5B3IA

Homo-dimeric structure of cytochrome c' from thermophilic hydrogenophilus thermoluteolus
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
135
structure length
135
Chain Sequence
DALKPEDKVKFRQASYTTMAWNMGKIKAMVVDGTMPFSQTQVSAAANVIAAIANSGMGALYSPDTLGVVGFKKSRLKENFFQEQDEVRKIATNFVEQANKLAEVAAMGDKDEIKAQFGEVGKACKACHEKFREEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c prime
publication title Structural and functional insights into thermally stable cytochrome c' from a thermophile
pubmed doi rcsb
molecule tags Electron transport
total genus 55
structure length 135
sequence length 135
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 5b3iA00
3M4CA 1APCA 3L1MA 4N4WA 3DE8A 4ULVA 1E83A 5JRAA 1CGOA 1YZAA 4N6HA 3HNIA 2XLEA 1QPUA 4D4NA 2XLDA 1BBHA 3M4BA 3HNKA 3ZWIA 2BC5A 2YLIA 3QW1A 4WGZA 4NC3A 2QLAA 5JUAA 1JAFA 3ZTMA 1E86A 3C62A 4IB4A 1EKYA 2XL8A 4IAQA 4CDAA 1LM3B 1YYXA 2CCYA 3NMIA 5JLIA 4CJGA 2XLMA 4U9EA 3VRCA 2YL3A 2YLGA 2XM0A 5JSLA 2XLOA 3ZQYA 1NBBA 1CPRA 4ER9A 4U9DA 1E84A 1YYJA 2J8WA 2YL7A 3FOPA 2YLDA 3ZTZA 2XM4A 3ZQVA 3M15A 3M79A 5JS5A 3QW0A 4CJOA 2XLHA 4JKVA 3NMJA 4IARA 2XLWA 4CIPA 4JE9A 4JEBA 3TOMA 1MQVA 1GQAA 3C63A 3HNLA 1A7VA 5B3IA 3IQ5A 4CDVA 3QVZA 2J9BA 1CGNA 4L6RA 3DE9A 256BA 3NMKA 4JEAA 3QVYA 2XLVA 2XL6A 5JT4A 3U8PA 1S05A 2YL0A 4CDYA 5AGFA 4EIYA 3HNJA 4WGYA 1QQ3A 2YKZA 4CX9A 1YZCA 2YL1A 3TOLA 3IQ6A 1CPQA 5JVEA 1M6TA 3FOOA 4D4XA 1E85A 5JP7A 1RCPA
chains in the Genus database with same CATH superfamily
2RD9A 2GDCA 1LVKA 2DB4A 2TMVP 4XQ1A 1O3UA 3EQLF 3FAPB 3S9OA 1I5NA 2HKVA 3T6BA 3TD7A 5HSWA 1PV3A 3NKDA 3C18A 3C8ZA 4E18A 1U6HA 4D4NA 4Q5SF 3NKEA 1BBHA 2EPKX 3M4BA 2OQMA 4J7YA 2NSFA 3NYJA 4YL1A 3MLGA 5K0IA 3QZCA 1RMVA 2DYSC 3JYYA 1U89A 2WZGA 4O79A 5DVWA 1WOLA 4ULWA 2A1DD 3QW1A 3GM1A 4FWVA 4YL3A 3G4XA 5AC5A 5BUOA 4KI2A 4G78A 4WGZA 5KYYA 1RXQA 1JAFA 2AP3A 5A69A 1Z5ZA 2HSQA 4GQHA 4EHPA 3ZVRA 3AGTA 5FCLA 4IB4A 1EKYA 2IBFA 5B1AC 5GPGB 1RKCA 1LM3B 2CCYA 1HW2A 4Z9HA 4CS9C 2VCCA 2PP4A 2Q9BA 4JZAA 5A6BD 4U9EA 3I5PA 3VRCA 2RSEB 1D1BA 2YL3A 2YLGA 2EINC 4U5FE 1PCXA 3FVYA 3DWWA 4RBNA 3SEOA 2J7PD 3TQOA 1Q0FA 2WVNA 1ZW2A 2XLOA 1OCZC 3JCUQ 2Z15A 5E2QA 2HMZA 1D0ZA 1E2XA 1CPRA 2EIMC 3KPHA 4U9DA 3VYWA 4ER9A 1YYJA 4I1OB 3KYJA 2NG1A 2YHSA 3HKKA 1JR8A 4BEMJ 1OXBA 2HJMA 2YLDA 2WVQA 2W4BA 1G5ZA 1MMGA 4P6IC 2PFDA 4NTFA 2O9XA 2OCCC 3U3FA 5E3CA 1RJ9A 2XXAA 2H7BA 5L3VA 3U2LA 3ABLC 2R02A 2R7QA 3C8GA 3BEHA 2EIJC 4JKVA 4CIHA 3EPVA 3G50A 3PHF2 1G4WR 2WZFA 5KYYB 4FESA 1FMWA 1MNEA 2AVKA 2KW3C 3EZHA 3ASNC 3ABKC 1WTYA 3RQGA 3T6JA 3A9CA 4HE8D 3HTKC 1HMOA 1VYIA 1TWGA 3C63A 2MHRA 3HNLA 1OKKA 3H2VA 4Z9JA 3T9OA 3UMIA 1QLEC 5B3IA 1E85A 5COFA 4B6IA 3I4UA 4JTCB 1NZEA 1NU9C 2I15A 5T3TA 4MVRA 1FNTc 1TWCA 3EJNA 1SR2A 2D5RB 2W9YA 2A6EF 3DE9A 3ATPA 3MYIA 3LUTB 4DVZA 4AE4B 2LQGA 1NFNA 1V55C 2OG2A 1G8XA 3K66A 