5B3IA

Homo-dimeric structure of cytochrome c' from thermophilic hydrogenophilus thermoluteolus
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
135
structure length
135
Chain Sequence
DALKPEDKVKFRQASYTTMAWNMGKIKAMVVDGTMPFSQTQVSAAANVIAAIANSGMGALYSPDTLGVVGFKKSRLKENFFQEQDEVRKIATNFVEQANKLAEVAAMGDKDEIKAQFGEVGKACKACHEKFREEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional insights into thermally stable cytochrome c' from a thermophile
pubmed doi rcsb
molecule tags Electron transport
molecule keywords Cytochrome c prime
total genus 55
structure length 135
sequence length 135
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 5b3iA00
4ULVA 5JP7A 1E84A 3QVYA 2YLDA 3QW0A 4U9EA 3C63A 5JVEA 4L6RA 3FOPA 3FOOA 3NMIA 3ZTMA 256BA 1YZAA 2YL1A 4JKVA 3ZQYA 3ZTZA 1MQVA 1RCPA 1S05A 2XLDA 3NMJA 2YL7A 5JS5A 3M4CA 3IQ5A 1A7VA 5AGFA 1YYXA 4CX9A 4D4XA 4D4NA 2YKZA 2QLAA 3TOMA 1LM3B 1E85A 4IAQA 4U9DA 1GQAA 2XLOA 4IB4A 2XLHA 1CPRA 2XLMA 1JAFA 2XL8A 2XLVA 2XLWA 2XL6A 3M79A 2XM4A 1CGNA 2XM0A 5JLIA 5JRAA 3QVZA 4JEBA 4WGZA 3TOLA 3VRCA 4JEAA 4CDAA 3M4BA 4EIYA 1EKYA 3ZWIA 2YL3A 1QPUA 1YZCA 3DE9A 2YL0A 4CJGA 1NBBA 4CJOA 1CGOA 2J8WA 3U8PA 3HNLA 4CDYA 4ER9A 1CPQA 1M6TA 2BC5A 2J9BA 3C62A 3DE8A 3L1MA 3M15A 3HNKA 1E83A 4IARA 3IQ6A 5B3IA 3NMKA 1BBHA 1YYJA 3HNIA 1E86A 3QW1A 4NC3A 2XLEA 3ZQVA 4CIPA 2CCYA 4WGYA 4CDVA 2YLIA 5JSLA 5JUAA 2YLGA 4N6HA 1QQ3A 5JT4A 1APCA 4N4WA 3HNJA 4JE9A
chains in the Genus database with same CATH superfamily
2ETSA 2P1AA 3RQEA 5A6KA 4ULVA 2J0XA 1J8YF 4RBNA 4OIPF 1U89A 1QKRA 3NDBB 2D4UA 4E0IA 4EBBA 4Z9HA 1V74B 1I4YA 1D1AA 2I8BA 1TFOB 4HFKB 3GM2A 1Z3IX 3FAPB 1M2VB 2W9YA 1UFBA 4IJJA 4JCHA 3F46A 1N1CA 1TWAA 3KKBA 5E3CA 2L7AA 3C63A 3WAQA 5K0IA 1U6HA 5F28E 3E70C 4NQFA 4RDAA 3U3BA 4L6RA 2PP4A 3AG2C 1ZHYA 3FOOA 2R25A 4DRHB 4DRJB 256BA 3S90A 4MVZA 2YL1A 4HEAJ 2M64A 4E17A 2R7VA 1RJ9B 3LUTB 4BJTA 3ZQYA 2H7VC 2LFDA 1D1CA 3MBGA 4LDKA 2J46A 3CSKA 3IHUA 2Z15A 3GEHA 2IXOA 1HE1A 2VCAA 1FAPB 3RF3A 4JTAB 4A4AA 1S05A 5A69A 2YL7A 1Y4CA 3AQCA 3B71A 4Q5SF 3M4CA 1MMAA 3IQ5A 3K1HA 2KNHA 2H7BA 1V55C 1YLMA 1YYXA 2NPUA 3DAGA 4G78A 3DXJF 3QTHA 3EHMA 2YKZA 3R7CA 4CIHA 1ORSC 3JRTA 1OR3A 4H54A 3ATPA 4YL0A 4Q7CA 4DVYP 4MQ9F 3V5ZA 1LM3B 4ONSA 2EIJC 3LS0A 3LS1A 4PFPA 4JC7A 4B6IA 5TJ5E 5HSWA 1RMVA 3EG9B 2RD9A 3F47A 2OJQA 3L34A 4IB4A 5DVWA 4ANJA 2ZXPA 2AP3A 4JTDB 3TQOA 2CNWD 2Q9AA 3N2ZB 1NU9C 2WZGA 2KGOA 1OCCC 5E2QA 3FDQA 2LQGA 1SF8A 3M79A 1CGNA 2DYRC 4KC9A 4U5FE 2WB7A 1GS9A 2NUPA 1M2OA 2PBEA 3QVZA 4WGZA 3SXMA 3VRCA 4JEAA 3ZVRA 2FAPB 2HMZA 4NTFA 4CDAA 4G7OF 2GWWA 3NG1A 3FMSA 5B1BC 1FNTc 2J9WA 3ZWIA 2MYSA 3DZAA 3CQZA 1LS4A 1JR8A 2JD3A 4PJMA 2KK1A 4LACB 2R7RA 2PX0A 2OG2A 2NSGA 1KNYA 2J45A 1YAUO 2BE5F 4KBLA 4MS2A 3RVYA 1D0YA 4GEHA 4AK9A 3K66A 4FAPB 4K1OA 1ZVZA 4JW1A 3LJBA 4CJOA 3MYIA 1CGOA 1FFTC 1Z23A 3GEEA 3B9QA 