5B3IA

Homo-dimeric structure of cytochrome c' from thermophilic hydrogenophilus thermoluteolus
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
135
structure length
135
Chain Sequence
DALKPEDKVKFRQASYTTMAWNMGKIKAMVVDGTMPFSQTQVSAAANVIAAIANSGMGALYSPDTLGVVGFKKSRLKENFFQEQDEVRKIATNFVEQANKLAEVAAMGDKDEIKAQFGEVGKACKACHEKFREEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c prime
publication title Structural and functional insights into thermally stable cytochrome c' from a thermophile
pubmed doi rcsb
molecule tags Electron transport
total genus 55
structure length 135
sequence length 135
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 5b3iA00
4CJOA 4D4XA 2XLWA 2YLIA 3FOOA 4JEAA 1EKYA 1YZCA 5JP7A 2YL1A 3NMKA 3ZQVA 3M4BA 4EIYA 1YZAA 4JEBA 3TOLA 3QVYA 1S05A 1E83A 1A7VA 3QW1A 3ZQYA 1QPUA 3U8PA 1RCPA 2XLOA 1NBBA 1MQVA 4CDVA 4CX9A 2J8WA 2XLVA 2YLDA 5JSLA 1CPQA 1E86A 4ER9A 3NMJA 2BC5A 3C63A 5JVEA 5AGFA 3NMIA 2XLHA 4N4WA 4IAQA 5JT4A 1YYXA 3ZTZA 4CIPA 4CJGA 4WGZA 2J9BA 2XL6A 4WGYA 5JRAA 4CDAA 1CGOA 3M79A 4IB4A 2YL3A 1E85A 3QW0A 3HNLA 4U9EA 2CCYA 4JE9A 3HNKA 2YLGA 3HNJA 2XM0A 2QLAA 3M15A 3DE8A 1GQAA 3TOMA 5B3IA 1M6TA 3HNIA 4IARA 4CDYA 3ZTMA 3M4CA 3ZWIA 2YL0A 5JUAA 3FOPA 1APCA 3QVZA 2XLMA 2XLDA 1JAFA 2YL7A 5JS5A 3IQ6A 1LM3B 2XLEA 5JLIA 3C62A 3IQ5A 4L6RA 1BBHA 1E84A 3VRCA 4D4NA 3DE9A 256BA 2XL8A 4N6HA 1YYJA 4JKVA 1QQ3A 4NC3A 4ULVA 1CPRA 2XM4A 3L1MA 1CGNA 2YKZA 4U9DA
chains in the Genus database with same CATH superfamily
2G3KA 1AEPA 2XLWA 1OW8A 3FOOA 4AL0A 4E7ZA 2Q4FA 4CSAC 4DRHB 3DKAA 4YN0B 3OWTA 5B1AC 1LIHA 1LPEA 2EIMC 4J32B 1G8XA 1MMNA 4UDVA 1RMVA 2XRHA 3UMKA 1OKKD 3CAXA 4XLNF 1OXBA 1OCCC 2FFHA 3IEEA 3GODA 1YLMA 3O6XA 2R9RB 2MWQA 3S9OA 4EWCA 3DI5A 3NG1A 4G7ZF 4EKWA 4CS9A 3ZQYA 1QPUA 1WATA 3DJUB 1LI5A 3L8IA 4OIRF 3U8PA 1SYQA 3VM6A 3AG2C 1HMOA 3DM9B 4CS8C 1Z5ZA 5L0CA 1VYKA 2W9YA 2P0NA 1JR8A 2NPUA 2XS1A 4HFKB 1A7EA 2HMZA 4IRUA 5AC5A 1LVKA 4CIHA 5K0IA 3H2VA 3JTLO 4M63A 1ORYA 1VOMA 1T5OA 