3LJBA 2EPNA 2XS1A 3EGXA 2CGEA 4ZLDA 2J0WA 4N6CA 4O6YA 3R2PA 1JMWA 5KYWB 3K33A 4K7BA 2UUIA 2WZFA 4IJJA 2XLMA 3CQZA 1I4ZA 2L6FA 4JJFA 5COGA 1PCXA 2YRFA 1MNEA 5L0IA 2O9XA 1V54C 2LK4A 5B1BC 4U5CE 1U89A 2XLDA 4U9DA 3X2QC 1VMAA 5L0CA 3DE9A 4JJGA 1AEPA 3TJ6A 4MVRA 1E86A 1Q0KA 2Y3BA 5DQZA 2HMZA 3RYLA 3HLZA 4IWBA 3RKOF 1ZW3A 4JVSA 4BJ5C 3SP1A 3DWWA 4JZAA 1VYIA 2P7VA 1EI7A 1HMOA 1APCA 1TFOB 3O10A 2IXNA 4DBQA 256BA 2OJED 3MFNA 3SZRA 3RQFA 1NFOA 2H7OA 1QLEC 2XSEA 4ULVA 3C8GB 2R7OA 4PFPA 5BUOA 1QZXA 5KYXA 1VB5A 2B0JA 3LUTB 2YLDA 4F4BA 4HFFB 2AVKA 1ZHYA 2W45A 5E2QA 1ZHZA 5FCLA 1M6TA 4IRUA 3U8PA 4JIOA 1LI7A 2YHSA 1BR1A 1WASA 3M4CA 3HNKA 2YLIA 3AG2C 3IPMO 1LI5A 5HSWA 2X51A 5CI9A 1C03A 4EWCA 1K05A 1C02A 2YL0A 3EG9A 5JS5A 1YDIA 1IW7F 1A7EA 2KYHA 4W8PA 2FFHA 4E0HA 4E7ZA 1NG1A 3ABMC 2QLAA 2KNHA 2PF4E 1E85A 1QSPA 2DYSC 3IQ5A 2V3CC 2NUTB 1A7VA 4U5HA 1R5ID 5EK0A 1ZHTA 1MMGA 2VCAA 3UMHA 4BJTA 4C3BA 1SMYF 1DOVA 1VYKA 2NUPA 2XS8A 2ZXPA 2OKUA 4MW8A 4XQ1A 2I15A 4HEAJ 4KC9A 3RVZA 1OW8A 1FFTC 2R7SA 1W2WA 1NU7D 1OR3A 2KGOA 4DRHB 2L7AA 4MVZA 4K1OA 3GWNA 2R7RA 1WGWA 3HTKC 4OIOF 3OEOA 2EILC 4U5FE 3T6BA 2X0CA 5JSLA 3PCVA 4GQHA 1S7ZA 4YJWA 3W2WA 3ASNC 4G78A 2ETSA 2PX3A 2PX0A 1Z3IX 1T6QA 3E9VA 3AJMA 3L8JA 4IAQA 4JKVA 1C17M 4U5EE 4JTAB 3RQEA 4EKWA 3WAQA 4FAPB 3L8IA 4C3EA 5KYWA 3EHNA 2L81A 5IY5C 1RJ9B 4IGGA 4B6IA 2CCYA 3AGUA 3SXMA 4H54A 3LESA 1DOWA 1WATA 2R02A 3O39A 1D1AA 1U6HA 2C04A 2R25A 3C7JA 4DXWA 3CEXA 3G50A 3DAGA 4GEHA 4R32A 4BJ5A 2XM0A 2ZXRA 3GORA 5CIVA 4PK4A 1JPJA 4JRZA 1E2XA 3JCUQ 5F5HA 4OIPF 4Z9HA 2JD3A 4D4XA 3GEIA 1MMNA 3IQ6A 4JEBA 3NKEA 1TKNA 2HJMA 4EBKA 4HFKB 3N2ZB 2GWWA 3KKBA 4JCZA 3S90A 2OEXA 2A0UA 2XL8A 3S28A 3C18A 4A4AA 2XLEA 3K1IC 5B1AC 1EKYA 2J8WA 1ORYA 3FAPB 1QVXA 3MYIA 5T1DB 2YL7A 5KYNA 3DI5A 1V4AA 3LEOA 2HV7A 5E3CA 2DGJA 4MVQA 1K40A 1RKEB 3NRHA 4WGYA 4GYTA 3SEOA 3N24A 3HKKA 2EPLX 2R7WA 4M63A 5T3WA 2GFHA 1FAPB 3ZIBA 1LPEA 4EBBA 4L6RA 4P6IC 3V7OA 5L3QA 5TJ5E 2Q7RA 4DBRA 1KTMA 3T9OA 3UMIA 2LP4A 1OKKA 3JRMO 5A6BA 2H7BA 2Y3HA 3GM2A 4J7TA 1TQGA 2J7PD 3HNJA 4NY3A 4RDAA 3JSEO 4EHPA 1H6GA 1OCOC 4G7HF 5L0HA 2OQMA 1NSGB 1PD1A 2L6HA 1RKCA 1WTYA 3K6BA 4CJOA 4CDVA 4DOZA 3S84A 2YEVA 4CSAC 3L1MA 1BBHA 1I4YA 1LIHA 1YZCA 