1D0XA 4PR9A 4BG0A 2HKVA 2Q9CA 3NYJA 4MVMA 3UR3C 2LCHA 4MVUA 1O5HA 4CS9A 4CDYA 4XQ1A 5CI9A 1SZIA 4XEFA 1OCRC 4OD5A 3RVZA 4MVOA 4QI0A 2D5RB 2OOCA 1OKKA 1E2XA 2GAQA 3DE8A 1H6GA 5COFA 2VC9A 5EK0A 3JSEO 4P6IC 2EPLX 1E83A 4IARA 2A69F 1I5NA 1WOLA 2OJED 5KYXA 1BBHA 1NLXA 2E87A 2V3CC 1OXBA 1J8MF 3EH2A 3HNIA 3SEOA 4RD9A 3SYNA 4AX2A 3QW1A 1E86A 2R7UA 1VYKA 3IPMO 3K1IA 4EUKB 5KYUB 2XLEA 1SR2A 3BEHA 3ZQVA 4BJ5C 4CIPA 3HTKC 4WGYA 1UG7A 2DB4A 3BRJA 5F5FA 5JSLA 3O10A 3W2VA 2H7OA 2ICWG 1AVOB 1TQGA 5T1DB 3G50A 3B0VC 2Y3BA 5T3TA 2IXNA 3U2MA 4G7ZF 1EQ1A 3ASOC 4W8PA 4OINF 5CI8A 4BEJA 1ZZPA 4LDQA 5A6AA 2AU5A 1AEPA 1VLSA 4IAOA 4A2NB 1YJGA 4JIOA 3EJNA 2EPNA 1BZ4A 3AOUA 3FAJA 3TK0A 3U2LA 3E9VA 1JRAA 3WHNA 1WGWA 4EHPA 4U9EA 3UNGC 1JMWA 4UDVA 4BEMJ 2HZ8A 4XEKA 5COGA 1OQCA 5JVEA 4R32A 3ZC4A 4E7ZA 1Z5ZA 4O6YA 2CW0F 3K6BA 3NYLA 1T6IA 1JPNA 1Z7Qc 1PCXA 3NMIA 4J30B 3U5SA 3ZTMA 3HKKA 4LLEA 3U9JA 4BPMA 1YZAA 4JKVA 1HW2A 3EGXB 2Y69C 1Q0MA 5DS4A 1FTSA 3DM9B 4XWJA 5L3QA 3KH2A 1BR1A 1NFNA 1CGME 2Q7RA 4NTBA 2R7OA 1YARO 2KC3A 2NSFA 4OIOF 1VTMP 4QDLA 1NG1A 3EZIA 4CSAC 1A7VA 2CYDA 3EQLF 5AGFA 4YT8A 1HE9A 2P0NA 4CX9A 5DS5A 1OKKD 4BJ5A 4D4NA 1T6UA 4U5HA 1C17M 2BL2A 4BJ6C 4C3BA 2L6HA 3TOMA 3V7OA 2XS8A 2XS1A 3FVYA 2LSEA 2X51A 3EZHA 3PMRA 2L6FA 2B0JA 4U9DA 5T3WA 1GQAA 1OW6A 3H2UA 3B0PA 2WL8A 4JRZA 2W4BA 1GGQA 1MMDA 1CPRA 1O87A 2WVNA 5E33A 3VAYA 4DRIB 1T6QA 4U5GA 2KSFA 2EPKX 4PJJA 4LDRA 3UMIA 3S84A 4IRUA 1G8XA 2P6VA 4JTCB 3GWNA 2XM4A 1PD1A 2XM0A 2OU6A 1NSGB 2R7QA 3TOLA 4XPYA 4YJWA 3JT1A 3ZG1A 5L0FA 2O9XA 2P7VA 3C8ZA 3M4BA 3T6JA 4J7YA 2VCBA 5KYNA 2EPOA 1MMNA 4K0DA 4MTGA 2Y39A 3LEVA 4O6MA 4OIRF 2NUTB 4XPXA 4GQHA 3L8IA 3S27A 1A7EA 3L0IA 1VOMA 2YL0A 4OIQF 4KNWA 1NFOA 4AE4B 2Q4FA 3ZIBA 3AG4C 2A68F 3T9OA 4MW3A 1NBBA 3PCVA 1O3UA 3CAXA 4N6CA 3EFOA 2J8WA 1S7ZA 2YQYA 4U5CE 4LERA 3U8PA 5BQIA 1OR2A 1VMAA 1Y6DA 2GA0A 2LD6A 3FHDA 3GM1A 3W8HA 3GORA 1LS1A 2Q9BA 3I5QA 1IW7F 4XLPF 2AWYA 1OXKA 4YT2A 4HFFB 1A0BA 1G4US 3K1IC 1AUEA 3IEEA 2NUTA 1TKNA 2OEXA 3HJCA 2AWCA 4IGGA 3JCUQ 5E3AA 3KYJA 3IQ6A 3M1CB 2OCCC 5B3IA 3JZ0A 5D92A 2R7SA 3G4ZA 2CNWA 3Q7LA 2GDCA 5AC4A 2LFFA 2YEVA 3GANA 5L0DA 4HE8D 1EA8A 4NC3A 2TMVP 2A6HF 3T4RA 5KYWB 2CCYA 3NYMA 4CDVA 3O6XA 4PFOA 1LI5A 3C8GA 3K7DA 3W8IA 5B1AC 3LESA 4XLNF 4DJ9A 3DD7A 1VB5A 3K33A 1LPEA 3HNJA 4JE9A 2A0UA 3UMKA 5DQTA 4DBQA 2HMQA 2IXMA 3JYYA 4FESA 1VLTA 2P61A 4YT5A 4AL0A 2AVKA 4I1OB 1E84A 1D0ZA 3N24A 2OKUA 4W8KA 3PDMP 3WG7C 1TWCA 3SP1A 3EGDB 1ORJA 1Q0KA 2G3VA 4U5BE 2IYLD 2HV7A 2YLDA 3L8JA 3W4YA 2LP4A 3KL4A 4MW8A 3U8VA 1JOGA 3AG1C 4C7OA 3SNHA 1D1BA 3RKOF 1SMYF 4MVSA 2R7XA 3ITFA 3EGXA 3LNMB 2GFHA 3H2VA 2ZD9A 4H4KC 4NTAA 5D91A 3TJ5A 2ZXRA 3EHNA 1Q0FA 2VB6A 2VH3A 4I3MA 4O7GA 1MQVA 3CEXA 3POVA 2PX3A 1M57C 4F4BA 2QE9A 3NRHA 3NMJA 2XLDA 2ZXWC 2RSEB 5JS5A 3KPHA 5EGYA 5KYXB 3DMDA 4G0HA 3OEOA 3ABKC 2ZXOA 5B3SC 