2HSQA

Human vinculin (head domain, vh1, residues 1-258) in complex with shigella's ipaa vinculin binding site 2 (residues 565-587)
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
266
structure length
261
Chain Sequence
MEHHHHHHMPVFHTRTIESILEPVAQQISHLVIMHEEKAIPDLTAPVAAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVEKMSAEINEIIRVLQLTSWDEDAW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion, structural protein
molecule keywords Vinculin
publication title Shigella applies molecular mimicry to subvert vinculin and invade host cells.
pubmed doi rcsb
source organism Homo sapiens
total genus 94
structure length 261
sequence length 266
ec nomenclature
pdb deposition date 2006-07-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 2hsqA02
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 2hsqA01
1T01A 4P9TA 3T6GB 4IGGA 3VF0A 3MYIA 1TR2A 3RF3A 5FZTA 1XWJA 2X0CA 1L7CA 4K1OA 3ZDLA 3H2VA 3TJ5A 1QKRA 1SYQA 5L0HA 4E18A 1ZVZA 5L0FA 4W8PA 5L0GA 1DOVA 1ZW2A 5L0DA 2LQGA 1ZW3A 4E17A 2B0HA 2GWWA 2GDCA 1YDIA 2L7AA 4ONSA 1U6HA 1DOWA 3H2UA 5L0IA 1H6GA 1U89A 4DJ9A 3TJ6A 2IBFA 2HSQA 4PR9A 5L0CA 3S90A 4EHPA 5L0JA 1ST6A 1RKEB 1RKCA 1RKEA
chains in the Genus database with same CATH superfamily
1M56C 2AU5A 3QTHA 4IARA 4KNVA 4JE9A 1E83A 4JKVA 1QLEC 3U8VA 3C63A 4MW8A 1OCZC 5FZTA 2XLWA 2FFHA 1MMNA 3RQGA 3ZDLA 1TFKB 2JPUA 3FMSA 1GM5A 2NUTA 3RQEA 1GS9A 5DS5A 1VYKA 3TD7A 1AEPA 2NUPA 2OJQA 3DKAA 2QY9A 4XLNF 3W8IA 3KMIA 1RXQA 4CJOA 4JCHA 4NY3A 2WZLA 4YWQA 1H9TA 2R05A 3EZIA 3HNLA 3M15A 4AE4A 3J06A 1J8MF 1WTYA 2HJMA 4Q7CA 4IAOA 2BL2A 1L3PA 3UGPA 3VAYA 2H7BA 2CGEA 2V26A 4U5CE 3U8PA 5L0JA 2EIJC 1FAPB 1QQ3A 2CYDA 3GM3A 5JVEA 1CGNA 1BBHA 1RMVA 1Y4CA 1FR0A 2YKZA 3R2PA 3RVYA 2Y3HA 4C7OA 4HE8D 1MMAA 2YL1A 1NU7D 2EPNA 4E7ZA 3LEVA 4H4KC 2ZXOA 3DWWA 1NBBA 3LESA 2MYSA 2A0BA 4P6IC 2P61A 4AL0A 1ZVZA 5B1AC 1R5ID 4LLEA 2KW3C 3TOLA 5BUOA 1DOVA 1ZW2A 2VCCA 1TFOB 2HV7A 2XSEA 4NTFA 2MWQA 3QZCA 5L0DA 3NRHA 3US6A 1ZU4A 5A69A 3LS1A 3SEOA 3UGOA 3OA1A 4CJGA 1A0BA 3ZC4A 4D4XA 2LSEA 2Z15A 1A7VA 1QZXA 4JTAB 4XWJA 2XLMA 3S90A 4E0IA 5COFA 4NTAA 3DD7A 1VK5A 1E85A 2QNLA 1RKEB 1V74B 2KK1A 1C02A 1NG1A 2R9RB 2R02A 3AQCA 3HLZA 1ZHTA 2J9UA 2YZSA 3I4UA 1ZYRF 3Q7LA 3ZWIA 1A41A 4XLPF 3RQFA 4EKWA 3EG9A 5EHHA 1PCXA 4LDRA 1JAFA 2KYHA 2R7VA 3ASNC 3G50A 4K0DA 3IQCA 3LNMB 2ZPAA 3DJNB 5L0HA 3EQLF 1SMYF 2A0UA 3S27A 2E87A 2Q4FA 2WL8A 2XM0A 3OWTA 5L0GA 1Q0DA 2KC3A 2RSEB 2G62A 1GGQA 2I15A 4O6YA 1V55C 3DAGA 3CQZA 3RIPA 3ZIBA 5AC5A 2R7TA 3EGDA 1A7DA 4I3MA 3DE9A 1RJ9A 4MS2A 3TJ6A 1WATA 3T6JA 1VB5A 4LDQA 1OKKD 3B71A 