2HSQA

Human vinculin (head domain, vh1, residues 1-258) in complex with shigella's ipaa vinculin binding site 2 (residues 565-587)
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
266
structure length
261
Chain Sequence
MEHHHHHHMPVFHTRTIESILEPVAQQISHLVIMHEEKAIPDLTAPVAAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVEKMSAEINEIIRVLQLTSWDEDAW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Shigella applies molecular mimicry to subvert vinculin and invade host cells.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion, structural protein
molecule keywords Vinculin
total genus 94
structure length 261
sequence length 266
ec nomenclature
pdb deposition date 2006-07-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 2hsqA02
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 2hsqA01
5FZTA 4E18A 4ONSA 1L7CA 5L0FA 5L0HA 4E17A 2GWWA 4P9TA 5L0IA 1H6GA 1U6HA 1XWJA 3H2UA 5L0JA 1ZW3A 5L0DA 2HSQA 4DJ9A 1QKRA 3TJ6A 1ST6A 5L0GA 3RF3A 2IBFA 3MYIA 1TR2A 1T01A 1ZVZA 1SYQA 3S90A 1RKEA 4IGGA 3TJ5A 2GDCA 4W8PA 1RKCA 2X0CA 1RKEB 1ZW2A 1DOWA 3T6GB 2B0HA 4EHPA 2L7AA 2LQGA 3H2VA 1YDIA 1U89A 4K1OA 4PR9A 1DOVA 3ZDLA 5L0CA 3VF0A
chains in the Genus database with same CATH superfamily
1BDJB 3EHNA 3R7CA 2PP4A 5A6AA 5AC4A 2HS5A 1OCOC 2LCHA 2HFIA 4LDRA 3SXZA 2CYDA 4EBBA 2QNLA 4BEMJ 2YWAA 2CNWA 5B3SC 1K05A 2C04A 3SEOA 4AL0A 2YL7A 2LFFA 1CGME 3H65A 4NCQA 3NMKA 2IXPA 1LE2A 1WASA 3GEEA 3MYFA 4EIYA 4OIPF 4E7SA 3B9QA 5B3IA 4Q5SF 1NFNA 2UUHA 4OIQF 3MLGA 2LK4A 1RKEA 2OU6A 1FAPB 2Z15A 3AG1C 2MWQA 2AU5A 3LS0A 1U0BB 5JP7A 2OKUA 4YT4A 1I4ZA 2NUTA 1KNYA 1LI7A 2B0HA 2KGOA 2R03A 2I15A 4D4NA 4PR9A 1YDIA 4O7GA 5AGFA 4OINF 4N6CA 1G8XA 4MTGA 5CIVA 1D1CA 2L6FA 3CAXA 3JYYA 4WGYA 3KL4A 4C7OB 3O10A 4YL3A 4EUKB 5KYYA 2EPOA 2PX0A 2NSGA 2DGJA 2EPNA 3KYIA 2PF4E 1M57C 4MW8A 2R7QA 1LKXA 3X2QC 4IRUA 1RMVA 4L6RA 3AQBA 5KYUA 1Q0GA 2ZD9A 4PJJA 3S28A 1HY5A 3B0PA 3AOUA 1ZHYA 2OJED 4A2NB 2CGEA 4Z9HA 2J0XA 3SXMA 5F5HA 1QLEC 2NUPA 3DE9A 2Q4FA 3JSZA 3PMRA 1BR2A 1ZW2A 3T4RA 3T6GB 1KU2A 3HKKA 4JEBA 3ZWIA 4JCHA 3QTHA 2QY9A 3JCUQ 3ASNC 4U5EE 1JMWA 3M79A 4BJ6A 4PACA 2R9RB 1L7CA 2Y3DA 4MNDA 256BA 4OD4A 3HNLA 3JT1A 5T1DB 2KW3C 4I1OB 2J7PD 4YL1A 1E83A 1A7VA 1XWJA 3LNMB 2CDQA 3E9VA 1HW1A 3ZTMA 5JT4A 2NUTB 3HNKA 4KNWA 1LM3B 2HSQA 3V5ZA 3MX3A 4CS8A 4F4BA 2GAQA 1Q0MA 5E3CA 4OIOF 3WODF 1LS1A 3FOPA 3ZSUA 4MVUA 5DLJA 2G62A 1TR2A 3DI5A 5F28E 4IWBA 4OD5A 2XLHA 4DXWA 3C8GB 3N24A 4JTAB 1IZMA 3T6BA 1Z5ZA 3LEOA 2HZ8A 2XLMA 4DBQA 4AL1A 3G50A 4DRHB 1TWHA 3B0UX 3GODA 1Z6AA 2EILC 2X51A 5CI9A 1TWGA 5L0CA 1T6IA 2M64A 5KYXA 