2KW3C 4P9FA 1EI7A 4X0RA 4O6NA 3J06A 3I5PA 2QUPA 2XXAA 3ABLC 2QLAA 3EG9A 3JSZA 1FR0A 2LK4A 3C8GD 4E0HA 1XZPA 5KYYB 1TWHA 1ZYRF 3DI5A 3ZSUA 4DVZA 1C02A 1E85A 4KI2A 4IAQA 4ZLDA 3W2WA 3S28A 4Z9IA 4EBJA 2XXAB 5A6BA 4YWQA 2MWQA 2XLHA 3Q7GA 4BJ1A 2KYHA 3NKDA 2YVKA 4CS9C 1L3PA 1QVXA 2NUPB 2XL8A 3Q6MA 1TR2A 5L0GA 1KTMA 4AL1A 2OQMA 2C04A 1K05A 1BDJB 1ZHXA 2XL6A 2XLWA 5DLJA 1MMGA 2PNOA 1U0BB 3RH3A 1XWJA 2WZLA 4ZLCA 4JEBA 5JRAA 4E18A 4JJFA 3ABMC 1PD0A 2EIKC 2UUHA 1LVKA 3LNRA 4CS8A 1M56C 3RYLA 3B29A 2QY9A 3RIPA 1WN0A 3MYFA 4PJNA 4QI2A 1DOWA 1YZCA 2PF4E 3DE9A 2R05A 1B68A 1YA9A 3C8GB 3IQTA 3TD7A 4EKWA 4C7OB 3O39A 3JYHA 3MFNA 1VYIA 3V5XA 3LAYA 4NCQA 1A7DA 1TFKB 1WATA 2HJMA 3WODF 1PV3A 5CIVA 1OW8A 1V4AA 5DS6A 4LLCA 3OWTA 4I1MA 4PJLA 2X0CA 4IWBA 1R4TA 4I44A 1FMWA 3T6BA 1T9KA 5FZTA 1T5OA 2H8AA 1M6TA 1MNEA 4JZAA 2BC5A 3C62A 3M15A 4U5EE 3KMIA 2A6EF 4BJ6A 3DM5A 3HNKA 4FX5A 2L81A 1ZU5A 4NY3A 5KYUA 3GM3A 2J7PA 1RKEA 3TJ6A 2Y3DA 1H9GA 1YYJA 4K7BA 5L0IA 1TWGA 1HW1A 1YVIA 3A11A 3O55A 2UUIA 3DWWA 4C3DA 2FGYA 3DJUB 2I15A 2R02A 2YHSA 4JJGA 2G62A 1RKCA 2JX0A 1HMOA 1MNDA 2M4EA 2LIGA 2YLGA 4N6HA 1QQ3A 4CS8C 5JT4A 4WJ0A 1APCA 4P9TA 2HS5A 1NZEA 2JPUA 3MX3A 4U5DE 2IOQA 2KJGA 3GWLA 3LLIA 3CZ6A 4FWVA 1R5ID 4WABA 4YL3A 5JP7A 3LEOA 1G5ZA 1ZHTA 4MVQA 1H9TA 3IQCA 2QTVA 3QVYA 4J32B 1G4WR 1LE4A 3I4UA 5AC5A 3EH1A 4MVRA 2EPMX 3MLGA 4XPWA 3EFOB 5COMA 3ASNC 1GM5A 1M2VA 1T01A 2CDQA 2XRHA 3QW0A 5DQZA 2L6GA 3AGTA 3QMKA 4XEVA 3AGUA 4ULWA 5BQGA 5IY5C 3VM6A 4Q4ZF 2FFHA 1SYQA 1WWPA 3FOPA 1K40A 3V5YA 2Y3HA 1OW7A 5BQHA 2J9VA 1ORYA 2WZFA 2WVQA 5KYYA 5HV9A 4M63A 3ZTZA 4O79A 5L0JA 1RCPA 3U3FA 2R7WA 4Z9JA 1W2WA 2Y3GA 3KYIA 3NKEA 1FFHA 3RFYA 2L9JA 3S0XA 1ZU4A 3RW0A 2IBFA 3S29A 3VYWA 2R7TA 2Q00A 3X2QC 3PHF2 2YRFA 3QZCA 2DYSC 2J9UA 1LE2A 1Z6AA 4D4XA 1Q0GA 2C03A 3JTLO 4C3EA 3TULA 4YN0B 2XL4A 4OD4A 2B0HA 3OA1A 1Z63A 3N0TA 1RJ9A 2G3KA 1WASA 3ZDLA 3R2PA 4CSAA 3FXHA 1F1MA 2XLOA 3UGOA 1BR4A 4G7HF 3C18A 2EILC 2HSQA 3C7JA 3UMHA 2EIMC 2XLMA 2J7PD 1JAFA 4YT4A 3S9OA 2HUJA 3A9CA 3SXYA 2R03A 2XLVA 5FCLA 4XTKA 1KU2A 3SXZA 3EGDA 1XZQA 1IZMA 2EINC 3G4XA 5A6BD 1VK5A 4PK4A 2HV6A 1FMVA 5JLIA 1HMDA 1HY5A 3JRMO 4EIYA 1A41A 1ZHWA 3RQGA 2Q3TA 2ASRA 2V26A 4JCZA 1EKYA 3T6GB 4MNDA 4AE4A 2VCCA 4EBKA 2HSBA 2YL3A 5BUOA 3B0UX 5F5HA 1I4ZA 2NG1A 1RXQA 2CGEA 2OEVA 3X1OA 4E7SA 5A6JA 2DGJA 4DXWA 4CJGA 2IXPA 2W45A 4JURI 3U0CA 1YDIA 1BR2A 5L0CA 2HFIA 5KYWA 3SZRA 2ZPAA 1LI7A 1OCOC 2QNLA 2XSEA 2KQ9A 3AG3C 4DBRA 2DI3A 1ZW3A 2J0WA 1LIHA 4MTFA 2YWAA 4YK5A 2A0BA 1NU7D 2MHRA 4J7TA 3US6A 4MTOA 3HNLA 3LLKA 1QSPA 2HJ3A 2W4MA 3GEIA 4GYTA 2A1DD 4N06A 4ER9A 5EHHA 1YA7O 4YL1A 3AJMA 5L3VA 2VASA 1CPQA 3EPVA 1V54C 2R9RB 3L1MA 2J9BA 3DKAA 3DJNB 1K04A 2PFDA 1H7IA 3DAFA 1QLEC 1OCZC 3HLZA 1ZW2A 1C03A 3RQFA 1JPJA 3GODA 3NMKA 1ZHZA 1WTYA 4CS7A 5L0HA 1DOVA 1QZXA 3ECSA 1Q0DA 1RKEB 2WVOA 1ST6A 4EWCA 3Q6NA 2YZSA 4JVSA 3UGPA 3VF0A 3H65A 1L7CA 5GPGB 4CBEA 4PACA 2YLIA 1LKXA 3AQBA 3SXKA 4DOZA 5JUAA 4KNVA 3U9MA 2F22A 2IM8A 4N4WA 1QPUA
