2HSQA

Human vinculin (head domain, vh1, residues 1-258) in complex with shigella's ipaa vinculin binding site 2 (residues 565-587)
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
266
structure length
261
Chain Sequence
b'MEHHHHHHMPVFHTRTIESILEPVAQQISHLVIMHEEKAIPDLTAPVAAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVEKMSAEINEIIRVLQLTSWDEDAW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vinculin
molecule tags Cell adhesion, structural protein
source organism Homo sapiens
publication title Shigella applies molecular mimicry to subvert vinculin and invade host cells.
pubmed doi rcsb
total genus 94
structure length 261
sequence length 266
ec nomenclature
pdb deposition date 2006-07-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 2hsqA02
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 2hsqA01
3H2UA 5L0GA 1T01A 1YDIA 2B0HA 1TR2A 5L0FA 1U89A 3S90A 3ZDLA 1QKRA 3RF3A 2IBFA 4E17A 3TJ6A 1ZVZA 2X0CA 4K1OA 5L0JA 1L7CA 3VF0A 1RKEB 4E18A 1ZW3A 4W8PA 3TJ5A 1SYQA 2HSQA 5L0IA 4PR9A 1RKCA 4EHPA 1U6HA 2L7AA 4P9TA 3T6GB 1H6GA 4DJ9A 5L0DA 5FZTA 2GWWA 1ST6A 3MYIA 4IGGA 3H2VA 1DOWA 1DOVA 2LQGA 1ZW2A 1RKEA 2GDCA 5L0HA 1XWJA 5L0CA 4ONSA
chains in the Genus database with same CATH superfamily
2YWAA 3ZTMA 3AGTA 1R5ID 1PD0A 2R7SA 4RD9A 2CDQA 2KK1A 1Q0FA 1T5OA 1T6UA 4LDRA 2A6EF 2XLHA 4I1OB 4E17A 2VC9A 3EQLF 1AVOB 5KYNA 4G78A 3LNMB 1OCRC 3K1HA 3T4RA 2R7UA 2IYLD 3DI5A 3TK0A 4PFPA 1CGME 2W4MA 3HLZA 1WWPA 3FAJA 4EBKA 2W9YA 1QQ3A 4HE8D 5B1BC 2GWWA 4E7ZA 2V3CC 5JP7A 2EPMX 4MVQA 3GEIA 3AJMA 2P6VA 2NPUA 3W8HA 1A7VA 4YL1A 1O5HA 4JW1A 3NKEA 4CS9C 4DBRA 2J45A 4JVSA 3G4XA 3MFNA 3OEOA 5D91A 3M15A 3T9OA 4MVMA 2DYSC 2Q4FA 2E87A 2YRFA 3B9QA 2WB7A 2X51A 1A0BA 2B0JA 3VRCA 2PFDA 2G62A 4IRUA 1G4US 2YKZA 4FESA 2HJMA 2VCAA 2CNWD 3JSEO 4OIQF 1GQAA 4JTAB 4YT5A 1TFKB 4IAQA 2EIMC 5L0DA 2NUPB 4NTBA 2YLIA 4K0DA 5L0FA 5KYXB 1M2VA 2EPOA 3QTHA 4LDKA 3DAFA 4PK4A 4U5EE 4KNVA 1B68A 3ECSA 4DRIB 1E83A 3LLKA 4ULWA 1BBHA 3CEXA 1XWJA 4K1OA 4BJ5A 1O3UA 2I8BA 3EG9A 3NYMA 3RVYA 4ANJA 2EINC 4MW3A 1Z63A 5JUAA 3K6BA 2ZXWC 2MWQA 2XLVA 2YEVA 5AGFA 3S90A 4AE4B 1TKNA 2AWCA 3DM5A 5BQHA 1R4TA 3HNJA 1VB5A 1L7CA 3VF0A 1RKEB 3EGXB 1I4ZA 2NSGA 2LCHA 2OEXA 4I1MA 4PR9A 4EHPA 1NZEA 1LVKA 4MVZA 1E84A 3NRHA 3B71A 1SZIA 1D0XA 1NSGB 2YVKA 2JX0A 1LPEA 3LS0A 4I44A 3V5YA 3VAYA 1YA9A 5DQTA 3DWWA 4MS2A 1OQCA 3C18A 4OIRF 4CJGA 1LS1A 3KYIA 1HW2A 4FAPB 2CNWA 1SR2A 2LQGA 2LFDA 2FAPB 2YLGA 3JTLO 2KC3A 1CPRA 3B0VC 1C17M 1H9TA 5K0IA 3U3FA 1PD1A 4C3BA 2GA0A 4HFFB 2IOQA 4U5DE 3EGDA 3ZSUA 2R25A 3R2PA 3RQGA 3I4UA 1J8MF 1NBBA 