3LESA 2B0JA 2R7SA 1OR2A 1Y6DA 3EZIA 3Q6MA 4BJ5C 4EBJA 1FFHA 3NG1A 4ER9A 1YAUO 2Y3HA 2AWCA 2FGYA 2WVQA 3DD7A 1OKKD 3NYLA 3IQCA 3K33A 5COFA 3M1CB 3E70C 5L3QA 2VH3A 2HUJA 3ABKC 3ZG1A 1EA8A 1YZCA 1TWAA 2C03A 4MTOA 1H9GA 1ZHZA 4WGZA 3MYIA 1NG1A 2KYHA 3Q6NA 5GPGB 4PFPA 3K1IC 2J45A 3L8JA 3US6A 5A6JA 1E86A 4OIRF 3LUTB 1RJ9B 3B0VC 1M2VB 3G4XA 1E84A 2YLIA 3C63A 1EKYA 4CS8C 3LS1A 2WVOA 4JW1A 4PK4A 1MNDA 2WL8A 3S84A 4E18A 5L0HA 2EPKX 3U8PA 5L0IA 3GEHA 3VM6A 3AJMA 2YL0A 4O79A 5KYUB 3EPVA 3H2UA 5HV9A 4YWQA 5L0DA 3ATPA 3N0TA 3IPMO 5B1BC 1ZHXA 2GA0A 1O3UA 1QKRA 1OCCC 5K0IA 4DVYP 4RDAA 1PCXA 3Q7LA 1SYQA 1CGOA 4CDYA 2G3KA 2DB4A 5BUOA 3S0XA 4QI2A 4W8PA 1HMDA 3ABMC 1NSGB 2X0CA 5KYWA 1M2VA 4XWJA 4YJWA 4BJ5A 3AGUA 1T5OA 5E33A 4ANJA 3ZQYA 1MQVA 2HJ3A 4K1OA 3AQCA 4XQ1A 1DOVA 1OCRC 5JLIA 3L8IA 1AEPA 4U5HA 3ASOC 3TK0A 2HSBA 4Q4ZF 3M15A 1Q0KA 1O87A 4MW3A 4N6HA 4P9TA 1OXBA 3OEOA 2NPUA 2Q9CA 4HFKB 1D1BA 2J7PA 1QSPA 3SYNA 2YLGA 2R7UA 2VB6A 5DS6A 4BPMA 5KYXB 4N06A 3F46A 1V55C 2PBEA 3POVA 4O6NA 2VCCA 2YQYA 4QDLA 1QQ3A 2Q3TA 3HLZA 5DS5A 1MMNA 3ITFA 1BBHA 3UMKA 3KMIA 3JYHA 3UGPA 4I1MA 4MVQA 3CQZA 1A41A 1O5HA 1VB5A 2ZXPA 2PX3A 3DM5A 3C8GD 4MVSA 4XPYA 3TD7A 2XXAA 5AC5A 1OQCA 2XLWA 3I5PA 1G5ZA 1VLSA 2E87A 2W4BA 3CZ6A 3DJNB 2BC5A 4CSAC 1PD1A 3H2VA 2FAPB 1QPUA 1TFOB 2RD9A 2VC9A 3KYJA 3RQFA 4DOZA 2G3VA 3AG3C 3NYJA 4MVOA 1K04A 4HEAJ 3W8IA 4CDVA 1T6UA 2W4MA 4E17A 3GM1A 4C3DA 4BG0A 3U5SA 1Q0FA 5F5FA 4KBLA 1MMDA 5A6BA 4XEVA 4C3BA 1EQ1A 2MYSA 2W45A 2D5RB 2LIGA 3EQLF 4DJ9A 4CIPA 5E3AA 3DMDA 4MVRA 5JRAA 1FMVA 2A0UA 3KH2A 4ZLDA 3M4BA 4JTDB 4MTFA 1V4AA 1T01A 4MS2A 4LERA 4EBKA 1GGQA 2XXAB 1GQAA 4U9DA 2P7VA 3FHDA 5BQIA 3FAJA 2OCCC 3IQ5A 3RQEA 2XM0A 4LACB 1HMOA 1ZYRF 1TWCA 4PJLA 2WVNA 3SZRA 3VAYA 5KYNA 4XEFA 2XL8A 3I4UA 1JR8A 2XM4A 1FR0A 2XS1A 2P1AA 2M4EA 4NTFA 1LVKA 1BR4A 3GANA 3K7DA 2P61A 4GYTA 4J32B 4ULWA 4X0RA 4B6IA 2LFDA 4ZLCA 1Q0DA 4IARA 4JE9A 4DVZA 2GFHA 1GS9A 3IQ6A 4ULVA 2WZFA 3AGTA 3WG7C 5L0JA 2BL2A 1J8MF 3S29A 3R2PA 3U3FA 3EG9A 3FXHA 3QMKA 1R4TA 3RF3A 1YJGA 2QUPA 5TJ5E 3FOOA 3JRMO 2Y69C 4K7BA 1WATA 2R7OA 1VTMP 3HNJA 4FAPB 2J0WA 2R7VA 2OJQA 3K6BA 4HFFB 3UNGC 2F22A 5KYWB 2R7TA 3DAGA 2HMQA 3F47A 4WABA 1RKCA 3JTLO 1SZIA 2KNHA 1OXKA 5A6BD 2CW0F 5D92A 5IY5C 3S27A 3GWLA 2ZXRA 2CNWD 5DS4A 2EINC 1G4WR 4G78A 3UMIA 1D0ZA 2WB7A 2R7RA 5CI8A 3JZ0A 1C17M 4JJFA 2BE5F 2IYLD 4MQ9F 4AX2A 1WGWA 1YYJA 2ASRA 1VYKA 2GWWA 2MHRA 3BRJA 4GQHA 2IXMA 2YRFA 3RIPA 5A6KA 1WTYA 5EGYA 4IAOA 3PDMP 2OOCA 3O55A 3LLIA 2KK1A 2XLEA 2V26A 1APCA 4JRZA 1Z63A 2IOQA 2YEVA 1M6TA 5L0GA 4O6YA 3JRTA 1K40A 3GEIA 3C8ZA 3JSEO 4K0DA 1WN0A 