2AP3A

1.6 a crystal structure of a conserved protein of unknown function from staphylococcus aureus
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
196
structure length
192
Chain Sequence
AHMGIQRPTSTTTDKKEIKAYLKQVDKIKDDEEPIKTVGKKIAELDEKKKKLTEDVNSKDTAVRGKAVKDLIKNADDRLKEFEKEEDAIKKSEQDFKKADNIDNDVKRKEVKQLDDVLKEKYKLHSDYAKAYKKAVNSEKTLFKYLNQNDATQQGVNEKSKAIEQNYKKLKEVSDKYTKVLNKVQKEKQDVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords conserved hypothetical protein
publication title 1.6A crystal structure of a conserved hypothetical protein from Staphylococcus aureus MW2
rcsb
source organism Staphylococcus aureus subsp. aureus
total genus 92
structure length 192
sequence length 196
ec nomenclature
pdb deposition date 2005-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10368 YkyA Putative cell-wall binding lipoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.570 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) YkyA-like 2ap3A00
2AP3A
chains in the Genus database with same CATH superfamily
1G5ZA 2O9XA 3H65A 1VLSA 2OU6A 4Z9HA 2VCAA 3Q6MA 4HE8D 4IAQA 3B29A 4K1OA 5CI9A 3ZQVA 1DOWA 1RXQA 1U89A 2BL2A 4JTAB 3PDMP 3MYIA 1CGOA 2WB7A 3M15A 3VAYA 1RJ9B 5CI8A 2CCYA 5T3TA 4FAPB 2R7RA 3WAQA 3FOPA 4U9DA 4A4AA 2J46A 3AG1C 1QSPA 3TD7A 4I3MA 2LIGA 2XS8A 2YL7A 2AVKA 2G3VA 2UUHA 2HMZA 5E3CA 4E18A 1JOGA 1GGQA 2MHRA 3HLZA 1ZHZA 2AP3A 3EZHA 4LLCA 1K05A 4RD9A 4ULWA 4DRIB 5A6KA 3LLIA 1G4US 4EIYA 4G78A 2KJGA 4DBRA 4CS8A 1UFBA 2XLEA 2I8BA 3K1IA 4OD5A 4LDKA 1R5ID 2J7PD 2YHSA 3J06A 3H2UA 2WL8A 3F47A 3AG3C 4ULVA 3S28A 4AE4B 2BE5F 2IM8A 3I5PA 2QE9A 4JCHA 4DRHB 4CIHA 4ANJA 4H4KC 3ITFA 3TJ6A 4D4XA 2XLOA 1PD1A 1LS4A 4MVUA 1PD0A 3EG9A 1RKCA 2KW3C 2V26A 3IPMO 3OWTA 4A2NB 4EKWA 2Z15A 4Q4ZF 3US6A 1KTMA 4WJ0A 2EPLX 3CSKA 4MVZA 3ATPA 3FAJA 4RBNA 2XLMA 2XL6A 3B0PA 3FVYA 4JEBA 5L3QA 3U8VA 2W4MA 4U5GA 2P1AA 1XWJA 2YVKA 4XTKA 3U9MA 4MTFA 1AVOB 2CYDA 3RH3A 3EQLF 3BRJA 5A69A 1WN0A 5KYUB 1TWAA 1BZ4A 3GEHA 2KK1A 5DS4A 3JTLO 3KPHA 2NUPB 3OA1A 4PFOA 4XPYA 3UMKA 5JRAA 2WZLA 4JJGA 4CS9A 2HJ3A 2Y3GA 2HUJA 3GODA 3M1CB 5COMA 2NUTA 4ER9A 3FAPB 4RDAA 3CAXA 1CPQA 3S9OA 2WVOA 3UNGC 1T01A 2JD3A 5A6AA 4HFKB 2KYHA 2EPKX 4C3EA 3FXHA 4NTFA 2XXAB 5DQTA 4L6RA 3AOUA 3SP1A 2LFFA 1Q0FA 3EGXA 3GEIA 5T3WA 3DE9A 4LACB 1Q0GA 4QI0A 3MLGA 4IGGA 3QMKA 5E3AA 1H6GA 2NG1A 2XLVA 1TWGA 2YLIA 3MFNA 4I44A 2IXMA 2RSEB 4MNDA 1K04A 