5B3IA

Homo-dimeric structure of cytochrome c' from thermophilic hydrogenophilus thermoluteolus
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
135
structure length
135
Chain Sequence
DALKPEDKVKFRQASYTTMAWNMGKIKAMVVDGTMPFSQTQVSAAANVIAAIANSGMGALYSPDTLGVVGFKKSRLKENFFQEQDEVRKIATNFVEQANKLAEVAAMGDKDEIKAQFGEVGKACKACHEKFREEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Cytochrome c prime
publication title Structural and functional insights into thermally stable cytochrome c' from a thermophile
pubmed doi rcsb
total genus 55
structure length 135
sequence length 135
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 5b3iA00
5JT4A 3M4CA 1E83A 1YZAA 1CPRA 1BBHA 1E84A 4WGZA 2XL8A 4CDAA 3HNKA 3M4BA 3TOMA 2BC5A 1JAFA 5JRAA 1E86A 5JVEA 1CPQA 2CCYA 4CDYA 4CX9A 2XM4A 4CJOA 3DE8A 3HNJA 3QVZA 3U8PA 3FOOA 4WGYA 2YL1A 5B3IA 5JLIA 3ZWIA 3DE9A 2YL0A 3HNLA 3M15A 4N6HA 4EIYA 1NBBA 2XLDA 2XLHA 3NMKA 5JS5A 3FOPA 1M6TA 2XM0A 1YYJA 3NMIA 2XLOA 4NC3A 1APCA 3ZTZA 3ZTMA 2XLMA 3C63A 4IAQA 2XLEA 1S05A 4JEAA 1MQVA 2YLGA 4CJGA 5AGFA 4IB4A 2XLVA 3M79A 4ULVA 3IQ6A 3QW1A 2J9BA 3ZQVA 3C62A 3VRCA 2YLIA 1GQAA 3QVYA 4JE9A 4D4XA 3IQ5A 1CGNA 4N4WA 1LM3B 2XLWA 2YL7A 5JUAA 4JKVA 4IARA 3L1MA 2J8WA 4CDVA 4ER9A 2YLDA 2YKZA 1A7VA 3QW0A 1YZCA 1YYXA 3NMJA 1QQ3A 1CGOA 4CIPA 1QPUA 2QLAA 1E85A 4L6RA 5JSLA 4D4NA 5JP7A 1RCPA 2YL3A 1EKYA 3ZQYA 4U9DA 3HNIA 4U9EA 2XL6A 256BA 3TOLA 4JEBA
chains in the Genus database with same CATH superfamily
1SYQA 2HUJA 2XXAB 3K7DA 4BJ5C 2PX3A 3EG9A 2LK4A 4YT5A 1E84A 1VYKA 5D92A 3S9OA 4GYTA 1ZHXA 2DYRC 2KQ9A 4XPXA 2A68F 1LE2A 1O87A 2EPMX 2HV7A 1OR3A 1OW6A 3C7JA 5COMA 5KYUB 3O6XA 3JSZA 2F22A 3M4BA 4EHPA 2NG1A 4N6CA 1CPQA 4CDYA 3C8GD 3HTKC 3NKEA 4NTFA 4DRIB 4CS7A 3JRTA 2LSEA 2ZD9A 1SZIA 4RBNA 3WHNA 1RKCA 1RJ9B 4MVMA 1J8YF 4PJNA 2GFHA 3UGPA 3HNJA 3RW0A 5KYYB 4G7OF 2G62A 1RMVA 1HY5A 2CNWD 2HS5A 3FOOA 1VLSA 4WGYA 5B3IA 5TJ5E 5F5HA 1JRAA 5JLIA 4G7HF 1ZVZA 3LUTB 1MMAA 1HMDA 2KSFA 2MHRA 4PK4A 1FFHA 3POVA 3M1CB 1TR2A 2YL0A 2IXPA 5F28E 3UMIA 3OEOA 3MYIA 1V74B 4YN0B 4MTFA 4A2NB 3M15A 3W8IA 1C03A 4EIYA 2A0UA 3V7OA 3KL4A 1O3UA 3CAXA 4DOZA 1D1BA 3TK0A 1NBBA 2H8AA 2XLDA 4ANJA 5KYNA 2M4EA 3SZRA 5AC5A 4PJLA 2XXAA 3K1IA 1V4AA 4RD9A 3JTLO 1G8XA 3U3FA 5A6BD 4FESA 1TWGA 1YYJA 4YT8A 1MNDA 3NMIA 4IJJA 2CW0F 1APCA 3RYLA 5A6AA 3I5PA 3Q6MA 3ZTMA 4QI2A 1U0BB 2Y3DA 5KYUA 3R7CA 3B9QA 1TWCA 4IRUA 4PR9A 3CSKA 2XLEA 3EGDA 1FNTc 3AQBA 3H65A 2PBEA 4O6NA 3K1HA 2OQMA 4AL0A 1MMGA 3AGTA 3IPMO 2KC3A 4IAOA 3N24A 3ECSA 3KH2A 2Y69C 1T5OA 3R2PA 4E7SA 1G5ZA 3EFOB 1SMYF 4FX5A 3PDMP 4DBRA 3LNMB 3M79A 2AU5A 2R9RB 3LEVA 2D5RB 1NSGB 3AOUA 3C62A 3MLGA 3S84A 3UGOA 3FVYA 3SXYA 1NFOA 1I5NA 3EH2A 3ITFA 4Z9JA 1AVOB 2EPKX 3KYIA 2OOCA 2RSEB 3LJBA 4DBQA 5A69A 5EHHA 4B6IA 3EJNA 4J30B 1ZHWA 1A0BA 2LQGA 2WZLA 4LDQA 1OW8A 1QKRA 3IQ5A 1IW7F 