1OQCA 3DJUB 3U8PA 1MNDA 1YJGA 4U5DE 1M56C 3T6GB 3PMRA 1S05A 4HFFB 4K7BA 1O87A 2YL0A 4K0DA 4MVSA 5DQTA 3H65A 2DI3A 1AVOB 3OEOA 2R25A 1TFKB 4PJNA 2OJED 2J0XA 2X0CA 1JMWA 1N1CA 1W2WA 3CSKA 3S0XA 4WABA 1R4TA 1YVIA 2IYLD 3LEVA 3DAFA 4YT5A 3FAJA 2XS8A 3L0IA 5KYXA 4XEFA 4EIYA 3EH1A 4G7OF 2LFFA 4ONSA 2AU5A 1QQ3A 1T9KA 4CSAC 1VOMA 1RJ9B 3LNRA 3LNMB 3POVA 2XXAB 3IQ6A 3K1IC 4DRHB 2ZD9A 1ZHXA 4XEVA 3DI5A 5JVEA 1J8YF 2KQ9A 1M57C 1NG1A 3FOOA 3IPMO 3PDMP 4EBKA 4MVOA 2CDQA 2HV6A 3Q6MA 4MVUA 4U5EE 3M4CA 3ZIBA 1C02A 2JX0A 2YVKA 4H54A 4IWBA 3T4RA 4DXWA 1C17M 3DE8A 1I4ZA 4YWQA 3SNHA 1OR3A 5JRAA 1E83A 1YZAA 4XTKA 2Q4FA 4PACA 3O55A 3EHNA 2Y3HA 4DRJB 1SZIA 3HNKA 2EPLX 3V5ZA 4KBLA 2WL8A 4BJ6C 4PJJA 2NSGA 2YLIA 3U3BA 4E17A 4JW1A 4CS9A 4QI2A 2Q9CA 4N06A 3EH2A 2R7VA 2M64A 2EIKC 2P0NA 5BQIA 4PJLA 2L6HA 4OIPF 2QNLA 3AGUA 1K04A 3Q6NA 2JD3A 3IEEA 1TQGA 2C04A 3C62A 2LK4A 3X1OA 1NFOA 1Q0KA 2YZSA 3RQEA 1I4YA 2HUJA 1Z7Qc 1CGME 2XL8A 1WGWA 4IAQA 4IJJA 3KH2A 5F5FA 1NSGB 1YYXA 1RKEA 2HV7A 4JRZA 3SXZA 4LDKA 5FZTA 3S27A 4CJGA 4F4BA 3UGOA 4Q7CA 3VF0A 3W8HA 2L7AA 4P9FA 4RDAA 1MMAA 4E0HA 1XZPA 3AG3C 3DKAA 3RFYA 1QKRA 1A7DA 1ORSC 1HW1A 2J8WA 2IM8A 2YL7A 3NDBB 4C3EA 1ZYRF 3FOPA 2UUIA 1YA9A 3QMKA 2Q9AA 5L0GA 2R7RA 2J9WA 3IHUA 1WWPA 1HE9A 2PF4E 3N2ZB 2ZXRA 3ITFA 3RVZA 3X2QC 3AG2C 1OCOC 3G4ZA 4O6NA 1FFHA 2UUHA 3EG9B 2NUPA 3LEOA 3NYMA 2IXPA 3GWLA 3W2WA 1KU2A 4BPMA 1T5OA 1KTMA 3K7DA 4PK4A 5DS5A 1ZHWA 1FAPB 1SYQA 3S29A 3UMKA 3R7CA 2J45A 1NLXA 4IARA 2XLWA 4CIPA 4JC7A 3C8GD 3TK0A 4UDVA 1ORJA 2BE5F 2R7OA 3GEIA 5IY5C 3KL4A 4AE4A 2R7WA 2PX3A 1XZQA 2EPMX 4LERA 2M4EA 3S28A 1YDIA 1WN0A 3GWNA 1TKNA 3U5SA 4CS7A 3CQZA 4DBRA 5DS6A 3Q7GA 2OEXA 3B29A 1JPJA 4I44A 2MWQA 2KGOA 1OKKD 4O6MA 2ZXOA 4G0HA 5A6JA 1JPNA 3N24A 256BA 3M1CB 1RKEB 3DJNB 1BZ4A 1T01A 4LACB 4OD5A 5L0HA 2XLVA 3FXHA 4QDLA 5TJ5E 2VCBA 3WHNA 3K1HA 2Q3TA 4BJ1A 4CSAA 4A4AA 3RQFA 2VC9A 3U9JA 2HJ3A 3S90A 4BJTA 3K1IA 2ZPAA 2QTVA 5AC4A 3AQBA 4YK5A 1OW6A 2BL2A 2R03A 3EFOB 1Z63A 3GANA 1U0BB 2H7VC 4OIQF 2MYSA 3V7OA 4FAPB 3FDQA 2P1AA 1VLTA 4CX9A 3RIPA 2HZ8A 2QE9A 4QI0A 2NUPB 4YL0A 5L0FA 2R9RB 2AWCA 3JTLO 4KNWA 3ZG1A 1HMDA 4U5GA 4PFPA 5T1DB 2L81A 3B0VC 3KYIA 2Y69C 3LS1A 4U5CE 3TJ5A 2FFHA 1NU7D 3EHMA 1TFOB 4BG0A 4BJ5A 4BJ6A 2XSEA 1Q0MA 5DQZA 1RCPA 1ST6A 1LE2A 2A0UA 1YAUO 3L1MA 2CNWA 3JSZA 2L6FA 1BR4A 5KYWB 3FHDA 3SXMA 4Z9IA 4OINF 4CS8C 1FFTC 4EBJA 3HNIA 4KNVA 2XS1A 4DBQA 4DRIB 1QPUA 3JRMO 3UNGC 4C3BA 5KYUA 2BC5A 4P9TA 3FMSA 1G4US 2FGYA 2YQYA 3HLZA 3WAQA 3UR3C 2ZXPA 3U8VA 3ZSUA 1M2VA 3DAGA 3K33A 1B68A 3E70C 3OA1A 1Z6AA 1Z23A 2QLAA 2J46A 4RD9A 5JUAA 2LFDA 4MTOA 1K05A 1GM5A 3ZTMA 1V54C 1E86A 4DVYP 1Q0DA 2A69F 5B1BC 4LDRA 3RVYA 4ZLDA 1ZU5A 1V4AA 3JT1A 1H9GA 1T6QA 4EKWA 3PCVA 4G7HF 5COMA 3AQCA 4CDAA 1Q0GA 4EBBA 1WASA 4JCHA 3NMIA 2I8BA 2KYHA 2PX0A 4OIOF 2CGEA 1DOWA 3J06A 5E3AA 1OR2A 1D1CA 5B3SC 