2UUHA 1Z7Qc 1J8YF 2NPUA 3GODA 3EPVA 3O55A 3VRCA 1SR2A 1G8XA 4JTCB 4BG0A 1D1CA 3S29A 1E84A 2WVQA 5A6JA 3JYHA 4H4KC 4NTFA 1BR4A 3NG1A 1ZHWA 2OOCA 1LKXA 2KC3A 2BE5F 1F1MA 2YVKA 3S0XA 2AP3A 2J9BA 5A6KA 5BQGA 3E70C 1HMDA 3U3FA 4Q5SF 1B68A 2R7VA 1Z23A 2FAPB 3JRTA 1WWPA 3JYYA 1Q0FA 3QVZA 4Q7CA 5COMA 5BQHA 3GM3A 2KSFA 1Y6DA 1FMWA 1O3UA 2IOQA 4XEVA 4DVYP 2NSGA 4MS2A 4OD5A 1YAUO 5E33A 5JLIA 4FWVA 3SXZA 5A69A 5HV9A 2R7TA 2EIKC 3M79A 5AC4A 5F28E 4MNDA 3Q7GA 1E83A 3AG4C 1NLXA 3AQBA 2XL4A 2Q4FA 2EIMC 2ZXWC 3K7DA 4IAOA 4OD4A 4LDKA 3RQGA 4CS7A 4Z9JA 4O79A 5DS6A 4QI2A 4PJJA 5DQTA 3T6JA 5EHHA 2QE9A 3M4BA 4LACB 4NTBA 2RSEB 2M4EA 4XTKA 5JVEA 4DJ9A 1GS9A 1J8MF 2KK1A 3NDBB 3K1IA 3KMIA 1M2VB 3MX3A 4WGZA 3VF0A 4AX2A 1MNDA 4AL0A 5DS5A 2Y3GA 1H9TA 1TWAA 4OIRF 3ZWIA 3G4XA 3ABKC 5BQIA 1ZU4A 3LLIA 3VAYA 3ZC4A 1JR8A 2A69F 2W4MA 4NCQA 4N6HA 2Y3DA 1OQCA 3VYWA 1O87A 4YT4A 2GDCA 3DZAA 1Z6AA 3DJNB 2XRHA 4C7OB 3A11A 2IXMA 2LD6A 3WHNA 2B0HA 3AQCA 1HE1A 2C03A 3BEHA 3C63A 3AG1C 3U2LA 1LE2A 3KPHA 3U9JA 5L0DA 1H7IA 2HFIA 2LSEA 2PNOA 1CGNA 1GQAA 1SYQA 3GM1A 3FXHA 5GPGB 1ZVZA 2I8BA 2CNWA 1M56C 4MTOA 3TD7A 3ZVRA 5L0GA 2CDQA 3JT1A 3EJNA 3EFOB 3RF3A 2V26A 5B3IA 1NBBA 2Z15A 3NYJA 1ORSC 4JEAA 2PBEA 2KJGA 3H2VA 4NC3A 4AE4B 4CSAA 1NZEA 4AK9A 3JZ0A 2AU5A 4FX5A 4P9FA 4LERA 1ZYRF 2R7XA 2ZD9A 4O7GA 5EGYA 4BJ6C 4ONSA 3HNLA 2QNLA 1KNYA 2A6EF 3IHUA 3GEEA 2OEVA 2YLGA 4KBLA 4E7SA 1FNTc 3CSKA 4J7YA 3B0UX 2QUPA 1EA8A 3HNIA 1YARO 3QW1A 1XZPA 2CW0F 2HZ8A 1UFBA 3ZQVA 1CGME 2OJQA 3LS0A 2OG2A 3I4UA 1ORJA 2HJ3A 4U5GA 4OINF 2NSFA 4MTGA 5JP7A 3I5QA 4BJ1A 3DM5A 2D5RB 2XL6A 1D0ZA 3US6A 1RCPA 2DYRC 2LIGA 5CI8A 4ANJA 3K1HA 1Q0DA 4QI0A 2XXAB 3B0VC 4FESA 3SYNA 3L34A 3V5ZA 1AVOB 1CPRA 2Q9BA 3C8GA 3EGDB 1JAFA 3QZCA 3PHF2 2JPUA 5F5FA 3L0IA 4QDLA 4G7OF 1NFNA 3J06A 3RH3A 1R4TA 1QQ3A 1CPQA 1V74B 1VK5A 3PMRA 4LLCA 4U5BE 2XM4A 2A1DD 2HSQA 3AGTA 1PD0A 5T3TA 1L3PA 3O6XA 4I1OB 3ZDLA 1FMVA 4YT2A 4Q4ZF 5E3AA 4O6NA 2PFDA 2J0XA 4PJLA 1HW2A 5JT4A 1LM3B 1AUEA 2GA0A 4ULWA 1YLMA 2Y39A 3FVYA 3U3BA 1A41A 4PJNA 4MW3A 5COFA 2R03A 3EG9B 3Q7LA 3QTHA 3AG3C 2HV6A 5KYYB 1HY5A 4DRJB 4WJ0A 4IARA 1M2VA 1TWHA 3R7CA 4EIYA 2VCBA 1TFKB 2Q9CA 2W9YA 2AWYA 2AWCA 3W2VA 2WZGA 1OR2A 3QVYA 1D0YA 1U0BB 