4AE4B 4N4WA 2LCHA 2ZPAA 2WZFA 4P6IC 4JTCB 2WZGA 4DRHB 4OD4A 5JUAA 3JSEO 3W8HA 5B1BC 4RDAA 4XQ1A 1EQ1A 1C02A 4R32A 3RVZA 1QLEC 4O6MA 4JW1A 1DOWA 2B0JA 2L6GA 4LERA 3Q6NA 2YKZA 2OCCC 3G50A 2I8BA 2A0BA 1JPNA 2PNOA 2Q00A 3B0PA 2YEVA 4C7OB 3A9CA 1JPJA 1HW2A 1YLMA 3WODF 4NTBA 2HMZA 3EFOA 1GGQA 3GEEA 1MNEA 1QPUA 1TFOB 4XEKA 5DQTA 1GS9A 2LFDA 3DAGA 4O6YA 1D1AA 3GANA 1A7DA 1E85A 4XTKA 3SXKA 1QVXA 4JCHA 4YK5A 3DAFA 2AWCA 5E33A 3ZQYA 1K05A 2Q9AA 2WL8A 1LKXA 2WVNA 2XL6A 3EG9B 256BA 1ZW3A 3HKKA 3F47A 4I3MA 4MVUA 2NUPA 3T6GB 2R7RA 2WVOA 5KYYA 5KYXB 3ABKC 3O39A 3VYWA 2L6HA 1EI7A 1YJGA 4NY3A 3QTHA 1CPRA 4JC7A 4U5EE 3U5SA 4BJ6A 2XS8A 1FMVA 2A6HF 2FAPB 4EUKB 1PCXA 3GWLA 4C3EA 2IYLD 1FR0A 4KBLA 4IGGA 2IXOA 1FMWA 1FTSA 2J46A 3U9JA 4CDAA 2VCAA 4LLCA 3HNKA 1A7EA 3ZVRA 3VM6A 1E2XA 3SP1A 4PACA 2HSQA 2CCYA 5D91A 3NG1A 5E3AA 3S27A 2VCCA 4EBJA 1H9GA 4J32B 4G0HA 2OJED 2J7PD 4CJOA 3BEHA 3RF3A 4CS8A 1Q0KA 2UUIA 1JOGA 4HFFB 4H54A 3O10A 3LESA 2IXNA 2LP4A 1UFBA 2E87A 1HE1A 4N6HA 4Z9IA 3ABLC 5K0IA 2OKUA 2YVKA 2Y39A 3IHUA 4Z9HA 2V3CC 4DRJB 2XLHA 2KJGA 4JTDB 5JS5A 2MWQA 3RQEA 3T4RA 1Z6AA 3FOPA 3W2WA 1M6TA 2ETSA 2W4BA 3DJNB 3EGDB 4A4AA 3LS0A 2XLOA 1ZHTA 4U5GA 2L9JA 5EGYA 1Z63A 2EIKC 3UR3C 2R7XA 1ST6A 2W4MA 4E0HA 1Y6DA 4MNDA 4I1MA 3GM2A 4JVSA 3RVYA 1TFKB 4X0RA 2YWAA 3FMSA 4DXWA 4U5BE 1R5ID 3DKAA 1H6GA 2FGYA 3DI5A 3LLKA 4M63A 2YLGA 4BJ6C 3EZHA 3F46A 3S0XA 4ZLCA 4BJ1A 4WABA 4ULVA 5COGA 4JRZA 2O9XA 3QW1A 4LACB 2J9BA 1WATA 4PFOA 2VH3A 1M57C 1ORJA 2Z15A 3E9VA 3LEOA 4MVSA 5KYWB 2HKVA 2DYSC 3RIPA 2ASRA 3RFYA 3U8VA 4ZLDA 3FAJA 2GA0A 3VRCA 3FDQA 3L8IA 5HSWA 1GQAA 1NZEA 2HJMA 2Q7RA 3U9MA 2EINC 3GODA 2QNLA 5CIVA 3ABMC 2LD6A 4FAPB 4C3DA 4PJJA 3NRHA 4CS8C 1LIHA 3BRJA 4XEFA 5AC4A 3U0CA 1LM3B 3ZIBA 4MTOA 3V5XA 2JPUA 2XLWA 5DQZA 5B3SC 2B0HA 2H7BA 1Z23A 4BEMJ 1V54C 2NSGA 1JMWA 3JYYA 4CBEA 1U6HA 4ULWA 4GEHA 3T6JA 1K04A 2QE9A 3QMKA 4W8PA 4IARA 4CSAA 3L1MA 2J8WA 4CDVA 2YLDA 3LLIA 1EA8A 1A7VA 5FCLA 1D0XA 1OCCC 2EPOA 3DWWA 2G3VA 3QW0A 2OEVA 2A6EF 1S7ZA 3DM5A 3L34A 1VMAA 4ONSA 2BL2A 3RKOF 1YA7O 5L3VA 3JYHA 4H4KC 5B1AC 5A6KA 1M56C 3X2QC 1NLXA 1V55C 4YJWA 3B29A 4QI0A 5COFA 5T1DB 4EBKA 3TJ6A 1OXBA 5KYWA 3MX3A 3GORA 1Y4CA 4J7YA 2NUPB 1ZHZA 2L7AA 3HJCA 3GM1A 2JX0A 2KNHA 2ICWG 2GDCA 2VASA 1XZQA 2HMQA 3C8GA 3PMRA 4O79A 5L0JA 1BR4A 4U9EA 5E2QA 4BG0A 2GWWA 2XS1A 5DS6A 1KU2A 4JEBA 2NPUA 2CNWA 2WVQA 2XRHA 1QSPA 1WOLA 1XZPA 2DGJA 2QY9A 2HV6A 3EH1A 3JRMO 3S28A 4EWCA 2Q3TA 1YZAA 4U5HA 4OIRF 5L3QA 2OG2A 1E83A 2R7VA 2PF4E 2CGEA 3JT1A 4WGZA 3W2VA 4N06A 5KYXA 2XL8A 3GEIA 1HE9A 2QUPA 3QZCA 2R7TA 3IEEA 2L6FA 1ZZPA 1LE4A 3TOMA 1LPEA 2BC5A 2VB6A 1JAFA 5JRAA 5HV9A 5JVEA 1HW1A 3TULA 3S29A 1F1MA 1BR2A 3DXJF 4I44A 1B68A 2XM4A 3I4UA 1Q0MA 3JCUQ 3U2LA 1R4TA 2R7UA 3RH3A 4DJ9A 2PP4A 5T3TA 3U8PA 5L0CA 2YL1A 3MBGA 1FAPB 3W4YA 4QDLA 4JJGA 4CSAC 3DE9A 3SNHA 3HNLA 