chains in the Genus database with same CATH topology
4ULVA 5JP7A 1E84A 3QVYA 2YLDA 3QW0A 4U9EA 3C63A 5JVEA 4L6RA 3FOPA 3FOOA 3NMIA 3ZTMA 256BA 1YZAA 2YL1A 4JKVA 3ZQYA 3ZTZA 1MQVA 1RCPA 1S05A 2XLDA 3NMJA 2YL7A 5JS5A 3M4CA 3IQ5A 1A7VA 5AGFA 1YYXA 4CX9A 4D4XA 4D4NA 2YKZA 2QLAA 3TOMA 1LM3B 1E85A 4IAQA 4U9DA 1GQAA 2XLOA 4IB4A 2XLHA 1CPRA 2XLMA 1JAFA 2XL8A 2XLVA 2XLWA 2XL6A 3M79A 2XM4A 1CGNA 2XM0A 5JLIA 5JRAA 3QVZA 4JEBA 4WGZA 3TOLA 3VRCA 4JEAA 4CDAA 3M4BA 4EIYA 1EKYA 3ZWIA 2YL3A 1QPUA 1YZCA 3DE9A 2YL0A 4CJGA 1NBBA 4CJOA 1CGOA 2J8WA 3U8PA 3HNLA 4CDYA 4ER9A 1CPQA 1M6TA 2BC5A 2J9BA 3C62A 3DE8A 3L1MA 3M15A 3HNKA 1E83A 4IARA 3IQ6A 5B3IA 3NMKA 1BBHA 1YYJA 3HNIA 1E86A 3QW1A 4NC3A 2XLEA 3ZQVA 4CIPA 2CCYA 4WGYA 4CDVA 2YLIA 5JSLA 5JUAA 2YLGA 4N6HA 1QQ3A 5JT4A 1APCA 4N4WA 3HNJA 4JE9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ULV A;  5JP7 A;  1E84 A;  3QVY A;  2YLD A;  3QW0 A;  4U9E A;  3C63 A;  5JVE A;  4L6R A;  3FOP A;  3FOO A;  3NMI A;  3ZTM A;  256B A;  1YZA A;  2YL1 A;  4JKV A;  3ZQY A;  3ZTZ A;  1MQV A;  1RCP A;  1S05 A;  2XLD A;  3NMJ A;  2YL7 A;  5JS5 A;  3M4C A;  3IQ5 A;  1A7V A;  5AGF A;  1YYX A;  4CX9 A;  4D4X A;  4D4N A;  2YKZ A;  2QLA A;  3TOM A;  1LM3 B;  1E85 A;  4IAQ A;  4U9D A;  1GQA A;  2XLO A;  4IB4 A;  2XLH A;  1CPR A;  2XLM A;  1JAF A;  2XL8 A;  2XLV A;  2XLW A;  2XL6 A;  3M79 A;  2XM4 A;  1CGN A;  2XM0 A;  5JLI A;  5JRA A;  3QVZ A;  4JEB A;  4WGZ A;  3TOL A;  3VRC A;  4JEA A;  4CDA A;  3M4B A;  4EIY A;  1EKY A;  3ZWI A;  2YL3 A;  1QPU A;  1YZC A;  3DE9 A;  2YL0 A;  4CJG A;  1NBB A;  4CJO A;  1CGO A;  2J8W A;  3U8P A;  3HNL A;  4CDY A;  4ER9 A;  1CPQ A;  1M6T A;  2BC5 A;  2J9B A;  3C62 A;  3DE8 A;  3L1M A;  3M15 A;  3HNK A;  1E83 A;  4IAR A;  3IQ6 A;  5B3I A;  3NMK A;  1BBH A;  1YYJ A;  3HNI A;  1E86 A;  3QW1 A;  4NC3 A;  2XLE A;  3ZQV A;  4CIP A;  2CCY A;  4WGY A;  4CDV A;  2YLI A;  5JSL A;  5JUA A;  2YLG A;  4N6H A;  1QQ3 A;  5JT4 A;  1APC A;  4N4W A;  3HNJ A;  4JE9 A; 
#chains in the Genus database with same CATH topology
 2ETS A;  2P1A A;  3RQE A;  5A6K A;  4ULV A;  2J0X A;  1J8Y F;  4RBN A;  4OIP F;  1U89 A;  1QKR A;  3NDB B;  2D4U A;  4E0I A;  4EBB A;  4Z9H A;  1V74 B;  1I4Y A;  1D1A A;  2I8B A;  1TFO B;  4HFK B;  3GM2 A;  1Z3I X;  3FAP B;  1M2V B;  2W9Y A;  1UFB A;  4IJJ A;  4JCH A;  3F46 A;  1N1C A;  1TWA A;  3KKB A;  5E3C A;  2L7A A;  3C63 A;  3WAQ A;  5K0I A;  1U6H A;  5F28 E;  3E70 C;  4NQF A;  4RDA A;  3U3B A;  4L6R A;  2PP4 A;  3AG2 C;  1ZHY A;  3FOO A;  2R25 A;  4DRH B;  4DRJ B;  256B A;  3S90 A;  4MVZ A;  2YL1 A;  4HEA J;  2M64 A;  4E17 A;  2R7V A;  1RJ9 B;  3LUT B;  4BJT A;  3ZQY A;  2H7V C;  2LFD A;  1D1C A;  