1RCPA 3MYFA 1Z23A 4BEJA 3JYYA 4IB4A 1APCA 1MMGA 3HJCA 4IGGA 4XEFA 2HFIA 2VCBA 1AUEA 3Q6MA 1XWJA 1XZQA 4WJ0A 5B3SC 1JR8A 2IXPA 4J7YA 1L7CA 3M79A 3TULA 1OW7A 3O10A 3F46A 3K33A 4MTOA 1BDJB 2NUTB 2C03A 1LI7A 1HW1A 1TWGA 1YJGA 1FMWA 2NUPB 4IRUA 1OW6A 3WODF 2Y39A 2VC9A 3RVZA 3JRTA 3GEHA 4I1OB 4NTBA 2PF4E 4OIPF 4P9FA 2HJ3A 2R25A 1T9KA 1Z6AA 4AE4B 4EUKB 2EPLX 1H6GA 1KU2A 2CDQA 2HSQA 1HE9A 1D0XA 2NSFA 2QUPA 1YLMA 4O6MA 4U5BE 1H7IA 4EHPA 2OEVA 3HNKA 2EINC 1IW7F 3AOUA 1ZZPA 1RKEA 2LQGA 3GWLA 3T6BA 5B3IA 2ICWG 3NDBB 1ORYA 3DXJF 1YARO 4NQFA 4PJLA 5KYUA 1PD1A 1CGME 4C7OB 2M64A 3LS0A 3Q6NA 2R7QA 1OXKA 2R7RA 4ULWA 4KC9A 1QKRA 2Q9AA 3NYLA 4YL1A 3WG7C 4JIOA 2GFHA 1TWHA 2W45A 1M6TA 3PCVA 2XL6A 2Y69C 1CGOA 4Z9HA 3KH2A 2WZGA 1I4YA 3F47A 3JRMO 1HY5A 4JJFA 2DB4A 4JVSA 5KYXA 3FOOA 3V5YA 4OINF 2CCYA 3RH3A 2YQYA 2OQMA 2QTVA 4JEAA 4LLCA 4JZAA 1OQCA 2L9JA 4M63A 3KKBA 3NYMA 1S7ZA 4I44A 3EGXA 1T01A 4XEVA 3EHNA 1UFBA 3EZHA 3K7DA 3VF0A 3V5ZA 4JEBA 3VYWA 4BEMJ 4YL3A 1K05A 1AVOB 1CPQA 3EG9B 4FESA 4U9EA 5D92A 2Q3TA 3M4CA 5BQGA 4LDKA 5L3QA 3DMDA 1SYQA 4DXWA 5COGA 1O3UA 3SNHA 4PJJA 3ZG1A 4CSAA 1T5OA 2A68F 4PK4A 4U5DE 1Q0GA 1T6QA 2KJGA 4BPMA 2HMZA 3B0VC 5A6BD 3K66A 4KNWA 1FNTc 1MQVA 2VCAA 1SF8A 3EGDB 5IY5C 5KYWA 3SP1A 1RJ9B 2Q00A 4CDYA 1G8XA 4GYTA 5T3WA 5BQIA 3EPVA 2WZFA 4MVOA 3T9OA 2ZXWC 3L34A 3S9OA 1ORSC 2ZXPA 2YHSA 2RD9A 3T4RA 4QI2A 4RBNA 1D0ZA 2J9BA 4CS8A 3AJMA 1LIHA 2DI3A 3C7JA 2F22A 3QW0A 3SXMA 2J7PA 1TWAA 3AGTA 3AGUA 3H2VA 4J7TA 1Q0MA 3K1IA 1G4WR 3IQ5A 4HFFB 4PJNA 1NLXA 1K40A 3UNGC 4A4AA 3NMIA 3L1MA 3N2ZB 4EWCA 4KI2A 5E33A 1HE1A 1LI5A 1ZHXA 3JZ0A 3UMKA 4PJMA 5A6JA 2L7AA 4MTGA 1JRAA 1M2VB 4JTDB 3ZTZA 3H65A 1Z63A 5HSWA 1WOLA 4MVQA 2XLHA 1Z3IX 4BJTA 3PDMP 3AG2C 2YWAA 3ECSA 4ULVA 4MVSA 2A6EF 1FFTC 1BZ4A 3FAJA 3CAXA 4JURI 3W4YA 3WHNA 4EBJA 3R7CA 1ZU5A 2BC5A 3HTKC 4PACA 2Y3GA 5JT4A 3DM9B 2QLAA 4ZLCA 5KYUB 1KNYA 2V3CC 4CSAC 2OKUA 5T3TA 4RDAA 2G3KA 1I4ZA 3POVA 1OW8A 2B0JA 1LS4A 2A1DD 2HV6A 2OOCA 2WVNA 2H7OA 1NU9C 5F5HA 1E2XA 2OU6A 2WB7A 1ZW3A 3ABLC 3GWNA 4GQHA 4MVUA 1N1CA 1C03A 4KBLA 5DLJA 5KYXB 3U3BA 5HV9A 3OEOA 3TOMA 2JX0A 1WGWA 2I8BA 3CSKA 5L0IA 2HUJA 1LS1A 2IXMA 4N6HA 3ZQYA 3TK0A 2YEVA 2NPUA 4CS8C 2L6FA 3LJBA 3Q7GA 1RKCA 1LKXA 2W4MA 3VRCA 3EGXB 5JS5A 2EILC 4E0HA 3DZAA 3K1IC 2VB6A 4O7GA 5COMA 5KYNA 4BJ1A 2KSFA 4DRHB 4FWVA 4EBKA 2J7PD 3O6XA 1O5HA 1NFOA 3IQ6A 1Z7Qc 3IQTA 5TJ5E 4E18A 2C04A 5KYYA 1TWCA 2LP4A 2OEXA 2D4UA 4HFKB 4JW1A 4L6RA 4U5EE 4OIOF 4O6NA 4W8KA 5DVWA 5BQHA 1XZPA 2Q9CA 4ONSA 1OCRC 4PFOA 2Y3DA 3O55A 2J9VA 3FXHA 1M2VA 3SXKA 1MNEA 4PR9A 2LCHA 3KYJA 5KYWB 2IXNA 4N6CA 2AVKA 5K0IA 