3E70C 1HW2A 4KNVA 4LLCA 5L0IA 1U6HA 3T9OA 2KYHA 1Q0GA 4NTAA 2WVOA 4MVQA 3ZC4A 2J9UA 2BC5A 2AU5A 3JSEO 5JVEA 2VCBA 1Z7Qc 1V4AA 3DM5A 2R7SA 1I4YA 2ASRA 2W45A 3ZVRA 3ZIBA 4AE4A 3RW0A 1OCOC 4DOZA 3PHF2 2C03A 5HV9A 3SYNA 5KYWA 4IAQA 2PX3A 2LQGA 1FAPB 3N2ZB 4MVOA 3UGOA 5L0DA 4OD4A 3W2WA 1DOVA 1HE9A 2W4BA 4JZAA 1YA7O 2JD3A 4HEAJ 3LS1A 1ZVZA 3CQZA 4MVZA 4AK9A 1FFTC 2ETSA 5KYXA 3SXKA 5JRAA 4MS2A 2GDCA 2CNWA 4PJMA 1VLTA 2YL3A 2L6FA 4IB4A 1NZEA 2MYSA 3LAYA 2GWWA 5EK0A 2CCYA 3S0XA 1Q0MA 1BR1A 1KNYA 2GAQA 3UR3C 2YLGA 1D0ZA 2J0XA 2QNLA 4MVUA 4YT8A 2HKVA 1D1CA 4KC9A 2QLAA 4MVMA 5FZTA 3K1HA 3DWWA 3LEVA 1D1AA 4PFOA 3C7JA 3M1CB 3JCUQ 1UG7A 5A6AA 2XXAB 3SP1A 4KI2A 1S7ZA 4H54A 3GEHA 1YAUO 1K05A 2Y3GA 2H7OA 3TOMA 1QZXA 4DBRA 4IARA 3H65A 5CIVA 2HZ8A 1F1MA 2LSEA 3QTHA 2Q00A 3CEXA 1TFOB 3FAJA 3JT1A 4PACA 4QI0A 1J8MF 2P6VA 4F4BA 4K1OA 2ZXOA 3U2LA 2R05A 4MW3A 3FOPA 1WASA 2VH3A 2ZPAA 2H7BA 2RSEB 4JJGA 2R7VA 5JS5A 2XL4A 1JOGA 3K7DA 4W8PA 3L34A 3EZIA 4Q5SF 4EBKA 1OXKA 2L6HA 4L6RA 4PR9A 4RD9A 5A6BD 2DGJA 2KSFA 2KNHA 2W4MA 2IYLD 4D4NA 3RKOF 1DOWA 1RJ9A 256BA 2Q9CA 3V7OA 2YHSA 4E0IA 1ZU4A 5DLJA 4YL0A 2HSBA 4A2NB 2YWAA 4G7OF 2QTVA 4AL1A 4BG0A 4JKVA 1V74B 1W2WA 4LLEA 5L0FA 4Q7CA 1OKKA 1FTSA 3S28A 3LESA 1ZW3A 3EZHA 2XM4A 1CGNA 3QZCA 1A0BA 1JPJA 2YKZA 1D0XA 5A6JA 1G4US 3RH3A 3EGDB 4XEVA 3FXHA 1FFHA 4A4AA 4XEFA 5DS5A 2J46A 1V54C 4D4XA 1JPNA 3EQLF 3LUTB 4JEAA 2J9VA 1EKYA 3C8GD 2WVQA 1ORSC 2J45A 2EPNA 2A1DD 1GS9A 1R5ID 3AGTA 3U9MA 3M4BA 1XZQA 4NTBA 3RVYA 5KYNA 4E18A 1U0BB 1YZAA 3B71A 1K40A 4CSAA 1OR2A 3EPVA 1NU9C 1S05A 1A7VA 3GWLA 3K33A 5COGA 3QW1A 2NSFA 4MVSA 1Z3IX 4ANJA 2XLOA 4BEMJ 2HJMA 5COFA 1YARO 1NU7D 5F5HA 2WL8A 2IM8A 2IXOA 2Y3DA 2R03A 4P6IC 4O6YA 3BRJA 3RVZA 4YL1A 4IGGA 1D0YA 1MQVA 3FMSA 3U3BA 4CDVA 4JJFA 2XXAA 2VCCA 3Q6NA 3DZAA 4PJJA 5D92A 3C8GB 5E33A 2FAPB 3ABKC 1MNEA 1TR2A 2IXNA 1E86A 4U5EE 2WZFA 2HV7A 4BJ5C 1MMDA 3HLZA 2R25A 3C63A 4G78A 1BDJB 4XEKA 3Q7GA 2C04A 3DJNB 4BJTA 2NSGA 3AQCA 2OEVA 3TK0A 1I4ZA 4BJ6C 