4R32A 3DAFA 2R25A 4Z9IA 4IGGA 2R05A 2IM8A 4EWCA 2Q9AA 5FCLA 1LPEA 4Z9JA 3WAQA 1R5ID 4H4KC 1DOWA 2J9UA 1W2WA 4KC9A 2J8WA 2V3CC 1JPJA 1VLTA 3W2VA 1NBBA 3DJUB 1T6QA 3T9OA 1YYXA 3SXYA 3HNIA 4ONSA 3N2ZB 3PCVA 1ORYA 1RJ9A 3A9CA 4FX5A 3SNHA 4Q7CA 1ZU5A 3DWWA 2JPUA 4U5BE 5JSLA 2AWYA 2IXNA 1AVOB 1I4YA 4CBEA 2XL4A 1UFBA 3MBGA 3B71A 2D4UA 3RYLA 4LDKA 1FMWA 3O6XA 4NTBA 1B68A 3TQOA 5EHHA 3QVYA 4CJOA 4JKVA 3RFYA 5JUAA 2ZXOA 3FVYA 4YT8A 1TFKB 2YHSA 2OEVA 3NMIA 3TJ5A 4CDAA 2GDCA 2J9WA 3NRHA 1N1CA 3C8GA 3CSKA 4RD9A 1SF8A 3W4YA 5HSWA 5D91A 4IJJA 4WJ0A 3FMSA 3AG4C 5E2QA 1D0XA 1Z23A 1A7DA 1NFOA 1YA9A 4IB4A 3DXJF 3MFNA 2KQ9A 4E0HA 1OW6A 1XZPA 4PJNA 2XLDA 3DKAA 3K1IA 2YLDA 2AVKA 3NKEA 4G0HA 3V5XA 2L9JA 1KTMA 3EGDA 3RVZA 1E2XA 4YK5A 1S05A 2XLVA 1QVXA 3EFOB 3U3BA 5BQHA 2AP3A 3A11A 3U2MA 3TJ6A 2L6HA 3FDQA 1NU9C 4XEKA 3M4CA 4D4XA 5KYYB 3I5QA 1C03A 1ZVZA 3L0IA 1NZEA 3AG2C 1V74B 2NUPB 2QLAA 3EJNA 3KPHA 5L3VA 4G7OF 1BR1A 3GWNA 2H7BA 1RKEB 2DYSC 1VK5A 1PD0A 1FFTC 2ETSA 2L81A 4EHPA 2XLOA 2WZGA 2O9XA 2NSFA 2A68F 2J9VA 3ZTZA 3VF0A 1G4US 2DI3A 3S9OA 2EIMC 4JCZA 2H7OA 2Q9BA 1H6GA 1Y4CA 4XTKA 1Z7Qc 3RQGA 4BJTA 3SXKA 2A6HF 2ICWG 3RKOF 3EZHA 4CX9A 5DQZA 1FNTc 2VCAA 1CGNA 2EPLX 2Y3BA 3VYWA 2R02A 1WWPA 2WZLA 4U5GA 2YL3A 2LP4A 3NYMA 3ABLC 1CPRA 2P6VA 4FESA 4BJ6C 4E0IA 1FTSA 1ZHWA 4U9EA 4DRIB 1JAFA 2Y3GA 1A7EA 3OA1A 4NY3A 2YZSA 3T6JA 4YT2A 1YA7O 3NKDA 2W9YA 4NTAA 5T3WA 3VRCA 1NLXA 2LQGA 1OW8A 1SMYF 1U89A 1ZZPA 2RSEB 1I5NA 5COGA 3RVYA 2Y39A 4IAQA 1PV3A 3IQTA 3LLKA 4CS9A 3PHF2 4DBRA 1CPQA 5FZTA 4XPXA 4AK9A 5L0FA 3U0CA 1YLMA 4QI0A 3TULA 2R7WA 2A6EF 3C7JA 1NU7D 2XSEA 2Q7RA 1U6HA 2H7VC 4P6IC 4LLEA 4CSAA 2XS8A 1D1AA 1JPNA 3QZCA 4AE4A 5T3TA 3U9MA 2YL1A 4I3MA 2IBFA 3O39A 3V5YA 4CJGA 1Z3IX 3QVZA 3EH1A 2PFDA 2OQMA 2L6GA 3S90A 3HTKC 2EIJC 2NG1A 3IHUA 2XRHA 2JX0A 2ZXWC 3GM2A 4RBNA 2A0BA 1ORSC 4YT5A 2YKZA 5EK0A 4I44A 4JVSA 1GM5A 3LNRA 2HV7A 1ORJA 3EGDB 3DE8A 1S7ZA 3QW0A 3BEHA 1YARO 4JTCB 4FWVA 4LDQA 3RH3A 1C02A 3B29A 1F1MA 1OR3A 2QE9A 1HW2A 2VASA 4G7ZF 3EG9B 4EKWA 2UUIA 4CS7A 2HJMA 2LSEA 2P0NA 3Q7GA 4PJMA 1JRAA 2R7XA 3LEVA 4J7YA 3ZC4A 1H9TA 2ZPAA 1VOMA 3EGXB 3K66A 3U2LA 4UDVA 4N4WA 4CS9C 3GORA 4NQFA 3G4ZA 4XLNF 4J30B 1SR2A 4BEJA 1ZHTA 1VMAA 3KKBA 2YVKA 4JURI 3C18A 3DM9B 3ZQVA 3TOMA 2LD6A 4U5DE 4MVMA 3NDBB 2L7AA 3EH2A 1T9KA 3W8HA 4O6MA 4JEAA 2J9BA 3UGOA 3X1OA 2JD3A 1IW7F 1M2OA 3J06A 2HV6A 3V7OA 4XPWA 1RCPA 1L3PA 2KJGA 2OG2A 4JZAA 3HJCA 2A1DD 4LLCA 2PNOA 4NC3A 2FFHA 1BZ4A 2QTVA 3ECSA 3NMJA 4JC7A 2EIKC 2HKVA 2HMZA 5DVWA 1EI7A 1TKNA 2XL6A 3K1HA 4U5FE 5JS5A 4PFOA 5BQGA 4JJGA 2DYRC 5JVEA 1TQGA 1ST6A 1OKKA 3C62A 