1TWHA 2IM8A 1N1CA 5L0GA 4U5DE 4U5FE 1VLTA 3TQOA 4BPMA 4MVOA 3NMKA 1OCZC 4MVQA 1OW7A 3FXHA 1Q0GA 4JJFA 3T9OA 1OXKA 2PFDA 3CQZA 1I4ZA 2CYDA 5FZTA 5A6JA 4WJ0A 2XLMA 4HE8D 4FWVA 3US6A 1MMDA 4LDRA 4IAQA 3OA1A 3UNGC 3J06A 1S05A 3AG1C 3GEHA 4I1OB 1D0YA 1D1CA 1PV3A 2HZ8A 3G4ZA 4OIPF 1Z5ZA 2EPLX 1NU7D 2JD3A 2P7VA 2YZSA 1LI7A 1GM5A 4HFKB 1UG7A 3IQTA 3V5YA 1MQVA 4C3BA 4KNWA 1TKNA 3A11A 5AGFA 4IB4A 3N0TA 2LIGA 3EHMA 3X1OA 3C18A 3EPVA 2NUTB 3ZQVA 4MW3A 3S90A 1LS4A 1JR8A 2H7OA 1ZU5A 2W9YA 1I4YA 1OCOC 2XSEA 2P61A 1ZHYA 3HLZA 3NYLA 4PJMA 3KYJA 2Q9CA 3FHDA 3IQCA 2KGOA 1C17M 1RXQA 2J0XA 3H2VA 3QVYA 4NQFA 4EBBA 5BQIA 3K33A 3NKDA 3ZSUA 3WAQA 4JIOA 2GAQA 4D4XA 1ZYRF 1MMNA 3EZIA 5IY5C 4G7ZF 3PHF2 2EIJC 2I15A 3DZAA 4OD5A 2IXMA 2KK1A 5L0DA 3MYFA 3CZ6A 3DJUB 3VF0A 4MVRA 5F5FA 5BQHA 1LI5A 2ZXOA 4O7GA 2R7QA 3EQLF 4CS9A 4JKVA 4JURI 1D0ZA 1PD1A 2X0CA 2R7WA 1QZXA 1AEPA 4AX2A 4CIHA 3ATPA 4NTAA 1YAUO 2J0WA 5GPGB 3MFNA 3NYJA 3OWTA 4UDVA 2YHSA 1YZCA 1TWAA 4AL1A 1QQ3A 1WN0A 2Y3BA 1CGOA 2HFIA 4E7ZA 1M2VB 3C8GB 1WWPA 2IBFA 2J9UA 5T3WA 3VAYA 1CGME 4OIQF 4L6RA 1LVKA 2NUTA 3ZG1A 4MS2A 2A1DD 1RCPA 1W2WA 4LLEA 2VC9A 2YL3A 2R02A 2X51A 2DI3A 3K6BA 2Q4FA 1PD0A 3C8ZA 3HNIA 4NCQA 4U9DA 4XPYA 2J7PA 3RQGA 1M2OA 4E0IA 1E86A 3B0UX 3TOLA 4E18A 2R7OA 1XWJA 1VYIA 5JT4A 3H2UA 3AG2C 1OKKD 2D4UA 2ZXPA 4XLNF 1HMOA 3M4CA 1BBHA 1Q0DA 4PFPA 1H9TA 1J8MF 2EPNA 4P9TA 1A41A 3SXMA 1NG1A 4W8KA 1FFTC 1VB5A 3ZC4A 1O5HA 2V26A 2AP3A 4YT4A 2OJQA 2P0NA 4MW8A 1RKEB 4XEVA 3KKBA 2Q9BA 1WTYA 2PX0A 4CX9A 2Y3GA 2LFFA 3UMHA 4E17A 3EGXB 3ASNC 1M2VA 2EIMC 2AVKA 3AQCA 2OU6A 3DE8A 2R05A 1OCRC 1T9KA 1U89A 3G4XA 3QVZA 4HEAJ 4JCZA 4JTAB 1ORYA 1OQCA 4CS9C 5L0IA 1Z7Qc 3ZWIA 3AG4C 1RJ9A 4KNVA 1BZ4A 3L8JA 1H7IA 3T6BA 3WG7C 2AWYA 2YQYA 1TQGA 3DMDA 1YVIA 1Q0FA 1WGWA 1DOVA 1YA9A 3CEXA 3LAYA 1AUEA 3Q7GA 5E3CA 3DM9B 4BEJA 4YL1A 3GM3A 2CDQA 1G4WR 1T6UA 2FFHA 2P1AA 4BJTA 1SR2A 2R25A 2XM0A 3JZ0A 2C03A 4NC3A 4YT2A 3ZTZA 3FAPB 2BE5F 3DD7A 4Q5SF 3NYMA 3K66A 3C63A 2H7VC 1L3PA 3GWNA 1VTMP 3E70C 3Q7LA 3TD7A 1KTMA 1RKEA 4G78A 4IWBA 1ZW2A 2W45A 2MYSA 4JEAA 1T6IA 4LDKA 3EGXA 1G4US 4CJGA 5A6BA 1VOMA 2RD9A 1OKKA 4Q7CA 1NFNA 2XLVA 2C04A 3SXZA 1ZU4A 1LS1A 3IQ6A 1YDIA 4EKWA 4BJ5A 2TMVP 4KC9A 3B0VC 3K1IC 4K1OA 3UMKA 4OINF 3NDBB 1K40A 3SEOA 2ZXRA 4MTGA 4JZAA 2OEXA 2WB7A 2YLIA 4KI2A 3SYNA 1SF8A 2J9WA 5BUOA 2G3KA 4JE9A 2HSBA 2A69F 4MVZA 3KMIA 3U2MA 1BDJB 4DVZA 3AGUA 2R03A 1L7CA 1VK5A 1T01A 2Y3HA 4MQ9F 1CGNA 2VCBA 3AJMA 4DVYP 4XPWA 3EHNA 4OIOF 4K0DA 1T6QA 5DS4A 2YL7A 3L0IA 5L0HA 4Q4ZF 4J7TA 4P9FA 1WASA 5L0FA 4AE4A 4XWJA 4F4BA 1Z3IX 5DLJA 5EK0A 1ORSC 3N2ZB 5CI8A 2XL4A 1KNYA 2DB4A 2QTVA 2UUHA 3LS1A 1NU9C 4GQHA 4ER9A 2IOQA 2KYHA 2ZXWC 3ASOC 3PCVA 1YYXA 1YARO 4YWQA 3NMJA 5CI9A 4YL0A 3RQFA 2P6VA 4CIPA 3LNRA 2NSFA 2EILC 2HJ3A 2M64A 4U5CE 3U3BA 2QLAA 2J45A 5DS5A 4C7OA 2R7SA 2J9VA 2YRFA 3ZDLA 2L81A 5JSLA 2KW3C 4D4NA 5JP7A 4XLPF 3V5ZA 4K7BA 1OR2A 1EKYA 1BR1A 4YL3A 4AK9A 1IZMA 3I5QA 3TJ5A 3AG3C 3O55A 3KPHA 3B71A 5DVWA 5BQGA