1JRAA 2KC3A 4YT8A 3WG7C 1BR2A 4LLCA 1ZHTA 3EG9A 3VM6A 3ZQYA 4HFKB 4OD4A 2IOQA 3GODA 5EGYA 3HJCA 1E84A 2DYRC 3NYLA 4G7ZF 1LIHA 3O10A 5EK0A 2QY9A 3NRHA 2HSBA 2R7TA 3AJMA 3JSEO 3R2PA 4JURI 1FMVA 2XM4A 1HE1A 1KNYA 2CYDA 5A6AA 2YRFA 5KYWA 2Y39A 2XRHA 4IGGA 5EHHA 1EQ1A 3ZC4A 3GM2A 2GA0A 5KYUB 3F47A 3RH3A 3UMHA 2XLHA 1OCCC 3AOUA 3LESA 2G3VA 1ZHZA 2E87A 3A11A 1M2VB 2WZLA 2A68F 2WVOA 2L6GA 3US6A 5DLJA 5BQGA 3SP1A 1V74B 2AWYA 3L34A 1GS9A 5KYNA 4O6YA 3N0TA 4MVMA 4AX2A 5D91A 4E7SA 3RKOF 3UGPA 3QTHA 4LLEA 1MQVA 1H9TA 2FAPB 1A7VA 2A6HF 2Y3DA 1A41A 1IZMA 2GFHA 4GEHA 3V5XA 4EWCA 3QVZA 2J9BA 1CGNA 1Y4CA 2LP4A 3EFOA 4JTDB 4L6RA 5L0IA 4AK9A 4JEAA 3QVYA 1OW7A 3B0PA 4FX5A 2J9UA 3U9MA 2KNHA 1UFBA 4W8PA 5JT4A 1GGQA 4NTBA 4A2NB 1XWJA 2J0WA 4MTGA 1L3PA 1LE4A 4C7OB 4W8KA 2EILC 4CBEA 4E7ZA 4AL1A 1PD1A 3MYFA 2VCAA 2OJQA 2XL4A 3DM5A 3TULA 1BDJB 4JCZA 4OIRF 1O5HA 1F1MA 1WATA 5A6KA 1A0BA 1L7CA 5CIVA 3HNJA 5CI9A 3JYHA 1VTMP 1OXKA 5F5HA 2NUTA 2CW0F 2GAQA 3CAXA 1D1AA 3ECSA 3EGXA 3H2UA 1YZCA 2HFIA 4I1MA 1QSPA 1M2OA 1YLMA 3DMDA 4MNDA 4CS8A 4YT4A 5L0CA 1UG7A 4J30B 4EUKB 1M6TA 3LLKA 3C7JA 2VH3A 3U2MA 3RW0A 4D4XA 2HMQA 1JOGA 3AG1C 1ZU4A 4YJWA 4WJ0A 4KC9A 3GEHA 1J8MF 4MW3A 2P7VA 1PD0A 5JP7A 3TJ6A 3MFNA 1APCA 3WODF 5E33A 4J7TA 1DOVA 4DOZA 3MX3A 4JJGA 3I5QA 3MBGA 3S84A 1LI5A 1LI7A 4N4WA 4ULVA 4XPWA 3RF3A 2CNWD 1CGOA 1S7ZA 1K40A 1C03A 2C03A 4MVZA 4N6HA 5L0DA 1LPEA 2XLEA 4NQFA 5D92A 2XLDA 3ZDLA 2ETSA 3E9VA 2OOCA 4MS2A 3LS0A 4HEAJ 3ZWIA 4DJ9A 1LKXA 5L3QA 3AG4C 4H4KC 3B9QA 2WB7A 4MVQA 1FR0A 4U5BE 3W8IA 5COGA 4NC3A 1T6IA 1OW8A 2L9JA 5HV9A 5DS4A 2JPUA 3L8JA 3CEXA 1QVXA 3EZIA 4XEKA 3VAYA 4X0RA 2B0JA 2OKUA 3KMIA 2YEVA 1ZHYA 4GYTA 1D0XA 3L8IA 3JRTA 2LCHA 3DM9B 3O39A 2Y3GA 5A6BA 3GEEA 3SXKA 2NUTB 3EGXB 2H7OA 5JLIA 3B0UX 3Q7LA 2XLMA 2YWAA 1SMYF 1H7IA 2VB6A 2PNOA 4IAOA 5T3WA 3EGDA 2X51A 1VK5A 2GWWA 2J7PA 4XPYA 2LD6A 4ZLCA 2IXMA 4N6CA 1R5ID 1YA7O 2XM0A 3LLIA 5JSLA 3U0CA 1TWAA 1SF8A 4R32A 4J32B 3CZ6A 1ZW3A 1NBBA 4YT2A 1LS1A 1Y6DA 4I3MA 1BR1A 3SZRA 5CI8A 3IQTA 2EPOA 4MQ9F 3ZTZA 2IXOA 1T6UA 4MTFA 2KSFA 3BRJA 1ZZPA 1VLSA 3ZQVA 3M15A 2LSEA 1VMAA 3F46A 3M79A 5JS5A 1Z3IX 3QW0A 4CJOA 3ASOC 1A7EA 2Y3BA 3KKBA 4E0IA 1VB5A 2F22A 3NG1A 4PR9A 2R7SA 1IW7F 2H8AA 2IXNA 3NMJA 1H6GA 4ANJA 4JE9A 1ORYA 4JEBA 3TOMA 2VASA 3GM3A 3W4YA 2V3CC 3O6XA 4LDQA 1TWHA 4XLNF 1AUEA 2P61A 3DZAA 1GQAA 1OCRC 4PFOA 4JTAB 1D0YA 2J9VA 2NPUA 2OEVA 2V26A 3IQ5A 4K1OA 4CDVA 2DGJA 4C7OA 3LJBA 3V5YA 3ABMC 1MMDA 2PBEA 2Q00A 3C8GB 1ZVZA 2B0HA 2OU6A 2P6VA 3NMKA 4Q4ZF 4XWJA 2G3KA 2ICWG 5F28E 3EGDB 3K6BA 2XL6A 2G62A 4AL0A 1TR2A 1QZXA 4XPXA 1EA8A 2D4UA 2W45A 4PJMA 4CDYA 4XLPF 3B71A 3LAYA 4IRUA 2EPNA 4NCQA 1AEPA 3GORA 3W2VA 2QUPA 2W4MA 4O7GA 3OWTA 5L0JA 4BEJA 3JZ0A 5AGFA 2R7XA 4U5HA 4C3DA 2A0BA 1YARO 2ZXWC 1MMNA 3DXJF 4NTAA 4M63A 2HS5A 4NY3A 2Q7RA 4BJ5C 3IQCA 1HY5A 4WGYA 1VYKA 1FTSA 2YKZA 3SXYA 2LIGA 4MW8A 4JIOA 2YL1A 1LS4A 3TOLA 3SYNA 1CPQA 2R05A 4JVSA 3RYLA 2R7UA 4JJFA 3DD7A 2KJGA 1EI7A 2ASRA 4YN0B 5KYXB 5BQHA 2KK1A