1V54C 3UMHA 3WHNA 1MMAA 1WOLA 1YZAA 1J8YF 4J7TA 4YL0A 1LS4A 4YN0B 3DZAA 4C3EA 1UG7A 4BJ1A 4KI2A 1MNEA 1LIHA 5COMA 2J46A 1AUEA 5A69A 2H8AA 4C7OA 2OEXA 3QW1A 4MVZA 3EGXA 3L1MA 5DQTA 3UR3C 3ZIBA 2IXOA 1HE9A 1XZQA 1LI5A 4U5CE 2EPMX 1D0YA 1H7IA 1LE4A 2CCYA 3L34A 2I8BA 4W8KA 3W2WA 4A4AA 2TMVP 5B1AC 4KNVA 3CEXA 4JIOA 4E7ZA 3LAYA 4AE4B 2KSFA 1YVIA 4H54A 1MMGA 3U9JA 1OCZC 1ZW3A 4HE8D 1E85A 3TOLA 4DRJB 3GM3A 4G7HF 2KC3A 2Q00A 3RW0A 1HE1A 3U8VA 3LJBA 2VCBA 3ZVRA 4CIHA 1RXQA 3EHMA 1OW7A 1VYIA 3OWTA 1JOGA 4M63A 1ZU4A 4GEHA 3EFOA 1M56C 2A69F 1QZXA 3SP1A 4XLPF 4P9FA 3FAPB 3IEEA 3ZDLA 1A0BA
chains in the Genus database with same CATH topology
5FZTA 4E18A 4ONSA 1L7CA 5L0FA 5L0HA 4E17A 2GWWA 4P9TA 5L0IA 1H6GA 1U6HA 1XWJA 3H2UA 5L0JA 1ZW3A 5L0DA 2HSQA 4DJ9A 1QKRA 3TJ6A 1ST6A 5L0GA 3RF3A 2IBFA 3MYIA 1TR2A 1T01A 1ZVZA 1SYQA 3S90A 1RKEA 4IGGA 3TJ5A 2GDCA 4W8PA 1RKCA 2X0CA 1RKEB 1ZW2A 1DOWA 3T6GB 2B0HA 4EHPA 2L7AA 2LQGA 3H2VA 1YDIA 1U89A 4K1OA 4PR9A 1DOVA 3ZDLA 5L0CA 3VF0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FZT A;  4E18 A;  4ONS A;  1L7C A;  5L0F A;  5L0H A;  4E17 A;  2GWW A;  4P9T A;  5L0I A;  1H6G A;  1U6H A;  1XWJ A;  3H2U A;  5L0J A;  1ZW3 A;  5L0D A;  2HSQ A;  4DJ9 A;  1QKR A;  3TJ6 A;  1ST6 A;  5L0G A;  3RF3 A;  2IBF A;  3MYI A;  1TR2 A;  1T01 A;  1ZVZ A;  1SYQ A;  3S90 A;  1RKE A;  4IGG A;  3TJ5 A;  2GDC A;  4W8P A;  1RKC A;  2X0C A;  1RKE B;  1ZW2 A;  1DOW A;  3T6G B;  2B0H A;  4EHP A;  2L7A A;  2LQG A;  3H2V A;  1YDI A;  1U89 A;  4K1O A;  4PR9 A;  1DOV A;  3ZDL A;  5L0C A;  3VF0 A; 
#chains in the Genus database with same CATH topology
 1BDJ B;  3EHN A;  3R7C A;  2PP4 A;  5A6A A;  5AC4 A;  2HS5 A;  1OCO C;  2LCH A;  2HFI A;  4LDR A;  3SXZ A;  2CYD A;  4EBB A;  2QNL A;  4BEM J;  2YWA A;  2CNW A;  5B3S C;  1K05 A;  2C04 A;  3SEO A;  4AL0 A;  2YL7 A;  2LFF A;  1CGM E;  3H65 A;  4NCQ A;  3NMK A;  2IXP A;  1LE2 A;  1WAS A;  3GEE A;  3MYF A;  4EIY A;  4OIP F;  4E7S A;  3B9Q A;  5B3I A;  4Q5S F;  1NFN A;  2UUH A;  4OIQ F;  3MLG A;  2LK4 A;  1RKE A;  2OU6 A;  1FAP B;  2Z15 A;  3AG1 C;  2MWQ A;  2AU5 A;  3LS0 A;  1U0B B;  5JP7 A;  2OKU A;  4YT4 A;  1I4Z A;  2NUT A;  1KNY A;  1LI7 A;  2B0H A;  2KGO A;  2R03 A;  2I15 A;  4D4N A;  4PR9 A;  1YDI A;  4O7G A;  5AGF A;  4OIN F;  4N6C A;  1G8X A;  4MTG A;  5CIV A;  1D1C A;  2L6F A;  3CAX A;  3JYY A;  4WGY A;  3KL4 A;  4C7O B;  3O10 A;  4YL3 A;  4EUK B;  5KYY A;  2EPO A;  2PX0 A;  2NSG A;  2DGJ A;  2EPN A;  3KYI A;  2PF4 E;  1M57 C;  4MW8 A;  2R7Q A;  1LKX A;  3X2Q C;  4IRU A;  1RMV A;  4L6R A;  3AQB A;  5KYU A;  