chains in the Genus database with same CATH topology
5JT4A 3M4CA 1E83A 1YZAA 1CPRA 1BBHA 1E84A 4WGZA 2XL8A 4CDAA 3HNKA 3M4BA 3TOMA 2BC5A 1JAFA 5JRAA 1E86A 5JVEA 1CPQA 2CCYA 4CDYA 4CX9A 2XM4A 4CJOA 3DE8A 3HNJA 3QVZA 3U8PA 3FOOA 4WGYA 2YL1A 5B3IA 5JLIA 3ZWIA 3DE9A 2YL0A 3HNLA 3M15A 4N6HA 4EIYA 1NBBA 2XLDA 2XLHA 3NMKA 5JS5A 3FOPA 1M6TA 2XM0A 1YYJA 3NMIA 2XLOA 4NC3A 1APCA 3ZTZA 3ZTMA 2XLMA 3C63A 4IAQA 2XLEA 1S05A 4JEAA 1MQVA 2YLGA 4CJGA 5AGFA 4IB4A 2XLVA 3M79A 4ULVA 3IQ6A 3QW1A 2J9BA 3ZQVA 3C62A 3VRCA 2YLIA 1GQAA 3QVYA 4JE9A 4D4XA 3IQ5A 1CGNA 4N4WA 1LM3B 2XLWA 2YL7A 5JUAA 4JKVA 4IARA 3L1MA 2J8WA 4CDVA 4ER9A 2YLDA 2YKZA 1A7VA 3QW0A 1YZCA 1YYXA 3NMJA 1QQ3A 1CGOA 4CIPA 1QPUA 2QLAA 1E85A 4L6RA 5JSLA 4D4NA 5JP7A 1RCPA 2YL3A 1EKYA 3ZQYA 4U9DA 3HNIA 4U9EA 2XL6A 256BA 3TOLA 4JEBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JT4 A;  3M4C A;  1E83 A;  1YZA A;  1CPR A;  1BBH A;  1E84 A;  4WGZ A;  2XL8 A;  4CDA A;  3HNK A;  3M4B A;  3TOM A;  2BC5 A;  1JAF A;  5JRA A;  1E86 A;  5JVE A;  1CPQ A;  2CCY A;  4CDY A;  4CX9 A;  2XM4 A;  4CJO A;  3DE8 A;  3HNJ A;  3QVZ A;  3U8P A;  3FOO A;  4WGY A;  2YL1 A;  5B3I A;  5JLI A;  3ZWI A;  3DE9 A;  2YL0 A;  3HNL A;  3M15 A;  4N6H A;  4EIY A;  1NBB A;  2XLD A;  2XLH A;  3NMK A;  5JS5 A;  3FOP A;  1M6T A;  2XM0 A;  1YYJ A;  3NMI A;  2XLO A;  4NC3 A;  1APC A;  3ZTZ A;  3ZTM A;  2XLM A;  3C63 A;  4IAQ A;  2XLE A;  1S05 A;  4JEA A;  1MQV A;  2YLG A;  4CJG A;  5AGF A;  4IB4 A;  2XLV A;  3M79 A;  4ULV A;  3IQ6 A;  3QW1 A;  2J9B A;  3ZQV A;  3C62 A;  3VRC A;  2YLI A;  1GQA A;  3QVY A;  4JE9 A;  4D4X A;  3IQ5 A;  1CGN A;  4N4W A;  1LM3 B;  2XLW A;  2YL7 A;  5JUA A;  4JKV A;  4IAR A;  3L1M A;  2J8W A;  4CDV A;  4ER9 A;  2YLD A;  2YKZ A;  1A7V A;  3QW0 A;  1YZC A;  1YYX A;  3NMJ A;  1QQ3 A;  1CGO A;  4CIP A;  1QPU A;  2QLA A;  1E85 A;  4L6R A;  5JSL A;  4D4N A;  5JP7 A;  1RCP A;  2YL3 A;  1EKY A;  3ZQY A;  4U9D A;  3HNI A;  4U9E A;  2XL6 A;  256B A;  3TOL A;  4JEB A; 
#chains in the Genus database with same CATH topology
 1SYQ A;  2HUJ A;  2XXA B;  3K7D A;  4BJ5 C;  2PX3 A;  3EG9 A;  2LK4 A;  4YT5 A;  1E84 A;  1VYK A;  5D92 A;  3S9O A;  4GYT A;  1ZHX A;  2DYR C;  2KQ9 A;  4XPX A;  2A68 F;  1LE2 A;  1O87 A;  2EPM X;  2HV7 A;  1OR3 A;  1OW6 A;  3C7J A;  5COM A;  5KYU B;  3O6X A;  3JSZ A;  2F22 A;  3M4B A;  4EHP A;  2NG1 A;  4N6C A;  1CPQ A;  4CDY A;  3C8G D;  3HTK C;  3NKE A;  4NTF A;  4DRI B;  4CS7 A;  3JRT A;  2LSE A;  2ZD9 A;  1SZI A;  4RBN A;  3WHN A;  1RKC A;  1RJ9 B;  4MVM A;  1J8Y F;  4PJN A;  2GFH A;  3UGP A;  3HNJ A;  3RW0 A;  5KYY B;  4G7O F;  2G62 A;  1RMV A;  1HY5 A;  2CNW D;  2HS5 A;  3FOO A;  1VLS A;  4WGY A;  5B3I