chains in the Genus database with same CATH topology
3M4CA 1APCA 3L1MA 4N4WA 3DE8A 4ULVA 1E83A 5JRAA 1CGOA 1YZAA 4N6HA 3HNIA 2XLEA 1QPUA 4D4NA 2XLDA 1BBHA 3M4BA 3HNKA 3ZWIA 2BC5A 2YLIA 3QW1A 4WGZA 4NC3A 2QLAA 5JUAA 1JAFA 3ZTMA 1E86A 3C62A 4IB4A 1EKYA 2XL8A 4IAQA 4CDAA 1LM3B 1YYXA 2CCYA 3NMIA 5JLIA 4CJGA 2XLMA 4U9EA 3VRCA 2YL3A 2YLGA 2XM0A 5JSLA 2XLOA 3ZQYA 1NBBA 1CPRA 4ER9A 4U9DA 1E84A 1YYJA 2J8WA 2YL7A 3FOPA 2YLDA 3ZTZA 2XM4A 3ZQVA 3M15A 3M79A 5JS5A 3QW0A 4CJOA 2XLHA 4JKVA 3NMJA 4IARA 2XLWA 4CIPA 4JE9A 4JEBA 3TOMA 1MQVA 1GQAA 3C63A 3HNLA 1A7VA 5B3IA 3IQ5A 4CDVA 3QVZA 2J9BA 1CGNA 4L6RA 3DE9A 256BA 3NMKA 4JEAA 3QVYA 2XLVA 2XL6A 5JT4A 3U8PA 1S05A 2YL0A 4CDYA 5AGFA 4EIYA 3HNJA 4WGYA 1QQ3A 2YKZA 4CX9A 1YZCA 2YL1A 3TOLA 3IQ6A 1CPQA 5JVEA 1M6TA 3FOOA 4D4XA 1E85A 5JP7A 1RCPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M4C A;  1APC A;  3L1M A;  4N4W A;  3DE8 A;  4ULV A;  1E83 A;  5JRA A;  1CGO A;  1YZA A;  4N6H A;  3HNI A;  2XLE A;  1QPU A;  4D4N A;  2XLD A;  1BBH A;  3M4B A;  3HNK A;  3ZWI A;  2BC5 A;  2YLI A;  3QW1 A;  4WGZ A;  4NC3 A;  2QLA A;  5JUA A;  1JAF A;  3ZTM A;  1E86 A;  3C62 A;  4IB4 A;  1EKY A;  2XL8 A;  4IAQ A;  4CDA A;  1LM3 B;  1YYX A;  2CCY A;  3NMI A;  5JLI A;  4CJG A;  2XLM A;  4U9E A;  3VRC A;  2YL3 A;  2YLG A;  2XM0 A;  5JSL A;  2XLO A;  3ZQY A;  1NBB A;  1CPR A;  4ER9 A;  4U9D A;  1E84 A;  1YYJ A;  2J8W A;  2YL7 A;  3FOP A;  2YLD A;  3ZTZ A;  2XM4 A;  3ZQV A;  3M15 A;  3M79 A;  5JS5 A;  3QW0 A;  4CJO A;  2XLH A;  4JKV A;  3NMJ A;  4IAR A;  2XLW A;  4CIP A;  4JE9 A;  4JEB A;  3TOM A;  1MQV A;  1GQA A;  3C63 A;  3HNL A;  1A7V A;  5B3I A;  3IQ5 A;  4CDV A;  3QVZ A;  2J9B A;  1CGN A;  4L6R A;  3DE9 A;  256B A;  3NMK A;  4JEA A;  3QVY A;  2XLV A;  2XL6 A;  5JT4 A;  3U8P A;  1S05 A;  2YL0 A;  4CDY A;  5AGF A;  4EIY A;  3HNJ A;  4WGY A;  1QQ3 A;  2YKZ A;  4CX9 A;  1YZC A;  2YL1 A;  3TOL A;  3IQ6 A;  1CPQ A;  5JVE A;  1M6T A;  3FOO A;  4D4X A;  1E85 A;  5JP7 A;  1RCP A; 
#chains in the Genus database with same CATH topology
 2RD9 A;  2GDC A;  1LVK A;  2DB4 A;  2TMV P;  4XQ1 A;  1O3U A;  3EQL F;  3FAP B;  3S9O A;  1I5N A;  2HKV A;  3T6B A;  3TD7 A;  5HSW A;  1PV3 A;  3NKD A;  3C18 A;  3C8Z A;  4E18 A;  1U6H A;  4D4N A;  4Q5S F;  3NKE A;  1BBH A;  2EPK X;  3M4B A;  2OQM A;  4J7Y A;  2NSF A;  3NYJ A;  4YL1 A;  3MLG A;  5K0I A;  3QZC A;  1RMV A;  2DYS C;  3JYY A;  1U89 A;  2WZG A;  4O79 A;  5DVW A;  1WOL A;  4ULW A;  2A1D D;  3QW1 A;  3GM1 A;  4FWV A;  4YL3 A;  3G4X A;  5AC5 A;  5BUO A;  4KI2 A;  4G78 A;  4WGZ A;  5KYY A;  1RXQ A;  1JAF A;  2AP3 A;  5A69 A;  1Z5Z A;  2HSQ A;  4GQH A;  4EHP A;  3ZVR A;  3AGT A;  5FCL A;  4IB4 