1Q0G A;  2ZD9 A;  4PJJ A;  3S28 A;  1HY5 A;  3B0P A;  3AOU A;  1ZHY A;  2OJE D;  4A2N B;  2CGE A;  4Z9H A;  2J0X A;  3SXM A;  5F5H A;  1QLE C;  2NUP A;  3DE9 A;  2Q4F A;  3JSZ A;  3PMR A;  1BR2 A;  1ZW2 A;  3T4R A;  3T6G B;  1KU2 A;  3HKK A;  4JEB A;  3ZWI A;  4JCH A;  3QTH A;  2QY9 A;  3JCU Q;  3ASN C;  4U5E E;  1JMW A;  3M79 A;  4BJ6 A;  4PAC A;  2R9R B;  1L7C A;  2Y3D A;  4MND A;  256B A;  4OD4 A;  3HNL A;  3JT1 A;  5T1D B;  2KW3 C;  4I1O B;  2J7P D;  4YL1 A;  1E83 A;  1A7V A;  1XWJ A;  3LNM B;  2CDQ A;  3E9V A;  1HW1 A;  3ZTM A;  5JT4 A;  2NUT B;  3HNK A;  4KNW A;  1LM3 B;  2HSQ A;  3V5Z A;  3MX3 A;  4CS8 A;  4F4B A;  2GAQ A;  1Q0M A;  5E3C A;  4OIO F;  3WOD F;  1LS1 A;  3FOP A;  3ZSU A;  4MVU A;  5DLJ A;  2G62 A;  1TR2 A;  3DI5 A;  5F28 E;  4IWB A;  4OD5 A;  2XLH A;  4DXW A;  3C8G B;  3N24 A;  4JTA B;  1IZM A;  3T6B A;  1Z5Z A;  3LEO A;  2HZ8 A;  2XLM A;  4DBQ A;  4AL1 A;  3G50 A;  4DRH B;  1TWH A;  3B0U X;  3GOD A;  1Z6A A;  2EIL C;  2X51 A;  5CI9 A;  1TWG A;  5L0C A;  1T6I A;  2M64 A;  5KYX A;  3LES A;  2B0J A;  2R7S A;  1OR2 A;  1Y6D A;  3EZI A;  3Q6M A;  4BJ5 C;  4EBJ A;  1FFH A;  3NG1 A;  4ER9 A;  1YAU O;  2Y3H A;  2AWC A;  2FGY A;  2WVQ A;  3DD7 A;  1OKK D;  3NYL A;  3IQC A;  3K33 A;  5COF A;  3M1C B;  3E70 C;  5L3Q A;  2VH3 A;  2HUJ A;  3ABK C;  3ZG1 A;  1EA8 A;  1YZC A;  1TWA A;  2C03 A;  4MTO A;  1H9G A;  1ZHZ A;  4WGZ A;  3MYI A;  1NG1 A;  2KYH A;  3Q6N A;  5GPG B;  4PFP A;  3K1I C;  2J45 A;  3L8J A;  3US6 A;  5A6J A;  1E86 A;  4OIR F;  3LUT B;  1RJ9 B;  3B0V C;  1M2V B;  3G4X A;  1E84 A;  2YLI A;  3C63 A;  1EKY A;  4CS8 C;  3LS1 A;  2WVO A;  4JW1 A;  4PK4 A;  1MND A;  2WL8 A;  3S84 A;  4E18 A;  5L0H A;  2EPK X;  3U8P A;  5L0I A;  3GEH A;  3VM6 A;  3AJM A;  2YL0 A;  4O79 A;  5KYU B;  3EPV A;  3H2U A;  5HV9 A;  4YWQ A;  5L0D A;  3ATP A;  3N0T A;  3IPM O;  5B1B C;  1ZHX A;  2GA0 A;  1O3U A;  1QKR A;  1OCC C;  5K0I A;  4DVY P;  4RDA A;  1PCX A;  3Q7L A;  1SYQ A;  1CGO A;  4CDY A;  2G3K A;  2DB4 A;  5BUO A;  3S0X A;  4QI2 A;  4W8P A;  1HMD A;  3ABM C;  1NSG B;  2X0C A;  5KYW A;  1M2V A;  4XWJ A;  4YJW A;  4BJ5 A;  3AGU A;  1T5O A;  5E33 A;  4ANJ A;  3ZQY A;  1MQV A;  2HJ3 A;  4K1O A;  3AQC A;  4XQ1 A;  1DOV A;  1OCR C;  5JLI A;  3L8I A;  1AEP A;  4U5H A;  3ASO C;  3TK0 A;  2HSB A;  4Q4Z F;  3M15 A;  1Q0K A;  1O87 A;  4MW3 A;  4N6H A;  4P9T A;  1OXB A;  3OEO A;  2NPU A;  2Q9C A;  4HFK B;  1D1B A;  2J7P A;  1QSP A;  3SYN A;  2YLG A;  2R7U A;  2VB6 A;  5DS6 A;  4BPM A;  5KYX B;  4N06 A;  3F46 A;  1V55 C;  2PBE A;  3POV A;  4O6N A;  2VCC A;  