5BUOA 1BR4A 2P61A 3C18A 1M57C 4U5CE 3V5XA 4DXWA 1YYXA 1I5NA 2Y39A 4U5BE 4CIPA 4G7HF 3U5SA 1VLSA 3H2UA 2ZXRA 4K7BA 3R7CA 3T6GB 4CJGA 4WGZA 2R7UA 3ITFA 3KKBA 1SMYF 1K04A 4U5HA 2VCAA 3SNHA 1L7CA 3AG1C 4NCQA 4E7SA 1CGOA 1C03A 2FGYA 1L3PA 2ICWG 4EHPA 1VB5A 3VAYA 2R7XA 3T4RA 3QW0A 1NFNA 3Q6MA 4U9EA 2VC9A 3AGUA 3SXZA 3TQOA 2IOQA 3ZSUA 1Z63A 1TWCA 3L8JA 4GEHA 2J7PA 3QMKA 5DQTA 3FDQA 4NQFA 4C3EA 2P1AA 3I4UA 3T6BA 1WWPA 2L7AA 2HUJA 4XWJA 2A6HF 1YJGA 4N06A 1NFOA 1HW1A 3DE8A 2PNOA 4CS7A 2UUIA 3EGDA 3RQFA 1GQAA 5E3AA 5L3VA 2KQ9A 1M6TA 1ZHXA 3HNIA 3RQGA 2KGOA 3TULA 4DVYP 4LACB 1RXQA 2XS8A 2R7RA 1WTYA 3TJ5A 1EI7A 2PBEA 4JRZA 1D1BA 4RDAA 4DVZA 2YEVA 5DS4A 3ZDLA 2ZXWC 1M2VB 1LI7A 3KH2A 3LNRA 5BQGA 1MMAA 2EINC 1IZMA 2XLMA 1VK5A 2B0HA 2XLDA 5CI8A 2DI3A 3S29A 3WHNA 3DXJF 2EPLX 2HV6A 4R32A 3B9QA 1LM3B 3O55A 5JLIA 2VB6A 1BBHA 3LS0A 3MX3A 1Y6DA 4U5FE 3VRCA 2PF4E 3FAPB 4O7GA 1MNDA 2A6EF 3DE9A 4O6MA 2LP4A 1Z23A 4J7TA 3C8GA 3UGPA 3W8IA 2GFHA 3KPHA 2Y69C 4XQ1A 3B0UX 3ASOC 2R7TA 3GANA 1CGME 3DAGA 1ZZPA 3KYIA 4JTAB 4NC3A 1ZHTA 4JW1A 1EA8A 1CPRA 1OW7A 4ULVA 4Z9JA 4OINF 3U3FA 1LS4A 3G50A 3DMDA 4BEJA 4DRJB 1OCRC 3OA1A 3T6JA 4FAPB 3U9JA 2NG1A 5A69A 5A6KA 4U9DA 3GORA 2G62A 4WJ0A 4CJOA 2EPMX 3GEEA 3JYYA 2Q9AA 5L0HA 1VYIA 3I5PA 4XPXA 2VASA 1LE2A 3PDMP 2EIKC 5JP7A 3POVA 3NMKA 1B68A 1PCXA 2A69F 4LDKA 4J30B 4JTDB 4OIOF 4EIYA 4W8KA 1YDIA 3HKKA 2X51A 4JEBA 4LDQA 4XPWA 4BJ1A 2EIJC 3NKEA 3QVYA 2PP4A 3HTKC 4IAOA 1E83A 1Q0DA 3B0PA 1JMWA 3U2MA 1IW7F 4OIPF 3EGXB 5E3CA 1RCPA 3EHNA 3ZG1A 3KYJA 3I5QA 4P9TA 2YVKA 3SEOA 2X0CA 3MYFA 2A0UA 3AG3C 4YK5A 3CSKA 3DD7A 3O10A 3WAQA 1NLXA 4MQ9F 2AWCA 2IBFA 1LKXA 4C3BA 2NUTB 2HJ3A 5CI9A 2RD9A 2XLVA 5DQZA 4C7OB 1CPQA 2TMVP 1RKEB 4OD5A 2H8AA 2PFDA 4YJWA 4JCZA 2V26A 2OU6A 3C8ZA 3V5ZA 4DBQA 3A9CA 3SXMA 5B3SC 4JURI 5KYUB 1FNTc 1KU2A 3K1IC 2XLHA 4Q4ZF 3UNGC 4BPMA 4I1OB 4FWVA 4BJ5A 3VF0A 5JT4A 1Q0KA 1ZHWA 1ORJA 2Q9BA 4LERA 3SXYA 4BJ6A 3DAFA 1T9KA 3KL4A 3K6BA 1OW6A 1HMDA 3NYLA 4DJ9A 2J9BA 2XL6A 1SZIA 