2AP3A

1.6 a crystal structure of a conserved protein of unknown function from staphylococcus aureus
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
196
structure length
192
Chain Sequence
AHMGIQRPTSTTTDKKEIKAYLKQVDKIKDDEEPIKTVGKKIAELDEKKKKLTEDVNSKDTAVRGKAVKDLIKNADDRLKEFEKEEDAIKKSEQDFKKADNIDNDVKRKEVKQLDDVLKEKYKLHSDYAKAYKKAVNSEKTLFKYLNQNDATQQGVNEKSKAIEQNYKKLKEVSDKYTKVLNKVQKEKQDVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords conserved hypothetical protein
publication title 1.6A crystal structure of a conserved hypothetical protein from Staphylococcus aureus MW2
rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Structural genomics, unknown function
total genus 92
structure length 192
sequence length 196
ec nomenclature
pdb deposition date 2005-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10368 YkyA Putative cell-wall binding lipoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.570 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) YkyA-like 2ap3A00
2AP3A
chains in the Genus database with same CATH superfamily
1LE2A 2LCHA 1OR2A 2YQYA 3EH2A 2A6HF 3ATPA 1OCOC 2YZSA 5B1BC 5F5FA 1D1AA 1PD0A 2A0UA 1Z3IX 2ICWG 2B0JA 3GORA 1ZHZA 3Q6NA 5AGFA 1YLMA 3IQ5A 3QW1A 4H54A 4XWJA 3UMKA 2HJ3A 3MFNA 2M4EA 4DVZA 1BR1A 2ZXWC 1EKYA 1GS9A 3QZCA 2WVOA 4JKVA 2H8AA 2XLEA 3DKAA 1VOMA 3FHDA 3U2MA 5KYXB 2R7RA 1RXQA 2CDQA 2QLAA 3W2WA 4JURI 4D4NA 3RQFA 1MMDA 2Q9BA 1FTSA 2HZ8A 3T6BA 1T6QA 4AE4B 5KYYB 5JSLA 3HJCA 4I3MA 2EPNA 2D5RB 2BL2A 5L0JA 2OU6A 2KW3C 4G7ZF 2KC3A 1Q0MA 2EILC 5DLJA 4XPWA 1Z6AA 5DS6A 1E2XA 4CIHA 1MNEA 3L0IA 4JTDB 1JMWA 5T3TA 5BQIA 1Y6DA 3V5YA 2YL7A 4XEVA 4B6IA 1RKCA 1SMYF 2OQMA 3S27A 1JPJA 1SR2A 5BUOA 1KTMA 1VMAA 2LIGA 3AG1C 3O39A 4LDRA 1YARO 3HKKA 2NSGA 1JRAA 1D0XA 4O6MA 3HLZA 1JAFA 4LDQA 4PJLA 3G50A 4EHPA 2IOQA 4O7GA 1FR0A 1G4US 2G62A 2HSBA 4CS9A 4BJ1A 3S90A 1ZZPA 4NTBA 3TOMA 3V7OA 3JCUQ 4AX2A 3K7DA 3AOUA 2R7SA 2KK1A 3DMDA 4O6YA 1A7VA 4OIOF 3A11A 3CAXA 2A68F 3RFYA 3U9MA 4OIPF 1YYXA 4C3BA 5L3VA 2P6VA 3FOPA 1ZHWA 3M79A 4MTOA 4U5CE 3US6A 4YT2A 2DYRC 4L6RA 3VF0A 3E9VA 3SP1A 4CBEA 2QTVA 1G4WR 2Q3TA 1M2VA 2R7WA 4Z9JA 1O3UA 4MNDA 3IQTA 3NKDA 4JEAA 3B29A 3NRHA 1O87A 4U5DE 4RBNA 3EGXA 4P9FA 2ZPAA 4CDVA 4FAPB 3UGPA 3KPHA 2CNWD 3RIPA 3KL4A 3OA1A 3T4RA 1H9GA 5B3IA 1ZHTA 2H7BA 5D92A 3L8JA 1GGQA 4GYTA 4KC9A 2EPKX 1U89A 1V74B 1VLSA 1LS1A 2G3VA 2IXPA 1RKEA 2J7PA 3ASOC 