4JURI 3GM3A 4FX5A 1BDJB 1MMAA 2D5RB 1XZQA 1IZMA 2C04A 3IHUA 4FESA 1Y6DA 2DI3A 1V55C 4NC3A 2EIJC 2ZPAA 2CNWA 5FZTA 1FMWA 2RD9A 5T1DB 3T6GB 2VCCA 1VYIA 3NMIA 3T6JA 3ABKC 4XWJA 4YT2A 1ZZPA 4O6NA 1TWCA 1T5OA 3HNLA 3W4YA 4IARA 1ZHXA 2QLAA 4BJ6C 2NPUA 4HFFB 5D92A 2V3CC 2R7XA 3L1MA 1FTSA 1A0BA 4Z9IA 3G4XA 1Z6AA 5HV9A 1ZHYA 1D0ZA 3FDQA 1ZW3A 3V5YA 1LS1A 1OR3A 3EH2A 4WGZA 3DAGA 3ABLC 1V4AA 5DVWA 2OEVA 1SF8A 1C03A 1TQGA 3U3BA 5BQGA 3VRCA 1T6IA 3RQEA 2IYLD 2R7QA 4YT8A 3L0IA 3PCVA 5B3IA 1D1BA 1QZXA 4XPWA 4OIPF 4F4BA 1T6UA 3SXMA 4W8PA 2OEXA 3SZRA 5BUOA 3LUTB 4YL0A 1G4WR 2JX0A 4QDLA 4CSAC 1TFKB 3K7DA 3TJ5A 4UDVA 4YT4A 3WG7C 1LE4A 4CJOA 1YA9A 2EILC 2HV7A 4XPXA 2R7WA 3QVYA 3U0CA 1ORSC 3OEOA 2H8AA 2PFDA 1NFNA 1WGWA 3DM5A 3AQCA 1T9KA 3JT1A 2HKVA 3HNJA 1VLTA 2JPUA 4PJNA 4GQHA 4YN0B 1YZCA 4YL3A 1SR2A 1YVIA 1JAFA 4R32A 5KYWB 2M64A 3QW0A 1O5HA 2ZXWC 4H54A 2ZD9A 1SZIA 3X2QC 1WASA 3FHDA 1OCCC 1S7ZA 1K40A 2J45A 1JMWA 1B68A 2FGYA 4WABA 4IRUA 1A41A 4P6IC 4AL1A 5CIVA 3LEOA 2GA0A 4E0IA 3R2PA 5BQHA 3SNHA 3DJNB 3C8GD 4E7ZA 4JRZA 1RJ9A 4MVRA 2R7VA 3H2VA 2EIKC 3EGDB 4QI2A 2GDCA 3EPVA 1Q0MA 2E87A 2J9BA 4PACA 2Y3DA 2XS1A 3A11A 3I5QA 2OOCA 1NG1A 1OCZC 1RKEB 5B1BC 3V5ZA 3ZTZA 2C03A 3N2ZB 4CS8C 2CNWD 3LJBA 5HSWA 1NU7D 3LAYA 1FFHA 1QKRA 2WVNA 2Q7RA 1OCRC 1A7DA 3KYIA 4WGYA 4XLNF 2Y39A 4J7YA 4K0DA 4NCQA 1KNYA 3GORA 4PFPA 2Q9BA 1MMDA 3SXZA 1HE9A 3T9OA 1VTMP 1EKYA 4PJJA 1GM5A 1YJGA 1NU9C 3AGUA 2Y3BA 3EJNA 4U5FE 4AE4A 1I5NA 3GEEA 3NMJA 1RCPA 4E7SA 3RQFA 1LIHA 3JRTA 4MQ9F 1HW2A 1I4YA 5A6BA 3MBGA 5L0GA 3L8JA 1EQ1A 3V5XA 5L0IA 2DGJA 3PHF2 2GFHA 3ZC4A 2QY9A 4MVSA 1ZHTA 4PJMA 2YRFA 4BJ5A 2Q9AA 4N06A 1O87A 4DXWA 3HNKA 4OIQF 3RVYA 3KKBA 5L0FA 1QQ3A 5JS5A 2A69F 4YK5A 1LI5A 5EGYA 3M4CA 1TR2A 5KYUA 2A0UA 2D4UA 2J8WA 3K66A 2CDQA 1D0XA 4CS9C 1Z63A 5L0DA 4XLPF 2EPMX 1M6TA 2NUPA 4YT5A 2X0CA 3ZIBA 3KL4A 3E70C 4MW3A 3G4ZA 4Q7CA 5EHHA 3FMSA 5FCLA 1YDIA 2H7BA 4EBKA 2Q3TA 5IY5C 2L81A 1VMAA 4OIOF 4U5HA 3EH1A 4BEJA 4C3DA 2L6HA 1JPJA 4JC7A 3R7CA 2XXAA 2TMVP 2ASRA 5E2QA 3AGTA 3RQGA 4N4WA 4C3BA 1N1CA 1NZEA 2P6VA 1LPEA 1V54C 3O39A 3KMIA 1OR2A 2KSFA 4LDRA 3ZTMA 3ZSUA 2HFIA 2F22A 2Y3HA 4CS7A 3O55A 1OCOC 2M4EA 4P9TA 4BJ1A 5KYYA 3JZ0A 2PF4E 2J9VA 1A7EA 1Q0KA 4E17A 2QNLA 4OD4A 1ST6A 1R4TA 2HS5A 3Q7GA 2OG2A 1Z23A 2IXOA 3EZIA 1Y4CA 5COGA 3WHNA 3WODF 2X51A 3EFOB 4MW8A 2UUIA 4X0RA 5KYNA 1A7VA 2W4BA 3AQBA 4N6HA 1MNEA 3IEEA 3UR3C 3Q7LA 4HEAJ 1L7CA 