A;  5TJ5 E;  5F5H A;  1JRA A;  5JLI A;  4G7H F;  1ZVZ A;  3LUT B;  1MMA A;  1HMD A;  2KSF A;  2MHR A;  4PK4 A;  1FFH A;  3POV A;  3M1C B;  1TR2 A;  2YL0 A;  2IXP A;  5F28 E;  3UMI A;  3OEO A;  3MYI A;  1V74 B;  4YN0 B;  4MTF A;  4A2N B;  3M15 A;  3W8I A;  1C03 A;  4EIY A;  2A0U A;  3V7O A;  3KL4 A;  1O3U A;  3CAX A;  4DOZ A;  1D1B A;  3TK0 A;  1NBB A;  2H8A A;  2XLD A;  4ANJ A;  5KYN A;  2M4E A;  3SZR A;  5AC5 A;  4PJL A;  2XXA A;  3K1I A;  1V4A A;  4RD9 A;  3JTL O;  1G8X A;  3U3F A;  5A6B D;  4FES A;  1TWG A;  1YYJ A;  4YT8 A;  1MND A;  3NMI A;  4IJJ A;  2CW0 F;  1APC A;  3RYL A;  5A6A A;  3I5P A;  3Q6M A;  3ZTM A;  4QI2 A;  1U0B B;  2Y3D A;  5KYU A;  3R7C A;  3B9Q A;  1TWC A;  4IRU A;  4PR9 A;  3CSK A;  2XLE A;  3EGD A;  1FNT c;  3AQB A;  3H65 A;  2PBE A;  4O6N A;  3K1H A;  2OQM A;  4AL0 A;  1MMG A;  3AGT A;  3IPM O;  2KC3 A;  4IAO A;  3N24 A;  3ECS A;  3KH2 A;  2Y69 C;  1T5O A;  3R2P A;  4E7S A;  1G5Z A;  3EFO B;  1SMY F;  4FX5 A;  3PDM P;  4DBR A;  3LNM B;  3M79 A;  2AU5 A;  2R9R B;  3LEV A;  2D5R B;  1NSG B;  3AOU A;  3C62 A;  3MLG A;  3S84 A;  3UGO A;  3FVY A;  3SXY A;  1NFO A;  1I5N A;  3EH2 A;  3ITF A;  4Z9J A;  1AVO B;  2EPK X;  3KYI A;  2OOC A;  2RSE B;  3LJB A;  4DBQ A;  5A69 A;  5EHH A;  4B6I A;  3EJN A;  4J30 B;  1ZHW A;  1A0B A;  2LQG A;  2WZL A;  4LDQ A;  1OW8 A;  1QKR A;  3IQ5 A;  1IW7 F;  4AE4 B;  4N4W A;  2LCH A;  2ZPA A;  2WZF A;  4P6I C;  4JTC B;  2WZG A;  4DRH B;  4OD4 A;  5JUA A;  3JSE O;  3W8H A;  5B1B C;  4RDA A;  4XQ1 A;  1EQ1 A;  1C02 A;  4R32 A;  3RVZ A;  1QLE C;  4O6M A;  4JW1 A;  1DOW A;  2B0J A;  2L6G A;  4LER A;  3Q6N A;  2YKZ A;  2OCC C;  3G50 A;  2I8B A;  2A0B A;  1JPN A;  2PNO A;  2Q00 A;  3B0P A;  2YEV A;  4C7O B;  3A9C A;  1JPJ A;  1HW2 A;  1YLM A;  3WOD F;  4NTB A;  2HMZ A;  3EFO A;  1GGQ A;  3GEE A;  1MNE A;  1QPU A;  1TFO B;  4XEK A;  5DQT A;  1GS9 A;  2LFD A;  3DAG A;  4O6Y A;  1D1A A;  3GAN A;  1A7D A;  1E85 A;  4XTK A;  3SXK A;  1QVX A;  4JCH A;  4YK5 A;  3DAF A;  2AWC A;  5E33 A;  3ZQY A;  1K05 A;  2Q9A A;  2WL8 A;  1LKX A;  2WVN A;  2XL6 A;  3EG9 B;  256B A;  1ZW3 A;  3HKK A;  3F47 A;  4I3M A;  4MVU A;  2NUP A;  3T6G B;  2R7R A;  2WVO A;  5KYY A;  5KYX B;  3ABK C;  3O39 A;  3VYW A;  2L6H A;  1EI7 A;  1YJG A;  4NY3 A;  3QTH A;  1CPR A;  4JC7 A;  4U5E E;  3U5S A;  4BJ6 A;  2XS8 A;  1FMV A;  2A6H F;  2FAP B;  4EUK B;  1PCX A;  3GWL A;  4C3E A;  2IYL D;  1FR0 A;  4KBL A;  4IGG A;  2IXO A;  1FMW A;  1FTS A;  2J46 A;  3U9J A;  4CDA A;  2VCA A;  4LLC A;  3HNK A;  1A7E A;  3ZVR A;  3VM6 A;  1E2X A;  3SP1 A;  4PAC A;  2HSQ A;  2CCY A;  5D91 A;  3NG1 A;  5E3A A;  3S27 A;  2VCC A;  4EBJ A;  1H9G A;  4J32 B;  4G0H A;  2OJE D;  2J7P D;  4CJO A;  3BEH A;  3RF3 A;  4CS8 A;  1Q0K A;  2UUI A;  1JOG A;  4HFF B;  4H54 A;  3O10 A;  3LES A;  2IXN