4XPWA 2BE5F 3ITFA 3EHMA 1R4TA 4MVRA 1E84A 3EH1A 1G4US 1T6UA 2EPMX 2FAPB 2H7VC 5JSLA 3GM2A 4JTCB 4ANJA 4CS9A 3ABMC 3W2VA 1BR2A 1Z5ZA 3ZTMA 3B9QA 1EI7A 1G5ZA 3B0UX 2P6VA 4LACB 4UDVA 3L0IA 1VLTA 1D1AA 2XLVA 1J8YF 2YLIA 2TMVP 1HMOA 3VM6A 3U0CA 1F1MA 3RFYA 3EFOB 3MBGA 1TKNA 2GA0A 3E70C 3NMKA 3ZVRA 4DBQA 1TQGA 2CNWA 5DQTA 2WVOA 2HSBA 1IZMA 3FVYA 2MHRA 1OR3A 4DRJB 2PFDA 4NC3A 2PX0A 3PHF2 3WAQA 4WGYA 1ZHYA 2A69F 1WASA 1C17M 2ZXRA 1SZIA 1VLSA 3FDQA 4K7BA 2GAQA 3M1CB 3EH2A 4ZLDA 2AWYA 3A9CA 3IHUA 2XL8A 2AP3A 2HKVA 3ZQVA 5D91A 2L6HA 1NZEA 3AG1C 2ZD9A 2DGJA 4XEKA 1LVKA 4YK5A 3A11A 4I1MA 5T1DB 1VYIA 4H54A 1CPRA 1NFNA 2R7OA 4AX2A 3LUTB 1BR4A 5JP7A 4B6IA 4BJ5C 2EIKC 3C8GB 3HKKA 2R7SA 3W2WA 3M4BA 2GWWA 3ABKC 4A2NB 4XPYA 2KGOA 2NG1A 3GM1A 1ZHZA 4MW3A 1M2OA 4YT4A 1Q0FA 3QVZA 4J30B 5GPGB 3U3FA 4CS9C 3CEXA 3QMKA 3B29A 3U5SA 3NYJA 5EK0A 2YL7A 3JCUQ 2VASA 2XS1A 3FOPA 2OJED 1HW2A 3S29A 4NCQA 2L81A 4F4BA 4YL0A 4DOZA 2J0WA 3NKEA 4MVZA 3IEEA 3SXYA 1YZCA 3NG1A 4N06A 2J46A 3CZ6A 4DBRA 3S84A 2LIGA 3AQBA 4K1OA 2FGYA 4MTFA 4JJGA 4RD9A 4XQ1A 5DQZA 4C3DA 3U2MA 3U9MA 2XXAB 3MLGA 5KYYB 3EFOA 4OD4A 1Q0KA 1S05A 2AWCA 3TQOA 2CNWD 2XL4A 4JRZA 4OD5A 1PV3A 5FCLA 3FHDA 1M57C 2DYRC 2PNOA 3HNIA 3ATPA 2G3VA 3L8IA 4IWBA 3N24A 3V5XA 3PMRA 2P0NA 1QPUA 3BRJA 4DJ9A 2J8WA 2IM8A 3NKDA 3GANA 1OKKA 3GODA 2J0XA 1ST6A 2J45A 3GORA 3DAFA 3LLIA 4YT8A 2W9YA 5A6KA 1T6IA 3T6GB 2XXAA 4WABA 3RF3A 3UMHA 3AG3C 1BR1A 4QDLA 1KTMA 5JRAA 2M4EA 3NMJA 5E3CA 3O39A 1YZAA 4CDAA 5JUAA 2NSGA 4N4WA 4CDVA 1UG7A 1VTMP 2CW0F 3LNRA 3I5PA 4C3EA 3C8GA 3JT1A 3GEEA 3KYIA 4HEAJ 3L8JA 1Y6DA 4ER9A 4JCZA 4DVZA 1FTSA 2P7VA 1DOWA 3X1OA 5AC4A 3N0TA 2IOQA 1OCCC 4GEHA 1HMDA 4R32A 2IXOA 2J9WA 5E3AA 4Q5SF 1JPJA 3GEIA 1SR2A 5EGYA 2UUIA 2WVQA 1VOMA 2R7WA 4G7HF 2KNHA 3MX3A 4P9TA 1YA9A 1OR2A 1NSGB 4Z9JA 4BJ6A 1QSPA 2DYSC 3MYIA 4J32B 2YL0A 4X0RA 2Q9BA 2R7UA 4MNDA 2XM4A 4DVYP 1U0BB 256BA 4YT2A 1K04A 4G7ZF 5F28E 3ASOC 1FFHA 2PX3A 3SZRA 1ORJA 4YT5A 4E7SA 4W8PA 2XLDA 2LK4A 3ZSUA 2XRHA 2OG2A 4E17A 1V54C 1OXBA 2EPKX 3S28A 3HNJA 4XPXA 3LEOA 4MQ9F 4EBBA 1WN0A 4BJ5A 4U9DA 4DRIB 5F5FA 1FMVA 2IYLD 4YN0B 3S0XA 1H9GA 1A7EA 2IBFA 2PBEA 4Q4ZF 4G78A 1PD0A 1EQ1A 1YYJA 3B0PA 1JOGA 4JC7A 1LM3B 1I5NA 3IPMO 3G4ZA 2YL3A 1YA7O 1W2WA 2HS5A 1YAUO 2ASRA 2YRFA 2YVKA 3E9VA 3JTLO 4XTKA 4CS7A 1MMDA 3BEHA 5E2QA 1LE2A 3LAYA 1OCOC 2D5RB 2XLEA 5JLIA 5CI8A 4C3BA 1VMAA 5AGFA 4CIPA 1B68A 5DS4A 2Q7RA 2UUHA 1JPNA 2HZ8A 3DE8A 3JSEO 3TJ5A 1D1CA 3W8HA 2Y3BA 3MFNA 2HMQA 4G0HA 4U5GA 4BG0A 4CX9A 2W4BA 1LE4A 2EPOA 2P1AA 3C8GD 4IJJA 5L3VA 2PP4A 5CIVA 1E86A 2ETSA 3V7OA 1GQAA 3QVYA 4G7OF 4FX5A 2GDCA 