3VF0A 3ZQYA 2XM0A 2QTVA 2R05A 3C18A 4DRJB 2R7TA 1V74B 3HJCA 1QVXA 3ZVRA 1LM3B 1PCXA 1YYJA 3RYLA 1U0BB 2HSQA 1AUEA 5A6BD 3KYJA 1CGNA 2LQGA 5B3SC 3IQ6A 4JKVA 4U5BE 3SXKA 3QW1A 3C8GB 3M4BA 4U9EA 1LE2A 4C7OA 3GANA 3U9JA 1NSGB 3B0VC 1OW7A 1HY5A 2J9WA 1FAPB 4K7BA 4P9FA 1S05A 4JTDB 2R7OA 2J9UA 2G62A 4CIPA 3VM6A 4ONSA 1Q0DA 1VK5A 4NTBA 4YWQA 5L0JA 5KYXB 1D0YA 2VCBA 4JTCB 3GWNA 5AGFA 2PNOA 4I1OB 4C7OB 2PBEA 5DLJA 1WATA 2WVQA 2A6EF 3K6BA 5B1AC 5F5HA 5L3VA 3JYYA 5KYWA 3X1OA 2OJQA 5D91A 3IQTA 3U3FA 3LNRA 2XLDA 1H9TA 1VYKA 4ZLCA 3JYHA 2BC5A 1HE1A 2LCHA 2MWQA 2A6HF 2L6GA 2J0WA 3DXJF 3C63A 4OIRF 3CQZA 1W2WA 2QUPA 3AG4C 3NMKA 2YZSA 4I1MA 3SXYA 5AC5A 3UGOA 3LS1A 3BEHA 4IB4A 5COFA 4NQFA 2YQYA 3S84A 3ZDLA 4KC9A 4EBBA 1BR1A 1CGME 3EGDA 2PX3A 3W8IA 3L34A 2Q00A 1L3PA 4W8KA 1OKKA 2W9YA 1RKEA 1U6HA 1FR0A 1M2VA 3LS0A 1JR8A 3N24A 3ASNC 3QTHA 3HKKA 3GM2A 4KNWA 4PR9A 2IXNA 1NLXA 2HSBA 4J30B 1WTYA 1MMNA 3VYWA 1ORYA 2OCCC 4GEHA 3JSZA 1WWPA 4BEMJ 1FNTc 3NKEA 3QZCA 3DZAA 1EI7A 1LI7A 1M2VB 3TOMA 4CDVA 3IQCA 2B0JA 2J0XA 3K1IC 1RMVA 3AG2C 1J8YF 2PP4A 1AEPA 5JUAA 3B0UX 5GPGB 2YL3A 3GWLA 4AK9A 4O6YA 4IJJA 2R7SA 4U5CE 3UMIA 1NFOA 1OW6A 2HZ8A 4JIOA 2R9RB 1MQVA 1CPRA 4IWBA 2WZGA 1TKNA 3A9CA 2IOQA 4Z9JA 3C8ZA 3UGPA 3U2MA 1QLEC 3C7JA 4DOZA 1C02A 4CJGA 1ZW2A 4G7ZF 2XL8A 3S90A 3RFYA 3DD7A 1YARO 4JCZA 2YL1A 2W45A 2GWWA 4DVZA 4D4NA 2L9JA 4GYTA 2Q4FA 2HMQA 3MX3A 3SEOA 3GM1A 1VOMA 2FAPB 3U2LA 3TK0A 5JP7A 5JVEA 3POVA 4FWVA 5A6JA 2YWAA 1MNDA 2A0BA 1ORJA 1J8MF 4G7OF 4LERA 2EPOA 3QVZA 4B6IA 3DE8A 3G50A 5JSLA 5E33A 3DWWA 4AX2A 1Z3IX 2L7AA 2H7VC 256BA 5F5FA 1BBHA 2YKZA 3HNIA 2YLGA 3K1HA 4KNVA 4CDYA 4CX9A 5L0HA 3I4UA 1YAUO 3S0XA 4MTOA 3S27A 4ZLDA 1H7IA 2IBFA 4DJ9A 1H9GA 2P7VA 1APCA 1D1CA 1OXKA 2AWYA 4EHPA 2PX0A 3SYNA 3RIPA 1ZU5A 2A68F 2LD6A 3T6BA 1I4ZA 2EIMC 3DMDA 3MYFA 1E86A 2XM4A 4CDAA 2KC3A 2CGEA 2DYSC 2VH3A 5DS6A 2LK4A 1OXBA 3EFOA 2VC9A 3W2WA 1HMOA 4EUKB 1IW7F 1GQAA 4O6MA 2XSEA 5EK0A 2ICWG 3V7OA 3B71A 2KGOA 2CW0F 4U5EE 1EA8A 3EG9B 3LNMB 1YLMA 1LKXA 3DKAA 1OKKD 4OINF 1HMDA 3K33A 4BJTA 1YZAA 1G8XA 2VASA 4EBJA 3DAFA 1C17M 2DB4A 2GAQA 3ZWIA 1ZYRF 4PJLA 1DOVA 3TOLA 4BG0A 1T6QA 2A1DD 3E9VA 3NDBB 2KQ9A 1F1MA 4XQ1A 2P0NA 4MVOA 3O10A 3C8GA 3C62A 3AJMA 3NKDA 1YA7O 3NG1A 4MVQA 4LLEA 1Z7Qc 3KH2A 1XZPA 3JCUQ 4JJFA 4KI2A 1HW1A 2KNHA 3ABMC 3DI5A 4KBLA 1D1AA 4NTAA 5DQZA 1KU2A 5JLIA 5KYXA 3EGXB 1JRAA 2R7UA 4U5DE 4E0HA 4N6CA 1M2OA 2OKUA 