3QVYA 4BJ6A 4W8PA 2FFHA 3NDBB 2IBFA 3EJNA 1WGWA 2NPUA 2AU5A 3PHF2 3RF3A 3B9QA 3C8GA 2J9BA 4CIPA 3K1HA 1A41A 2EPOA 1T01A 4N6HA 1VB5A 5JT4A 3W4YA 3WG7C 4G78A 2J9VA 1YZCA 3K1IC 4NY3A 5JP7A 4XLNF 3TQOA 2PX3A 4U5BE 4KNWA 2YEVA 1ST6A 4XEKA 3DD7A 3TK0A 1OW8A 1CGNA 5KYWA 2LP4A 2GA0A 2Y69C 2A1DD 2B0HA 3KYIA 3M15A 1VTMP 3H2UA 4CS8C 1RJ9A 1KU2A 4EBJA 2W9YA 4LLEA 5COMA 3ABLC 3SXYA 2F22A 2J45A 2XS8A 4YT5A 1OCZC 4BPMA 4GEHA 1GM5A 4KNVA 5JRAA 2VCBA 3RQEA 1H9TA 2WVNA 1I4ZA 3Q6MA 2Y3DA 3ZTMA 1VLTA 2VH3A 3M4CA 1BZ4A 2A6EF 5CI8A 2NUPB 3LAYA 5D91A 2TMVP 4LLCA 4MVZA 2J0XA 3DJNB 3G4ZA 4PFPA 2Q7RA 2A69F 1ZHXA 4GQHA 4LDKA 4JC7A 1HE1A 5KYXA 4U5FE 2HKVA 4K7BA 4KBLA 1ZYRF 2J8WA 4WGZA 4NCQA 4PFOA 4PJNA 3U3FA 4E18A 5A6JA 4XQ1A 3LESA 2R03A 5KYYA 4MW3A 4E0HA 5COGA 2L6GA 1AVOB 3CZ6A 2Q9CA 3GWLA 2C03A 4EBKA 3KMIA 2EIJC 1WATA 3ITFA 3HNKA 4YK5A 3TD7A 2BE5F 1EQ1A 4LACB 1TWHA 2OG2A 3VRCA 4KI2A 3GEEA 2XXAB 5E2QA 3EFOB 4QI0A 5AC4A 3T9OA 3DAFA 3ABMC 3O55A 1MMAA 3WHNA 1M57C 1Z23A 4NQFA 3IEEA 4FX5A 5IY5C 4P9TA 3DWWA 1HW1A 3NMKA 1ZVZA 3E70C 2C04A 1MMNA 2DB4A 2J9WA 3AG3C 1W2WA 1MMGA 4J7TA 2X51A 4I1MA 3SZRA 1WOLA 3AGUA 4G0HA 4MTGA 3FDQA 1SF8A 3HNLA 3U3BA 1LPEA 2Y3GA 3NG1A 2XSEA 4YN0B 4DJ9A 1OQCA 4EUKB 2XL6A 3C63A 3VAYA 3W8HA 5FCLA 4A4AA 2DGJA 2VB6A 1D0ZA 1Q0GA 2L7AA 2RD9A 3AQCA 3IQCA 4U9DA 1QPUA 1TWAA 2I8BA 4AL1A 1NZEA 2XS1A 2J9UA 4CDYA 1C02A 5BQHA 1D1CA 1YJGA 2EIMC 5COFA 3MX3A 3QMKA 3EG9B 1NU7D 1ORSC 2YHSA 3NYJA 3AJMA 5EHHA 3T6JA 2AWYA 2WZLA 1B68A 2YL0A 4RDAA 2OOCA 4FESA 1YA9A 4MTFA 2ASRA 3DE8A 1LKXA 1OR3A 2NG1A 2Z15A 3DE9A 1NBBA 3JRMO 1FAPB 1NG1A 3GM3A 3IQ6A 4OINF 4EIYA 4YL1A 4FWVA 1I5NA 1T5OA 5A6BA 1VK5A 1PD1A 5DS5A 2YVKA 2ZD9A 4DBQA 2R7XA 3HTKC 3B71A 3GM2A 2P0NA 4N6CA 2HMZA 2PX0A 3JYHA 4XTKA 4DVYP 4LERA 3ZWIA 1TKNA 1Y4CA 4ULVA 3V5ZA 2AVKA 1AEPA 1LE4A 2RSEB 4YL3A 4IJJA 1A0BA 3UGOA 1J8YF 4X0RA 1OKKD 3O6XA 3I5QA 4OIRF 2XLOA 1S7ZA 3U8PA 3UNGC 5TJ5E 2V3CC 2QUPA 4U5EE 2LSEA 3L8IA 3SXMA 1EI7A 3WAQA 3ABKC 4G7HF 3F47A 1JR8A 5E3AA 1HE9A 2MHRA 2EPMX 4DBRA 2CYDA 5JVEA 4U5GA 2HV6A 3JZ0A 3U9JA 2VCAA 2Y39A 1C17M 3S28A 2NUTB 4W8KA 1Q0FA 2W45A 2Y3HA 5B1AC 1CGOA 2P1AA 1OW6A 3CQZA 5DVWA 1H7IA 2BC5A 3CEXA 4MS2A 3KYJA 3TULA 1E83A 4YT4A 3U2LA 3FXHA 1TQGA 2NUPA 5F28E 5L3QA 1OCCC 1ORYA 2KQ9A 4JCHA 3UMIA 3K1IA 2XM0A 1FFTC 3LS0A 2YL1A 4XLPF 2LFDA 3RW0A 4DOZA 3B0VC 1LVKA 2W4MA 2XLDA 4WABA 2KJGA 3CSKA 4Q7CA 1BDJB 3ZC4A 1ZU4A 3G4XA 4CS8A 