A;  1EKY A;  2IBF A;  5B1A C;  5GPG B;  1RKC A;  1LM3 B;  2CCY A;  1HW2 A;  4Z9H A;  4CS9 C;  2VCC A;  2PP4 A;  2Q9B A;  4JZA A;  5A6B D;  4U9E A;  3I5P A;  3VRC A;  2RSE B;  1D1B A;  2YL3 A;  2YLG A;  2EIN C;  4U5F E;  1PCX A;  3FVY A;  3DWW A;  4RBN A;  3SEO A;  2J7P D;  3TQO A;  1Q0F A;  2WVN A;  1ZW2 A;  2XLO A;  1OCZ C;  3JCU Q;  2Z15 A;  5E2Q A;  2HMZ A;  1D0Z A;  1E2X A;  1CPR A;  2EIM C;  3KPH A;  4U9D A;  3VYW A;  4ER9 A;  1YYJ A;  4I1O B;  3KYJ A;  2NG1 A;  2YHS A;  3HKK A;  1JR8 A;  4BEM J;  1OXB A;  2HJM A;  2YLD A;  2WVQ A;  2W4B A;  1G5Z A;  1MMG A;  4P6I C;  2PFD A;  4NTF A;  2O9X A;  2OCC C;  3U3F A;  5E3C A;  1RJ9 A;  2XXA A;  2H7B A;  5L3V A;  3U2L A;  3ABL C;  2R02 A;  2R7Q A;  3C8G A;  3BEH A;  2EIJ C;  4JKV A;  4CIH A;  3EPV A;  3G50 A;  3PHF 2;  1G4W R;  2WZF A;  5KYY B;  4FES A;  1FMW A;  1MNE A;  2AVK A;  2KW3 C;  3EZH A;  3ASN C;  3ABK C;  1WTY A;  3RQG A;  3T6J A;  3A9C A;  4HE8 D;  3HTK C;  1HMO A;  1VYI A;  1TWG A;  3C63 A;  2MHR A;  3HNL A;  1OKK A;  3H2V A;  4Z9J A;  3T9O A;  3UMI A;  1QLE C;  5B3I A;  1E85 A;  5COF A;  4B6I A;  3I4U A;  4JTC B;  1NZE A;  1NU9 C;  2I15 A;  5T3T A;  4MVR A;  1FNT c;  1TWC A;  3EJN A;  1SR2 A;  2D5R B;  2W9Y A;  2A6E F;  3DE9 A;  3ATP A;  3MYI A;  3LUT B;  4DVZ A;  4AE4 B;  2LQG A;  1NFN A;  1V55 C;  2OG2 A;  1G8X A;  3K66 A;  1OQC A;  3DJU B;  3U8P A;  1MND A;  1YJG A;  4U5D E;  1M56 C;  3T6G B;  3PMR A;  1S05 A;  4HFF B;  4K7B A;  1O87 A;  2YL0 A;  4K0D A;  4MVS A;  5DQT A;  3H65 A;  2DI3 A;  1AVO B;  3OEO A;  2R25 A;  1TFK B;  4PJN A;  2OJE D;  2J0X A;  2X0C A;  1JMW A;  1N1C A;  1W2W A;  3CSK A;  3S0X A;  4WAB A;  1R4T A;  1YVI A;  2IYL D;  3LEV A;  3DAF A;  4YT5 A;  3FAJ A;  2XS8 A;  3L0I A;  5KYX A;  4XEF A;  4EIY A;  3EH1 A;  4G7O F;  2LFF A;  4ONS A;  2AU5 A;  1QQ3 A;  1T9K A;  4CSA C;  1VOM A;  1RJ9 B;  3LNR A;  3LNM B;  3POV A;  2XXA B;  3IQ6 A;  3K1I C;  4DRH B;  2ZD9 A;  1ZHX A;  4XEV A;  3DI5 A;  5JVE A;  1J8Y F;  2KQ9 A;  1M57 C;  1NG1 A;  3FOO A;  3IPM O;  3PDM P;  4EBK A;  4MVO A;  2CDQ A;  2HV6 A;  3Q6M A;  4MVU A;  4U5E E;  3M4C A;  3ZIB A;  1C02 A;  2JX0 A;  2YVK A;  4H54 A;  4IWB A;  3T4R A;  4DXW A;  1C17 M;  3DE8 A;  1I4Z A;  4YWQ A;  3SNH A;  1OR3 A;  5JRA A;  1E83 A;  1YZA A;  4XTK A;  2Q4F A;  4PAC A;  3O55 A;  3EHN A;  2Y3H A;  4DRJ B;  1SZI A;  3HNK A;  2EPL X;  3V5Z A;  4KBL A;  2WL8 A;  4BJ6 C;  4PJJ A;  2NSG A;  2YLI A;  3U3B A;  4E17 A;  4JW1 A;  4CS9 A;  4QI2 A;  2Q9C A;  4N06 A;  3EH2 A;  2R7V A;  2M64 A;  2EIK C;  2P0N A;  5BQI A;  4PJL A;  2L6H A;  4OIP F;  2QNL A;  3AGU A;  1K04 A;  3Q6N A;  2JD3 A;  3IEE A;  1TQG A;  2C04 A;  3C62 A;  2LK4 A;  3X1O A;  1NFO A;  1Q0K A;  2YZS A;  3RQE A;  1I4Y A;  2HUJ A;  1Z7Q c;  1CGM E;  2XL8 A;  1WGW A;  4IAQ A;  4IJJ A;  3KH2 A;  5F5F