4JEBA 3O55A 3ZQYA 3X2QC 1RMVA 4BG0A 2YZSA 1F1MA 3GANA 1RJ9B 4XPYA 1E86A 4MVOA 1FTSA 3W2VA 2D5RB 2OU6A 1YARO 3KPHA 5FZTA 2Q7RA 4MNDA 4CDVA 1EA8A 1OW8A 4J7TA 3JYYA 3C7JA 3BEHA 1DOVA 3C8GD 3NMJA 4YT4A 4EUKB 3LS1A 5L0GA 4Q5SF 4JC7A 2C03A 1XZQA 1OW6A 2ZD9A 5T1DB 1M2VB 4AK9A 3G50A 3UMHA 2A69F 3F47A 4BJ6A 1D1BA 3US6A 1ZHXA 3A11A 5L0JA 4JCZA 4XPWA 2CCYA 2OKUA 1T6IA 5L0IA 1ZU4A 5FCLA 4RDAA 2CYDA 4C3DA 3FDQA 1BR4A 1V4AA 1TWCA 2EPKX 3T6GB 1OCCC 2LD6A 1FR0A 3GORA 3EFOA 3VYWA 1EI7A 2XS1A 3B29A 1I5NA 3Q6NA 3IQ6A 3SXZA 2ICWG 2NSFA 3NYLA 4XEFA 3Q6MA 1IZMA 4Q4ZF 3M1CB 5EGYA 2J9UA 1D1AA 4N4WA 5COMA 2A6HF 2LK4A 4B6IA 3IPMO 2A0UA 1ZZPA 1T01A 5F28E 2J9VA 2MHRA 4ZLCA 1GM5A 1QKRA 2A1DD 4J7YA 1N1CA 5B3SC 4OIPF 4IARA 3DD7A 3JCUQ 1ZHWA 4E18A 2YL0A 3RQFA 2H7BA 1LE2A 2XM4A 4U9DA 2J8WA 4JIOA 4P6IC 3SZRA 3ASNC 1NLXA 3DM9B 3EGDB 1JMWA 4BJTA 4XLPF 1TFOB 2XL8A 1OR3A 3FHDA 4IJJA 1OW7A 3NYJA 1OKKA 4FWVA 1IW7F 4U5CE 3SNHA 3PHF2 2W4BA 3DAGA 4O6YA 4KI2A 3IQ5A 2HSBA 2HKVA 4QDLA 3KMIA 4ULVA 1T9KA 2ZXRA 1ORYA 2YQYA 3IHUA 2AP3A 3O39A 2HUJA 3GEHA 2FGYA 1MNDA 5DVWA 1WOLA 2XXAA 4YT8A 2PNOA 3K66A 2XSEA 1YJGA 2WVQA 2IXOA 2J7PD 2HMZA 3EPVA 4DOZA 2R7TA 3NG1A 3V7OA 1ZHZA 4ZLDA 1SYQA 1G8XA 2HSQA 1D0YA 1OCZC 2IM8A 2HS5A 1LIHA 2ZPAA 4EWCA 2GFHA 1NFOA 3L8JA 3CQZA 3WAQA 3KH2A 1APCA 3TQOA 3MLGA 5KYYA 4DJ9A 1LKXA 3MX3A 1O87A 2MYSA 3FMSA 3JT1A 1VK5A 2Y3DA 3MYIA 3RVZA 4MW8A 4PFOA 1CGOA 4C7OB 2OG2A 5A6BA 1HY5A 2J9WA 4RBNA 5L0HA 5A6AA 4GYTA 2KGOA 2JPUA 1K04A 4P9FA 3UMKA 4CS7A 4D4XA 3H65A 3EFOB 4EBJA 1ORSC 4EKWA 3NDBB 1JR8A 2ETSA 1QSPA 3MBGA 2LSEA 2XL4A 3SP1A 4BEMJ 2RD9A 2XS8A 4CJOA 2Q9CA 3RF3A 2YHSA 2XLOA 1LM3B 1OR2A 2HFIA 5GPGB 3RW0A 1G4WR 2Z15A 3V5ZA 2R7RA 1KU2A 3K1IC 2OOCA 4XEVA 5CIVA 4W8PA 1EQ1A 3AQBA 1JOGA 3GM2A 3DZAA 2XL6A 5A6JA 1BZ4A 1OKKD 4C7OA 2F22A 1UFBA 1UG7A 1FFTC 4G7ZF 4O6NA 3ATPA 4LACB 2UUHA 4XTKA 1QPUA 2DYRC 3KKBA 5JRAA 4YL0A 1VTMP 3HNKA 2P61A 4HEAJ 1ST6A 2J0WA 3GODA 3O6XA 3L8IA 4NCQA 3HKKA 4A2NB 1Q0KA 1G5ZA 4JZAA 3J06A 4G0HA 3HNLA 5T3TA 2LIGA 2J9BA 4WABA 3SYNA 2G3VA 2QLAA 3WHNA 1I4YA 4CIPA 1GS9A 3U8PA 1OXBA 1YZCA 3ASOC 4I3MA 3W4YA 1FMWA 5TJ5E 4E7SA 1YZAA 2OJED 1M2OA 2Q00A 2R02A 4LLCA 1MMNA 5EK0A 2XM0A 2R7WA 2R7QA 4U5FE 4N06A 4QI2A 2H7OA 4M63A 5DLJA 3S84A 1RXQA 4K7BA 1EKYA 2BL2A 1ORJA 1V74B 3QVYA 4WJ0A 3L34A 3B0UX 1NU9C 5CI8A 2EPLX 2M4EA 4JJGA 4YL3A 2IXMA 2HV7A 5KYUB 1YYJA 4A4AA 3HTKC 5DS6A 2C04A 1LS4A 3ABKC 3K7DA 3N24A 4NY3A 3I5PA 3S27A 5KYYB 3NMIA 3IQTA 1WGWA 3ZTZA 1S05A 3FAPB 2IXNA 4YK5A 1FAPB 1FNTc 2DB4A 3M4BA 3TD7A 3AGUA 3TJ6A 2Y3GA 4PJNA 3C8ZA 1WATA 1MMAA 1YAUO 1Z7Qc 1D0ZA 4JTDB 3LNRA 3Q7LA 