2CNWA 1PCXA 5HV9A 2R7VA 1F1MA 3FAJA 1KNYA 2LQGA 1D0YA 2PFDA 4WGYA 5EK0A 1M2OA 1EA8A 1PV3A 1M56C 2PBEA 3B0PA 2XL4A 4MVQA 2E87A 4BG0A 4Z9HA 1OW7A 1A7DA 2XXAA 3AGTA 2IM8A 2R7UA 3X1OA 2IXNA 3RH3A 4BEJA 3ZQYA 4IB4A 4EKWA 4QI2A 4C3DA 4G7OF 1G8XA 2V26A 1Z7Qc 2HUJA 1QVXA 1WWPA 2R02A 3SYNA 1LI5A 5E3CA 1UG7A 3LLIA 4J30B 3RKOF 1E86A 3C18A 1ORJA 3EPVA 3KKBA 3FAPB 2EINC 4YL0A 4J32B 2ETSA 2AP3A 3SXZA 4E7SA 4ZLDA 2OEVA 2XLWA 3FMSA 4PK4A 1HMDA 2KNHA 4I44A 3ZSUA 2QNLA 3NKEA 1BR4A 4AE4A 3GEIA 1CPQA 1E84A 1QQ3A 2JPUA 3QW0A 1I4YA 4CX9A 3EHNA 5A6KA 3AG4C 3TJ5A 1E85A 2YKZA 1L3PA 5T1DB 4H4KC 2L6HA 4JRZA 3DJUB 3EZIA 3LLKA 5GPGB 3WODF 3B0UX 4HFKB 3HNIA 3K66A 3JRTA 5L0HA 2MWQA 4JIOA 2GWWA 1J8MF 4DRJB 3V5XA 3ZDLA 4ZLCA 5L0IA 4F4BA 1RKEB 5KYNA 2R7OA 3NMJA 3EGDB 5DS4A 1QKRA 2UUHA 2ZXOA 3MYIA 4ONSA 3ZG1A 5HSWA 3SXKA 3C7JA 4MVSA 2HV7A 3U8VA 1JPNA 2HFIA 3SEOA 3W2VA 3K6BA 4HE8D 4PJJA 3S9OA 2KYHA 3C62A 3JSZA 1CGME 3I4UA 1H6GA 1TWGA 1NFOA 4OD5A 4WJ0A 2X0CA 1QSPA 2I15A 4U9EA 3NYMA 1CPRA 1NU9C 1WASA 3NMIA 5L0FA 1L7CA 5KYWB 4XPYA 1YA7O 5L0GA 4JTAB 2R05A 1ZHYA 1K04A 2DYSC 3S29A 3TJ6A 4JJGA 4K0DA 4DRIB 5CI9A 1HMOA 4M63A 1Z5ZA 4D4XA 4JVSA 2Q00A 1OXKA 1XZQA 5JUAA 2OJQA 3W8IA 3IPMO 5DQZA 4E7ZA 4JJFA 1QZXA 4IARA 5KYUB 3MLGA 1SYQA 2CGEA 3POVA 3GODA 4PACA 1OCRC 3UR3C 1Q0KA 1GQAA 2YLIA 4R32A 4PR9A 2IYLD 1FMWA 1LM3B 3H65A 1VYIA 2AWCA 2NUTA 3X2QC 5L0DA 3S0XA 1D1BA 1IW7F 4YWQA 3LNRA 1FFHA 2J0WA 3O10A 4CDAA 3MBGA 256BA 2OJED 2YLGA 3GEHA 3N0TA 2ZXRA 4C7OB 3VM6A 2WZGA 3ECSA 3GM1A 4E0IA 2D4UA 2OKUA 2L81A 4Z9IA 1ZW2A 1WN0A 2H7VC 4EWCA 5A6BD 3QTHA 4DXWA 2PF4E 2WL8A 2HS5A 3AG2C 2FGYA 4YJWA 1C03A 2CW0F 4AL0A 4EBBA 2WZFA 5F5HA 1TFOB 5AC5A 5B3SC 4ULWA 3FVYA 4JE9A 4XPXA 2JX0A 2WB7A 3RQGA 3L1MA 1K05A 3PDMP 2VCCA 4ANJA 1V54C 3DZAA 1Q0DA 2P61A 3EQLF 3LJBA 1NFNA 2QE9A 2IXMA 2R7QA 3N24A 1OXBA 3R2PA 4JZAA 1NLXA 5FZTA 2J46A 3A9CA 3U0CA 2ZXPA 4JTCB 1LI7A 4QDLA 4MW8A 3S84A 3DXJF 3DM5A 4K1OA 4OIQF 2FAPB 3GANA 3R7CA 1XZPA 1N1CA 2DI3A 2YRFA 4BEMJ 3JSEO 4O79A 2LK4A 2KGOA 1OKKA 1MNDA 2HJMA 4CS9C 1TWCA 2H7OA 3MYFA 1IZMA 3OEOA 4J7YA 3ASNC 5E33A 2HSQA 3GWNA 2GDCA 4Q5SF 3JT1A 3M1CB 4U5HA 3ZQVA 2XLMA 3M4BA 1HW2A 1RMVA 2J7PD 1FMVA 4I1OB 3UMHA 2A0BA 2VC9A 3RVZA 3TOLA 3F46A 4ER9A 5EGYA 3KH2A 2QY9A 5BQGA 1U6HA 1SZIA 5JLIA 4RD9A 3RYLA 1A7EA 2R25A 3C8GD 4IRUA 1Z63A 4CSAA 1T9KA 1V55C 1YAUO 3SNHA 2LD6A 3HNJA 3Q7LA 4N06A 5DQTA 1UFBA 1MQVA 4CJOA 2R9RB 3ZVRA 2XL8A 