2YQY A;  4QDL A;  1QQ3 A;  2Q3T A;  3HLZ A;  5DS5 A;  1MMN A;  3ITF A;  1BBH A;  3UMK A;  3KMI A;  3JYH A;  3UGP A;  4I1M A;  4MVQ A;  3CQZ A;  1A41 A;  1O5H A;  1VB5 A;  2ZXP A;  2PX3 A;  3DM5 A;  3C8G D;  4MVS A;  4XPY A;  3TD7 A;  2XXA A;  5AC5 A;  1OQC A;  2XLW A;  3I5P A;  1G5Z A;  1VLS A;  2E87 A;  2W4B A;  3CZ6 A;  3DJN B;  2BC5 A;  4CSA C;  1PD1 A;  3H2V A;  2FAP B;  1QPU A;  1TFO B;  2RD9 A;  2VC9 A;  3KYJ A;  3RQF A;  4DOZ A;  2G3V A;  3AG3 C;  3NYJ A;  4MVO A;  1K04 A;  4HEA J;  3W8I A;  4CDV A;  1T6U A;  2W4M A;  4E17 A;  3GM1 A;  4C3D A;  4BG0 A;  3U5S A;  1Q0F A;  5F5F A;  4KBL A;  1MMD A;  5A6B A;  4XEV A;  4C3B A;  1EQ1 A;  2MYS A;  2W45 A;  2D5R B;  2LIG A;  3EQL F;  4DJ9 A;  4CIP A;  5E3A A;  3DMD A;  4MVR A;  5JRA A;  1FMV A;  2A0U A;  3KH2 A;  4ZLD A;  3M4B A;  4JTD B;  4MTF A;  1V4A A;  1T01 A;  4MS2 A;  4LER A;  4EBK A;  1GGQ A;  2XXA B;  1GQA A;  4U9D A;  2P7V A;  3FHD A;  5BQI A;  3FAJ A;  2OCC C;  3IQ5 A;  3RQE A;  2XM0 A;  4LAC B;  1HMO A;  1ZYR F;  1TWC A;  4PJL A;  2WVN A;  3SZR A;  3VAY A;  5KYN A;  4XEF A;  2XL8 A;  3I4U A;  1JR8 A;  2XM4 A;  1FR0 A;  2XS1 A;  2P1A A;  2M4E A;  4NTF A;  1LVK A;  1BR4 A;  3GAN A;  3K7D A;  2P61 A;  4GYT A;  4J32 B;  4ULW A;  4X0R A;  4B6I A;  2LFD A;  4ZLC A;  1Q0D A;  4IAR A;  4JE9 A;  4DVZ A;  2GFH A;  1GS9 A;  3IQ6 A;  4ULV A;  2WZF A;  3AGT A;  3WG7 C;  5L0J A;  2BL2 A;  1J8M F;  3S29 A;  3R2P A;  3U3F A;  3EG9 A;  3FXH A;  3QMK A;  1R4T A;  3RF3 A;  1YJG A;  2QUP A;  5TJ5 E;  3FOO A;  3JRM O;  2Y69 C;  4K7B A;  1WAT A;  2R7O A;  1VTM P;  3HNJ A;  4FAP B;  2J0W A;  2R7V A;  2OJQ A;  3K6B A;  4HFF B;  3UNG C;  2F22 A;  5KYW B;  2R7T A;  3DAG A;  2HMQ A;  3F47 A;  4WAB A;  1RKC A;  3JTL O;  1SZI A;  2KNH A;  1OXK A;  5A6B D;  2CW0 F;  5D92 A;  5IY5 C;  3S27 A;  3GWL A;  2ZXR A;  2CNW D;  5DS4 A;  2EIN C;  1G4W R;  4G78 A;  3UMI A;  1D0Z A;  2WB7 A;  2R7R A;  5CI8 A;  3JZ0 A;  1C17 M;  4JJF A;  2BE5 F;  2IYL D;  4MQ9 F;  4AX2 A;  1WGW A;  1YYJ A;  2ASR A;  1VYK A;  2GWW A;  2MHR A;  3BRJ A;  4GQH A;  2IXM A;  2YRF A;  3RIP A;  5A6K A;  1WTY A;  5EGY A;  4IAO A;  3PDM P;  2OOC A;  3O55 A;  3LLI A;  2KK1 A;  2XLE A;  2V26 A;  1APC A;  4JRZ A;  1Z63 A;  2IOQ A;  2YEV A;  1M6T A;  5L0G A;  4O6Y A;  3JRT A;  1K40 A;  3GEI A;  3C8Z A;  3JSE O;  4K0D A;  1WN0 A;  4R32 A;  3DAF A;  2R25 A;  4Z9I A;  4IGG A;  2R05 A;  2IM8 A;  4EWC A;  2Q9A A;  5FCL A;  1LPE A;  4Z9J A;  3WAQ A;  1R5I D;  4H4K C;  1DOW A;  2J9U A;  1W2W A;  4KC9 A;  2J8W A;  2V3C C;  1JPJ A;  1VLT A;  3W2V A;  1NBB A;  3DJU B;  