1NG1A 4WGYA 4AE4B 1OCZC 5E2QA 4PFPA 2DYRC 4GQHA 2R02A 3EH1A 3R2PA 3F46A 4CS8A 2R7QA 2BE5F 4JE9A 2OQMA 2H7VC 3HNKA 3MYIA 3HNJA 2LIGA 2LFFA 1T6QA 3OEOA 3M15A 2WZGA 1ZHZA 1FMWA 1A41A 1PD0A 3ECSA 3N24A 2Q7RA 2Q3TA 3S84A 2D5RB 4GYTA 2I8BA 1QVXA 3LJBA 4K0DA 4U5GA 2IXPA 3ATPA 3EH2A 4E0HA 4HE8D 3HJCA 2M4EA 2IXMA 4EUKB 1LE4A 2L9JA 2Z15A 1VMAA 3TJ6A 2HSQA 4CDYA 5T3TA 3ZWIA 2CDQA 2LFDA 1M56C 5BQHA 5KYYB 2YL0A 5AC4A 2R7OA 5JUAA 3JZ0A 3B0VC 3QVZA 2A68F 3NKDA 3GWNA 3F47A 2YL7A 3AG4C 1GGQA 2EPKX 1ST6A 5FCLA 2KW3C 2A0BA 1O3UA 3EGXA 2L81A 1TKNA 3KMIA 2D4UA 2LCHA 4MNDA 1PD1A 3Q7LA 2J0WA 4EBJA 2UUHA 1T01A 3EHMA 3LLIA 1E84A 3RF3A 3NYJA 3PCVA 4IWBA 3W2VA 2OCCC 4E17A 3GM3A 1U89A 3ASNC 3U8VA 4YT4A 2MHRA 4FESA 4JCHA 2NUTA 2ZXPA 1ZHYA 3MLGA 4C7OA 1C17M 2PX0A 1RKEA 4PJLA 1G4WR 4QDLA 4AX2A 5A6BA 4N6CA 2KC3A 1QQ3A 4XLPF 3JYHA 2OG2A 2F22A 4O79A 5KYUA 4YWQA 3O39A 3L1MA 4MTOA 1RJ9B 2M64A 3G4XA 2GA0A 3E9VA 5TJ5E 1QSPA 3MFNA 3JSZA 4RBNA 5DVWA 1H9TA 2YLIA 5IY5C 1YZCA 2CYDA 1Z6AA 1BR2A 2AVKA 3V5YA 2CW0F 2ZD9A 2EILC 1UFBA 1SR2A 2YL1A 3ZQVA 1Y4CA 1WOLA 2WVNA 3A11A 4IJJA 4PJNA 3WG7C 4KNWA 1OR3A 2Y3HA 1N1CA 3X2QC 4CS9C 4ULWA 3J06A 3TOLA 1AUEA 2QE9A 2HMQA 2JPUA 4U5DE 4P9FA 3S27A 2CGEA 2R7WA 2V3CC 4Z9IA 2BL2A 1TFKB 1QLEC 2QY9A 3TD7A 1NBBA 3W4YA 3EG9B 2B0JA 1C02A 1TWAA 2LK4A 1JRAA 3K66A 1VTMP 1T6IA 1XWJA 5COMA 4PK4A 5L0GA 4CX9A 5D91A 3GM1A 5GPGB 1YA9A 3VYWA 1H7IA 2J8WA 2YLDA 4WABA 5JSLA 2NUPB 4ONSA 1G5ZA 4ER9A 3NMJA 5KYYA 1BZ4A 3UMHA 4YT5A 4MVRA 5EHHA 4ZLDA 4I3MA 1NSGB 2EPOA 3EFOB 3NMIA 4NTFA 5AGFA 3S90A 2YQYA 3UMIA 4C3DA 4N4WA 4FX5A 2DYSC 2J9WA 2OOCA 3G4ZA 3WODF 1RKCA 3GEIA 3X1OA 4JIOA 3K1IA 4XPYA 2P7VA 3ZTZA 2LD6A 2J7PD 2Y3BA 2OJED 3FVYA 3EJNA 3IHUA 2JX0A 4EBBA 3W8HA 1YVIA 4LDRA 1FR0A 2O9XA 4CDAA 4KBLA 1ZW2A 3RYLA 2WB7A 3M79A 4JTCB 3SZRA 5L3QA 1WN0A 2HS5A 3CZ6A 1E85A 3HNLA 2OKUA 3LEOA 3RFYA 5F5FA 4H4KC 1FMVA 5T1DB 4ZLCA 4MW8A 1HE1A 1XZPA 1M2OA 2XM0A 3B29A 4HFFB 5DS6A 4J7YA 5L0JA 4DRIB 3FHDA 4I1MA 1TWHA 2G3VA 1M2VA 2KK1A 3LNMB 