2EPLX 4NC3A 3N2ZB 4A2NB 2NSFA 5K0IA 5T3WA 2UUIA 4JCZA 1BBHA 1DOWA 1HY5A 2L9JA 2PNOA 3EFOA 4CSAC 3LEOA 3DAGA 3LEVA 3EH1A 2OEXA 2XLVA 3U5SA 2EIKC 1YZAA 2Y3BA 3EGDA 1YVIA 4O6NA 1NSGB 2GAQA 2MYSA 3LUTB 1LS4A 2XLHA 3EZHA 3L34A 2XM4A 3T6GB 5CIVA 5L0CA 2R7TA 3LS1A 3BEHA 1U0BB 1T6UA 2VASA 2HMQA 3IHUA 2G3KA 2O9XA 3BRJA 3EHMA 4CJGA 1S05A 4BJ6C 5A69A 2KSFA 3DM9B 1M2VB 2LFFA 4MVRA 4DRHB 2P7VA 2Q9AA 1VYKA 2W4BA 1AUEA 4IAOA 1ZU5A 3EGXB 3C8ZA 4AK9A 1WTYA 2YL3A 1TR2A 1YYJA 1APCA 3QVZA 3NYLA 1R4TA 1TFKB 3PCVA 3PMRA 2YWAA 4HFFB 3DI5A 4C3EA 3JYYA 2CCYA 3Q7GA 4HEAJ 5KYUA 1LIHA 2OCCC 1R5ID 2WVQA 4BJ5A 2M64A 4MVOA 1T6IA 2XRHA 3EG9A 1JOGA 3FOOA 3LNMB 4P6IC 2IXOA 1K40A 3ZIBA 1O5HA 1M6TA 2L6FA 4NTAA 4E17A 3RVYA 1V4AA 4MQ9F 4PJMA 1FNTc 4JW1A 1BR2A 3C8GB 5A6AA 2YLDA 4YT8A 3I5PA 1ZW3A 3K33A 4BJ5C 3AQBA 4C7OA 1G5ZA 4OD4A 1QLEC 1YDIA 2Q4FA 4JEBA 4MVUA 4BJTA 4IGGA 3JTLO 4MVMA 3VYWA 1DOVA 1RCPA 5JS5A 4IAQA 4IWBA 1XWJA 3H2VA 3J06A 4N4WA 2PP4A 2JD3A 3OWTA 1RJ9B 4NTFA 4Q4ZF 4UDVA 4CS7A 2GFHA 4XEFA 3ZTZA
chains in the Genus database with same CATH topology
2AP3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AP3 A; 
#chains in the Genus database with same CATH topology
 1LE2 A;  2LCH A;  1OR2 A;  2YQY A;  3EH2 A;  2A6H F;  3ATP A;  1OCO C;  2YZS A;  5B1B C;  5F5F A;  1D1A A;  1PD0 A;  2A0U A;  1Z3I X;  2ICW G;  2B0J A;  3GOR A;  1ZHZ A;  3Q6N A;  5AGF A;  1YLM A;  3IQ5 A;  3QW1 A;  4H54 A;  4XWJ A;  3UMK A;  2HJ3 A;  3MFN A;  2M4E A;  4DVZ A;  1BR1 A;  2ZXW C;  1EKY A;  1GS9 A;  3QZC A;  2WVO A;  4JKV A;  2H8A A;  2XLE A;  3DKA A;  1VOM A;  3FHD A;  3U2M A;  5KYX B;  2R7R A;  1RXQ A;  2CDQ A;  2QLA A;  3W2W A;  4JUR I;  4D4N A;  3RQF A;  1MMD A;  2Q9B A;  1FTS A;  2HZ8 A;  3T6B A;  1T6Q A;  4AE4 B;  5KYY B;  5JSL A;  3HJC A;  4I3M A;  2EPN A;  2D5R B;  2BL2 A;  5L0J A;  2OU6 A;  2KW3 C;  4G7Z F;  2KC3 A;  1Q0M A;  2EIL C;  5DLJ A;  4XPW A;  1Z6A A;  5DS6 A;  1E2X A;  4CIH A;  1MNE A;  3L0I A;  4JTD B;  1JMW A;  5T3T A;  5BQI A;  1Y6D A;  3V5Y A;  2YL7 A;  4XEV A;  4B6I A;  1RKC A;  1SMY F;  2OQM A;  3S27 A;  1JPJ A;  1SR2 A;  5BUO A;  1KTM A;  1VMA A;  2LIG A;  3AG1 C;  3O39 A;  4LDR A;  1YAR O;  3HKK A;  2NSG A;  1JRA A;  1D0X A;  4O6M A;  3HLZ A;  1JAF A;  4LDQ A;  4PJL A;  3G50 A;  4EHP A;  2IOQ A;  4O7G A;  1FR0 A;  1G4U S;  2G62 A;  2HSB A;  4CS9 A;  4BJ1 A;  3S90 A;  1ZZP A;  4NTB A;  3TOM A;  3V7O