1YDIA 2VH3A 4WGZA 1U6HA 1JMWA 1YVIA 5A6BA 1EA8A 2O9XA 4U5HA 4U5FE 4AK9A 4CIHA 3H2UA 3KL4A 4CBEA 4BJ6C 1U89A 4O79A 3I5QA 1EKYA 3RYLA 3G4XA 2LFFA 2QE9A 4AL1A 3C8ZA 2XS8A 4YJWA 4Z9IA 2L6GA 4PFPA 1YYXA 2R7XA 2R03A 1D1BA 5L0FA 2XLOA 1V4AA 3X2QC 4QI0A 3SXZA 1MNDA 2EIMC 3RW0A 1TR2A 2H8AA 2JD3A 3JSZA 3EJNA 2LD6A 3K1HA 4LERA 2X0CA 4FAPB 4D4NA 3JYHA 1QVXA 3C62A 1WWPA 2KQ9A 3LLKA 2OCCC 3U9JA 3U2LA 1O87A 1D0YA 3DJUB 3C18A 3KPHA 3RKOF 4MVMA 5CI9A 4IAQA 3SYNA 3FAPB 3AG4C 5B1BC 3UMIA 1LPEA 2YLDA 2B0HA 2LFDA 2YLGA 3DM5A 4EIYA 3K6BA 5L0CA 5DS6A 4OIQF 1ZHWA 3UR3C 2A6HF 2X51A 3DI5A 5A6AA 4OIRF 3QW1A
chains in the Genus database with same CATH topology
1T01A 4P9TA 3T6GB 4IGGA 3VF0A 3MYIA 1TR2A 3RF3A 5FZTA 1XWJA 2X0CA 1L7CA 4K1OA 3ZDLA 3H2VA 3TJ5A 1QKRA 1SYQA 5L0HA 4E18A 1ZVZA 5L0FA 4W8PA 5L0GA 1DOVA 1ZW2A 5L0DA 2LQGA 1ZW3A 4E17A 2B0HA 2GWWA 2GDCA 1YDIA 2L7AA 4ONSA 1U6HA 1DOWA 3H2UA 5L0IA 1H6GA 1U89A 4DJ9A 3TJ6A 2IBFA 2HSQA 4PR9A 5L0CA 3S90A 4EHPA 5L0JA 1ST6A 1RKEB 1RKCA 1RKEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T01 A;  4P9T A;  3T6G B;  4IGG A;  3VF0 A;  3MYI A;  1TR2 A;  3RF3 A;  5FZT A;  1XWJ A;  2X0C A;  1L7C A;  4K1O A;  3ZDL A;  3H2V A;  3TJ5 A;  1QKR A;  1SYQ A;  5L0H A;  4E18 A;  1ZVZ A;  5L0F A;  4W8P A;  5L0G A;  1DOV A;  1ZW2 A;  5L0D A;  2LQG A;  1ZW3 A;  4E17 A;  2B0H A;  2GWW A;  2GDC A;  1YDI A;  2L7A A;  4ONS A;  1U6H A;  1DOW A;  3H2U A;  5L0I A;  1H6G A;  1U89 A;  4DJ9 A;  3TJ6 A;  2IBF A;  2HSQ A;  4PR9 A;  5L0C A;  3S90 A;  4EHP A;  5L0J A;  1ST6 A;  1RKE B;  1RKC A;  1RKE A; 
#chains in the Genus database with same CATH topology
 1M56 C;  2AU5 A;  3QTH A;  4IAR A;  4KNV A;  4JE9 A;  1E83 A;  4JKV A;  1QLE C;  3U8V A;  3C63 A;  4MW8 A;  1OCZ C;  5FZT A;  2XLW A;  2FFH A;  1MMN A;  3RQG A;  3ZDL A;  1TFK B;  2JPU A;  3FMS A;  1GM5 A;  2NUT A;  3RQE A;  1GS9 A;  5DS5 A;  1VYK A;  3TD7 A;  1AEP A;  2NUP A;  2OJQ A;  3DKA A;  2QY9 A;  4XLN F;  3W8I A;  3KMI A;  1RXQ A;  4CJO A;  4JCH A;  4NY3 A;  2WZL A;  4YWQ A;  1H9T A;  2R05 A;  3EZI A;  3HNL A;  3M15 A;  4AE4 A;  3J06 A;  1J8M F;  1WTY A;  2HJM A;  4Q7C A;  4IAO A;  2BL2 A;  1L3P A;  3UGP A;  3VAY A;  2H7B A;  2CGE A;  2V26 A;  4U5C E;  3U8P A;  5L0J A;  2EIJ C;  1FAP B;  1QQ3 A;  2CYD A;  3GM3 A;  5JVE A;  1CGN A;  1BBH A;  1RMV A;  1Y4C A;  1FR0 A;  2YKZ A;  3R2P A;  3RVY A;  2Y3H A;  4C7O A;  4HE8 D;  1MMA A;  2YL1 A;  1NU7 D;  2EPN A;  4E7Z A;  3LEV A;  4H4K C;  2ZXO A;  3DWW A;  1NBB A;  3LES A;  2MYS A;  2A0B A;  4P6I C;  2P61 A;  4AL0 A;  1ZVZ A;  5B1A C;  1R5I D;  4LLE A;  2KW3 