4U5HA 5KYUA 1AEPA 4OD4A 1RKCA 4KNWA 4U9EA 2R7OA 4KBLA 3ZVRA 3X1OA 3ABLC 1QZXA 2EPNA 2KSFA 4WGYA 3AG2C 2WZLA 3EGXA 3HNIA 5COFA 2KQ9A 2M64A 3S9OA 3GEEA 1MMDA 3B0PA 5EHHA 1HE9A 3JYHA 3AQCA 3JRTA 5DS4A 1RCPA 3N2ZB 4LLEA 2P1AA 2Y69C 5BQIA 4MVRA 3F46A 4QI0A 1MMGA 1YDIA 2HMQA 1TR2A 2D4UA 4MTOA 5BUOA 1HW1A 3FOOA 3SXYA 1VMAA 4YN0B 3ZG1A 4EIYA 4ER9A 5L3VA 2QTVA 2NUPA 3PCVA 4BJ1A 2VCCA 1C03A 1K40A 3AOUA 4JRZA 5KYXA 4JE9A 3L1MA 4LDQA 4G7HF 2VCBA 3K1IA 3S28A 1Z6AA 1Z3IX 4JJFA 1HMOA 2L7AA 2YLDA 4BJ6C 4YJWA 3PDMP 2L6GA 2EILC 3EHNA 4OINF 1Y4CA 2A68F 3JZ0A 4JEAA 3C63A 5F5HA 2LP4A 1JRAA 2WVOA 3EHMA 1V54C 1RJ9A 1TQGA 3GWLA 3E70C 3KL4A 2J7PA 1Z5ZA 1RKEA 2ASRA 2R03A 3Q7GA 2VB6A 4IWBA 4Q7CA 3VM6A 3WODF 4DRJB 2TMVP 1WTYA 1YA7O 1TWAA 1LI5A 1YVIA 2PP4A 2H8AA 4NTFA 2DGJA 1YYXA 5E3CA 4W8KA 3LJBA 1KNYA 1Z23A 1ZHTA 5D92A 3DJUB 3K33A 4O7GA 4F4BA 4YT2A 2JD3A 3CAXA 2P0NA 3DE9A 2WL8A 1Q0DA 4MTGA 1A7DA 2PF4E 2OQMA 3LEOA 1GGQA 3S29A 1VYIA 3FVYA 1C02A 5BQGA 2PX0A 3EH1A 3UMIA 2A0BA 2XLEA 5AC5A 1QLEC 2R05A 4Z9HA 1E2XA 4IB4A 3U2LA 5KYWB 3FOPA 1M57C 2RSEB 3T6BA 1H9GA 4JTCB 4JCHA 1Q0MA 1CGNA 1H6GA 1PV3A 2KYHA 2R9RB 4LERA 4NTAA 3ZC4A 1VYKA 3DKAA 2EIJC 3C8GA 4WGZA 1J8YF 3V5XA 4CIHA 1TWGA 1KTMA 3SEOA 1WASA 1MQVA 3BRJA 2W45A 2VASA 2QNLA 4IGGA 3R7CA 1JAFA 3U0CA 1W2WA 1QVXA 2Q9AA 1SF8A 2QY9A 4J32B 2OEVA 1MNEA 3M79A 3H2UA 3T6JA 5DQZA 2XLWA 4CS8A 5A6KA 5KYWA 5JSLA 4DRHB 4JKVA 2Q3TA 4PJMA 2R7XA 2NUTA 3RKOF 3U8VA 1L3PA 2L6HA 2ZXOA 4OD5A 4DVYP 1ZU5A 5B1AC 1ZVZA 3GM3A 3C8GB 3U3BA 4XWJA 3ZIBA 3TJ5A 3HJCA 1M6TA 3LAYA 4U5GA 4CDYA 3U9MA 3EG9B 2H7VC 3EZHA 3UGOA 3QW0A 4P9TA 1FMVA 2L6FA 3NKDA 3QMKA 4MVSA 4AE4A 3A9CA 1M56C 3RYLA 3AG4C 3RIPA 2BC5A 4CS8C 1FFHA 1HMDA 2WZFA 3SXKA 4YWQA 1A7EA 5COGA 4BJ5C 4CX9A 4C3EA 1ZHYA 5E33A 3UR3C 1ZYRF 1DOWA 2PX3A 5L3QA 4NC3A 4NQFA 4U5BE 4N6CA 4EBBA 3M4CA 5L0CA 4G7OF 3WG7C 2G3KA 4XEKA 5A69A 3OA1A 5E2QA 1T6QA 2Q9BA 2QE9A 2VH3A 3ZDLA 3OWTA 2EIKC 1BDJB 2LFFA 4HFKB 3RFYA 4KC9A 4UDVA 3LESA 1H7IA 3N0TA 2V26A 5JVEA 4IAOA 4E0IA 3EJNA 3JSZA 5B3IA 4MQ9F 4GEHA 3AG3C 3TULA 3I5QA 2XLDA 2R7VA 1AUEA 1TWHA 4L6RA 3FXHA 3C62A 2OCCC 3KYJA 3QW1A 1LI7A 2FFHA 1A41A 3EZIA 4D4NA 1XZPA 2XRHA 1JPJA 1BR1A 3AG1C 3GM1A 4XQ1A 4DVZA 2KNHA 3RH3A 5HSWA 3GWNA 4XLNF 3DJNB 4CS9A 3H2VA 3DMDA 2HV6A 2QUPA 4X0RA 1LE4A 4AL1A 3MYFA 3UGPA 1E85A 2KJGA 4ONSA 2XLMA 3QVZA 3U9JA 3S0XA 5HV9A 1U89A 1Q0GA 4DBQA 1HE1A 2KW3C 4CDAA 2YL3A 2WZGA 4Z9IA 1NFNA 4MVUA 2HZ8A 2X0CA 5F5FA 2Y3HA 3NMKA 3O10A 4R32A 2AU5A 2PBEA 1CPQA 3DXJF 4H54A 4PACA 4BEJA 2O9XA 3UNGC 3JRMO 2NUTB 3LLIA 2IXPA 4XPXA 3U5SA 4BPMA 5AC4A 3U2MA 4J30B 3ABMC 2XXAB 1Y6DA 