A;  3JCU Q;  4AX2 A;  3K7D A;  3AOU A;  2R7S A;  2KK1 A;  3DMD A;  4O6Y A;  1A7V A;  4OIO F;  3A11 A;  3CAX A;  2A68 F;  3RFY A;  3U9M A;  4OIP F;  1YYX A;  4C3B A;  5L3V A;  2P6V A;  3FOP A;  1ZHW A;  3M79 A;  4MTO A;  4U5C E;  3US6 A;  4YT2 A;  2DYR C;  4L6R A;  3VF0 A;  3E9V A;  3SP1 A;  4CBE A;  2QTV A;  1G4W R;  2Q3T A;  1M2V A;  2R7W A;  4Z9J A;  1O3U A;  4MND A;  3IQT A;  3NKD A;  4JEA A;  3B29 A;  3NRH A;  1O87 A;  4U5D E;  4RBN A;  3EGX A;  4P9F A;  2ZPA A;  4CDV A;  4FAP B;  3UGP A;  3KPH A;  2CNW D;  3RIP A;  3KL4 A;  3OA1 A;  3T4R A;  1H9G A;  5B3I A;  1ZHT A;  2H7B A;  5D92 A;  3L8J A;  1GGQ A;  4GYT A;  4KC9 A;  2EPK X;  1U89 A;  1V74 B;  1VLS A;  1LS1 A;  2G3V A;  2IXP A;  1RKE A;  2J7P A;  3ASO C;  3QVY A;  4BJ6 A;  4W8P A;  2FFH A;  3NDB B;  2IBF A;  3EJN A;  1WGW A;  2NPU A;  2AU5 A;  3PHF 2;  3RF3 A;  3B9Q A;  3C8G A;  2J9B A;  4CIP A;  3K1H A;  1A41 A;  2EPO A;  1T01 A;  4N6H A;  1VB5 A;  5JT4 A;  3W4Y A;  3WG7 C;  4G78 A;  2J9V A;  1YZC A;  3K1I C;  4NY3 A;  5JP7 A;  4XLN F;  3TQO A;  2PX3 A;  4U5B E;  4KNW A;  2YEV A;  1ST6 A;  4XEK A;  3DD7 A;  3TK0 A;  1OW8 A;  1CGN A;  5KYW A;  2LP4 A;  2GA0 A;  2Y69 C;  2A1D D;  2B0H A;  3KYI A;  3M15 A;  1VTM P;  3H2U A;  4CS8 C;  1RJ9 A;  1KU2 A;  4EBJ A;  2W9Y A;  4LLE A;  5COM A;  3ABL C;  3SXY A;  2F22 A;  2J45 A;  2XS8 A;  4YT5 A;  1OCZ C;  4BPM A;  4GEH A;  1GM5 A;  4KNV A;  5JRA A;  2VCB A;  3RQE A;  1H9T A;  2WVN A;  1I4Z A;  3Q6M A;  2Y3D A;  3ZTM A;  1VLT A;  2VH3 A;  3M4C A;  1BZ4 A;  2A6E F;  5CI8 A;  2NUP B;  3LAY A;  5D91 A;  2TMV P;  4LLC A;  4MVZ A;  2J0X A;  3DJN B;  3G4Z A;  4PFP A;  2Q7R A;  2A69 F;  1ZHX A;  4GQH A;  4LDK A;  4JC7 A;  1HE1 A;  5KYX A;  4U5F E;  2HKV A;  4K7B A;  4KBL A;  1ZYR F;  2J8W A;  4WGZ A;  4NCQ A;  4PFO A;  4PJN A;  3U3F A;  4E18 A;  5A6J A;  4XQ1 A;  3LES A;  2R03 A;  5KYY A;  4MW3 A;  4E0H A;  5COG A;  2L6G A;  1AVO B;  3CZ6 A;  2Q9C A;  3GWL A;  2C03 A;  4EBK A;  3KMI A;  2EIJ C;  1WAT A;  3ITF A;  3HNK A;  4YK5 A;  3TD7 A;  2BE5 F;  1EQ1 A;  4LAC B;  1TWH A;  2OG2 A;  3VRC A;  4KI2 A;  3GEE A;  2XXA B;  5E2Q A;  3EFO B;  4QI0 A;  5AC4 A;  3T9O A;  3DAF A;  3ABM C;  3O55 A;  1MMA A;  3WHN A;  1M57 C;  1Z23 A;  4NQF A;  3IEE A;  4FX5 A;  5IY5 C;  4P9T A;  3DWW A;  1HW1 A;  3NMK A;  1ZVZ A;  3E70 C;  2C04 A;  1MMN A;  2DB4 A;  2J9W A;  3AG3 C;  1W2W A;  1MMG A;  4J7T