A;  2LP4 A;  1UFB A;  2E87 A;  1HE1 A;  4N6H A;  4Z9I A;  3ABL C;  5K0I A;  2OKU A;  2YVK A;  2Y39 A;  3IHU A;  4Z9H A;  2V3C C;  4DRJ B;  2XLH A;  2KJG A;  4JTD B;  5JS5 A;  2MWQ A;  3RQE A;  3T4R A;  1Z6A A;  3FOP A;  3W2W A;  1M6T A;  2ETS A;  2W4B A;  3DJN B;  3EGD B;  4A4A A;  3LS0 A;  2XLO A;  1ZHT A;  4U5G A;  2L9J A;  5EGY A;  1Z63 A;  2EIK C;  3UR3 C;  2R7X A;  1ST6 A;  2W4M A;  4E0H A;  1Y6D A;  4MND A;  4I1M A;  3GM2 A;  4JVS A;  3RVY A;  1TFK B;  4X0R A;  2YWA A;  3FMS A;  4DXW A;  4U5B E;  1R5I D;  3DKA A;  1H6G A;  2FGY A;  3DI5 A;  3LLK A;  4M63 A;  2YLG A;  4BJ6 C;  3EZH A;  3F46 A;  3S0X A;  4ZLC A;  4BJ1 A;  4WAB A;  4ULV A;  5COG A;  4JRZ A;  2O9X A;  3QW1 A;  4LAC B;  2J9B A;  1WAT A;  4PFO A;  2VH3 A;  1M57 C;  1ORJ A;  2Z15 A;  3E9V A;  3LEO A;  4MVS A;  5KYW B;  2HKV A;  2DYS C;  3RIP A;  2ASR A;  3RFY A;  3U8V A;  4ZLD A;  3FAJ A;  2GA0 A;  3VRC A;  3FDQ A;  3L8I A;  5HSW A;  1GQA A;  1NZE A;  2HJM A;  2Q7R A;  3U9M A;  2EIN C;  3GOD A;  2QNL A;  5CIV A;  3ABM C;  2LD6 A;  4FAP B;  4C3D A;  4PJJ A;  3NRH A;  4CS8 C;  1LIH A;  3BRJ A;  4XEF A;  5AC4 A;  3U0C A;  1LM3 B;  3ZIB A;  4MTO A;  3V5X A;  2JPU A;  2XLW A;  5DQZ A;  5B3S C;  2B0H A;  2H7B A;  1Z23 A;  4BEM J;  1V54 C;  2NSG A;  1JMW A;  3JYY A;  4CBE A;  1U6H A;  4ULW A;  4GEH A;  3T6J A;  1K04 A;  2QE9 A;  3QMK A;  4W8P A;  4IAR A;  4CSA A;  3L1M A;  2J8W A;  4CDV A;  2YLD A;  3LLI A;  1EA8 A;  1A7V A;  5FCL A;  1D0X A;  1OCC C;  2EPO A;  3DWW A;  2G3V A;  3QW0 A;  2OEV A;  2A6E F;  1S7Z A;  3DM5 A;  3L34 A;  1VMA A;  4ONS A;  2BL2 A;  3RKO F;  1YA7 O;  5L3V A;  3JYH A;  4H4K C;  5B1A C;  5A6K A;  1M56 C;  3X2Q C;  1NLX A;  1V55 C;  4YJW A;  3B29 A;  4QI0 A;  5COF A;  5T1D B;  4EBK A;  3TJ6 A;  1OXB A;  5KYW A;  3MX3 A;  3GOR A;  1Y4C A;  4J7Y A;  2NUP B;  1ZHZ A;  2L7A A;  3HJC A;  3GM1 A;  2JX0 A;  2KNH A;  2ICW G;  2GDC A;  2VAS A;  1XZQ A;  2HMQ A;  3C8G A;  3PMR A;  4O79 A;  5L0J A;  1BR4 A;  4U9E A;  5E2Q A;  4BG0 A;  2GWW A;  2XS1 A;  5DS6 A;  1KU2 A;  4JEB A;  2NPU A;  2CNW A;  2WVQ A;  2XRH A;  1QSP A;  1WOL A;  1XZP A;  2DGJ A;  2QY9 A;  2HV6 A;  3EH1 A;  3JRM O;  3S28 A;  4EWC A;  2Q3T A;  1YZA A;  4U5H A;  4OIR F;  5L3Q A;  2OG2 A;  1E83 A;  2R7V A;  2PF4 E;  2CGE A;  3JT1 A;  4WGZ A;  3W2V A;  4N06 A;  5KYX A;  2XL8 A;  3GEI A;  1HE9 A;  2QUP A;  3QZC A;  2R7T A;  3IEE A;  2L6F A;  1ZZP A;  1LE4 A;  3TOM A;  1LPE A;  2BC5 A;  2VB6 A;  1JAF A;  5JRA A;  5HV9 A;  5JVE A;  1HW1 A;  3TUL A;  3S29 A;  1F1M A;  1BR2 A;  3DXJ F;  4I44 A;  1B68 A;  2XM4 A;  3I4U A;  1Q0M A;  3JCU Q;  3U2L A;  1R4T A;  2R7U A;  3RH3 A;  4DJ9 A;  2PP4 A;  5T3T A;  3U8P A;  5L0C A;  2YL1 A;  3MBG A;  1FAP B;  3W4Y A;  4QDL A;  4JJG A;  4CSA C;  3DE9 A;  3SNH A;  3HNL A;  1TWH A;  2IM8 A;  1N1C A;  5L0G