A;  1NSG B;  1YYX A;  1RKE A;  2HV7 A;  4JRZ A;  3SXZ A;  4LDK A;  5FZT A;  3S27 A;  4CJG A;  4F4B A;  3UGO A;  4Q7C A;  3VF0 A;  3W8H A;  2L7A A;  4P9F A;  4RDA A;  1MMA A;  4E0H A;  1XZP A;  3AG3 C;  3DKA A;  3RFY A;  1QKR A;  1A7D A;  1ORS C;  1HW1 A;  2J8W A;  2IM8 A;  2YL7 A;  3NDB B;  4C3E A;  1ZYR F;  3FOP A;  2UUI A;  1YA9 A;  3QMK A;  2Q9A A;  5L0G A;  2R7R A;  2J9W A;  3IHU A;  1WWP A;  1HE9 A;  2PF4 E;  3N2Z B;  2ZXR A;  3ITF A;  3RVZ A;  3X2Q C;  3AG2 C;  1OCO C;  3G4Z A;  4O6N A;  1FFH A;  2UUH A;  3EG9 B;  2NUP A;  3LEO A;  3NYM A;  2IXP A;  3GWL A;  3W2W A;  1KU2 A;  4BPM A;  1T5O A;  1KTM A;  3K7D A;  4PK4 A;  5DS5 A;  1ZHW A;  1FAP B;  1SYQ A;  3S29 A;  3UMK A;  3R7C A;  2J45 A;  1NLX A;  4IAR A;  2XLW A;  4CIP A;  4JC7 A;  3C8G D;  3TK0 A;  4UDV A;  1ORJ A;  2BE5 F;  2R7O A;  3GEI A;  5IY5 C;  3KL4 A;  4AE4 A;  2R7W A;  2PX3 A;  1XZQ A;  2EPM X;  4LER A;  2M4E A;  3S28 A;  1YDI A;  1WN0 A;  3GWN A;  1TKN A;  3U5S A;  4CS7 A;  3CQZ A;  4DBR A;  5DS6 A;  3Q7G A;  2OEX A;  3B29 A;  1JPJ A;  4I44 A;  2MWQ A;  2KGO A;  1OKK D;  4O6M A;  2ZXO A;  4G0H A;  5A6J A;  1JPN A;  3N24 A;  256B A;  3M1C B;  1RKE B;  3DJN B;  1BZ4 A;  1T01 A;  4LAC B;  4OD5 A;  5L0H A;  2XLV A;  3FXH A;  4QDL A;  5TJ5 E;  2VCB A;  3WHN A;  3K1H A;  2Q3T A;  4BJ1 A;  4CSA A;  4A4A A;  3RQF A;  2VC9 A;  3U9J A;  2HJ3 A;  3S90 A;  4BJT A;  3K1I A;  2ZPA A;  2QTV A;  5AC4 A;  3AQB A;  4YK5 A;  1OW6 A;  2BL2 A;  2R03 A;  3EFO B;  1Z63 A;  3GAN A;  1U0B B;  2H7V C;  4OIQ F;  2MYS A;  3V7O A;  4FAP B;  3FDQ A;  2P1A A;  1VLT A;  4CX9 A;  3RIP A;  2HZ8 A;  2QE9 A;  4QI0 A;  2NUP B;  4YL0 A;  5L0F A;  2R9R B;  2AWC A;  3JTL O;  4KNW A;  3ZG1 A;  1HMD A;  4U5G A;  4PFP A;  5T1D B;  2L81 A;  3B0V C;  3KYI A;  2Y69 C;  3LS1 A;  4U5C E;  3TJ5 A;  2FFH A;  1NU7 D;  3EHM A;  1TFO B;  4BG0 A;  4BJ5 A;  4BJ6 A;  2XSE A;  1Q0M A;  5DQZ A;  1RCP A;  1ST6 A;  1LE2 A;  2A0U A;  1YAU O;  3L1M A;  2CNW A;  3JSZ A;  2L6F A;  1BR4 A;  5KYW B;  3FHD A;  3SXM A;  4Z9I A;  4OIN F;  4CS8 C;  1FFT C;  4EBJ A;  3HNI A;  4KNV A;  2XS1 A;  4DBQ A;  4DRI B;  1QPU A;  3JRM O;  3UNG C;  4C3B A;  5KYU A;  2BC5 A;  4P9T A;  3FMS A;  1G4U S;  2FGY A;  2YQY A;  3HLZ A;  3WAQ A;  3UR3 C;  2ZXP A;  3U8V A;  3ZSU A;  1M2V A;  3DAG A;  3K33 A;  1B68 A;  3E70 C;  3OA1 A;  1Z6A A;  1Z23 A;  2QLA A;  2J46 A;  4RD9 A;  5JUA A;  2LFD A;  4MTO A;  1K05 A;  1GM5 A;  3ZTM A;  1V54 C;  1E86 A;  4DVY P;  1Q0D A;  2A69 F;  5B1B C;  4LDR A;  3RVY A;  4ZLD A;  1ZU5 A;  1V4A A;  3JT1 A;  1H9G A;  1T6Q A;  4EKW A;  3PCV A;  4G7H F;  5COM A;  3AQC A;  4CDA A;  1Q0G A;  4EBB A;  1WAS A;  4JCH A;  3NMI A;  2I8B A;  2KYH A;  2PX0 A;  4OIO F;  2CGE A;  1DOW A;  3J06 A;  5E3A A;  1OR2 A;  1D1C A;  5B3S C;  1JRA A;  2KC3 A;  4YT8 A;  3WG7 C;  1BR2 A;  