3MBG A;  4LDK A;  2J46 A;  3CSK A;  3IHU A;  2Z15 A;  3GEH A;  2IXO A;  1HE1 A;  2VCA A;  1FAP B;  3RF3 A;  4JTA B;  4A4A A;  1S05 A;  5A69 A;  2YL7 A;  1Y4C A;  3AQC A;  3B71 A;  4Q5S F;  3M4C A;  1MMA A;  3IQ5 A;  3K1H A;  2KNH A;  2H7B A;  1V55 C;  1YLM A;  1YYX A;  2NPU A;  3DAG A;  4G78 A;  3DXJ F;  3QTH A;  3EHM A;  2YKZ A;  3R7C A;  4CIH A;  1ORS C;  3JRT A;  1OR3 A;  4H54 A;  3ATP A;  4YL0 A;  4Q7C A;  4DVY P;  4MQ9 F;  3V5Z A;  1LM3 B;  4ONS A;  2EIJ C;  3LS0 A;  3LS1 A;  4PFP A;  4JC7 A;  4B6I A;  5TJ5 E;  5HSW A;  1RMV A;  3EG9 B;  2RD9 A;  3F47 A;  2OJQ A;  3L34 A;  4IB4 A;  5DVW A;  4ANJ A;  2ZXP A;  2AP3 A;  4JTD B;  3TQO A;  2CNW D;  2Q9A A;  3N2Z B;  1NU9 C;  2WZG A;  2KGO A;  1OCC C;  5E2Q A;  3FDQ A;  2LQG A;  1SF8 A;  3M79 A;  1CGN A;  2DYR C;  4KC9 A;  4U5F E;  2WB7 A;  1GS9 A;  2NUP A;  1M2O A;  2PBE A;  3QVZ A;  4WGZ A;  3SXM A;  3VRC A;  4JEA A;  3ZVR A;  2FAP B;  2HMZ A;  4NTF A;  4CDA A;  4G7O F;  2GWW A;  3NG1 A;  3FMS A;  5B1B C;  1FNT c;  2J9W A;  3ZWI A;  2MYS A;  3DZA A;  3CQZ A;  1LS4 A;  1JR8 A;  2JD3 A;  4PJM A;  2KK1 A;  4LAC B;  2R7R A;  2PX0 A;  2OG2 A;  2NSG A;  1KNY A;  2J45 A;  1YAU O;  2BE5 F;  4KBL A;  4MS2 A;  3RVY A;  1D0Y A;  4GEH A;  4AK9 A;  3K66 A;  4FAP B;  4K1O A;  1ZVZ A;  4JW1 A;  3LJB A;  4CJO A;  3MYI A;  1CGO A;  1FFT C;  1Z23 A;  3GEE A;  3B9Q A;  1D0X A;  4PR9 A;  4BG0 A;  2HKV A;  2Q9C A;  3NYJ A;  4MVM A;  3UR3 C;  2LCH A;  4MVU A;  1O5H A;  4CS9 A;  4CDY A;  4XQ1 A;  5CI9 A;  1SZI A;  4XEF A;  1OCR C;  4OD5 A;  3RVZ A;  4MVO A;  4QI0 A;  2D5R B;  2OOC A;  1OKK A;  1E2X A;  2GAQ A;  3DE8 A;  1H6G A;  5COF A;  2VC9 A;  5EK0 A;  3JSE O;  4P6I C;  2EPL X;  1E83 A;  4IAR A;  2A69 F;  1I5N A;  1WOL A;  2OJE D;  5KYX A;  1BBH A;  1NLX A;  2E87 A;  2V3C C;  1OXB A;  1J8M F;  3EH2 A;  3HNI A;  3SEO A;  4RD9 A;  3SYN A;  4AX2 A;  3QW1 A;  1E86 A;  2R7U A;  1VYK A;  3IPM O;  3K1I A;  4EUK B;  5KYU B;  2XLE A;  1SR2 A;  3BEH A;  3ZQV A;  4BJ5 C;  4CIP A;  3HTK C;  4WGY A;  1UG7 A;  2DB4 A;  3BRJ A;  5F5F A;  5JSL A;  3O10 A;  3W2V A;  2H7O A;  2ICW G;  1AVO B;  1TQG A;  5T1D B;  3G50 A;  3B0V C;  2Y3B A;  5T3T A;  2IXN A;  3U2M A;  4G7Z F;  1EQ1 A;  3ASO C;  4W8P A;  4OIN F;  5CI8 A;  4BEJ A;  1ZZP A;  4LDQ A;  5A6A A;  2AU5 A;  1AEP A;  1VLS A;  4IAO A;  4A2N B;  1YJG A;  4JIO A;  3EJN A;  2EPN A;  1BZ4 A;  3AOU A;  3FAJ A;  3TK0 A;  3U2L A;  3E9V A;  1JRA A;  3WHN A;  1WGW A;  4EHP A;  4U9E A;  3UNG C;  1JMW A;  4UDV A;  4BEM J;  2HZ8 A;  4XEK A;  5COG A;  1OQC A;  5JVE A;  4R32 A;  3ZC4 A;  4E7Z A;  1Z5Z A;  4O6Y A;  2CW0 F;  3K6B A;  3NYL A;  1T6I A;  1JPN A;  1Z7Q c;  1PCX A;  3NMI A;  4J30 B;  3U5S A;  3ZTM A;  3HKK A;  4LLE A;  3U9J A;  4BPM A;  1YZA A;  4JKV A;  1HW2 A;  3EGX B;  2Y69 C;  1Q0M A;  5DS4 A;  1FTS A;  