A;  4U5D E;  4U5F E;  1VLT A;  3TQO A;  4BPM A;  4MVO A;  3NMK A;  1OCZ C;  4MVQ A;  1OW7 A;  3FXH A;  1Q0G A;  4JJF A;  3T9O A;  1OXK A;  2PFD A;  3CQZ A;  1I4Z A;  2CYD A;  5FZT A;  5A6J A;  4WJ0 A;  2XLM A;  4HE8 D;  4FWV A;  3US6 A;  1MMD A;  4LDR A;  4IAQ A;  3OA1 A;  3UNG C;  3J06 A;  1S05 A;  3AG1 C;  3GEH A;  4I1O B;  1D0Y A;  1D1C A;  1PV3 A;  2HZ8 A;  3G4Z A;  4OIP F;  1Z5Z A;  2EPL X;  1NU7 D;  2JD3 A;  2P7V A;  2YZS A;  1LI7 A;  1GM5 A;  4HFK B;  1UG7 A;  3IQT A;  3V5Y A;  1MQV A;  4C3B A;  4KNW A;  1TKN A;  3A11 A;  5AGF A;  4IB4 A;  3N0T A;  2LIG A;  3EHM A;  3X1O A;  3C18 A;  3EPV A;  2NUT B;  3ZQV A;  4MW3 A;  3S90 A;  1LS4 A;  1JR8 A;  2H7O A;  1ZU5 A;  2W9Y A;  1I4Y A;  1OCO C;  2XSE A;  2P61 A;  1ZHY A;  3HLZ A;  3NYL A;  4PJM A;  3KYJ A;  2Q9C A;  3FHD A;  3IQC A;  2KGO A;  1C17 M;  1RXQ A;  2J0X A;  3H2V A;  3QVY A;  4NQF A;  4EBB A;  5BQI A;  3K33 A;  3NKD A;  3ZSU A;  3WAQ A;  4JIO A;  2GAQ A;  4D4X A;  1ZYR F;  1MMN A;  3EZI A;  5IY5 C;  4G7Z F;  3PHF 2;  2EIJ C;  2I15 A;  3DZA A;  4OD5 A;  2IXM A;  2KK1 A;  5L0D A;  3MYF A;  3CZ6 A;  3DJU B;  3VF0 A;  4MVR A;  5F5F A;  5BQH A;  1LI5 A;  2ZXO A;  4O7G A;  2R7Q A;  3EQL F;  4CS9 A;  4JKV A;  4JUR I;  1D0Z A;  1PD1 A;  2X0C A;  2R7W A;  1QZX A;  1AEP A;  4AX2 A;  4CIH A;  3ATP A;  4NTA A;  1YAU O;  2J0W A;  5GPG B;  3MFN A;  3NYJ A;  3OWT A;  4UDV A;  2YHS A;  1YZC A;  1TWA A;  4AL1 A;  1QQ3 A;  1WN0 A;  2Y3B A;  1CGO A;  2HFI A;  4E7Z A;  1M2V B;  3C8G B;  1WWP A;  2IBF A;  2J9U A;  5T3W A;  3VAY A;  1CGM E;  4OIQ F;  4L6R A;  1LVK A;  2NUT A;  3ZG1 A;  4MS2 A;  2A1D D;  1RCP A;  1W2W A;  4LLE A;  2VC9 A;  2YL3 A;  2R02 A;  2X51 A;  2DI3 A;  3K6B A;  2Q4F A;  1PD0 A;  3C8Z A;  3HNI A;  4NCQ A;  4U9D A;  4XPY A;  2J7P A;  3RQG A;  1M2O A;  4E0I A;  1E86 A;  3B0U X;  3TOL A;  4E18 A;  2R7O A;  1XWJ A;  1VYI A;  5JT4 A;  3H2U A;  3AG2 C;  1OKK D;  2D4U A;  2ZXP A;  4XLN F;  1HMO A;  3M4C A;  1BBH A;  1Q0D A;  4PFP A;  1H9T A;  1J8M F;  2EPN A;  4P9T A;  1A41 A;  3SXM A;  1NG1 A;  4W8K A;  1FFT C;  1VB5 A;  3ZC4 A;  1O5H A;  2V26 A;  2AP3 A;  4YT4 A;  2OJQ A;  2P0N A;  4MW8 A;  1RKE B;  4XEV A;  3KKB A;  2Q9B A;  1WTY A;  2PX0 A;  4CX9 A;  2Y3G A;  2LFF A;  3UMH A;  4E17 A;  3EGX B;  3ASN C;  1M2V A;  2EIM C;  2AVK A;  3AQC A;  2OU6 A;  3DE8 A;  2R05 A;  1OCR C;  1T9K A;  1U89 A;  3G4X A;  3QVZ A;  4HEA J;  4JCZ A;  4JTA B;  1ORY A;  1OQC A;  4CS9 C;  5L0I A;  1Z7Q c;  3ZWI A;  3AG4 C;  1RJ9 A;  4KNV A;  1BZ4 A;  3L8J A;  1H7I A;  3T6B A;  3WG7 C;  2AWY A;  2YQY A;  1TQG A;  3DMD A;  1YVI A;  1Q0F A;  1WGW A;  1DOV A;  1YA9 A;  3CEX A;  3LAY A;  1AUE A;  3Q7G A;  5E3C A;  3DM9 B;  4BEJ A;  4YL1 A;  3GM3 A;  2CDQ A;  1G4W R;  1T6U A;  2FFH A;  2P1A A;  4BJT A;  1SR2 A;  2R25 A;  2XM0 A;  3JZ0 A;  2C03 