2UUIA 3W8IA 3G4ZA 4CBEA 1NG1A 2J0XA 3LEVA 2CW0F 2P7VA 3IQCA 3SXMA 4CSAA 1ZW2A 4E0HA 2NG1A 1VLTA 1PCXA 1S7ZA 256BA 3PMRA 3ITFA 2HJ3A 4GQHA 4H4KC 4O6MA 3TOMA 2DI3A 1JPNA 2I15A 4Z9JA 2J46A 5JT4A 4DXWA 2CGEA 1U0BB 5T3WA 2B0HA 2L81A 1NU7D 2ZXPA 2GAQA 2Y39A 3DE8A 2IBFA 2L9JA 3TOLA 1SMYF 3W2WA 4O79A 5IY5C 1YLMA 4FX5A 1ZW3A 5DS5A 1OCOC 3LUTB 3QZCA 2BE5F 3EH2A 1K05A 1OXKA 3IEEA 4PJJA 5E3AA 4AX2A 5JS5A 2AVKA 3CSKA 4OIOF 1U6HA 2YL7A 2WVNA 3E9VA 3RQEA 2OJQA 4JURI 3CZ6A 1V55C 2Y3BA 5JLIA 5CI9A 3POVA 1VLSA 4PJLA 1D1CA 2YL1A 1VOMA 3L0IA 4CSAC 3ZQVA 4AL0A 2AWYA 2GDCA 3ZWIA 4MTFA 5A6BD 1WN0A 1BR2A 4N6HA
chains in the Genus database with same CATH topology
3H2UA 5L0GA 1T01A 1YDIA 2B0HA 1TR2A 5L0FA 1U89A 3S90A 3ZDLA 1QKRA 3RF3A 2IBFA 4E17A 3TJ6A 1ZVZA 2X0CA 4K1OA 5L0JA 1L7CA 3VF0A 1RKEB 4E18A 1ZW3A 4W8PA 3TJ5A 1SYQA 2HSQA 5L0IA 4PR9A 1RKCA 4EHPA 1U6HA 2L7AA 4P9TA 3T6GB 1H6GA 4DJ9A 5L0DA 5FZTA 2GWWA 1ST6A 3MYIA 4IGGA 3H2VA 1DOWA 1DOVA 2LQGA 1ZW2A 1RKEA 2GDCA 5L0HA 1XWJA 5L0CA 4ONSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H2U A;  5L0G A;  1T01 A;  1YDI A;  2B0H A;  1TR2 A;  5L0F A;  1U89 A;  3S90 A;  3ZDL A;  1QKR A;  3RF3 A;  2IBF A;  4E17 A;  3TJ6 A;  1ZVZ A;  2X0C A;  4K1O A;  5L0J A;  1L7C A;  3VF0 A;  1RKE B;  4E18 A;  1ZW3 A;  4W8P A;  3TJ5 A;  1SYQ A;  2HSQ A;  5L0I A;  4PR9 A;  1RKC A;  4EHP A;  1U6H A;  2L7A A;  4P9T A;  3T6G B;  1H6G A;  4DJ9 A;  5L0D A;  5FZT A;  2GWW A;  1ST6 A;  3MYI A;  4IGG A;  3H2V A;  1DOW A;  1DOV A;  2LQG A;  1ZW2 A;  1RKE A;  2GDC A;  5L0H A;  1XWJ A;  5L0C A;  4ONS A; 
#chains in the Genus database with same CATH topology
 2YWA A;  3ZTM A;  3AGT A;  1R5I D;  1PD0 A;  2R7S A;  4RD9 A;  2CDQ A;  2KK1 A;  1Q0F A;  1T5O A;  1T6U A;  4LDR A;  2A6E F;  2XLH A;  4I1O B;  4E17 A;  2VC9 A;  3EQL F;  1AVO B;  5KYN A;  4G78 A;  3LNM B;  1OCR C;  3K1H A;  3T4R A;  2R7U A;  2IYL D;  3DI5 A;  3TK0 A;  4PFP A;  1CGM E;  2W4M A;  3HLZ A;  1WWP A;  3FAJ A;  4EBK A;  2W9Y A;  1QQ3 A;  4HE8 D;  5B1B C;  2GWW A;  4E7Z A;  2V3C C;  5JP7 A;  2EPM X;  4MVQ A;  3GEI A;  3AJM A;  2P6V A;  2NPU A;  3W8H A;  1A7V A;  4YL1 A;  1O5H A;  4JW1 A;  3NKE A;  4CS9 C;  4DBR A;  2J45 A;  4JVS A;  3G4X A;  3MFN A;  3OEO A;  5D91 A;  3M15 A;  3T9O A;  4MVM A;  2DYS C;  2Q4F A;  2E87 A;  2YRF A;  3B9Q A;  2WB7 A;  2X51 A;  1A0B A;  2B0J A;  3VRC A;  2PFD A;  2G62 A;  4IRU A;  1G4U S;  2YKZ A;  4FES A;  2HJM A;  2VCA A;  2CNW D;  3JSE O;  4OIQ F;  1GQA A;  4JTA B;  4YT5 A;  1TFK B;  4IAQ A;  2EIM C;  5L0D A;  2NUP B;  4NTB A;  2YLI A;  4K0D A;  5L0F A;  5KYX B;  