3DM9 B;  4XWJ A;  5L3Q A;  3KH2 A;  1BR1 A;  1NFN A;  1CGM E;  2Q7R A;  4NTB A;  2R7O A;  1YAR O;  2KC3 A;  2NSF A;  4OIO F;  1VTM P;  4QDL A;  1NG1 A;  3EZI A;  4CSA C;  1A7V A;  2CYD A;  3EQL F;  5AGF A;  4YT8 A;  1HE9 A;  2P0N A;  4CX9 A;  5DS5 A;  1OKK D;  4BJ5 A;  4D4N A;  1T6U A;  4U5H A;  1C17 M;  2BL2 A;  4BJ6 C;  4C3B A;  2L6H A;  3TOM A;  3V7O A;  2XS8 A;  2XS1 A;  3FVY A;  2LSE A;  2X51 A;  3EZH A;  3PMR A;  2L6F A;  2B0J A;  4U9D A;  5T3W A;  1GQA A;  1OW6 A;  3H2U A;  3B0P A;  2WL8 A;  4JRZ A;  2W4B A;  1GGQ A;  1MMD A;  1CPR A;  1O87 A;  2WVN A;  5E33 A;  3VAY A;  4DRI B;  1T6Q A;  4U5G A;  2KSF A;  2EPK X;  4PJJ A;  4LDR A;  3UMI A;  3S84 A;  4IRU A;  1G8X A;  2P6V A;  4JTC B;  3GWN A;  2XM4 A;  1PD1 A;  2XM0 A;  2OU6 A;  1NSG B;  2R7Q A;  3TOL A;  4XPY A;  4YJW A;  3JT1 A;  3ZG1 A;  5L0F A;  2O9X A;  2P7V A;  3C8Z A;  3M4B A;  3T6J A;  4J7Y A;  2VCB A;  5KYN A;  2EPO A;  1MMN A;  4K0D A;  4MTG A;  2Y39 A;  3LEV A;  4O6M A;  4OIR F;  2NUT B;  4XPX A;  4GQH A;  3L8I A;  3S27 A;  1A7E A;  3L0I A;  1VOM A;  2YL0 A;  4OIQ F;  4KNW A;  1NFO A;  4AE4 B;  2Q4F A;  3ZIB A;  3AG4 C;  2A68 F;  3T9O A;  4MW3 A;  1NBB A;  3PCV A;  1O3U A;  3CAX A;  4N6C A;  3EFO A;  2J8W A;  1S7Z A;  2YQY A;  4U5C E;  4LER A;  3U8P A;  5BQI A;  1OR2 A;  1VMA A;  1Y6D A;  2GA0 A;  2LD6 A;  3FHD A;  3GM1 A;  3W8H A;  3GOR A;  1LS1 A;  2Q9B A;  3I5Q A;  1IW7 F;  4XLP F;  2AWY A;  1OXK A;  4YT2 A;  4HFF B;  1A0B A;  1G4U S;  3K1I C;  1AUE A;  3IEE A;  2NUT A;  1TKN A;  2OEX A;  3HJC A;  2AWC A;  4IGG A;  3JCU Q;  5E3A A;  3KYJ A;  3IQ6 A;  3M1C B;  2OCC C;  5B3I A;  3JZ0 A;  5D92 A;  2R7S A;  3G4Z A;  2CNW A;  3Q7L A;  2GDC A;  5AC4 A;  2LFF A;  2YEV A;  3GAN A;  5L0D A;  4HE8 D;  1EA8 A;  4NC3 A;  2TMV P;  2A6H F;  3T4R A;  5KYW B;  2CCY A;  3NYM A;  4CDV A;  3O6X A;  4PFO A;  1LI5 A;  3C8G A;  3K7D A;  3W8I A;  5B1A C;  3LES A;  4XLN F;  4DJ9 A;  3DD7 A;  1VB5 A;  3K33 A;  1LPE A;  3HNJ A;  4JE9 A;  2A0U A;  3UMK A;  5DQT A;  4DBQ A;  2HMQ A;  2IXM A;  3JYY A;  4FES A;  1VLT A;  2P61 A;  4YT5 A;  4AL0 A;  2AVK A;  4I1O B;  1E84 A;  1D0Z A;  3N24 A;  2OKU A;  4W8K A;  3PDM P;  3WG7 C;  1TWC A;  3SP1 A;  3EGD B;  1ORJ A;  1Q0K A;  2G3V A;  4U5B E;  2IYL D;  2HV7 A;  2YLD A;  3L8J A;  3W4Y A;  2LP4 A;  3KL4 A;  4MW8 A;  3U8V A;  1JOG A;  3AG1 C;  4C7O A;  3SNH A;  1D1B A;  3RKO F;  1SMY F;  4MVS A;  2R7X A;  3ITF A;  3EGX A;  3LNM B;  2GFH A;  3H2V A;  2ZD9 A;  4H4K C;  4NTA A;  5D91 A;  3TJ5 A;  2ZXR A;  3EHN A;  1Q0F A;  2VB6 A;  2VH3 A;  4I3M A;  4O7G A;  1MQV A;  3CEX A;  3POV A;  2PX3 A;  1M57 C;  4F4B A;  2QE9 A;  3NRH A;  3NMJ A;  2XLD A;  2ZXW C;  2RSE B;  5JS5 A;  3KPH A;  5EGY A;  5KYX B;  3DMD A;  4G0H A;  3OEO A;  3ABK C;  2ZXO A;  5B3S C;  2KW3 C;  4P9F A;  1EI7 A;  4X0R A;  4O6N