2YLDA 3O6XA 1SYQA 2P61A 2YEVA 2OQMA 1O3UA 2VB6A 3FOOA 2HV6A 3EHNA 1M57C 2XRHA 1PV3A 2MYSA 3CEXA 4JE9A 4AL0A 1NBBA 2AWCA 5KYYB 4JZAA 3S29A 3LEVA 2J7PA 4JW1A 4O79A 4XEVA 1SMYF 3T4RA 1YYXA 3ZG1A 3NRHA 3NYMA 1E85A 2FFHA 2ZXPA 1GS9A 2G3KA 2XLWA 3B9QA 3RVZA 4BJ6A 4MS2A 4NY3A 1ZHWA 2XL4A 3L8IA 1E84A 2NSGA 3F46A 3EHMA 2B0HA 4BPMA 1JPNA 2I15A 1M56C 1LVKA 3HTKC 1OQCA 4J32B 2LP4A 2WZFA 3LLKA 1TWHA 2ETSA 3Q6NA 4EWCA 4DBQA 3TQOA 1UG7A 2EINC 2Q9CA 4DVYP 3DM9B 5TJ5E 3RW0A 4LDQA 3NYJA 4M63A 4G0HA 4PK4A 4XEFA 3UMHA 3JRMO 5BQIA 1ZVZA 2LSEA 2XLHA 1Z5ZA 4MVMA 1WOLA 1ZU4A 3TULA 3CZ6A 5AC4A 1BR2A 1BR4A 1TFOB 1VB5A 4JVSA 2HJMA 2L6FA 2Y69C 4O7GA 2AU5A 2IXPA 5L0CA 3LESA 2LFDA 3NYLA 4CSAA 3N0TA 2OJED 1QPUA 2EPNA 1E83A 4Q5SF 3DJUB 2H7OA 3RF3A 5K0IA 3JSEO 5JT4A 4CBEA 2R02A 4IAOA 3M79A 2NUTB 3W8HA 2R25A 5DS5A 4YJWA 3U8PA 2ZXOA 3PMRA 1E2XA 4JEAA 4BJ5C 1FFTC 4YL1A 3RKOF 3W2VA 1MMGA 2DYRC 3IQ5A 1FMVA 4MTGA 4XEKA 4J7TA 3U5SA 4G7HF 2ZXRA 3ASOC 5F28E 3ECSA 2NSFA 1OW8A 2R03A 2YL0A
chains in the Genus database with same CATH topology
2AP3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AP3 A; 
#chains in the Genus database with same CATH topology
 1G5Z A;  2O9X A;  3H65 A;  1VLS A;  2OU6 A;  4Z9H A;  2VCA A;  3Q6M A;  4HE8 D;  4IAQ A;  3B29 A;  4K1O A;  5CI9 A;  3ZQV A;  1DOW A;  1RXQ A;  1U89 A;  2BL2 A;  4JTA B;  3PDM P;  3MYI A;  1CGO A;  2WB7 A;  3M15 A;  3VAY A;  1RJ9 B;  5CI8 A;  2CCY A;  5T3T A;  4FAP B;  2R7R A;  3WAQ A;  3FOP A;  4U9D A;  4A4A A;  2J46 A;  3AG1 C;  1QSP A;  3TD7 A;  4I3M A;  2LIG A;  2XS8 A;  2YL7 A;  2AVK A;  2G3V A;  2UUH A;  2HMZ A;  5E3C A;  4E18 A;  1JOG A;  1GGQ A;  2MHR A;  3HLZ A;  1ZHZ A;  2AP3 A;  3EZH A;  4LLC A;  1K05 A;  4RD9 A;  4ULW A;  4DRI B;  5A6K A;  3LLI A;  1G4U S;  4EIY A;  4G78 A;  2KJG A;  4DBR A;  4CS8 A;  1UFB A;  2XLE A;  2I8B A;  3K1I A;  4OD5 A;  4LDK A;  1R5I D;  2J7P D;  2YHS A;  3J06 A;  3H2U A;  2WL8 A;  3F47 A;  3AG3 C;  4ULV A;  3S28 A;  4AE4 B;  2BE5 F;  2IM8 A;  3I5P A;  2QE9 A;  4JCH A;  4DRH B;  4CIH A;  4ANJ A;  4H4K C;  3ITF A;  3TJ6 A;  4D4X A;  2XLO A;  1PD1 A;  1LS4 A;  4MVU A;  1PD0 A;  3EG9 A;  1RKC A;  2KW3 C;  2V26 A;  3IPM O;  3OWT A;  4A2N B;  4EKW A;  2Z15 A;  4Q4Z F;  3US6 A;  1KTM A;  4WJ0 A;  2EPL X;  3CSK A;  4MVZ A;  3ATP A;  3FAJ A;  4RBN A;  2XLM A;  2XL6 A;  3B0P A;  3FVY A;  4JEB A;  5L3Q A;  3U8V A;  2W4M A;  4U5G