A;  2X51 A;  4I1M A;  3SZR A;  1WOL A;  3AGU A;  4G0H A;  4MTG A;  3FDQ A;  1SF8 A;  3HNL A;  3U3B A;  1LPE A;  2Y3G A;  3NG1 A;  2XSE A;  4YN0 B;  4DJ9 A;  1OQC A;  4EUK B;  2XL6 A;  3C63 A;  3VAY A;  3W8H A;  5FCL A;  4A4A A;  2DGJ A;  2VB6 A;  1D0Z A;  1Q0G A;  2L7A A;  2RD9 A;  3AQC A;  3IQC A;  4U9D A;  1QPU A;  1TWA A;  2I8B A;  4AL1 A;  1NZE A;  2XS1 A;  2J9U A;  4CDY A;  1C02 A;  5BQH A;  1D1C A;  1YJG A;  2EIM C;  5COF A;  3MX3 A;  3QMK A;  3EG9 B;  1NU7 D;  1ORS C;  2YHS A;  3NYJ A;  3AJM A;  5EHH A;  3T6J A;  2AWY A;  2WZL A;  1B68 A;  2YL0 A;  4RDA A;  2OOC A;  4FES A;  1YA9 A;  4MTF A;  2ASR A;  3DE8 A;  1LKX A;  1OR3 A;  2NG1 A;  2Z15 A;  3DE9 A;  1NBB A;  3JRM O;  1FAP B;  1NG1 A;  3GM3 A;  3IQ6 A;  4OIN F;  4EIY A;  4YL1 A;  4FWV A;  1I5N A;  1T5O A;  5A6B A;  1VK5 A;  1PD1 A;  5DS5 A;  2YVK A;  2ZD9 A;  4DBQ A;  2R7X A;  3HTK C;  3B71 A;  3GM2 A;  2P0N A;  4N6C A;  2HMZ A;  2PX0 A;  3JYH A;  4XTK A;  4DVY P;  4LER A;  3ZWI A;  1TKN A;  1Y4C A;  4ULV A;  3V5Z A;  2AVK A;  1AEP A;  1LE4 A;  2RSE B;  4YL3 A;  4IJJ A;  1A0B A;  3UGO A;  1J8Y F;  4X0R A;  1OKK D;  3O6X A;  3I5Q A;  4OIR F;  2XLO A;  1S7Z A;  3U8P A;  3UNG C;  5TJ5 E;  2V3C C;  2QUP A;  4U5E E;  2LSE A;  3L8I A;  3SXM A;  1EI7 A;  3WAQ A;  3ABK C;  4G7H F;  3F47 A;  1JR8 A;  5E3A A;  1HE9 A;  2MHR A;  2EPM X;  4DBR A;  2CYD A;  5JVE A;  4U5G A;  2HV6 A;  3JZ0 A;  3U9J A;  2VCA A;  2Y39 A;  1C17 M;  3S28 A;  2NUT B;  4W8K A;  1Q0F A;  2W45 A;  2Y3H A;  5B1A C;  1CGO A;  2P1A A;  1OW6 A;  3CQZ A;  5DVW A;  1H7I A;  2BC5 A;  3CEX A;  4MS2 A;  3KYJ A;  3TUL A;  1E83 A;  4YT4 A;  3U2L A;  3FXH A;  1TQG A;  2NUP A;  5F28 E;  5L3Q A;  1OCC C;  1ORY A;  2KQ9 A;  4JCH A;  3UMI A;  3K1I A;  2XM0 A;  1FFT C;  3LS0 A;  2YL1 A;  4XLP F;  2LFD A;  3RW0 A;  4DOZ A;  3B0V C;  1LVK A;  2W4M A;  2XLD A;  4WAB A;  2KJG A;  3CSK A;  4Q7C A;  1BDJ B;  3ZC4 A;  1ZU4 A;  3G4X A;  4CS8 A;  2CNW A;  1PCX A;  5HV9 A;  2R7V A;  1F1M A;  3FAJ A;  1KNY A;  2LQG A;  1D0Y A;  2PFD A;  4WGY A;  5EK0 A;  1M2O A;  1EA8 A;  1PV3 A;  1M56 C;  2PBE A;  3B0P A;  2XL4 A;  4MVQ A;  2E87 A;  4BG0 A;  4Z9H A;  1OW7 A;  1A7D A;  2XXA A;  3AGT A;  2IM8 A;  2R7U A;  3X1O A;  2IXN A;  3RH3 A;  4BEJ A;  3ZQY A;  4IB4 A;  4EKW A;  4QI2 A;  4C3D A;  4G7O F;  1G8X A;  2V26 A;  1Z7Q c;  2HUJ A;  1QVX A;  1WWP A;  2R02 A;  3SYN A;  1LI5 A;  5E3C