A;  3J06 A;  3I5P A;  2QUP A;  2XXA A;  3ABL C;  2QLA A;  3EG9 A;  3JSZ A;  1FR0 A;  2LK4 A;  3C8G D;  4E0H A;  1XZP A;  5KYY B;  1TWH A;  1ZYR F;  3DI5 A;  3ZSU A;  4DVZ A;  1C02 A;  1E85 A;  4KI2 A;  4IAQ A;  4ZLD A;  3W2W A;  3S28 A;  4Z9I A;  4EBJ A;  2XXA B;  5A6B A;  4YWQ A;  2MWQ A;  2XLH A;  3Q7G A;  4BJ1 A;  2KYH A;  3NKD A;  2YVK A;  4CS9 C;  1L3P A;  1QVX A;  2NUP B;  2XL8 A;  3Q6M A;  1TR2 A;  5L0G A;  1KTM A;  4AL1 A;  2OQM A;  2C04 A;  1K05 A;  1BDJ B;  1ZHX A;  2XL6 A;  2XLW A;  5DLJ A;  1MMG A;  2PNO A;  1U0B B;  3RH3 A;  1XWJ A;  2WZL A;  4ZLC A;  4JEB A;  5JRA A;  4E18 A;  4JJF A;  3ABM C;  1PD0 A;  2EIK C;  2UUH A;  1LVK A;  3LNR A;  4CS8 A;  1M56 C;  3RYL A;  3B29 A;  2QY9 A;  3RIP A;  1WN0 A;  3MYF A;  4PJN A;  4QI2 A;  1DOW A;  1YZC A;  2PF4 E;  3DE9 A;  2R05 A;  1B68 A;  1YA9 A;  3C8G B;  3IQT A;  3TD7 A;  4EKW A;  4C7O B;  3O39 A;  3JYH A;  3MFN A;  1VYI A;  3V5X A;  3LAY A;  4NCQ A;  1A7D A;  1TFK B;  1WAT A;  2HJM A;  3WOD F;  1PV3 A;  5CIV A;  1OW8 A;  1V4A A;  5DS6 A;  4LLC A;  3OWT A;  4I1M A;  4PJL A;  2X0C A;  4IWB A;  1R4T A;  4I44 A;  1FMW A;  3T6B A;  1T9K A;  5FZT A;  1T5O A;  2H8A A;  1M6T A;  1MNE A;  4JZA A;  2BC5 A;  3C62 A;  3M15 A;  4U5E E;  3KMI A;  2A6E F;  4BJ6 A;  3DM5 A;  3HNK A;  4FX5 A;  2L81 A;  1ZU5 A;  4NY3 A;  5KYU A;  3GM3 A;  2J7P A;  1RKE A;  3TJ6 A;  2Y3D A;  1H9G A;  1YYJ A;  4K7B A;  5L0I A;  1TWG A;  1HW1 A;  1YVI A;  3A11 A;  3O55 A;  2UUI A;  3DWW A;  4C3D A;  2FGY A;  3DJU B;  2I15 A;  2R02 A;  2YHS A;  4JJG A;  2G62 A;  1RKC A;  2JX0 A;  1HMO A;  1MND A;  2M4E A;  2LIG A;  2YLG A;  4N6H A;  1QQ3 A;  4CS8 C;  5JT4 A;  4WJ0 A;  1APC A;  4P9T A;  2HS5 A;  1NZE A;  2JPU A;  3MX3 A;  4U5D E;  2IOQ A;  2KJG A;  3GWL A;  3LLI A;  3CZ6 A;  4FWV A;  1R5I D;  4WAB A;  4YL3 A;  5JP7 A;  3LEO A;  1G5Z A;  1ZHT A;  4MVQ A;  1H9T A;  3IQC A;  2QTV A;  3QVY A;  4J32 B;  1G4W R;  1LE4 A;  3I4U A;  5AC5 A;  3EH1 A;  4MVR A;  2EPM X;  3MLG A;  4XPW A;  3EFO B;  5COM A;  3ASN C;  1GM5 A;  1M2V A;  1T01 A;  2CDQ A;  2XRH A;  3QW0 A;  5DQZ A;  2L6G A;  3AGT A;  3QMK A;  4XEV A;  3AGU A;  4ULW A;  5BQG A;  5IY5 C;  3VM6 A;  4Q4Z F;  2FFH A;  1SYQ A;  1WWP A;  3FOP A;  1K40 A;  3V5Y A;  2Y3H A;  1OW7 A;  5BQH A;  2J9V A;  1ORY A;  2WZF A;  2WVQ A;  5KYY A;  5HV9 A;  4M63 A;  3ZTZ A;  4O79 A;  5L0J A;  1RCP A;  3U3F A;  2R7W A;  4Z9J A;  1W2W A;  2Y3G A;  3KYI A;  3NKE A;  1FFH A;  3RFY A;  2L9J A;  3S0X A;  1ZU4 A;  3RW0 A;  2IBF A;  3S29 A;  3VYW A;  2R7T A;  2Q00 A;  3X2Q C;  3PHF 2;  2YRF A;  3QZC A;  2DYS C;  2J9U A;  1LE2 A;  1Z6A A;  4D4X A;  1Q0G A;  2C03 A;  3JTL O;  4C3E A;  3TUL A;  4YN0 B;  2XL4 A;  4OD4 A;  2B0H A;  3OA1 A;  1Z63 A;  3N0T A;  1RJ9 A;  2G3K A;  1WAS A;  3ZDL A;  3R2P A;  4CSA A;  3FXH A;  1F1M A;  2XLO