C;  3TOL A;  5BUO A;  1DOV A;  1ZW2 A;  2VCC A;  1TFO B;  2HV7 A;  2XSE A;  4NTF A;  2MWQ A;  3QZC A;  5L0D A;  3NRH A;  3US6 A;  1ZU4 A;  5A69 A;  3LS1 A;  3SEO A;  3UGO A;  3OA1 A;  4CJG A;  1A0B A;  3ZC4 A;  4D4X A;  2LSE A;  2Z15 A;  1A7V A;  1QZX A;  4JTA B;  4XWJ A;  2XLM A;  3S90 A;  4E0I A;  5COF A;  4NTA A;  3DD7 A;  1VK5 A;  1E85 A;  2QNL A;  1RKE B;  1V74 B;  2KK1 A;  1C02 A;  1NG1 A;  2R9R B;  2R02 A;  3AQC A;  3HLZ A;  1ZHT A;  2J9U A;  2YZS A;  3I4U A;  1ZYR F;  3Q7L A;  3ZWI A;  1A41 A;  4XLP F;  3RQF A;  4EKW A;  3EG9 A;  5EHH A;  1PCX A;  4LDR A;  1JAF A;  2KYH A;  2R7V A;  3ASN C;  3G50 A;  4K0D A;  3IQC A;  3LNM B;  2ZPA A;  3DJN B;  5L0H A;  3EQL F;  1SMY F;  2A0U A;  3S27 A;  2E87 A;  2Q4F A;  2WL8 A;  2XM0 A;  3OWT A;  5L0G A;  1Q0D A;  2KC3 A;  2RSE B;  2G62 A;  1GGQ A;  2I15 A;  4O6Y A;  1V55 C;  3DAG A;  3CQZ A;  3RIP A;  3ZIB A;  5AC5 A;  2R7T A;  3EGD A;  1A7D A;  4I3M A;  3DE9 A;  1RJ9 A;  4MS2 A;  3TJ6 A;  1WAT A;  3T6J A;  1VB5 A;  4LDQ A;  1OKK D;  3B71 A;  1RCP A;  3MYF A;  1Z23 A;  4BEJ A;  3JYY A;  4IB4 A;  1APC A;  1MMG A;  3HJC A;  4IGG A;  4XEF A;  2HFI A;  2VCB A;  1AUE A;  3Q6M A;  1XWJ A;  1XZQ A;  4WJ0 A;  5B3S C;  1JR8 A;  2IXP A;  4J7Y A;  1L7C A;  3M79 A;  3TUL A;  1OW7 A;  3O10 A;  3F46 A;  3K33 A;  4MTO A;  1BDJ B;  2NUT B;  2C03 A;  1LI7 A;  1HW1 A;  1TWG A;  1YJG A;  1FMW A;  2NUP B;  4IRU A;  1OW6 A;  3WOD F;  2Y39 A;  2VC9 A;  3RVZ A;  3JRT A;  3GEH A;  4I1O B;  4NTB A;  2PF4 E;  4OIP F;  4P9F A;  2HJ3 A;  2R25 A;  1T9K A;  1Z6A A;  4AE4 B;  4EUK B;  2EPL X;  1H6G A;  1KU2 A;  2CDQ A;  2HSQ A;  1HE9 A;  1D0X A;  2NSF A;  2QUP A;  1YLM A;  4O6M A;  4U5B E;  1H7I A;  4EHP A;  2OEV A;  3HNK A;  2EIN C;  1IW7 F;  3AOU A;  1ZZP A;  1RKE A;  2LQG A;  3GWL A;  3T6B A;  5B3I A;  2ICW G;  3NDB B;  1ORY A;  3DXJ F;  1YAR O;  4NQF A;  4PJL A;  5KYU A;  1PD1 A;  1CGM E;  4C7O B;  2M64 A;  3LS0 A;  3Q6N A;  2R7Q A;  1OXK A;  2R7R A;  4ULW A;  4KC9 A;  1QKR A;  2Q9A A;  3NYL A;  4YL1 A;  3WG7 C;  4JIO A;  2GFH A;  1TWH A;  2W45 A;  1M6T A;  3PCV A;  2XL6 A;  2Y69 C;  1CGO A;  4Z9H A;  3KH2 A;  2WZG A;  1I4Y A;  3F47 A;  3JRM O;  1HY5 A;  4JJF A;  2DB4 A;  4JVS A;  5KYX A;  3FOO A;  3V5Y A;  4OIN F;  2CCY A;  3RH3 A;  2YQY A;  2OQM A;  2QTV A;  4JEA A;  4LLC A;  4JZA A;  1OQC A;  2L9J A;  4M63 A;  3KKB A;  3NYM A;  1S7Z A;  4I44 A;  3EGX A;  1T01 A;  4XEV A;  3EHN A;  1UFB A;  3EZH A;  3K7D A;  3VF0 A;  3V5Z A;  4JEB A;  3VYW A;  4BEM J;  4YL3 A;  1K05 A;  1AVO B;  1CPQ A;  3EG9 B;  4FES A;  4U9E A;  5D92 A;  2Q3T