1VLSA 2NUTA 2H7VC 4CBEA 1Y4CA 3EQLF 1ZHXA 3LLKA 3UR3C 1OCCC 5JRAA 3VM6A 1GGQA 1MMAA 3KYIA 3OWTA 2QY9A 2NUPB 3JSZA 2ICWG 1Z63A 2OU6A 4C7OA 2W4BA 2HSBA 1HW1A 5D91A 1V55C 3NMKA 4PFOA 1BZ4A 2WVOA 2H8AA 1YVIA 3K66A 3ZQYA 1JRAA 4I44A 4CS8C 3MYFA 1OKKD 5A6BD 2HMQA 1RXQA 2WL8A 4OIQF 3EFOA 3SNHA 2FGYA 4JURI 2J9UA 3TK0A 4BPMA 1ST6A 2IYLD 4MTFA 3ZTZA 4CIHA 2G62A 2A68F 3IQCA 1OCRC 3POVA 1EQ1A 2J9WA 2ZPAA 4AE4A 4BEJA 1H9GA 3DXJF 2GAQA 4RD9A 4XEKA 2IBFA 5DS4A 2P1AA 1G4US 3W4YA 1SZIA 2OCCC 3LS1A 1RJ9A 3IQTA 3UNGC 4BJ6A 4BEMJ 4DRIB 4XEFA 2P0NA 3DM9B 1M2OA 3DKAA 3RIPA 1A7DA 3DJUB 3LEVA 5AC5A 3ZG1A 2A0BA 4PR9A 2LCHA 3ZTMA 1GM5A 2EINC 2KW3C 5DVWA 3MBGA 2M64A 1TWGA 3TULA 3DD7A 3B0PA 4WABA 2DI3A 4JTDB 2TMVP 3B9QA 4ER9A 3DAFA 1L7CA 2MWQA 3RW0A 4ZLCA 2XXAA 2QTVA 4YT8A 2LQGA 3UGOA 3S27A 2Q3TA 3HJCA 1CGOA 2P6VA 1G4WR 3N0TA 1Q0MA 2HS5A 4CS9C 3EGDA 3EH1A 3F47A 4X0RA 3ZSUA 5L0FA
chains in the Genus database with same CATH topology
5L0JA 1RKCA 4IGGA 3TJ5A 1T01A 1DOVA 3MYIA 4ONSA 5L0IA 2HSQA 2GDCA 4PR9A 1DOWA 4E17A 1U89A 3H2UA 1U6HA 3ZDLA 1RKEA 5L0CA 2B0HA 1RKEB 2L7AA 3T6GB 3TJ6A 5L0DA 4K1OA 4P9TA 3VF0A 4E18A 1SYQA 5FZTA 1L7CA 1ZVZA 1YDIA 5L0HA 2X0CA 1ZW3A 5L0GA 1ST6A 1ZW2A 3RF3A 4W8PA 2LQGA 4DJ9A 1TR2A 1XWJA 2GWWA 4EHPA 3H2VA 1QKRA 1H6GA 3S90A 2IBFA 5L0FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5L0J A;  1RKC A;  4IGG A;  3TJ5 A;  1T01 A;  1DOV A;  3MYI A;  4ONS A;  5L0I A;  2HSQ A;  2GDC A;  4PR9 A;  1DOW A;  4E17 A;  1U89 A;  3H2U A;  1U6H A;  3ZDL A;  1RKE A;  5L0C A;  2B0H A;  1RKE B;  2L7A A;  3T6G B;  3TJ6 A;  5L0D A;  4K1O A;  4P9T A;  3VF0 A;  4E18 A;  1SYQ A;  5FZT A;  1L7C A;  1ZVZ A;  1YDI A;  5L0H A;  2X0C A;  1ZW3 A;  5L0G A;  1ST6 A;  1ZW2 A;  3RF3 A;  4W8P A;  2LQG A;  4DJ9 A;  1TR2 A;  1XWJ A;  2GWW A;  4EHP A;  3H2V A;  1QKR A;  1H6G A;  3S90 A;  2IBF A;  5L0F A; 
#chains in the Genus database with same CATH topology