A;  4NC3 A;  4YT2 A;  3ZTZ A;  3FAP B;  2BE5 F;  3DD7 A;  4Q5S F;  3NYM A;  3K66 A;  3C63 A;  2H7V C;  1L3P A;  3GWN A;  1VTM P;  3E70 C;  3Q7L A;  3TD7 A;  1KTM A;  1RKE A;  4G78 A;  4IWB A;  1ZW2 A;  2W45 A;  2MYS A;  4JEA A;  1T6I A;  4LDK A;  3EGX A;  1G4U S;  4CJG A;  5A6B A;  1VOM A;  2RD9 A;  1OKK A;  4Q7C A;  1NFN A;  2XLV A;  2C04 A;  3SXZ A;  1ZU4 A;  1LS1 A;  3IQ6 A;  1YDI A;  4EKW A;  4BJ5 A;  2TMV P;  4KC9 A;  3B0V C;  3K1I C;  4K1O A;  3UMK A;  4OIN F;  3NDB B;  1K40 A;  3SEO A;  2ZXR A;  4MTG A;  4JZA A;  2OEX A;  2WB7 A;  2YLI A;  4KI2 A;  3SYN A;  1SF8 A;  2J9W A;  5BUO A;  2G3K A;  4JE9 A;  2HSB A;  2A69 F;  4MVZ A;  3KMI A;  3U2M A;  1BDJ B;  4DVZ A;  3AGU A;  2R03 A;  1L7C A;  1VK5 A;  1T01 A;  2Y3H A;  4MQ9 F;  1CGN A;  2VCB A;  3AJM A;  4DVY P;  4XPW A;  3EHN A;  4OIO F;  4K0D A;  1T6Q A;  5DS4 A;  2YL7 A;  3L0I A;  5L0H A;  4Q4Z F;  4J7T A;  4P9F A;  1WAS A;  5L0F A;  4AE4 A;  4XWJ A;  4F4B A;  1Z3I X;  5DLJ A;  5EK0 A;  1ORS C;  3N2Z B;  5CI8 A;  2XL4 A;  1KNY A;  2DB4 A;  2QTV A;  2UUH A;  3LS1 A;  1NU9 C;  4GQH A;  4ER9 A;  2IOQ A;  2KYH A;  2ZXW C;  3ASO C;  3PCV A;  1YYX A;  1YAR O;  4YWQ A;  3NMJ A;  5CI9 A;  4YL0 A;  3RQF A;  2P6V A;  4CIP A;  3LNR A;  2NSF A;  2EIL C;  2HJ3 A;  2M64 A;  4U5C E;  3U3B A;  2QLA A;  2J45 A;  5DS5 A;  4C7O A;  2R7S A;  2J9V A;  2YRF A;  3ZDL A;  2L81 A;  5JSL A;  2KW3 C;  4D4N A;  5JP7 A;  4XLP F;  3V5Z A;  4K7B A;  1OR2 A;  1EKY A;  1BR1 A;  4YL3 A;  4AK9 A;  1IZM A;  3I5Q A;  3TJ5 A;  3AG3 C;  3O55 A;  3KPH A;  3B71 A;  5DVW A;  5BQG A; 
#chains in the Genus database with same CATH homology
 5JT4 A;  3M4C A;  1E83 A;  1YZA A;  1CPR A;  1BBH A;  1E84 A;  4WGZ A;  2XL8 A;  4CDA A;  3HNK A;  3M4B A;  3TOM A;  2BC5 A;  1JAF A;  5JRA A;  1E86 A;  5JVE A;  1CPQ A;  2CCY A;  4CDY A;  4CX9 A;  2XM4 A;  4CJO A;  3DE8 A;  3HNJ A;  3QVZ A;  3U8P A;  3FOO A;  4WGY A;  2YL1 A;  5B3I A;  5JLI A;  3ZWI A;  3DE9 A;  2YL0 A;  3HNL A;  3M15 A;  4N6H A;  4EIY A;  1NBB A;  2XLD A;  2XLH A;  3NMK A;  5JS5 A;  3FOP A;  1M6T A;  2XM0 A;  1YYJ A;  3NMI A;  2XLO A;  4NC3 A;  1APC A;  3ZTZ A;  3ZTM A;  2XLM A;  3C63 A;  4IAQ A;  2XLE A;  1S05 A;  4JEA A;  1MQV A;  2YLG A;  4CJG A;  5AGF A;  4IB4 A;  2XLV A;  3M79 A;  4ULV A;  3IQ6 A;  3QW1 A;  2J9B A;  3ZQV A;  3C62 A;  3VRC A;  2YLI A;  1GQA A;  3QVY A;  4JE9 A;  4D4X A;  3IQ5 A;  1CGN A;  4N4W A;  1LM3 B;  2XLW A;  2YL7 A;  5JUA A;  4JKV A;  4IAR A;  3L1M A;  2J8W A;  4CDV A;  4ER9 A;  2YLD A;  2YKZ A;  1A7V A;  3QW0 A;  1YZC A;  1YYX A;  3NMJ A;  1QQ3 A;  1CGO A;  4CIP A;  1QPU A;  2QLA A;  1E85 A;  4L6R A;  5JSL A;  4D4N A;  5JP7 A;  1RCP A;  2YL3 A;  1EKY A;  3ZQY A;  4U9D A;  3HNI A;  4U9E A;  2XL6 A;  256B A;  3TOL A;  4JEB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...