A;  2P1A A;  1XWJ A;  2YVK A;  4XTK A;  3U9M A;  4MTF A;  1AVO B;  2CYD A;  3RH3 A;  3EQL F;  3BRJ A;  5A69 A;  1WN0 A;  5KYU B;  1TWA A;  1BZ4 A;  3GEH A;  2KK1 A;  5DS4 A;  3JTL O;  3KPH A;  2NUP B;  3OA1 A;  4PFO A;  4XPY A;  3UMK A;  5JRA A;  2WZL A;  4JJG A;  4CS9 A;  2HJ3 A;  2Y3G A;  2HUJ A;  3GOD A;  3M1C B;  5COM A;  2NUT A;  4ER9 A;  3FAP B;  4RDA A;  3CAX A;  1CPQ A;  3S9O A;  2WVO A;  3UNG C;  1T01 A;  2JD3 A;  5A6A A;  4HFK B;  2KYH A;  2EPK X;  4C3E A;  3FXH A;  4NTF A;  2XXA B;  5DQT A;  4L6R A;  3AOU A;  3SP1 A;  2LFF A;  1Q0F A;  3EGX A;  3GEI A;  5T3W A;  3DE9 A;  4LAC B;  1Q0G A;  4QI0 A;  3MLG A;  4IGG A;  3QMK A;  5E3A A;  1H6G A;  2NG1 A;  2XLV A;  1TWG A;  2YLI A;  3MFN A;  4I44 A;  2IXM A;  2RSE B;  4MND A;  1K04 A;  4JUR I;  3GM3 A;  4FX5 A;  1BDJ B;  1MMA A;  2D5R B;  1XZQ A;  1IZM A;  2C04 A;  3IHU A;  4FES A;  1Y6D A;  2DI3 A;  1V55 C;  4NC3 A;  2EIJ C;  2ZPA A;  2CNW A;  5FZT A;  1FMW A;  2RD9 A;  5T1D B;  3T6G B;  2VCC A;  1VYI A;  3NMI A;  3T6J A;  3ABK C;  4XWJ A;  4YT2 A;  1ZZP A;  4O6N A;  1TWC A;  1T5O A;  3HNL A;  3W4Y A;  4IAR A;  1ZHX A;  2QLA A;  4BJ6 C;  2NPU A;  4HFF B;  5D92 A;  2V3C C;  2R7X A;  3L1M A;  1FTS A;  1A0B A;  4Z9I A;  3G4X A;  1Z6A A;  5HV9 A;  1ZHY A;  1D0Z A;  3FDQ A;  1ZW3 A;  3V5Y A;  1LS1 A;  1OR3 A;  3EH2 A;  4WGZ A;  3DAG A;  3ABL C;  1V4A A;  5DVW A;  2OEV A;  1SF8 A;  1C03 A;  1TQG A;  3U3B A;  5BQG A;  3VRC A;  1T6I A;  3RQE A;  2IYL D;  2R7Q A;  4YT8 A;  3L0I A;  3PCV A;  5B3I A;  1D1B A;  1QZX A;  4XPW A;  4OIP F;  4F4B A;  1T6U A;  3SXM A;  4W8P A;  2OEX A;  3SZR A;  5BUO A;  3LUT B;  4YL0 A;  1G4W R;  2JX0 A;  4QDL A;  4CSA C;  1TFK B;  3K7D A;  3TJ5 A;  4UDV A;  4YT4 A;  3WG7 C;  1LE4 A;  4CJO A;  1YA9 A;  2EIL C;  2HV7 A;  4XPX A;  2R7W A;  3QVY A;  3U0C A;  1ORS C;  3OEO A;  2H8A A;  2PFD A;  1NFN A;  1WGW A;  3DM5 A;  3AQC A;  1T9K A;  3JT1 A;  2HKV A;  3HNJ A;  1VLT A;  2JPU A;  4PJN A;  4GQH A;  4YN0 B;  1YZC A;  4YL3 A;  1SR2 A;  1YVI A;  1JAF A;  4R32 A;  5KYW B;  2M64 A;  3QW0 A;  1O5H A;  2ZXW C;  4H54 A;  2ZD9 A;  1SZI A;  3X2Q C;  1WAS A;  3FHD A;  1OCC C;  1S7Z A;  1K40 A;  2J45 A;  1JMW A;  1B68 A;  2FGY A;  4WAB A;  4IRU A;  1A41 A;  4P6I C;  4AL1 A;  5CIV A;  3LEO A;  2GA0 A;  4E0I A;  3R2P A;  5BQH A;  3SNH A;  3DJN B;  3C8G D;  4E7Z A;  4JRZ A;  1RJ9 A;  4MVR A;  2R7V A;  3H2V A;  