 2EPM X;  3UMK A;  1WN0 A;  4YL3 A;  3WG7 C;  2RD9 A;  1HE9 A;  3DE8 A;  3GWL A;  4O6M A;  4N06 A;  4YL0 A;  3M15 A;  3U8V A;  2HKV A;  2CYD A;  3U2M A;  2YL3 A;  4Z9I A;  1G5Z A;  1T6U A;  5KYU B;  1VLT A;  2MYS A;  2Q00 A;  3MLG A;  4JCH A;  1SF8 A;  4XWJ A;  4D4N A;  2KQ9 A;  1RKE A;  4N4W A;  4KI2 A;  4CX9 A;  3EZH A;  1JOG A;  1QPU A;  3A9C A;  5A6A A;  3G4Z A;  4XPX A;  4NQF A;  4JE9 A;  5AGF A;  3ITF A;  3SXY A;  4AL1 A;  2VCC A;  5KYY A;  1D1B A;  2VH3 A;  3V5Y A;  1FTS A;  3V5X A;  1D0X A;  1LE4 A;  3Q6M A;  3AOU A;  2ZXO A;  4W8K A;  4I1M A;  1VOM A;  1T9K A;  4CIP A;  5D92 A;  3QMK A;  4A2N B;  2ASR A;  2HUJ A;  3NYM A;  1YA7 O;  2Q9A A;  2IXP A;  1I5N A;  2VC9 A;  3EGX B;  4YL1 A;  4U5D E;  3EHM A;  3ASO C;  3FAJ A;  3TJ5 A;  2BC5 A;  1T01 A;  3LNR A;  2EIJ C;  2XLH A;  4EUK B;  2WB7 A;  4CS8 A;  4LDR A;  2CNW D;  3T4R A;  3IEE A;  4KNW A;  2L9J A;  4XLN F;  2G3K A;  3DMD A;  4E18 A;  3UGP A;  2YWA A;  2DB4 A;  1T6I A;  3C62 A;  5FZT A;  5L3V A;  1YJG A;  1RMV A;  3LAY A;  4LLE A;  2P61 A;  4NTA A;  4PJM A;  4XPW A;  2YZS A;  1OCZ C;  4J30 B;  4LDQ A;  4E0I A;  2JX0 A;  4MVO A;  3TOM A;  1OW7 A;  2YKZ A;  4I3M A;  3NKD A;  1ZZP A;  2LFD A;  3ECS A;  3GAN A;  2MHR A;  1T5O A;  2R05 A;  4YT5 A;  2YL1 A;  5L0J A;  2BL2 A;  4XPY A;  4EBJ A;  5B3S C;  3PDM P;  4KNV A;  1VTM P;  3GEH A;  5JUA A;  2R7U A;  1FR0 A;  5KYX B;  1WOL A;  4DVZ A;  2EPO A;  3RVY A;  3F46 A;  3QW0 A;  1IZM A;  2D4U A;  4PAC A;  4E17 A;  3TQO A;  5K0I A;  3U0C A;  3I5P A;  3NMI A;  4CJG A;  1S05 A;  3RFY A;  4JC7 A;  4JW1 A;  4G0H A;  1A0B A;  1YZA A;  1K04 A;  2A6H F;  2R7Q A;  4P9T A;  4YWQ A;  3KYJ A;  4YK5 A;  4G7Z F;  4YN0 B;  3Q6N A;  2XLO A;  3W8H A;  4CS9 A;  1FFH A;  1O5H A;  1M57 C;  1ZW2 A;  3C8G D;  1BDJ B;  3EZI A;  1LS4 A;  1MQV A;  1BR2 A;  2XLW A;  3FMS A;  4U9E A;  1Q0G A;  1Z5Z A;  3U9M A;  2EPK X;  2J45 A;  1QKR A;  2NG1 A;  2J46 A;  3H65 A;  1JPN A;  3U5S A;  4C3D A;  3EH2 A;  4CDA A;  3JTL O;  1YYJ A;  3B71 A;  3FDQ A;  3OA1 A;  2WZL A;  2J7P A;  2Y69 C;  3SXK A;  5KYU A;  3TOL A;  2G3V A;  3ABL C;  1XZQ A;  2PP4 A;  3FOO A;  3KL4 A;  1TWC A;  1KU2 A;  2XLV A;  1YA9 A;  1OXB A;  2R9R B;  3M1C B;  1UG7 A;  1NU9 C;  1OXK A;  2LFF A;  4MVM A;  4RBN A;  3H2U A;  1N1C A;  3ATP A;  4XLP F;  3CZ6 A;  2WVN A;  2YQY A;  3FOP A;  3X1O A;  2L6G A;  3WOD F;  2F22 A;  3T6G B;  4K0D A;  3NMJ A;  4MVU A;  4CDY A;  1LVK A;  1PV3 A;  1ZU5 A;  1OW6 A;  2VB6 A;  3LNM B;  4UDV