A;  1UG7 A;  3LLI A;  4J30 B;  3RKO F;  1E86 A;  3C18 A;  1ORJ A;  3EPV A;  3KKB A;  3FAP B;  2EIN C;  4YL0 A;  4J32 B;  2ETS A;  2AP3 A;  3SXZ A;  4E7S A;  4ZLD A;  2OEV A;  2XLW A;  3FMS A;  4PK4 A;  1HMD A;  2KNH A;  4I44 A;  3ZSU A;  2QNL A;  3NKE A;  1BR4 A;  4AE4 A;  3GEI A;  1CPQ A;  1E84 A;  1QQ3 A;  2JPU A;  3QW0 A;  1I4Y A;  4CX9 A;  3EHN A;  5A6K A;  3AG4 C;  3TJ5 A;  1E85 A;  2YKZ A;  1L3P A;  5T1D B;  4H4K C;  2L6H A;  4JRZ A;  3DJU B;  3EZI A;  3LLK A;  5GPG B;  3WOD F;  3B0U X;  4HFK B;  3HNI A;  3K66 A;  3JRT A;  5L0H A;  2MWQ A;  4JIO A;  2GWW A;  1J8M F;  4DRJ B;  3V5X A;  3ZDL A;  4ZLC A;  5L0I A;  4F4B A;  1RKE B;  5KYN A;  2R7O A;  3NMJ A;  3EGD B;  5DS4 A;  1QKR A;  2UUH A;  2ZXO A;  3MYI A;  4ONS A;  3ZG1 A;  5HSW A;  3SXK A;  3C7J A;  4MVS A;  2HV7 A;  3U8V A;  1JPN A;  2HFI A;  3SEO A;  3W2V A;  3K6B A;  4HE8 D;  4PJJ A;  3S9O A;  2KYH A;  3C62 A;  3JSZ A;  1CGM E;  3I4U A;  1H6G A;  1TWG A;  1NFO A;  4OD5 A;  4WJ0 A;  2X0C A;  1QSP A;  2I15 A;  4U9E A;  3NYM A;  1CPR A;  1NU9 C;  1WAS A;  3NMI A;  5L0F A;  1L7C A;  5KYW B;  4XPY A;  1YA7 O;  5L0G A;  4JTA B;  2R05 A;  1ZHY A;  1K04 A;  2DYS C;  3S29 A;  3TJ6 A;  4JJG A;  4K0D A;  4DRI B;  5CI9 A;  1HMO A;  4M63 A;  1Z5Z A;  4D4X A;  4JVS A;  2Q00 A;  1OXK A;  1XZQ A;  5JUA A;  2OJQ A;  3W8I A;  3IPM O;  5DQZ A;  4E7Z A;  4JJF A;  1QZX A;  4IAR A;  5KYU B;  3MLG A;  1SYQ A;  2CGE A;  3POV A;  3GOD A;  4PAC A;  1OCR C;  3UR3 C;  1Q0K A;  1GQA A;  2YLI A;  4R32 A;  4PR9 A;  2IYL D;  1FMW A;  1LM3 B;  3H65 A;  1VYI A;  2AWC A;  2NUT A;  3X2Q C;  5L0D A;  3S0X A;  1D1B A;  1IW7 F;  4YWQ A;  3LNR A;  1FFH A;  2J0W A;  3O10 A;  4CDA A;  3MBG A;  256B A;  2OJE D;  2YLG A;  3GEH A;  3N0T A;  2ZXR A;  4C7O B;  3VM6 A;  2WZG A;  3ECS A;  3GM1 A;  4E0I A;  2D4U A;  2OKU A;  2L81 A;  4Z9I A;  1ZW2 A;  1WN0 A;  2H7V C;  4EWC A;  5A6B D;  3QTH A;  4DXW A;  2PF4 E;  2WL8 A;  2HS5 A;  3AG2 C;  2FGY A;  4YJW A;  1C03 A;  2CW0 F;  4AL0 A;  4EBB A;  2WZF A;  5F5H A;  1TFO B;  5AC5 A;  5B3S C;  4ULW A;  3FVY A;  4JE9 A;  4XPX A;  2JX0 A;  2WB7 A;  3RQG A;  3L1M A;  1K05 A;  3PDM P;  2VCC A;  4ANJ A;  1V54 C;  3DZA A;  1Q0D A;  2P61 A;  3EQL F;  3LJB A;  1NFN A;  2QE9 A;  2IXM A;  2R7Q A;  3N24 A;  1OXB A;  3R2P A;  4JZA A;  1NLX A;  5FZT A;  2J46 A;  3A9C A;  3U0C A;  2ZXP A;  4JTC B;  1LI7 A;  4QDL A;  4MW8 A;  3S84 