4LLC A;  1ZHT A;  3EG9 A;  3VM6 A;  3ZQY A;  4HFK B;  4OD4 A;  2IOQ A;  3GOD A;  5EGY A;  3HJC A;  1E84 A;  2DYR C;  3NYL A;  4G7Z F;  1LIH A;  3O10 A;  5EK0 A;  2QY9 A;  3NRH A;  2HSB A;  2R7T A;  3AJM A;  3JSE O;  3R2P A;  4JUR I;  1FMV A;  2XM4 A;  1HE1 A;  1KNY A;  2CYD A;  5A6A A;  2YRF A;  5KYW A;  2Y39 A;  2XRH A;  4IGG A;  5EHH A;  1EQ1 A;  3ZC4 A;  3GM2 A;  2GA0 A;  5KYU B;  3F47 A;  3RH3 A;  3UMH A;  2XLH A;  1OCC C;  3AOU A;  3LES A;  2G3V A;  1ZHZ A;  2E87 A;  3A11 A;  1M2V B;  2WZL A;  2A68 F;  2WVO A;  2L6G A;  3US6 A;  5DLJ A;  5BQG A;  3SP1 A;  1V74 B;  2AWY A;  3L34 A;  1GS9 A;  5KYN A;  4O6Y A;  3N0T A;  4MVM A;  4AX2 A;  5D91 A;  4E7S A;  3RKO F;  3UGP A;  3QTH A;  4LLE A;  1MQV A;  1H9T A;  2FAP B;  1A7V A;  2A6H F;  2Y3D A;  1A41 A;  1IZM A;  2GFH A;  4GEH A;  3V5X A;  4EWC A;  3QVZ A;  2J9B A;  1CGN A;  1Y4C A;  2LP4 A;  3EFO A;  4JTD B;  4L6R A;  5L0I A;  4AK9 A;  4JEA A;  3QVY A;  1OW7 A;  3B0P A;  4FX5 A;  2J9U A;  3U9M A;  2KNH A;  1UFB A;  4W8P A;  5JT4 A;  1GGQ A;  4NTB A;  4A2N B;  1XWJ A;  2J0W A;  4MTG A;  1L3P A;  1LE4 A;  4C7O B;  4W8K A;  2EIL C;  4CBE A;  4E7Z A;  4AL1 A;  1PD1 A;  3MYF A;  2VCA A;  2OJQ A;  2XL4 A;  3DM5 A;  3TUL A;  1BDJ B;  4JCZ A;  4OIR F;  1O5H A;  1F1M A;  1WAT A;  5A6K A;  1A0B A;  1L7C A;  5CIV A;  3HNJ A;  5CI9 A;  3JYH A;  1VTM P;  1OXK A;  5F5H A;  2NUT A;  2CW0 F;  2GAQ A;  3CAX A;  1D1A A;  3ECS A;  3EGX A;  3H2U A;  1YZC A;  2HFI A;  4I1M A;  1QSP A;  1M2O A;  1YLM A;  3DMD A;  4MND A;  4CS8 A;  4YT4 A;  5L0C A;  1UG7 A;  4J30 B;  4EUK B;  1M6T A;  3LLK A;  3C7J A;  2VH3 A;  3U2M A;  3RW0 A;  4D4X A;  2HMQ A;  1JOG A;  3AG1 C;  1ZU4 A;  4YJW A;  4WJ0 A;  4KC9 A;  3GEH A;  1J8M F;  4MW3 A;  2P7V A;  1PD0 A;  5JP7 A;  3TJ6 A;  3MFN A;  1APC A;  3WOD F;  5E33 A;  4J7T A;  1DOV A;  4DOZ A;  3MX3 A;  4JJG A;  3I5Q A;  3MBG A;  3S84 A;  1LI5 A;  1LI7 A;  4N4W A;  4ULV A;  4XPW A;  3RF3 A;  2CNW D;  1CGO A;  1S7Z A;  1K40 A;  1C03 A;  2C03 A;  4MVZ A;  4N6H A;  5L0D A;  1LPE A;  2XLE A;  4NQF A;  5D92 A;  2XLD A;  3ZDL A;  2ETS A;  3E9V A;  2OOC A;  4MS2 A;  3LS0 A;  4HEA J;  3ZWI A;  4DJ9 A;  1LKX A;  5L3Q A;  3AG4 C;  4H4K C;  3B9Q A;  2WB7 A;  4MVQ A;  1FR0 A;  4U5B E;  3W8I A;  5COG A;  4NC3 A;  1T6I A;  1OW8 A;  2L9J A;  5HV9 A;  5DS4 A;  2JPU A;  3L8J A;  3CEX A;  1QVX A;  3EZI A;  4XEK A;  3VAY A;  4X0R A;  2B0J A;  2OKU A;  3KMI A;  2YEV A;  1ZHY A;  4GYT A;  1D0X A;  3L8I A;  3JRT A;  2LCH A;  3DM9 B;  3O39 A;  2Y3G A;  5A6B A;  3GEE A;  3SXK A;  2NUT B;  3EGX B;  2H7O A;  5JLI A;  3B0U X;  3Q7L A;  2XLM A;  2YWA A;  1SMY F;  1H7I A;  2VB6 A;  2PNO A;  4IAO A;  5T3W A;  3EGD A;  2X51 A;  1VK5 A;  2GWW A;  2J7P A;  4XPY A;  2LD6 A;  4ZLC A;  2IXM A;  4N6C A;  1R5I D;  1YA7 O;  2XM0 A;  3LLI A;  5JSL A;  3U0C