A;  2IXO A;  3W8I A;  3NYL A;  5DLJ A;  2IM8 A;  1YYX A;  2E87 A;  3FHD A;  4J32 B;  3KH2 A;  2VAS A;  3C8Z A;  4MVS A;  4IB4 A;  4MQ9 F;  1TR2 A;  3B29 A;  1XWJ A;  1LS1 A;  4HE8 D;  1MMD A;  3S9O A;  3CAX A;  2J9V A;  3BRJ A;  3LJB A;  2EPN A;  2XS1 A;  3EGX A;  2CGE A;  4ZLD A;  2J0W A;  4N6C A;  4O6Y A;  3R2P A;  1JMW A;  5KYW B;  3K33 A;  4K7B A;  2UUI A;  2WZF A;  4IJJ A;  2XLM A;  3CQZ A;  1I4Z A;  2L6F A;  4JJF A;  5COG A;  1PCX A;  2YRF A;  1MNE A;  5L0I A;  2O9X A;  1V54 C;  2LK4 A;  5B1B C;  4U5C E;  1U89 A;  2XLD A;  4U9D A;  3X2Q C;  1VMA A;  5L0C A;  3DE9 A;  4JJG A;  1AEP A;  3TJ6 A;  4MVR A;  1E86 A;  1Q0K A;  2Y3B A;  5DQZ A;  2HMZ A;  3RYL A;  3HLZ A;  4IWB A;  3RKO F;  1ZW3 A;  4JVS A;  4BJ5 C;  3SP1 A;  3DWW A;  4JZA A;  1VYI A;  2P7V A;  1EI7 A;  1HMO A;  1APC A;  1TFO B;  3O10 A;  2IXN A;  4DBQ A;  256B A;  2OJE D;  3MFN A;  3SZR A;  3RQF A;  1NFO A;  2H7O A;  1QLE C;  2XSE A;  4ULV A;  3C8G B;  2R7O A;  4PFP A;  5BUO A;  1QZX A;  5KYX A;  1VB5 A;  2B0J A;  3LUT B;  2YLD A;  4F4B A;  4HFF B;  2AVK A;  1ZHY A;  2W45 A;  5E2Q A;  1ZHZ A;  5FCL A;  1M6T A;  4IRU A;  3U8P A;  4JIO A;  1LI7 A;  2YHS A;  1BR1 A;  1WAS A;  3M4C A;  3HNK A;  2YLI A;  3AG2 C;  3IPM O;  1LI5 A;  5HSW A;  2X51 A;  5CI9 A;  1C03 A;  4EWC A;  1K05 A;  1C02 A;  2YL0 A;  3EG9 A;  5JS5 A;  1YDI A;  1IW7 F;  1A7E A;  2KYH A;  4W8P A;  2FFH A;  4E0H A;  4E7Z A;  1NG1 A;  3ABM C;  2QLA A;  2KNH A;  2PF4 E;  1E85 A;  1QSP A;  2DYS C;  3IQ5 A;  2V3C C;  2NUT B;  1A7V A;  4U5H A;  1R5I D;  5EK0 A;  1ZHT A;  1MMG A;  2VCA A;  3UMH A;  4BJT A;  4C3B A;  1SMY F;  1DOV A;  1VYK A;  2NUP A;  2XS8 A;  2ZXP A;  2OKU A;  4MW8 A;  4XQ1 A;  2I15 A;  4HEA J;  4KC9 A;  3RVZ A;  1OW8 A;  1FFT C;  2R7S A;  1W2W A;  1NU7 D;  1OR3 A;  2KGO A;  4DRH B;  2L7A A;  4MVZ A;  4K1O A;  3GWN A;  2R7R A;  1WGW A;  3HTK C;  4OIO F;  3OEO A;  2EIL C;  4U5F E;  3T6B A;  2X0C A;  5JSL A;  3PCV A;  4GQH A;  1S7Z A;  4YJW A;  3W2W A;  3ASN C;  4G78 A;  2ETS A;  2PX3 A;  2PX0 A;  1Z3I X;  1T6Q A;  3E9V A;  3AJM A;  3L8J A;  4IAQ A;  4JKV A;  1C17 M;  4U5E E;  4JTA B;  3RQE A;  4EKW A;  3WAQ A;  4FAP B;  3L8I A;  4C3E A;  5KYW A;  3EHN