1M2V A;  2EPO A;  3QTH A;  4LDK A;  3DAF A;  4PK4 A;  4U5E E;  4KNV A;  1B68 A;  3ECS A;  4DRI B;  1E83 A;  3LLK A;  4ULW A;  1BBH A;  3CEX A;  1XWJ A;  4K1O A;  4BJ5 A;  1O3U A;  2I8B A;  3EG9 A;  3NYM A;  3RVY A;  4ANJ A;  2EIN C;  4MW3 A;  1Z63 A;  5JUA A;  3K6B A;  2ZXW C;  2MWQ A;  2XLV A;  2YEV A;  5AGF A;  3S90 A;  4AE4 B;  1TKN A;  2AWC A;  3DM5 A;  5BQH A;  1R4T A;  3HNJ A;  1VB5 A;  1L7C A;  3VF0 A;  1RKE B;  3EGX B;  1I4Z A;  2NSG A;  2LCH A;  2OEX A;  4I1M A;  4PR9 A;  4EHP A;  1NZE A;  1LVK A;  4MVZ A;  1E84 A;  3NRH A;  3B71 A;  1SZI A;  1D0X A;  1NSG B;  2YVK A;  2JX0 A;  1LPE A;  3LS0 A;  4I44 A;  3V5Y A;  3VAY A;  1YA9 A;  5DQT A;  3DWW A;  4MS2 A;  1OQC A;  3C18 A;  4OIR F;  4CJG A;  1LS1 A;  3KYI A;  1HW2 A;  4FAP B;  2CNW A;  1SR2 A;  2LQG A;  2LFD A;  2FAP B;  2YLG A;  3JTL O;  2KC3 A;  1CPR A;  3B0V C;  1C17 M;  1H9T A;  5K0I A;  3U3F A;  1PD1 A;  4C3B A;  2GA0 A;  4HFF B;  2IOQ A;  4U5D E;  3EGD A;  3ZSU A;  2R25 A;  3R2P A;  3RQG A;  3I4U A;  1J8M F;  1NBB A;  4JEB A;  3O55 A;  3ZQY A;  3X2Q C;  1RMV A;  4BG0 A;  2YZS A;  1F1M A;  3GAN A;  1RJ9 B;  4XPY A;  1E86 A;  4MVO A;  1FTS A;  3W2V A;  2D5R B;  2OU6 A;  1YAR O;  3KPH A;  5FZT A;  2Q7R A;  4MND A;  4CDV A;  1EA8 A;  1OW8 A;  4J7T A;  3JYY A;  3C7J A;  3BEH A;  1DOV A;  3C8G D;  3NMJ A;  4YT4 A;  4EUK B;  3LS1 A;  5L0G A;  4Q5S F;  4JC7 A;  2C03 A;  1XZQ A;  1OW6 A;  2ZD9 A;  5T1D B;  1M2V B;  4AK9 A;  3G50 A;  3UMH A;  2A69 F;  3F47 A;  4BJ6 A;  1D1B A;  3US6 A;  1ZHX A;  3A11 A;  5L0J A;  4JCZ A;  4XPW A;  2CCY A;  2OKU A;  1T6I A;  5L0I A;  1ZU4 A;  5FCL A;  4RDA A;  2CYD A;  4C3D A;  3FDQ A;  1BR4 A;  1V4A A;  1TWC A;  2EPK X;  3T6G B;  1OCC C;  2LD6 A;  1FR0 A;  3GOR A;  3EFO A;  3VYW A;  1EI7 A;  2XS1 A;  3B29 A;  1I5N A;  3Q6N A;  3IQ6 A;  3SXZ A;  2ICW G;  2NSF A;  3NYL A;  4XEF A;  3Q6M A;  1IZM A;  4Q4Z F;  3M1C B;  5EGY A;  2J9U A;  1D1A A;  4N4W A;  5COM A;  2A6H F;  2LK4 A;  4B6I A;  3IPM O;  2A0U A;  1ZZP A;  1T01 A;  5F28 E;  2J9V A;  2MHR A;  4ZLC A;  1GM5 A;  1QKR A;  2A1D D;  4J7Y A;  1N1C A;  5B3S C;  4OIP F;  4IAR A;  3DD7 A;  3JCU Q;  1ZHW A;  4E18 A;  2YL0 A;  3RQF A;  2H7B A;  1LE2 A;  2XM4 A;  4U9D A;  2J8W A;  4JIO A;  4P6I C;  3SZR A;  3ASN C;  1NLX A;  3DM9 B;  3EGD B;  1JMW A;  4BJT A;  4XLP F;  1TFO B;  2XL8 A;  1OR3 A;  3FHD A;  4IJJ A;  1OW7 A;  3NYJ A;  1OKK A;  4FWV A;  1IW7 F;  4U5C E;  3SNH A;  3PHF 2;  2W4B A;  3DAG A;  4O6Y A;  4KI2 A;  3IQ5 A;  2HSB A;  2HKV A;  4QDL A;  3KMI A;  4ULV A;  1T9K A;  2ZXR A;  1ORY A;  2YQY A;  3IHU A;  