2EIK C;  3EGD B;  4QI2 A;  2GDC A;  3EPV A;  1Q0M A;  2E87 A;  2J9B A;  4PAC A;  2Y3D A;  2XS1 A;  3A11 A;  3I5Q A;  2OOC A;  1NG1 A;  1OCZ C;  1RKE B;  5B1B C;  3V5Z A;  3ZTZ A;  2C03 A;  3N2Z B;  4CS8 C;  2CNW D;  3LJB A;  5HSW A;  1NU7 D;  3LAY A;  1FFH A;  1QKR A;  2WVN A;  2Q7R A;  1OCR C;  1A7D A;  3KYI A;  4WGY A;  4XLN F;  2Y39 A;  4J7Y A;  4K0D A;  4NCQ A;  1KNY A;  3GOR A;  4PFP A;  2Q9B A;  1MMD A;  3SXZ A;  1HE9 A;  3T9O A;  1VTM P;  1EKY A;  4PJJ A;  1GM5 A;  1YJG A;  1NU9 C;  3AGU A;  2Y3B A;  3EJN A;  4U5F E;  4AE4 A;  1I5N A;  3GEE A;  3NMJ A;  1RCP A;  4E7S A;  3RQF A;  1LIH A;  3JRT A;  4MQ9 F;  1HW2 A;  1I4Y A;  5A6B A;  3MBG A;  5L0G A;  3L8J A;  1EQ1 A;  3V5X A;  5L0I A;  2DGJ A;  3PHF 2;  2GFH A;  3ZC4 A;  2QY9 A;  4MVS A;  1ZHT A;  4PJM A;  2YRF A;  4BJ5 A;  2Q9A A;  4N06 A;  1O87 A;  4DXW A;  3HNK A;  4OIQ F;  3RVY A;  3KKB A;  5L0F A;  1QQ3 A;  5JS5 A;  2A69 F;  4YK5 A;  1LI5 A;  5EGY A;  3M4C A;  1TR2 A;  5KYU A;  2A0U A;  2D4U A;  2J8W A;  3K66 A;  2CDQ A;  1D0X A;  4CS9 C;  1Z63 A;  5L0D A;  4XLP F;  2EPM X;  1M6T A;  2NUP A;  4YT5 A;  2X0C A;  3ZIB A;  3KL4 A;  3E70 C;  4MW3 A;  3G4Z A;  4Q7C A;  5EHH A;  3FMS A;  5FCL A;  1YDI A;  2H7B A;  4EBK A;  2Q3T A;  5IY5 C;  2L81 A;  1VMA A;  4OIO F;  4U5H A;  3EH1 A;  4BEJ A;  4C3D A;  2L6H A;  1JPJ A;  4JC7 A;  3R7C A;  2XXA A;  2TMV P;  2ASR A;  5E2Q A;  3AGT A;  3RQG A;  4N4W A;  4C3B A;  1N1C A;  1NZE A;  2P6V A;  1LPE A;  1V54 C;  3O39 A;  3KMI A;  1OR2 A;  2KSF A;  4LDR A;  3ZTM A;  3ZSU A;  2HFI A;  2F22 A;  2Y3H A;  4CS7 A;  3O55 A;  1OCO C;  2M4E A;  4P9T A;  4BJ1 A;  5KYY A;  3JZ0 A;  2PF4 E;  2J9V A;  1A7E A;  1Q0K A;  4E17 A;  2QNL A;  4OD4 A;  1ST6 A;  1R4T A;  2HS5 A;  3Q7G A;  2OG2 A;  1Z23 A;  2IXO A;  3EZI A;  1Y4C A;  5COG A;  3WHN A;  3WOD F;  2X51 A;  3EFO B;  4MW8 A;  2UUI A;  4X0R A;  5KYN A;  1A7V A;  2W4B A;  3AQB A;  4N6H A;  1MNE A;  3IEE A;  3UR3 C;  3Q7L A;  4HEA J;  1L7C A;  3VF0 A;  3ZQY A;  2XM0 A;  2QTV A;  2R05 A;  3C18 A;  4DRJ B;  2R7T A;  1V74 B;  3HJC A;  1QVX A;  3ZVR A;  1LM3 B;  1PCX A;  1YYJ A;  3RYL A;  1U0B B;  2HSQ A;  1AUE A;  5A6B D;  3KYJ A;  1CGN A;  2LQG A;  5B3S C;  3IQ6 A;  4JKV A;  4U5B E;  3SXK A;  3QW1 A;  3C8G B;  3M4B A;  4U9E A;  1LE2 A;  4C7O A;  3GAN A;  3U9J A;  1NSG B;  3B0V C;  1OW7 A;  1HY5 A;  2J9W A;  1FAP B;  4K7B A;  4P9F A;  1S05 