1T6Q A;  3T9O A;  1YYX A;  3SXY A;  3HNI A;  4ONS A;  3N2Z B;  3PCV A;  1ORY A;  1RJ9 A;  3A9C A;  4FX5 A;  3SNH A;  4Q7C A;  1ZU5 A;  3DWW A;  2JPU A;  4U5B E;  5JSL A;  2AWY A;  2IXN A;  1AVO B;  1I4Y A;  4CBE A;  2XL4 A;  1UFB A;  3MBG A;  3B71 A;  2D4U A;  3RYL A;  4LDK A;  1FMW A;  3O6X A;  4NTB A;  1B68 A;  3TQO A;  5EHH A;  3QVY A;  4CJO A;  4JKV A;  3RFY A;  5JUA A;  2ZXO A;  3FVY A;  4YT8 A;  1TFK B;  2YHS A;  2OEV A;  3NMI A;  3TJ5 A;  4CDA A;  2GDC A;  2J9W A;  3NRH A;  1N1C A;  3C8G A;  3CSK A;  4RD9 A;  1SF8 A;  3W4Y A;  5HSW A;  5D91 A;  4IJJ A;  4WJ0 A;  3FMS A;  3AG4 C;  5E2Q A;  1D0X A;  1Z23 A;  1A7D A;  1NFO A;  1YA9 A;  4IB4 A;  3DXJ F;  3MFN A;  2KQ9 A;  4E0H A;  1OW6 A;  1XZP A;  4PJN A;  2XLD A;  3DKA A;  3K1I A;  2YLD A;  2AVK A;  3NKE A;  4G0H A;  3V5X A;  2L9J A;  1KTM A;  3EGD A;  3RVZ A;  1E2X A;  4YK5 A;  1S05 A;  2XLV A;  1QVX A;  3EFO B;  3U3B A;  5BQH A;  2AP3 A;  3A11 A;  3U2M A;  3TJ6 A;  2L6H A;  3FDQ A;  1NU9 C;  4XEK A;  3M4C A;  4D4X A;  5KYY B;  3I5Q A;  1C03 A;  1ZVZ A;  3L0I A;  1NZE A;  3AG2 C;  1V74 B;  2NUP B;  2QLA A;  3EJN A;  3KPH A;  5L3V A;  4G7O F;  1BR1 A;  3GWN A;  2H7B A;  1RKE B;  2DYS C;  1VK5 A;  1PD0 A;  1FFT C;  2ETS A;  2L81 A;  4EHP A;  2XLO A;  2WZG A;  2O9X A;  2NSF A;  2A68 F;  2J9V A;  3ZTZ A;  3VF0 A;  1G4U S;  2DI3 A;  3S9O A;  2EIM C;  4JCZ A;  2H7O A;  2Q9B A;  1H6G A;  1Y4C A;  4XTK A;  1Z7Q c;  3RQG A;  4BJT A;  3SXK A;  2A6H F;  2ICW G;  3RKO F;  3EZH A;  4CX9 A;  5DQZ A;  1FNT c;  2VCA A;  1CGN A;  2EPL X;  2Y3B A;  3VYW A;  2R02 A;  1WWP A;  2WZL A;  4U5G A;  2YL3 A;  2LP4 A;  3NYM A;  3ABL C;  1CPR A;  2P6V A;  4FES A;  4BJ6 C;  4E0I A;  1FTS A;  1ZHW A;  4U9E A;  4DRI B;  1JAF A;  2Y3G A;  1A7E A;  3OA1 A;  4NY3 A;  2YZS A;  3T6J A;  4YT2 A;  1YA7 O;  3NKD A;  2W9Y A;  4NTA A;  5T3W A;  3VRC A;  1NLX A;  2LQG A;  1OW8 A;  1SMY F;  1U89 A;  1ZZP A;  2RSE B;  1I5N A;  5COG A;  3RVY A;  2Y39 A;  4IAQ A;  1PV3 A;  3IQT A;  3LLK A;  4CS9 A;  3PHF 2;  4DBR A;  1CPQ A;  5FZT A;  4XPX A;  4AK9 A;  5L0F A;  3U0C A;  1YLM A;  4QI0 A;  3TUL A;  2R7W A;  2A6E F;  3C7J A;  1NU7 D;  2XSE A;  2Q7R A;  1U6H A;  2H7V C;  4P6I C;  4LLE A;  4CSA A;  2XS8 A;  1D1A A;  1JPN A;  3QZC A;  4AE4 A;  5T3T A;  3U9M A;  2YL1 A;  4I3M A;  2IBF A;  3O39 A;  3V5Y A;  4CJG A;  1Z3I X;  3QVZ A;  3EH1 A;  2PFD A;  2OQM A;  2L6G A;  3S90 A;  3HTK C;  2EIJ C;  2NG1 A;  3IHU A;  2XRH A;  2JX0 A;  2ZXW C;  3GM2 A;  4RBN A;  2A0B A;  1ORS C;  4YT5 A;  2YKZ A;  5EK0 A;  4I44 A;  4JVS A;  1GM5 A;  3LNR A;  2HV7 A;  