A;  3M4C A;  5BQG A;  4LDK A;  5L3Q A;  3DMD A;  1SYQ A;  4DXW A;  5COG A;  1O3U A;  3SNH A;  4PJJ A;  3ZG1 A;  4CSA A;  1T5O A;  2A68 F;  4PK4 A;  4U5D E;  1Q0G A;  1T6Q A;  2KJG A;  4BPM A;  2HMZ A;  3B0V C;  5A6B D;  3K66 A;  4KNW A;  1FNT c;  1MQV A;  2VCA A;  1SF8 A;  3EGD B;  5IY5 C;  5KYW A;  3SP1 A;  1RJ9 B;  2Q00 A;  4CDY A;  1G8X A;  4GYT A;  5T3W A;  5BQI A;  3EPV A;  2WZF A;  4MVO A;  3T9O A;  2ZXW C;  3L34 A;  3S9O A;  1ORS C;  2ZXP A;  2YHS A;  2RD9 A;  3T4R A;  4QI2 A;  4RBN A;  1D0Z A;  2J9B A;  4CS8 A;  3AJM A;  1LIH A;  2DI3 A;  3C7J A;  2F22 A;  3QW0 A;  3SXM A;  2J7P A;  1TWA A;  3AGT A;  3AGU A;  3H2V A;  4J7T A;  1Q0M A;  3K1I A;  1G4W R;  3IQ5 A;  4HFF B;  4PJN A;  1NLX A;  1K40 A;  3UNG C;  4A4A A;  3NMI A;  3L1M A;  3N2Z B;  4EWC A;  4KI2 A;  5E33 A;  1HE1 A;  1LI5 A;  1ZHX A;  3JZ0 A;  3UMK A;  4PJM A;  5A6J A;  2L7A A;  4MTG A;  1JRA A;  1M2V B;  4JTD B;  3ZTZ A;  3H65 A;  1Z63 A;  5HSW A;  1WOL A;  4MVQ A;  2XLH A;  1Z3I X;  4BJT A;  3PDM P;  3AG2 C;  2YWA A;  3ECS A;  4ULV A;  4MVS A;  2A6E F;  1FFT C;  1BZ4 A;  3FAJ A;  3CAX A;  4JUR I;  3W4Y A;  3WHN A;  4EBJ A;  3R7C A;  1ZU5 A;  2BC5 A;  3HTK C;  4PAC A;  2Y3G A;  5JT4 A;  3DM9 B;  2QLA A;  4ZLC A;  5KYU B;  1KNY A;  2V3C C;  4CSA C;  2OKU A;  5T3T A;  4RDA A;  2G3K A;  1I4Z A;  3POV A;  1OW8 A;  2B0J A;  1LS4 A;  2A1D D;  2HV6 A;  2OOC A;  2WVN A;  2H7O A;  1NU9 C;  5F5H A;  1E2X A;  2OU6 A;  2WB7 A;  1ZW3 A;  3ABL C;  3GWN A;  4GQH A;  4MVU A;  1N1C A;  1C03 A;  4KBL A;  5DLJ A;  5KYX B;  3U3B A;  5HV9 A;  3OEO A;  3TOM A;  2JX0 A;  1WGW A;  2I8B A;  3CSK A;  5L0I A;  2HUJ A;  1LS1 A;  2IXM A;  4N6H A;  3ZQY A;  3TK0 A;  2YEV A;  2NPU A;  4CS8 C;  2L6F A;  3LJB A;  3Q7G A;  1RKC A;  1LKX A;  2W4M A;  3VRC A;  3EGX B;  5JS5 A;  2EIL C;  4E0H A;  3DZA A;  3K1I C;  2VB6 A;  4O7G A;  5COM A;  5KYN A;  4BJ1 A;  2KSF A;  4DRH B;  4FWV A;  4EBK A;  2J7P D;  3O6X A;  1O5H A;  1NFO A;  3IQ6 A;  1Z7Q c;  3IQT A;  5TJ5 E;  4E18 A;  2C04 A;  5KYY A;  1TWC A;  2LP4 A;  2OEX A;  2D4U A;  4HFK B;  4JW1 A;  4L6R A;  4U5E E;  4OIO F;  4O6N A;  4W8K A;  5DVW A;  5BQH A;  1XZP A;  2Q9C A;  4ONS A;  1OCR C;  4PFO A;  2Y3D A;  3O55 A;  2J9V A;  3FXH A;  1M2V A;  3SXK A;  1MNE A;  4PR9 A;  2LCH A;  3KYJ A;  5KYW B;  2IXN A;  4N6C A;  2AVK A;  5K0I A;  4XPW A;  2BE5 F;  3ITF A;  3EHM A;  1R4T A;  4MVR A;  1E84 A;  3EH1 A;  1G4U S;  1T6U A;  2EPM X;  2FAP B;  2H7V C;  5JSL A;  3GM2 A;  4JTC B;  4ANJ A;  4CS9 A;  3ABM C;  3W2V A;  1BR2 A;  1Z5Z A;  3ZTM A;  3B9Q A;  1EI7 A;  1G5Z A;  3B0U