A;  2L81 A;  5IY5 C;  1RJ9 B;  4IGG A;  4B6I A;  2CCY A;  3AGU A;  3SXM A;  4H54 A;  3LES A;  1DOW A;  1WAT A;  2R02 A;  3O39 A;  1D1A A;  1U6H A;  2C04 A;  2R25 A;  3C7J A;  4DXW A;  3CEX A;  3G50 A;  3DAG A;  4GEH A;  4R32 A;  4BJ5 A;  2XM0 A;  2ZXR A;  3GOR A;  5CIV A;  4PK4 A;  1JPJ A;  4JRZ A;  1E2X A;  3JCU Q;  5F5H A;  4OIP F;  4Z9H A;  2JD3 A;  4D4X A;  3GEI A;  1MMN A;  3IQ6 A;  4JEB A;  3NKE A;  1TKN A;  2HJM A;  4EBK A;  4HFK B;  3N2Z B;  2GWW A;  3KKB A;  4JCZ A;  3S90 A;  2OEX A;  2A0U A;  2XL8 A;  3S28 A;  3C18 A;  4A4A A;  2XLE A;  3K1I C;  5B1A C;  1EKY A;  2J8W A;  1ORY A;  3FAP B;  1QVX A;  3MYI A;  5T1D B;  2YL7 A;  5KYN A;  3DI5 A;  1V4A A;  3LEO A;  2HV7 A;  5E3C A;  2DGJ A;  4MVQ A;  1K40 A;  1RKE B;  3NRH A;  4WGY A;  4GYT A;  3SEO A;  3N24 A;  3HKK A;  2EPL X;  2R7W A;  4M63 A;  5T3W A;  2GFH A;  1FAP B;  3ZIB A;  1LPE A;  4EBB A;  4L6R A;  4P6I C;  3V7O A;  5L3Q A;  5TJ5 E;  2Q7R A;  4DBR A;  1KTM A;  3T9O A;  3UMI A;  2LP4 A;  1OKK A;  3JRM O;  5A6B A;  2H7B A;  2Y3H A;  3GM2 A;  4J7T A;  1TQG A;  2J7P D;  3HNJ A;  4NY3 A;  4RDA A;  3JSE O;  4EHP A;  1H6G A;  1OCO C;  4G7H F;  5L0H A;  2OQM A;  1NSG B;  1PD1 A;  2L6H A;  1RKC A;  1WTY A;  3K6B A;  4CJO A;  4CDV A;  4DOZ A;  3S84 A;  2YEV A;  4CSA C;  3L1M A;  1BBH A;  1I4Y A;  1LIH A;  1YZC A;  2UUH A;  1Z7Q c;  1J8Y F;  2NPU A;  3GOD A;  3EPV A;  3O55 A;  3VRC A;  1SR2 A;  1G8X A;  4JTC B;  4BG0 A;  1D1C A;  3S29 A;  1E84 A;  2WVQ A;  5A6J A;  3JYH A;  4H4K C;  4NTF A;  1BR4 A;  3NG1 A;  1ZHW A;  2OOC A;  1LKX A;  2KC3 A;  2BE5 F;  1F1M A;  2YVK A;  3S0X A;  2AP3 A;  2J9B A;  5A6K A;  5BQG A;  3E70 C;  1HMD A;  3U3F A;  4Q5S F;  1B68 A;  2R7V A;  1Z23 A;  2FAP B;  3JRT A;  1WWP A;  3JYY A;  1Q0F A;  3QVZ A;  4Q7C A;  5COM A;  5BQH A;  3GM3 A;  2KSF A;  1Y6D A;  1FMW A;  1O3U A;  2IOQ A;  4XEV A;  4DVY P;  2NSG A;  4MS2 A;  4OD5 A;  1YAU O;  5E33 A;  5JLI A;  4FWV A;  3SXZ A;  5A69 A;  5HV9 A;  2R7T A;  2EIK C;  3M79 A;  5AC4 A;  5F28 E;  4MND A;  3Q7G A;  1E83 A;  3AG4 C;  1NLX A;  3AQB A;  2XL4 A;  2Q4F A;  2EIM C;  2ZXW C;  3K7D A;  4IAO A;  4OD4 A;  4LDK A;  3RQG A;  4CS7 A;  4Z9J A;  4O79 A;  5DS6 A;  4QI2 