A;  3UGO A;  1BR4 A;  4G7H F;  3C18 A;  2EIL C;  2HSQ A;  3C7J A;  3UMH A;  2EIM C;  2XLM A;  2J7P D;  1JAF A;  4YT4 A;  3S9O A;  2HUJ A;  3A9C A;  3SXY A;  2R03 A;  2XLV A;  5FCL A;  4XTK A;  1KU2 A;  3SXZ A;  3EGD A;  1XZQ A;  1IZM A;  2EIN C;  3G4X A;  5A6B D;  1VK5 A;  4PK4 A;  2HV6 A;  1FMV A;  5JLI A;  1HMD A;  1HY5 A;  3JRM O;  4EIY A;  1A41 A;  1ZHW A;  3RQG A;  2Q3T A;  2ASR A;  2V26 A;  4JCZ A;  1EKY A;  3T6G B;  4MND A;  4AE4 A;  2VCC A;  4EBK A;  2HSB A;  2YL3 A;  5BUO A;  3B0U X;  5F5H A;  1I4Z A;  2NG1 A;  1RXQ A;  2CGE A;  2OEV A;  3X1O A;  4E7S A;  5A6J A;  2DGJ A;  4DXW A;  4CJG A;  2IXP A;  2W45 A;  4JUR I;  3U0C A;  1YDI A;  1BR2 A;  5L0C A;  2HFI A;  5KYW A;  3SZR A;  2ZPA A;  1LI7 A;  1OCO C;  2QNL A;  2XSE A;  2KQ9 A;  3AG3 C;  4DBR A;  2DI3 A;  1ZW3 A;  2J0W A;  1LIH A;  4MTF A;  2YWA A;  4YK5 A;  2A0B A;  1NU7 D;  2MHR A;  4J7T A;  3US6 A;  4MTO A;  3HNL A;  3LLK A;  1QSP A;  2HJ3 A;  2W4M A;  3GEI A;  4GYT A;  2A1D D;  4N06 A;  4ER9 A;  5EHH A;  1YA7 O;  4YL1 A;  3AJM A;  5L3V A;  2VAS A;  1CPQ A;  3EPV A;  1V54 C;  2R9R B;  3L1M A;  2J9B A;  3DKA A;  3DJN B;  1K04 A;  2PFD A;  1H7I A;  3DAF A;  1QLE C;  1OCZ C;  3HLZ A;  1ZW2 A;  1C03 A;  3RQF A;  1JPJ A;  3GOD A;  3NMK A;  1ZHZ A;  1WTY A;  4CS7 A;  5L0H A;  1DOV A;  1QZX A;  3ECS A;  1Q0D A;  1RKE B;  2WVO A;  1ST6 A;  4EWC A;  3Q6N A;  2YZS A;  4JVS A;  3UGP A;  3VF0 A;  3H65 A;  1L7C A;  5GPG B;  4CBE A;  4PAC A;  2YLI A;  1LKX A;  3AQB A;  3SXK A;  4DOZ A;  5JUA A;  4KNV A;  3U9M A;  2F22 A;  2IM8 A;  4N4W A;  1QPU A; 
#chains in the Genus database with same CATH homology
 4ULV A;  5JP7 A;  1E84 A;  3QVY A;  2YLD A;  3QW0 A;  4U9E A;  3C63 A;  5JVE A;  4L6R A;  3FOP A;  3FOO A;  3NMI A;  3ZTM A;  256B A;  1YZA A;  2YL1 A;  4JKV A;  3ZQY A;  3ZTZ A;  1MQV A;  1RCP A;  1S05 A;  2XLD A;  3NMJ A;  2YL7 A;  5JS5 A;  3M4C A;  3IQ5 A;  1A7V A;  5AGF A;  1YYX A;  4CX9 A;  4D4X A;  4D4N A;  2YKZ A;  2QLA A;  3TOM A;  1LM3 B;  1E85 A;  4IAQ A;  4U9D A;  1GQA A;  2XLO A;  4IB4 A;  2XLH A;  1CPR A;  2XLM A;  1JAF A;  2XL8 A;  2XLV A;  2XLW A;  2XL6 A;  3M79 A;  2XM4 A;  1CGN A;  2XM0 A;  5JLI A;  5JRA A;  3QVZ A;  4JEB A;  4WGZ A;  3TOL A;  3VRC A;  4JEA A;  4CDA A;  3M4B A;  4EIY A;  1EKY A;  3ZWI A;  2YL3 A;  1QPU A;  1YZC A;  3DE9 A;  2YL0 A;  4CJG A;  1NBB A;  4CJO A;  1CGO A;  2J8W A;  3U8P A;  3HNL A;  4CDY A;  4ER9 A;  1CPQ A;  1M6T A;  2BC5 A;  2J9B A;  3C62 A;  3DE8 A;  3L1M A;  3M15 A;  3HNK A;  1E83 A;  4IAR A;  3IQ6 A;  5B3I A;  3NMK A;  1BBH A;  1YYJ A;  3HNI A;  1E86 A;  3QW1 A;  4NC3 A;  2XLE A;  3ZQV A;  4CIP A;  2CCY A;  4WGY A;  4CDV A;  2YLI A;  5JSL A;  5JUA A;  2YLG A;  4N6H A;  1QQ3 A;  5JT4 A;  1APC A;  4N4W A;  3HNJ A;  4JE9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...