1H9GA 2OEXA 3JRMO 5T3WA 1R4TA 4O6NA 5B3IA 3ABMC 4NY3A 2CNWD 1MMGA 4Z9HA 3AJMA 4MTGA 4XTKA 3RQEA 3ZTMA 4QI2A 2QUPA 3M4CA 5B1BC 3N0TA 1Q0FA 3L0IA 3NRHA 4JVSA 1QKRA 1V55C 1ZYRF 1PV3A 3BEHA 4B6IA 3PMRA 1APCA 2KJGA 3IPMO 1TQGA 1SF8A 2I15A 3NYMA 1EQ1A 3U0CA 3RIPA 1JAFA 3US6A 2WZLA 2AP3A 1H6GA 2YZSA 5KYWB 5HSWA 3IQ6A 3NDBB 1A7DA 2HFIA 1KTMA 2XLEA 3C62A 3IQ5A 3GM2A 1HY5A 1LS1A 1AVOB 3ABLC 3EG9A 5F28E 4YT2A 3AOUA 1J8YF 3LLKA 1ZU5A 1TWGA 3IQCA 1T6UA 4YL3A 4X0RA 2XSEA 5KYXB 4G0HA 2XL8A 4N6HA 3IQTA 4JC7A 3AQBA 2OJQA 5BQIA 1OQCA 2NUPA 1O87A 1YYJA 5EGYA 4MTFA 1O5HA 1E2XA 2YRFA 1WGWA 1GM5A 3EFOA 4CBEA 4I44A 3JRTA 2DB4A 2E87A 2L6GA 4OIQF 2AWYA 3MBGA
chains in the Genus database with same CATH topology
4CJOA 4D4XA 2XLWA 2YLIA 3FOOA 4JEAA 1EKYA 1YZCA 5JP7A 2YL1A 3NMKA 3ZQVA 3M4BA 4EIYA 1YZAA 4JEBA 3TOLA 3QVYA 1S05A 1E83A 1A7VA 3QW1A 3ZQYA 1QPUA 3U8PA 1RCPA 2XLOA 1NBBA 1MQVA 4CDVA 4CX9A 2J8WA 2XLVA 2YLDA 5JSLA 1CPQA 1E86A 4ER9A 3NMJA 2BC5A 3C63A 5JVEA 5AGFA 3NMIA 2XLHA 4N4WA 4IAQA 5JT4A 1YYXA 3ZTZA 4CIPA 4CJGA 4WGZA 2J9BA 2XL6A 4WGYA 5JRAA 4CDAA 1CGOA 3M79A 4IB4A 2YL3A 1E85A 3QW0A 3HNLA 4U9EA 2CCYA 4JE9A 3HNKA 2YLGA 3HNJA 2XM0A 2QLAA 3M15A 3DE8A 1GQAA 3TOMA 5B3IA 1M6TA 3HNIA 4IARA 4CDYA 3ZTMA 3M4CA 3ZWIA 2YL0A 5JUAA 3FOPA 1APCA 3QVZA 2XLMA 2XLDA 1JAFA 2YL7A 5JS5A 3IQ6A 1LM3B 2XLEA 5JLIA 3C62A 3IQ5A 4L6RA 1BBHA 1E84A 3VRCA 4D4NA 3DE9A 256BA 2XL8A 4N6HA 1YYJA 4JKVA 1QQ3A 4NC3A 4ULVA 1CPRA 2XM4A 3L1MA 1CGNA 2YKZA 4U9DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CJO A;  4D4X A;  2XLW A;  2YLI A;  3FOO A;  4JEA A;  1EKY A;  1YZC A;  5JP7 A;  2YL1 A;  3NMK A;  3ZQV A;  3M4B A;  4EIY A;  1YZA A;  4JEB A;  3TOL A;  3QVY A;  1S05 A;  1E83 A;  1A7V A;  3QW1 A;  3ZQY A;  1QPU A;  3U8P A;  1RCP A;  2XLO A;  1NBB A;  1MQV A;  4CDV A;  4CX9 A;  2J8W A;  2XLV A;  2YLD A;  5JSL A;  1CPQ A;  1E86 A;  4ER9 A;  3NMJ A;  2BC5 A;  3C63 A;  5JVE A;  5AGF A;  3NMI A;  2XLH A;  4N4W A;  4IAQ A;  5JT4 A;  1YYX A;  