A;  1TWA A;  1SF8 A;  4R32 A;  4J32 B;  3CZ6 A;  1ZW3 A;  1NBB A;  4YT2 A;  1LS1 A;  1Y6D A;  4I3M A;  1BR1 A;  3SZR A;  5CI8 A;  3IQT A;  2EPO A;  4MQ9 F;  3ZTZ A;  2IXO A;  1T6U A;  4MTF A;  2KSF A;  3BRJ A;  1ZZP A;  1VLS A;  3ZQV A;  3M15 A;  2LSE A;  1VMA A;  3F46 A;  3M79 A;  5JS5 A;  1Z3I X;  3QW0 A;  4CJO A;  3ASO C;  1A7E A;  2Y3B A;  3KKB A;  4E0I A;  1VB5 A;  2F22 A;  3NG1 A;  4PR9 A;  2R7S A;  1IW7 F;  2H8A A;  2IXN A;  3NMJ A;  1H6G A;  4ANJ A;  4JE9 A;  1ORY A;  4JEB A;  3TOM A;  2VAS A;  3GM3 A;  3W4Y A;  2V3C C;  3O6X A;  4LDQ A;  1TWH A;  4XLN F;  1AUE A;  2P61 A;  3DZA A;  1GQA A;  1OCR C;  4PFO A;  4JTA B;  1D0Y A;  2J9V A;  2NPU A;  2OEV A;  2V26 A;  3IQ5 A;  4K1O A;  4CDV A;  2DGJ A;  4C7O A;  3LJB A;  3V5Y A;  3ABM C;  1MMD A;  2PBE A;  2Q00 A;  3C8G B;  1ZVZ A;  2B0H A;  2OU6 A;  2P6V A;  3NMK A;  4Q4Z F;  4XWJ A;  2G3K A;  2ICW G;  5F28 E;  3EGD B;  3K6B A;  2XL6 A;  2G62 A;  4AL0 A;  1TR2 A;  1QZX A;  4XPX A;  1EA8 A;  2D4U A;  2W45 A;  4PJM A;  4CDY A;  4XLP F;  3B71 A;  3LAY A;  4IRU A;  2EPN A;  4NCQ A;  1AEP A;  3GOR A;  3W2V A;  2QUP A;  2W4M A;  4O7G A;  3OWT A;  5L0J A;  4BEJ A;  3JZ0 A;  5AGF A;  2R7X A;  4U5H A;  4C3D A;  2A0B A;  1YAR O;  2ZXW C;  1MMN A;  3DXJ F;  4NTA A;  4M63 A;  2HS5 A;  4NY3 A;  2Q7R A;  4BJ5 C;  3IQC A;  1HY5 A;  4WGY A;  1VYK A;  1FTS A;  2YKZ A;  3SXY A;  2LIG A;  4MW8 A;  4JIO A;  2YL1 A;  1LS4 A;  3TOL A;  3SYN A;  1CPQ A;  2R05 A;  4JVS A;  3RYL A;  2R7U A;  4JJF A;  3DD7 A;  2KJG A;  1EI7 A;  2ASR A;  4YN0 B;  5KYX B;  5BQH A;  2KK1 A; 
#chains in the Genus database with same CATH homology
 3M4C A;  1APC A;  3L1M A;  4N4W A;  3DE8 A;  4ULV A;  1E83 A;  5JRA A;  1CGO A;  1YZA A;  4N6H A;  3HNI A;  2XLE A;  1QPU A;  4D4N A;  2XLD A;  1BBH A;  3M4B A;  3HNK A;  3ZWI A;  2BC5 A;  2YLI A;  3QW1 A;  4WGZ A;  4NC3 A;  2QLA A;  5JUA A;  1JAF A;  3ZTM A;  1E86 A;  3C62 A;  4IB4 A;  1EKY A;  2XL8 A;  4IAQ A;  4CDA A;  1LM3 B;  1YYX A;  2CCY A;  3NMI A;  5JLI A;  4CJG A;  2XLM A;  4U9E A;  3VRC A;  2YL3 A;  2YLG A;  2XM0 A;  5JSL A;  2XLO A;  3ZQY A;  1NBB A;  1CPR A;  4ER9 A;  4U9D A;  1E84 A;  1YYJ A;  2J8W A;  2YL7 A;  3FOP A;  2YLD A;  3ZTZ A;  2XM4 A;  3ZQV A;  3M15 A;  3M79 A;  5JS5 A;  3QW0 A;  4CJO A;  2XLH A;  4JKV A;  3NMJ A;  4IAR A;  2XLW A;  4CIP A;  4JE9 A;  4JEB A;  3TOM A;  1MQV A;  1GQA A;  3C63 A;  3HNL A;  1A7V A;  5B3I A;  3IQ5 A;  4CDV A;  3QVZ A;  2J9B A;  1CGN A;  4L6R A;  3DE9 A;  256B A;  3NMK A;  4JEA A;  3QVY A;  2XLV A;  2XL6 A;  5JT4 A;  3U8P A;  1S05 A;  2YL0 A;  4CDY A;  5AGF A;  4EIY A;  3HNJ A;  4WGY A;  1QQ3 A;  2YKZ A;  4CX9 A;  1YZC A;  2YL1 A;  3TOL A;  3IQ6 A;  1CPQ A;  5JVE A;  1M6T A;  3FOO A;  4D4X A;  1E85 A;  5JP7 A;  1RCP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...