A;  4PJJ A;  5DQT A;  3T6J A;  5EHH A;  2QE9 A;  3M4B A;  4LAC B;  4NTB A;  2RSE B;  2M4E A;  4XTK A;  5JVE A;  4DJ9 A;  1GS9 A;  1J8M F;  2KK1 A;  3NDB B;  3K1I A;  3KMI A;  1M2V B;  3MX3 A;  4WGZ A;  3VF0 A;  4AX2 A;  1MND A;  4AL0 A;  5DS5 A;  2Y3G A;  1H9T A;  1TWA A;  4OIR F;  3ZWI A;  3G4X A;  3ABK C;  5BQI A;  1ZU4 A;  3LLI A;  3VAY A;  3ZC4 A;  1JR8 A;  2A69 F;  2W4M A;  4NCQ A;  4N6H A;  2Y3D A;  1OQC A;  3VYW A;  1O87 A;  4YT4 A;  2GDC A;  3DZA A;  1Z6A A;  3DJN B;  2XRH A;  4C7O B;  3A11 A;  2IXM A;  2LD6 A;  3WHN A;  2B0H A;  3AQC A;  1HE1 A;  2C03 A;  3BEH A;  3C63 A;  3AG1 C;  3U2L A;  1LE2 A;  3KPH A;  3U9J A;  5L0D A;  1H7I A;  2HFI A;  2LSE A;  2PNO A;  1CGN A;  1GQA A;  1SYQ A;  3GM1 A;  3FXH A;  5GPG B;  1ZVZ A;  2I8B A;  2CNW A;  1M56 C;  4MTO A;  3TD7 A;  3ZVR A;  5L0G A;  2CDQ A;  3JT1 A;  3EJN A;  3EFO B;  3RF3 A;  2V26 A;  5B3I A;  1NBB A;  2Z15 A;  3NYJ A;  1ORS C;  4JEA A;  2PBE A;  2KJG A;  3H2V A;  4NC3 A;  4AE4 B;  4CSA A;  1NZE A;  4AK9 A;  3JZ0 A;  2AU5 A;  4FX5 A;  4P9F A;  4LER A;  1ZYR F;  2R7X A;  2ZD9 A;  4O7G A;  5EGY A;  4BJ6 C;  4ONS A;  3HNL A;  2QNL A;  1KNY A;  2A6E F;  3IHU A;  3GEE A;  2OEV A;  2YLG A;  4KBL A;  4E7S A;  1FNT c;  3CSK A;  4J7Y A;  3B0U X;  2QUP A;  1EA8 A;  3HNI A;  1YAR O;  3QW1 A;  1XZP A;  2CW0 F;  2HZ8 A;  1UFB A;  3ZQV A;  1CGM E;  2OJQ A;  3LS0 A;  2OG2 A;  3I4U A;  1ORJ A;  2HJ3 A;  4U5G A;  4OIN F;  2NSF A;  4MTG A;  5JP7 A;  3I5Q A;  4BJ1 A;  3DM5 A;  2D5R B;  2XL6 A;  1D0Z A;  3US6 A;  1RCP A;  2DYR C;  2LIG A;  5CI8 A;  4ANJ A;  3K1H A;  1Q0D A;  4QI0 A;  2XXA B;  3B0V C;  4FES A;  3SYN A;  3L34 A;  3V5Z A;  1AVO B;  1CPR A;  2Q9B A;  3C8G A;  3EGD B;  1JAF A;  3QZC A;  3PHF 2;  2JPU A;  5F5F A;  3L0I A;  4QDL A;  4G7O F;  1NFN A;  3J06 A;  3RH3 A;  1R4T A;  1QQ3 A;  1CPQ A;  1V74 B;  1VK5 A;  3PMR A;  4LLC A;  4U5B E;  2XM4 A;  2A1D D;  2HSQ A;  3AGT A;  1PD0 A;  5T3T A;  1L3P A;  3O6X A;  4I1O B;  3ZDL A;  1FMV A;  4YT2 A;  4Q4Z F;  5E3A A;  4O6N A;  2PFD A;  2J0X A;  4PJL A;  1HW2 A;  5JT4 A;  1LM3 B;  1AUE A;  2GA0 A;  4ULW A;  1YLM A;  2Y39 A;  3FVY A;  3U3B A;  1A41 A;  4PJN A;  4MW3 A;  5COF A;  2R03 A;  3EG9 B;  3Q7L A;  3QTH A;  3AG3 C;  2HV6 A;  5KYY B;  1HY5 A;  4DRJ B;  4WJ0 A;  4IAR A;  1M2V A;  1TWH A;  3R7C A;  4EIY A;  2VCB A;  1TFK B;  2Q9C A;  2W9Y A;  2AWY A;  2AWC A;  3W2V A;  2WZG A;  1OR2 A;  3QVY A;  1D0Y A;  1U0B B;  1VLS A;  2NUT A;  2H7V C;  4CBE A;  1Y4C A;  3EQL F;  1ZHX A;  3LLK A;  3UR3 C;  1OCC C;  5JRA A;  3VM6 A;  1GGQ A;  1MMA A;  3KYI A;  3OWT A;  2QY9 A;  2NUP B;  3JSZ A;  2ICW G;  1Z63 A;  2OU6 A;  4C7O A;  2W4B A;  2HSB A;  1HW1 A;  5D91 A;  1V55 C;  3NMK A;  4PFO A;  1BZ4 A;  2WVO A;  2H8A A;  1YVI A;  3K66 A;  3ZQY A;  1JRA A;  4I44 A;  4CS8 C;  3MYF A;  1OKK D;  5A6B D;  2HMQ A;  1RXQ A;  2WL8 A;  4OIQ F;  3EFO A;  3SNH A;  2FGY A;  4JUR I;  2J9U A;  3TK0 A;  4BPM A;  1ST6 A;  2IYL D;  4MTF A;  3ZTZ A;  4CIH A;  2G62 A;  2A68 F;  3IQC A;  1OCR C;  3POV A;  1EQ1 A;  2J9W A;  2ZPA A;  4AE4 A;  4BEJ A;  1H9G A;  3DXJ F;  2GAQ A;  4RD9 A;  4XEK A;  2IBF A;  5DS4 A;  2P1A A;  1G4U S;  3W4Y A;  1SZI A;  2OCC C;  3LS1 A;  1RJ9 A;  3IQT A;  3UNG C;  4BJ6 A;  4BEM J;  4DRI B;  4XEF A;  2P0N A;  3DM9 B;  1M2O A;  3DKA A;  3RIP A;  1A7D A;  3DJU B;  3LEV A;  5AC5 A;  3ZG1 A;  2A0B A;  4PR9 A;  2LCH A;  3ZTM A;  1GM5 A;  2EIN C;  2KW3 C;  5DVW A;  3MBG A;  2M64 A;  1TWG A;  3TUL A;  3DD7 A;  3B0P A;  4WAB A;  2DI3 A;  4JTD B;  2TMV P;  3B9Q A;  4ER9 A;  3DAF A;  1L7C A;  2MWQ A;  3RW0 A;  4ZLC A;  2XXA A;  2QTV A;  4YT8 A;  2LQG A;  3UGO A;  3S27 A;  2Q3T A;  3HJC A;  1CGO A;  2P6V A;  1G4W R;  3N0T A;  1Q0M A;  2HS5 A;  4CS9 C;  3EGD A;  3EH1 A;  3F47 A;  4X0R A;  3ZSU A;  5L0F A; 
#chains in the Genus database with same CATH homology
 5L0J A;  1RKC A;  4IGG A;  3TJ5 A;  1T01 A;  1DOV A;  3MYI A;  4ONS A;  5L0I A;  2HSQ A;  2GDC A;  4PR9 A;  1DOW A;  4E17 A;  1U89 A;  3H2U A;  1U6H A;  3ZDL A;  1RKE A;  5L0C A;  2B0H A;  1RKE B;  2L7A A;  3T6G B;  3TJ6 A;  5L0D A;  4K1O A;  4P9T A;  3VF0 A;  4E18 A;  1SYQ A;  5FZT A;  1L7C A;  1ZVZ A;  1YDI A;  5L0H A;  2X0C A;  1ZW3 A;  5L0G A;  1ST6 A;  1ZW2 A;  3RF3 A;  4W8P A;  2LQG A;  4DJ9 A;  1TR2 A;  1XWJ A;  2GWW A;  4EHP A;  3H2V A;  1QKR A;  1H6G A;  3S90 A;  2IBF A;  5L0F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...