A;  4JTD B;  2R7O A;  2J9U A;  2G62 A;  4CIP A;  3VM6 A;  4ONS A;  1Q0D A;  1VK5 A;  4NTB A;  4YWQ A;  5L0J A;  5KYX B;  1D0Y A;  2VCB A;  4JTC B;  3GWN A;  5AGF A;  2PNO A;  4I1O B;  4C7O B;  2PBE A;  5DLJ A;  1WAT A;  2WVQ A;  2A6E F;  3K6B A;  5B1A C;  5F5H A;  5L3V A;  3JYY A;  5KYW A;  3X1O A;  2OJQ A;  5D91 A;  3IQT A;  3U3F A;  3LNR A;  2XLD A;  1H9T A;  1VYK A;  4ZLC A;  3JYH A;  2BC5 A;  1HE1 A;  2LCH A;  2MWQ A;  2A6H F;  2L6G A;  2J0W A;  3DXJ F;  3C63 A;  4OIR F;  3CQZ A;  1W2W A;  2QUP A;  3AG4 C;  3NMK A;  2YZS A;  4I1M A;  3SXY A;  5AC5 A;  3UGO A;  3LS1 A;  3BEH A;  4IB4 A;  5COF A;  4NQF A;  2YQY A;  3S84 A;  3ZDL A;  4KC9 A;  4EBB A;  1BR1 A;  1CGM E;  3EGD A;  2PX3 A;  3W8I A;  3L34 A;  2Q00 A;  1L3P A;  4W8K A;  1OKK A;  2W9Y A;  1RKE A;  1U6H A;  1FR0 A;  1M2V A;  3LS0 A;  1JR8 A;  3N24 A;  3ASN C;  3QTH A;  3HKK A;  3GM2 A;  4KNW A;  4PR9 A;  2IXN A;  1NLX A;  2HSB A;  4J30 B;  1WTY A;  1MMN A;  3VYW A;  1ORY A;  2OCC C;  4GEH A;  3JSZ A;  1WWP A;  4BEM J;  1FNT c;  3NKE A;  3QZC A;  3DZA A;  1EI7 A;  1LI7 A;  1M2V B;  3TOM A;  4CDV A;  3IQC A;  2B0J A;  2J0X A;  3K1I C;  1RMV A;  3AG2 C;  1J8Y F;  2PP4 A;  1AEP A;  5JUA A;  3B0U X;  5GPG B;  2YL3 A;  3GWL A;  4AK9 A;  4O6Y A;  4IJJ A;  2R7S A;  4U5C E;  3UMI A;  1NFO A;  1OW6 A;  2HZ8 A;  4JIO A;  2R9R B;  1MQV A;  1CPR A;  4IWB A;  2WZG A;  1TKN A;  3A9C A;  2IOQ A;  4Z9J A;  3C8Z A;  3UGP A;  3U2M A;  1QLE C;  3C7J A;  4DOZ A;  1C02 A;  4CJG A;  1ZW2 A;  4G7Z F;  2XL8 A;  3S90 A;  3RFY A;  3DD7 A;  1YAR O;  4JCZ A;  2YL1 A;  2W45 A;  2GWW A;  4DVZ A;  4D4N A;  2L9J A;  4GYT A;  2Q4F A;  2HMQ A;  3MX3 A;  3SEO A;  3GM1 A;  1VOM A;  2FAP B;  3U2L A;  3TK0 A;  5JP7 A;  5JVE A;  3POV A;  4FWV A;  5A6J A;  2YWA A;  1MND A;  2A0B A;  1ORJ A;  1J8M F;  4G7O F;  4LER A;  2EPO A;  3QVZ A;  4B6I A;  3DE8 A;  3G50 A;  5JSL A;  5E33 A;  3DWW A;  4AX2 A;  1Z3I X;  2L7A A;  2H7V C;  256B A;  5F5F A;  1BBH A;  2YKZ A;  3HNI A;  2YLG A;  3K1H A;  4KNV A;  4CDY A;  4CX9 A;  5L0H A;  3I4U A;  1YAU O;  3S0X A;  4MTO A;  3S27 A;  4ZLD A;  1H7I A;  2IBF A;  4DJ9 A;  1H9G A;  2P7V A;  1APC A;  1D1C A;  1OXK A;  2AWY A;  4EHP A;  2PX0 A;  3SYN A;  3RIP A;  1ZU5 A;  2A68 F;  2LD6 A;  3T6B A;  1I4Z A;  2EIM C;  3DMD A;  3MYF A;  1E86 A;  2XM4 A;  4CDA A;  2KC3 A;  2CGE A;  2DYS C;  2VH3 A;  5DS6 A;  2LK4 A;  1OXB A;  