X;  2P6V A;  4LAC B;  4UDV A;  3L0I A;  1VLT A;  1D1A A;  2XLV A;  1J8Y F;  2YLI A;  2TMV P;  1HMO A;  3VM6 A;  3U0C A;  1F1M A;  3RFY A;  3EFO B;  3MBG A;  1TKN A;  2GA0 A;  3E70 C;  3NMK A;  3ZVR A;  4DBQ A;  1TQG A;  2CNW A;  5DQT A;  2WVO A;  2HSB A;  1IZM A;  3FVY A;  2MHR A;  1OR3 A;  4DRJ B;  2PFD A;  4NC3 A;  2PX0 A;  3PHF 2;  3WAQ A;  4WGY A;  1ZHY A;  2A69 F;  1WAS A;  1C17 M;  2ZXR A;  1SZI A;  1VLS A;  3FDQ A;  4K7B A;  2GAQ A;  3M1C B;  3EH2 A;  4ZLD A;  2AWY A;  3A9C A;  3IHU A;  2XL8 A;  2AP3 A;  2HKV A;  3ZQV A;  5D91 A;  2L6H A;  1NZE A;  3AG1 C;  2ZD9 A;  2DGJ A;  4XEK A;  1LVK A;  4YK5 A;  3A11 A;  4I1M A;  5T1D B;  1VYI A;  4H54 A;  1CPR A;  1NFN A;  2R7O A;  4AX2 A;  3LUT B;  1BR4 A;  5JP7 A;  4B6I A;  4BJ5 C;  2EIK C;  3C8G B;  3HKK A;  2R7S A;  3W2W A;  3M4B A;  2GWW A;  3ABK C;  4A2N B;  4XPY A;  2KGO A;  2NG1 A;  3GM1 A;  1ZHZ A;  4MW3 A;  1M2O A;  4YT4 A;  1Q0F A;  3QVZ A;  4J30 B;  5GPG B;  3U3F A;  4CS9 C;  3CEX A;  3QMK A;  3B29 A;  3U5S A;  3NYJ A;  5EK0 A;  2YL7 A;  3JCU Q;  2VAS A;  2XS1 A;  3FOP A;  2OJE D;  1HW2 A;  3S29 A;  4NCQ A;  2L81 A;  4F4B A;  4YL0 A;  4DOZ A;  2J0W A;  3NKE A;  4MVZ A;  3IEE A;  3SXY A;  1YZC A;  3NG1 A;  4N06 A;  2J46 A;  3CZ6 A;  4DBR A;  3S84 A;  2LIG A;  3AQB A;  4K1O A;  2FGY A;  4MTF A;  4JJG A;  4RD9 A;  4XQ1 A;  5DQZ A;  4C3D A;  3U2M A;  3U9M A;  2XXA B;  3MLG A;  5KYY B;  3EFO A;  4OD4 A;  1Q0K A;  1S05 A;  2AWC A;  3TQO A;  2CNW D;  2XL4 A;  4JRZ A;  4OD5 A;  1PV3 A;  5FCL A;  3FHD A;  1M57 C;  2DYR C;  2PNO A;  3HNI A;  3ATP A;  2G3V A;  3L8I A;  4IWB A;  3N24 A;  3V5X A;  3PMR A;  2P0N A;  1QPU A;  3BRJ A;  4DJ9 A;  2J8W A;  2IM8 A;  3NKD A;  3GAN A;  1OKK A;  3GOD A;  2J0X A;  1ST6 A;  2J45 A;  3GOR A;  3DAF A;  3LLI A;  4YT8 A;  2W9Y A;  5A6K A;  1T6I A;  3T6G B;  2XXA A;  4WAB A;  3RF3 A;  3UMH A;  3AG3 C;  1BR1 A;  4QDL A;  1KTM A;  5JRA A;  2M4E A;  3NMJ A;  5E3C A;  3O39 A;  1YZA A;  4CDA A;  5JUA A;  2NSG A;  4N4W A;  4CDV A;  1UG7 A;  1VTM P;  2CW0 F;  3LNR A;  3I5P A;  4C3E A;  3C8G A;  3JT1 A;  3GEE A;  3KYI A;  4HEA J;  3L8J A;  1Y6D A;  4ER9 A;  4JCZ A;  4DVZ A;  1FTS A;  2P7V A;  1DOW A;  3X1O A;  5AC4 A;  3N0T A;  2IOQ A;  1OCC C;  4GEH A;  1HMD A;  4R32 A;  2IXO A;  2J9W A;  5E3A A;  4Q5S F;  1JPJ A;  3GEI A;  1SR2 A;  5EGY A;  2UUI A;  2WVQ A;  1VOM A;  2R7W A;  4G7H F;  2KNH A;  3MX3 A;  4P9T A;  1YA9 A;  1OR2 A;  1NSG B;  4Z9J A;  4BJ6 A;  1QSP A;  2DYS C;  3MYI A;  4J32 B;  2YL0 A;  4X0R A;  2Q9B A;  2R7U A;  4MND A;  2XM4 A;  4DVY P;  1U0B B;  256B A;  4YT2 