A;  3DXJ F;  3DM5 A;  4K1O A;  4OIQ F;  2FAP B;  3GAN A;  3R7C A;  1XZP A;  1N1C A;  2DI3 A;  2YRF A;  4BEM J;  3JSE O;  4O79 A;  2LK4 A;  2KGO A;  1OKK A;  1MND A;  2HJM A;  4CS9 C;  1TWC A;  2H7O A;  3MYF A;  1IZM A;  3OEO A;  4J7Y A;  3ASN C;  5E33 A;  2HSQ A;  3GWN A;  2GDC A;  4Q5S F;  3JT1 A;  3M1C B;  4U5H A;  3ZQV A;  2XLM A;  3M4B A;  1HW2 A;  1RMV A;  2J7P D;  1FMV A;  4I1O B;  3UMH A;  2A0B A;  2VC9 A;  3RVZ A;  3TOL A;  3F46 A;  4ER9 A;  5EGY A;  3KH2 A;  2QY9 A;  5BQG A;  1U6H A;  1SZI A;  5JLI A;  4RD9 A;  3RYL A;  1A7E A;  2R25 A;  3C8G D;  4IRU A;  1Z63 A;  4CSA A;  1T9K A;  1V55 C;  1YAU O;  3SNH A;  2LD6 A;  3HNJ A;  3Q7L A;  4N06 A;  5DQT A;  1UFB A;  1MQV A;  4CJO A;  2R9R B;  3ZVR A;  2XL8 A;  2EPL X;  4NC3 A;  3N2Z B;  4A2N B;  2NSF A;  5K0I A;  5T3W A;  2UUI A;  4JCZ A;  1BBH A;  1DOW A;  1HY5 A;  2L9J A;  2PNO A;  3EFO A;  4CSA C;  3LEO A;  3DAG A;  3LEV A;  3EH1 A;  2OEX A;  2XLV A;  3U5S A;  2EIK C;  1YZA A;  2Y3B A;  3EGD A;  1YVI A;  4O6N A;  1NSG B;  2GAQ A;  2MYS A;  3LUT B;  1LS4 A;  2XLH A;  3EZH A;  3L34 A;  2XM4 A;  3T6G B;  5CIV A;  5L0C A;  2R7T A;  3LS1 A;  3BEH A;  1U0B B;  1T6U A;  2VAS A;  2HMQ A;  3IHU A;  2G3K A;  2O9X A;  3BRJ A;  3EHM A;  4CJG A;  1S05 A;  4BJ6 C;  5A69 A;  2KSF A;  3DM9 B;  1M2V B;  2LFF A;  4MVR A;  4DRH B;  2P7V A;  2Q9A A;  1VYK A;  2W4B A;  1AUE A;  4IAO A;  1ZU5 A;  3EGX B;  3C8Z A;  4AK9 A;  1WTY A;  2YL3 A;  1TR2 A;  1YYJ A;  1APC A;  3QVZ A;  3NYL A;  1R4T A;  1TFK B;  3PCV A;  3PMR A;  2YWA A;  4HFF B;  3DI5 A;  4C3E A;  3JYY A;  2CCY A;  3Q7G A;  4HEA J;  5KYU A;  1LIH A;  2OCC C;  1R5I D;  2WVQ A;  4BJ5 A;  2M64 A;  4MVO A;  1T6I A;  2XRH A;  3EG9 A;  1JOG A;  3FOO A;  3LNM B;  4P6I C;  2IXO A;  1K40 A;  3ZIB A;  1O5H A;  1M6T A;  2L6F A;  4NTA A;  4E17 A;  3RVY A;  1V4A A;  4MQ9 F;  4PJM A;  1FNT c;  4JW1 A;  1BR2 A;  3C8G B;  5A6A A;  2YLD A;  4YT8 A;  3I5P A;  1ZW3 A;  3K33 A;  4BJ5 C;  3AQB A;  4C7O A;  1G5Z A;  4OD4 A;  1QLE C;  1YDI A;  2Q4F A;  4JEB A;  4MVU A;  4BJT A;  4IGG A;  3JTL O;  4MVM A;  3VYW A;  1DOV A;  1RCP A;  5JS5 A;  4IAQ A;  4IWB A;  1XWJ A;  3H2V A;  3J06 A;  4N4W A;  2PP4 A;  2JD3 A;  3OWT A;  1RJ9 B;  4NTF A;  4Q4Z F;  4UDV A;  4CS7 A;  2GFH A;  4XEF A;  3ZTZ A; 
#chains in the Genus database with same CATH homology
 2AP3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...