2AP3 A;  3O39 A;  2HUJ A;  3GEH A;  2FGY A;  1MND A;  5DVW A;  1WOL A;  2XXA A;  4YT8 A;  2PNO A;  3K66 A;  2XSE A;  1YJG A;  2WVQ A;  2IXO A;  2J7P D;  2HMZ A;  3EPV A;  4DOZ A;  2R7T A;  3NG1 A;  3V7O A;  1ZHZ A;  4ZLD A;  1SYQ A;  1G8X A;  2HSQ A;  1D0Y A;  1OCZ C;  2IM8 A;  2HS5 A;  1LIH A;  2ZPA A;  4EWC A;  2GFH A;  1NFO A;  3L8J A;  3CQZ A;  3WAQ A;  3KH2 A;  1APC A;  3TQO A;  3MLG A;  5KYY A;  4DJ9 A;  1LKX A;  3MX3 A;  1O87 A;  2MYS A;  3FMS A;  3JT1 A;  1VK5 A;  2Y3D A;  3MYI A;  3RVZ A;  4MW8 A;  4PFO A;  1CGO A;  4C7O B;  2OG2 A;  5A6B A;  1HY5 A;  2J9W A;  4RBN A;  5L0H A;  5A6A A;  4GYT A;  2KGO A;  2JPU A;  1K04 A;  4P9F A;  3UMK A;  4CS7 A;  4D4X A;  3H65 A;  3EFO B;  4EBJ A;  1ORS C;  4EKW A;  3NDB B;  1JR8 A;  2ETS A;  1QSP A;  3MBG A;  2LSE A;  2XL4 A;  3SP1 A;  4BEM J;  2RD9 A;  2XS8 A;  4CJO A;  2Q9C A;  3RF3 A;  2YHS A;  2XLO A;  1LM3 B;  1OR2 A;  2HFI A;  5GPG B;  3RW0 A;  1G4W R;  2Z15 A;  3V5Z A;  2R7R A;  1KU2 A;  3K1I C;  2OOC A;  4XEV A;  5CIV A;  4W8P A;  1EQ1 A;  3AQB A;  1JOG A;  3GM2 A;  3DZA A;  2XL6 A;  5A6J A;  1BZ4 A;  1OKK D;  4C7O A;  2F22 A;  1UFB A;  1UG7 A;  1FFT C;  4G7Z F;  4O6N A;  3ATP A;  4LAC B;  2UUH A;  4XTK A;  1QPU A;  2DYR C;  3KKB A;  5JRA A;  4YL0 A;  1VTM P;  3HNK A;  2P61 A;  4HEA J;  1ST6 A;  2J0W A;  3GOD A;  3O6X A;  3L8I A;  4NCQ A;  3HKK A;  4A2N B;  1Q0K A;  1G5Z A;  4JZA A;  3J06 A;  4G0H A;  3HNL A;  5T3T A;  2LIG A;  2J9B A;  4WAB A;  3SYN A;  2G3V A;  2QLA A;  3WHN A;  1I4Y A;  4CIP A;  1GS9 A;  3U8P A;  1OXB A;  1YZC A;  3ASO C;  4I3M A;  3W4Y A;  1FMW A;  5TJ5 E;  4E7S A;  1YZA A;  2OJE D;  1M2O A;  2Q00 A;  2R02 A;  4LLC A;  1MMN A;  5EK0 A;  2XM0 A;  2R7W A;  2R7Q A;  4U5F E;  4N06 A;  4QI2 A;  2H7O A;  4M63 A;  5DLJ A;  3S84 A;  1RXQ A;  4K7B A;  1EKY A;  2BL2 A;  1ORJ A;  1V74 B;  3QVY A;  4WJ0 A;  3L34 A;  3B0U X;  1NU9 C;  5CI8 A;  2EPL X;  2M4E A;  4JJG A;  4YL3 A;  2IXM A;  2HV7 A;  5KYU B;  1YYJ A;  4A4A A;  3HTK C;  5DS6 A;  2C04 A;  1LS4 A;  3ABK C;  3K7D A;  3N24 A;  4NY3 A;  3I5P A;  3S27 A;  5KYY B;  3NMI A;  3IQT A;  1WGW A;  3ZTZ A;  1S05 A;  3FAP B;  2IXN A;  4YK5 A;  1FAP B;  1FNT c;  2DB4 A;  3M4B A;  3TD7 A;  3AGU A;  3TJ6 A;  2Y3G A;  4PJN A;  3C8Z A;  1WAT A;  1MMA A;  1YAU O;  1Z7Q c;  1D0Z A;  4JTD B;  3LNR A;  3Q7L A;  4U5H A;  5KYU A;  1AEP A;  4OD4 A;  1RKC A;  4KNW A;  4U9E A;  2R7O A;  4KBL A;  3ZVR A;  3X1O A;  3ABL C;  1QZX A;  2EPN A;  2KSF A;  4WGY A;  3AG2 C;  2WZL A;  3EGX A;  3HNI A;  5COF A;  2KQ9 A;  2M64 A;  3S9O A;  3GEE A;  1MMD A;  3B0P A;  5EHH