1ORJ A;  3EGD B;  3DE8 A;  1S7Z A;  3QW0 A;  3BEH A;  1YAR O;  4JTC B;  4FWV A;  4LDQ A;  3RH3 A;  1C02 A;  3B29 A;  1F1M A;  1OR3 A;  2QE9 A;  1HW2 A;  2VAS A;  4G7Z F;  3EG9 B;  4EKW A;  2UUI A;  4CS7 A;  2HJM A;  2LSE A;  2P0N A;  3Q7G A;  4PJM A;  1JRA A;  2R7X A;  3LEV A;  4J7Y A;  3ZC4 A;  1H9T A;  2ZPA A;  1VOM A;  3EGX B;  3K66 A;  3U2L A;  4UDV A;  4N4W A;  4CS9 C;  3GOR A;  4NQF A;  3G4Z A;  4XLN F;  4J30 B;  1SR2 A;  4BEJ A;  1ZHT A;  1VMA A;  3KKB A;  2YVK A;  4JUR I;  3C18 A;  3DM9 B;  3ZQV A;  3TOM A;  2LD6 A;  4U5D E;  4MVM A;  3NDB B;  2L7A A;  3EH2 A;  1T9K A;  3W8H A;  4O6M A;  4JEA A;  2J9B A;  3UGO A;  3X1O A;  2JD3 A;  1IW7 F;  1M2O A;  3J06 A;  2HV6 A;  3V7O A;  4XPW A;  1RCP A;  1L3P A;  2KJG A;  2OG2 A;  4JZA A;  3HJC A;  2A1D D;  4LLC A;  2PNO A;  4NC3 A;  2FFH A;  1BZ4 A;  2QTV A;  3ECS A;  3NMJ A;  4JC7 A;  2EIK C;  2HKV A;  2HMZ A;  5DVW A;  1EI7 A;  1TKN A;  2XL6 A;  3K1H A;  4U5F E;  5JS5 A;  4PFO A;  5BQG A;  4JJG A;  2DYR C;  5JVE A;  1TQG A;  1ST6 A;  1OKK A;  3C62 A;  1V54 C;  3UMH A;  3WHN A;  1MMA A;  1WOL A;  1YZA A;  1J8Y F;  4J7T A;  4YL0 A;  1LS4 A;  4YN0 B;  3DZA A;  4C3E A;  1UG7 A;  4BJ1 A;  4KI2 A;  1MNE A;  1LIH A;  5COM A;  2J46 A;  1AUE A;  5A69 A;  2H8A A;  4C7O A;  2OEX A;  3QW1 A;  4MVZ A;  3EGX A;  3L1M A;  5DQT A;  3UR3 C;  3ZIB A;  2IXO A;  1HE9 A;  1XZQ A;  1LI5 A;  4U5C E;  2EPM X;  1D0Y A;  1H7I A;  1LE4 A;  2CCY A;  3L34 A;  2I8B A;  4W8K A;  3W2W A;  4A4A A;  2TMV P;  5B1A C;  4KNV A;  3CEX A;  4JIO A;  4E7Z A;  3LAY A;  4AE4 B;  2KSF A;  1YVI A;  4H54 A;  1MMG A;  3U9J A;  1OCZ C;  1ZW3 A;  4HE8 D;  1E85 A;  3TOL A;  4DRJ B;  3GM3 A;  4G7H F;  2KC3 A;  2Q00 A;  3RW0 A;  1HE1 A;  3U8V A;  3LJB A;  2VCB A;  3ZVR A;  4CIH A;  1RXQ A;  3EHM A;  1OW7 A;  1VYI A;  3OWT A;  1JOG A;  4M63 A;  1ZU4 A;  4GEH A;  3EFO A;  1M56 C;  2A69 F;  1QZX A;  3SP1 A;  4XLP F;  4P9F A;  3FAP B;  3IEE A;  3ZDL A;  1A0B A; 
#chains in the Genus database with same CATH homology
 5FZT A;  4E18 A;  4ONS A;  1L7C A;  5L0F A;  5L0H A;  4E17 A;  2GWW A;  4P9T A;  5L0I A;  1H6G A;  1U6H A;  1XWJ A;  3H2U A;  5L0J A;  1ZW3 A;  5L0D A;  2HSQ A;  4DJ9 A;  1QKR A;  3TJ6 A;  1ST6 A;  5L0G A;  3RF3 A;  2IBF A;  3MYI A;  1TR2 A;  1T01 A;  1ZVZ A;  1SYQ A;  3S90 A;  1RKE A;  4IGG A;  3TJ5 A;  2GDC A;  4W8P A;  1RKC A;  2X0C A;  1RKE B;  1ZW2 A;  1DOW A;  3T6G B;  2B0H A;  4EHP A;  2L7A A;  2LQG A;  3H2V A;  1YDI A;  1U89 A;  4K1O A;  4PR9 A;  1DOV A;  3ZDL A;  5L0C A;  3VF0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...