3EFO A;  2VC9 A;  3W2W A;  1HMO A;  4EUK B;  1IW7 F;  1GQA A;  4O6M A;  2XSE A;  5EK0 A;  2ICW G;  3V7O A;  3B71 A;  2KGO A;  2CW0 F;  4U5E E;  1EA8 A;  3EG9 B;  3LNM B;  1YLM A;  1LKX A;  3DKA A;  1OKK D;  4OIN F;  1HMD A;  3K33 A;  4BJT A;  1YZA A;  1G8X A;  2VAS A;  4EBJ A;  3DAF A;  1C17 M;  2DB4 A;  2GAQ A;  3ZWI A;  1ZYR F;  4PJL A;  1DOV A;  3TOL A;  4BG0 A;  1T6Q A;  2A1D D;  3E9V A;  3NDB B;  2KQ9 A;  1F1M A;  4XQ1 A;  2P0N A;  4MVO A;  3O10 A;  3C8G A;  3C62 A;  3AJM A;  3NKD A;  1YA7 O;  3NG1 A;  4MVQ A;  4LLE A;  1Z7Q c;  3KH2 A;  1XZP A;  3JCU Q;  4JJF A;  4KI2 A;  1HW1 A;  2KNH A;  3ABM C;  3DI5 A;  4KBL A;  1D1A A;  4NTA A;  5DQZ A;  1KU2 A;  5JLI A;  5KYX A;  3EGX B;  1JRA A;  2R7U A;  4U5D E;  4E0H A;  4N6C A;  1M2O A;  2OKU A;  2YLD A;  3O6X A;  1SYQ A;  2P61 A;  2YEV A;  2OQM A;  1O3U A;  2VB6 A;  3FOO A;  2HV6 A;  3EHN A;  1M57 C;  2XRH A;  1PV3 A;  2MYS A;  3CEX A;  4JE9 A;  4AL0 A;  1NBB A;  2AWC A;  5KYY B;  4JZA A;  3S29 A;  3LEV A;  2J7P A;  4JW1 A;  4O79 A;  4XEV A;  1SMY F;  3T4R A;  1YYX A;  3ZG1 A;  3NRH A;  3NYM A;  1E85 A;  2FFH A;  2ZXP A;  1GS9 A;  2G3K A;  2XLW A;  3B9Q A;  3RVZ A;  4BJ6 A;  4MS2 A;  4NY3 A;  1ZHW A;  2XL4 A;  3L8I A;  1E84 A;  2NSG A;  3F46 A;  3EHM A;  2B0H A;  4BPM A;  1JPN A;  2I15 A;  1M56 C;  1LVK A;  3HTK C;  1OQC A;  4J32 B;  2LP4 A;  2WZF A;  3LLK A;  1TWH A;  2ETS A;  3Q6N A;  4EWC A;  4DBQ A;  3TQO A;  1UG7 A;  2EIN C;  2Q9C A;  4DVY P;  3DM9 B;  5TJ5 E;  3RW0 A;  4LDQ A;  3NYJ A;  4M63 A;  4G0H A;  4PK4 A;  4XEF A;  3UMH A;  3JRM O;  5BQI A;  1ZVZ A;  2LSE A;  2XLH A;  1Z5Z A;  4MVM A;  1WOL A;  1ZU4 A;  3TUL A;  3CZ6 A;  5AC4 A;  1BR2 A;  1BR4 A;  1TFO B;  1VB5 A;  4JVS A;  2HJM A;  2L6F A;  2Y69 C;  4O7G A;  2AU5 A;  2IXP A;  5L0C A;  3LES A;  2LFD A;  3NYL A;  4CSA A;  3N0T A;  2OJE D;  1QPU A;  2EPN A;  1E83 A;  4Q5S F;  3DJU B;  2H7O A;  3RF3 A;  5K0I A;  3JSE O;  5JT4 A;  4CBE A;  2R02 A;  4IAO A;  3M79 A;  2NUT B;  3W8H A;  2R25 A;  5DS5 A;  4YJW A;  3U8P A;  2ZXO A;  3PMR A;  1E2X A;  4JEA A;  4BJ5 C;  1FFT C;  4YL1 A;  3RKO F;  3W2V A;  1MMG A;  2DYR C;  3IQ5 A;  1FMV A;  4MTG A;  4XEK A;  4J7T A;  3U5S A;  4G7H F;  2ZXR A;  3ASO C;  5F28 E;  3ECS A;  2NSF A;  1OW8 A;  2R03 A;  2YL0 A; 
#chains in the Genus database with same CATH homology
 2AP3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...