A;  1HE9 A;  3JYH A;  3AQC A;  3JRT A;  5DS4 A;  1RCP A;  3N2Z B;  4LLE A;  2P1A A;  2Y69 C;  5BQI A;  4MVR A;  3F46 A;  4QI0 A;  1MMG A;  1YDI A;  2HMQ A;  1TR2 A;  2D4U A;  4MTO A;  5BUO A;  1HW1 A;  3FOO A;  3SXY A;  1VMA A;  4YN0 B;  3ZG1 A;  4EIY A;  4ER9 A;  5L3V A;  2QTV A;  2NUP A;  3PCV A;  4BJ1 A;  2VCC A;  1C03 A;  1K40 A;  3AOU A;  4JRZ A;  5KYX A;  4JE9 A;  3L1M A;  4LDQ A;  4G7H F;  2VCB A;  3K1I A;  3S28 A;  1Z6A A;  1Z3I X;  4JJF A;  1HMO A;  2L7A A;  2YLD A;  4BJ6 C;  4YJW A;  3PDM P;  2L6G A;  2EIL C;  3EHN A;  4OIN F;  1Y4C A;  2A68 F;  3JZ0 A;  4JEA A;  3C63 A;  5F5H A;  2LP4 A;  1JRA A;  2WVO A;  3EHM A;  1V54 C;  1RJ9 A;  1TQG A;  3GWL A;  3E70 C;  3KL4 A;  2J7P A;  1Z5Z A;  1RKE A;  2ASR A;  2R03 A;  3Q7G A;  2VB6 A;  4IWB A;  4Q7C A;  3VM6 A;  3WOD F;  4DRJ B;  2TMV P;  1WTY A;  1YA7 O;  1TWA A;  1LI5 A;  1YVI A;  2PP4 A;  2H8A A;  4NTF A;  2DGJ A;  1YYX A;  5E3C A;  4W8K A;  3LJB A;  1KNY A;  1Z23 A;  1ZHT A;  5D92 A;  3DJU B;  3K33 A;  4O7G A;  4F4B A;  4YT2 A;  2JD3 A;  3CAX A;  2P0N A;  3DE9 A;  2WL8 A;  1Q0D A;  4MTG A;  1A7D A;  2PF4 E;  2OQM A;  3LEO A;  1GGQ A;  3S29 A;  1VYI A;  3FVY A;  1C02 A;  5BQG A;  2PX0 A;  3EH1 A;  3UMI A;  2A0B A;  2XLE A;  5AC5 A;  1QLE C;  2R05 A;  4Z9H A;  1E2X A;  4IB4 A;  3U2L A;  5KYW B;  3FOP A;  1M57 C;  2RSE B;  3T6B A;  1H9G A;  4JTC B;  4JCH A;  1Q0M A;  1CGN A;  1H6G A;  1PV3 A;  2KYH A;  2R9R B;  4LER A;  4NTA A;  3ZC4 A;  1VYK A;  3DKA A;  2EIJ C;  3C8G A;  4WGZ A;  1J8Y F;  3V5X A;  4CIH A;  1TWG A;  1KTM A;  3SEO A;  1WAS A;  1MQV A;  3BRJ A;  2W45 A;  2VAS A;  2QNL A;  4IGG A;  3R7C A;  1JAF A;  3U0C A;  1W2W A;  1QVX A;  2Q9A A;  1SF8 A;  2QY9 A;  4J32 B;  2OEV A;  1MNE A;  3M79 A;  3H2U A;  3T6J A;  5DQZ A;  2XLW A;  4CS8 A;  5A6K A;  5KYW A;  5JSL A;  4DRH B;  4JKV A;  2Q3T A;  4PJM A;  2R7X A;  2NUT A;  3RKO F;  3U8V A;  1L3P A;  2L6H A;  2ZXO A;  4OD5 A;  4DVY P;  1ZU5 A;  5B1A C;  1ZVZ A;  3GM3 A;  3C8G B;  3U3B A;  4XWJ A;  3ZIB A;  3TJ5 A;  3HJC A;  1M6T A;  3LAY A;  4U5G A;  4CDY A;  3U9M A;  3EG9 B;  2H7V C;  3EZH A;  3UGO A;  3QW0 A;  4P9T A;  1FMV A;  2L6F A;  3NKD A;  3QMK A;  4MVS A;  4AE4 A;  3A9C A;  1M56 C;  3RYL A;  3AG4 C;  3RIP A;  2BC5 A;  4CS8 C;  1FFH A;  1HMD A;  2WZF A;  3SXK A;  4YWQ A;  1A7E A;  5COG A;  4BJ5 C;  4CX9 A;  4C3E A;  1ZHY A;  5E33 A;  3UR3 C;  1ZYR F;  1DOW A;  2PX3 A;  5L3Q A;  4NC3 A;  4NQF A;  4U5B E;  4N6C A;  4EBB A;  3M4C A;  5L0C A;  4G7O F;  3WG7 C;  2G3K A;  4XEK A;  5A69 A;  3OA1 A;  5E2Q A;  1T6Q A;  2Q9B A;  2QE9 A;  2VH3 