A;  1K04 A;  4G7Z F;  5F28 E;  3ASO C;  1FFH A;  2PX3 A;  3SZR A;  1ORJ A;  4YT5 A;  4E7S A;  4W8P A;  2XLD A;  2LK4 A;  3ZSU A;  2XRH A;  2OG2 A;  4E17 A;  1V54 C;  1OXB A;  2EPK X;  3S28 A;  3HNJ A;  4XPX A;  3LEO A;  4MQ9 F;  4EBB A;  1WN0 A;  4BJ5 A;  4U9D A;  4DRI B;  5F5F A;  1FMV A;  2IYL D;  4YN0 B;  3S0X A;  1H9G A;  1A7E A;  2IBF A;  2PBE A;  4Q4Z F;  4G78 A;  1PD0 A;  1EQ1 A;  1YYJ A;  3B0P A;  1JOG A;  4JC7 A;  1LM3 B;  1I5N A;  3IPM O;  3G4Z A;  2YL3 A;  1YA7 O;  1W2W A;  2HS5 A;  1YAU O;  2ASR A;  2YRF A;  2YVK A;  3E9V A;  3JTL O;  4XTK A;  4CS7 A;  1MMD A;  3BEH A;  5E2Q A;  1LE2 A;  3LAY A;  1OCO C;  2D5R B;  2XLE A;  5JLI A;  5CI8 A;  4C3B A;  1VMA A;  5AGF A;  4CIP A;  1B68 A;  5DS4 A;  2Q7R A;  2UUH A;  1JPN A;  2HZ8 A;  3DE8 A;  3JSE O;  3TJ5 A;  1D1C A;  3W8H A;  2Y3B A;  3MFN A;  2HMQ A;  4G0H A;  4U5G A;  4BG0 A;  4CX9 A;  2W4B A;  1LE4 A;  2EPO A;  2P1A A;  3C8G D;  4IJJ A;  5L3V A;  2PP4 A;  5CIV A;  1E86 A;  2ETS A;  3V7O A;  1GQA A;  3QVY A;  4G7O F;  4FX5 A;  2GDC A;  1YDI A;  2VH3 A;  4WGZ A;  1U6H A;  1JMW A;  1YVI A;  5A6B A;  1EA8 A;  2O9X A;  4U5H A;  4U5F E;  4AK9 A;  4CIH A;  3H2U A;  3KL4 A;  4CBE A;  4BJ6 C;  1U89 A;  4O79 A;  3I5Q A;  1EKY A;  3RYL A;  3G4X A;  2LFF A;  2QE9 A;  4AL1 A;  3C8Z A;  2XS8 A;  4YJW A;  4Z9I A;  2L6G A;  4PFP A;  1YYX A;  2R7X A;  2R03 A;  1D1B A;  5L0F A;  2XLO A;  1V4A A;  3X2Q C;  4QI0 A;  3SXZ A;  1MND A;  2EIM C;  3RW0 A;  1TR2 A;  2H8A A;  2JD3 A;  3JSZ A;  3EJN A;  2LD6 A;  3K1H A;  4LER A;  2X0C A;  4FAP B;  4D4N A;  3JYH A;  1QVX A;  3C62 A;  1WWP A;  2KQ9 A;  3LLK A;  2OCC C;  3U9J A;  3U2L A;  1O87 A;  1D0Y A;  3DJU B;  3C18 A;  3KPH A;  3RKO F;  4MVM A;  5CI9 A;  4IAQ A;  3SYN A;  3FAP B;  3AG4 C;  5B1B C;  3UMI A;  1LPE A;  2YLD A;  2B0H A;  2LFD A;  2YLG A;  3DM5 A;  4EIY A;  3K6B A;  5L0C A;  5DS6 A;  4OIQ F;  1ZHW A;  3UR3 C;  2A6H F;  2X51 A;  3DI5 A;  5A6A A;  4OIR F;  3QW1 A; 
#chains in the Genus database with same CATH homology
 1T01 A;  4P9T A;  3T6G B;  4IGG A;  3VF0 A;  3MYI A;  1TR2 A;  3RF3 A;  5FZT A;  1XWJ A;  2X0C A;  1L7C A;  4K1O A;  3ZDL A;  3H2V A;  3TJ5 A;  1QKR A;  1SYQ A;  5L0H A;  4E18 A;  1ZVZ A;  5L0F A;  4W8P A;  5L0G A;  1DOV A;  1ZW2 A;  5L0D A;  2LQG A;  1ZW3 A;  4E17 A;  2B0H A;  2GWW A;  2GDC A;  1YDI A;  2L7A A;  4ONS A;  1U6H A;  1DOW A;  3H2U A;  5L0I A;  1H6G A;  1U89 A;  4DJ9 A;  3TJ6 A;  2IBF A;  2HSQ A;  4PR9 A;  5L0C A;  3S90 A;  4EHP A;  5L0J A;  1ST6 A;  1RKE B;  1RKC A;  1RKE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...