A;  3ZDL A;  3OWT A;  2EIK C;  1BDJ B;  2LFF A;  4HFK B;  3RFY A;  4KC9 A;  4UDV A;  3LES A;  1H7I A;  3N0T A;  2V26 A;  5JVE A;  4IAO A;  4E0I A;  3EJN A;  3JSZ A;  5B3I A;  4MQ9 F;  4GEH A;  3AG3 C;  3TUL A;  3I5Q A;  2XLD A;  2R7V A;  1AUE A;  1TWH A;  4L6R A;  3FXH A;  3C62 A;  2OCC C;  3KYJ A;  3QW1 A;  1LI7 A;  2FFH A;  1A41 A;  3EZI A;  4D4N A;  1XZP A;  2XRH A;  1JPJ A;  1BR1 A;  3AG1 C;  3GM1 A;  4XQ1 A;  4DVZ A;  2KNH A;  3RH3 A;  5HSW A;  3GWN A;  4XLN F;  3DJN B;  4CS9 A;  3H2V A;  3DMD A;  2HV6 A;  2QUP A;  4X0R A;  1LE4 A;  4AL1 A;  3MYF A;  3UGP A;  1E85 A;  2KJG A;  4ONS A;  2XLM A;  3QVZ A;  3U9J A;  3S0X A;  5HV9 A;  1U89 A;  1Q0G A;  4DBQ A;  1HE1 A;  2KW3 C;  4CDA A;  2YL3 A;  2WZG A;  4Z9I A;  1NFN A;  4MVU A;  2HZ8 A;  2X0C A;  5F5F A;  2Y3H A;  3NMK A;  3O10 A;  4R32 A;  2AU5 A;  2PBE A;  1CPQ A;  3DXJ F;  4H54 A;  4PAC A;  4BEJ A;  2O9X A;  3UNG C;  3JRM O;  2NUT B;  3LLI A;  2IXP A;  4XPX A;  3U5S A;  4BPM A;  5AC4 A;  3U2M A;  4J30 B;  3ABM C;  2XXA B;  1Y6D A;  2UUI A;  3W8I A;  3G4Z A;  4CBE A;  1NG1 A;  2J0X A;  3LEV A;  2CW0 F;  2P7V A;  3IQC A;  3SXM A;  4CSA A;  1ZW2 A;  4E0H A;  2NG1 A;  1VLT A;  1PCX A;  1S7Z A;  256B A;  3PMR A;  3ITF A;  2HJ3 A;  4GQH A;  4H4K C;  4O6M A;  3TOM A;  2DI3 A;  1JPN A;  2I15 A;  4Z9J A;  2J46 A;  5JT4 A;  4DXW A;  2CGE A;  1U0B B;  5T3W A;  2B0H A;  2L81 A;  1NU7 D;  2ZXP A;  2GAQ A;  2Y39 A;  3DE8 A;  2IBF A;  2L9J A;  3TOL A;  1SMY F;  3W2W A;  4O79 A;  5IY5 C;  1YLM A;  4FX5 A;  1ZW3 A;  5DS5 A;  1OCO C;  3LUT B;  3QZC A;  2BE5 F;  3EH2 A;  1K05 A;  1OXK A;  3IEE A;  4PJJ A;  5E3A A;  4AX2 A;  5JS5 A;  2AVK A;  3CSK A;  4OIO F;  1U6H A;  2YL7 A;  2WVN A;  3E9V A;  3RQE A;  2OJQ A;  4JUR I;  3CZ6 A;  1V55 C;  2Y3B A;  5JLI A;  5CI9 A;  3POV A;  1VLS A;  4PJL A;  1D1C A;  2YL1 A;  1VOM A;  3L0I A;  4CSA C;  3ZQV A;  4AL0 A;  2AWY A;  2GDC A;  3ZWI A;  4MTF A;  5A6B D;  1WN0 A;  1BR2 A;  4N6H A; 
#chains in the Genus database with same CATH homology
 3H2U A;  5L0G A;  1T01 A;  1YDI A;  2B0H A;  1TR2 A;  5L0F A;  1U89 A;  3S90 A;  3ZDL A;  1QKR A;  3RF3 A;  2IBF A;  4E17 A;  3TJ6 A;  1ZVZ A;  2X0C A;  4K1O A;  5L0J A;  1L7C A;  3VF0 A;  1RKE B;  4E18 A;  1ZW3 A;  4W8P A;  3TJ5 A;  1SYQ A;  2HSQ A;  5L0I A;  4PR9 A;  1RKC A;  4EHP A;  1U6H A;  2L7A A;  4P9T A;  3T6G B;  1H6G A;  4DJ9 A;  5L0D A;  5FZT A;  2GWW A;  1ST6 A;  3MYI A;  4IGG A;  3H2V A;  1DOW A;  1DOV A;  2LQG A;  1ZW2 A;  1RKE A;  2GDC A;  5L0H A;  1XWJ A;  5L0C A;  4ONS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...