3ZTZ A;  4CIP A;  4CJG A;  4WGZ A;  2J9B A;  2XL6 A;  4WGY A;  5JRA A;  4CDA A;  1CGO A;  3M79 A;  4IB4 A;  2YL3 A;  1E85 A;  3QW0 A;  3HNL A;  4U9E A;  2CCY A;  4JE9 A;  3HNK A;  2YLG A;  3HNJ A;  2XM0 A;  2QLA A;  3M15 A;  3DE8 A;  1GQA A;  3TOM A;  5B3I A;  1M6T A;  3HNI A;  4IAR A;  4CDY A;  3ZTM A;  3M4C A;  3ZWI A;  2YL0 A;  5JUA A;  3FOP A;  1APC A;  3QVZ A;  2XLM A;  2XLD A;  1JAF A;  2YL7 A;  5JS5 A;  3IQ6 A;  1LM3 B;  2XLE A;  5JLI A;  3C62 A;  3IQ5 A;  4L6R A;  1BBH A;  1E84 A;  3VRC A;  4D4N A;  3DE9 A;  256B A;  2XL8 A;  4N6H A;  1YYJ A;  4JKV A;  1QQ3 A;  4NC3 A;  4ULV A;  1CPR A;  2XM4 A;  3L1M A;  1CGN A;  2YKZ A;  4U9D A; 
#chains in the Genus database with same CATH topology
 2G3K A;  1AEP A;  2XLW A;  1OW8 A;  3FOO A;  4AL0 A;  4E7Z A;  2Q4F A;  4CSA C;  4DRH B;  3DKA A;  4YN0 B;  3OWT A;  5B1A C;  1LIH A;  1LPE A;  2EIM C;  4J32 B;  1G8X A;  1MMN A;  4UDV A;  1RMV A;  2XRH A;  3UMK A;  1OKK D;  3CAX A;  4XLN F;  1OXB A;  1OCC C;  2FFH A;  3IEE A;  3GOD A;  1YLM A;  3O6X A;  2R9R B;  2MWQ A;  3S9O A;  4EWC A;  3DI5 A;  3NG1 A;  4G7Z F;  4EKW A;  4CS9 A;  3ZQY A;  1QPU A;  1WAT A;  3DJU B;  1LI5 A;  3L8I A;  4OIR F;  3U8P A;  1SYQ A;  3VM6 A;  3AG2 C;  1HMO A;  3DM9 B;  4CS8 C;  1Z5Z A;  5L0C A;  1VYK A;  2W9Y A;  2P0N A;  1JR8 A;  2NPU A;  2XS1 A;  4HFK B;  1A7E A;  2HMZ A;  4IRU A;  5AC5 A;  1LVK A;  4CIH A;  5K0I A;  3H2V A;  3JTL O;  4M63 A;  1ORY A;  1VOM A;  1T5O A;  3E70 C;  1HW2 A;  4KNV A;  4LLC A;  5L0I A;  1U6H A;  3T9O A;  2KYH A;  1Q0G A;  4NTA A;  2WVO A;  4MVQ A;  3ZC4 A;  2J9U A;  2BC5 A;  2AU5 A;  3JSE O;  5JVE A;  2VCB A;  1Z7Q c;  1V4A A;  3DM5 A;  2R7S A;  1I4Y A;  2ASR A;  2W45 A;  3ZVR A;  3ZIB A;  4AE4 A;  3RW0 A;  1OCO C;  4DOZ A;  3PHF 2;  2C03 A;  5HV9 A;  3SYN A;  5KYW A;  4IAQ A;  2PX3 A;  2LQG A;  1FAP B;  3N2Z B;  4MVO A;  3UGO A;  5L0D A;  4OD4 A;  3W2W A;  1DOV A;  1HE9 A;  2W4B A;  4JZA A;  1YA7 O;  2JD3 A;  4HEA J;  3LS1 A;  1ZVZ A;  3CQZ A;  4MVZ A;  4AK9 A;  1FFT C;  2ETS A;  5KYX A;  3SXK A;  5JRA A;  4MS2 A;  2GDC A;  2CNW A;  4PJM A;  1VLT A;  2YL3 A;  2L6F A;  4IB4 A;  1NZE A;  2MYS A;  3LAY A;  2GWW A;  5EK0 A;  2CCY A;  3S0X A;  1Q0M A;  1BR1 A;  1KNY A;  2GAQ A;  3UR3 C;  2YLG A;  1D0Z A;  2J0X A;  2QNL A;  4MVU A;  4YT8 A;  2HKV A;  1D1C A;  4KC9 A;  2QLA A;  4MVM A;  5FZT A;  3K1H A;  3DWW A;  3LEV A;  1D1A A;  4PFO A;  3C7J A;  3M1C B;  3JCU Q;  1UG7 A;  5A6A A;  2XXA B;  3SP1 A;  4KI2 A;  1S7Z A;  4H54 A;  3GEH A;  1YAU O;  1K05 A;  2Y3G A;  2H7O A;  3TOM A;  1QZX A;  4DBR A;  4IAR A;  3H65 A;  5CIV A;  2HZ8 A;  1F1M A;  2LSE A;  3QTH A;  2Q00 A;  3CEX A;  1TFO B;  3FAJ A;  3JT1 A;  4PAC A;  4QI0 A;  1J8M F;  2P6V A;  4F4B A;  4K1O A;  2ZXO A;  3U2L A;  2R05 A;  4MW3 A;  3FOP A;  1WAS A;  2VH3 A;  2ZPA A;  2H7B A;  2RSE B;  4JJG A;  2R7V A;  5JS5 A;  2XL4 A;  1JOG A;  3K7D A;  4W8P A;  3L34 A;  3EZI A;  4Q5S F;  4EBK A;  1OXK A;  2L6H A;  4L6R A;  4PR9 A;  4RD9 A;  5A6B D;  2DGJ A;  2KSF A;  2KNH A;  2W4M A;  2IYL D;  4D4N A;  3RKO F;  1DOW A;  1RJ9 A;  256B A;  2Q9C A;  3V7O A;  2YHS A;  4E0I A;  1ZU4 A;  5DLJ A;  4YL0 A;  2HSB A;  4A2N B;  2YWA A;  4G7O F;  2QTV A;  4AL1 A;  4BG0 A;  4JKV A;  1V74 B;  1W2W A;  4LLE A;  5L0F A;  4Q7C A;  1OKK A;  1FTS A;  3S28 A;  3LES A;  1ZW3 A;  3EZH A;  2XM4 A;  1CGN A;  3QZC A;  1A0B A;  1JPJ A;  2YKZ A;  1D0X A;  5A6J A;  1G4U S;  3RH3 A;  3EGD B;  4XEV A;  3FXH A;  1FFH A;  4A4A A;  4XEF A;  5DS5 A;  2J46 A;  1V54 C;  4D4X A;  1JPN A;  3EQL F;  3LUT B;  4JEA A;  2J9V A;  1EKY A;  3C8G D;  2WVQ A;  1ORS C;  2J45 A;  2EPN A;  2A1D D;  1GS9 A;  1R5I D;  3AGT A;  3U9M A;  3M4B A;  1XZQ A;  4NTB A;  3RVY A;  5KYN A;  4E18 A;  1U0B B;  1YZA A;  3B71 A;  1K40 A;  4CSA A;  1OR2 A;  3EPV A;  1NU9 C;  1S05 A;  1A7V A;  3GWL A;  3K33 A;  5COG A;  3QW1 A;  2NSF A;  4MVS A;  1Z3I X;  4ANJ A;  2XLO A;  4BEM J;  2HJM A;  5COF A;  1YAR O;  1NU7 D;  5F5H A;  2WL8 A;  2IM8 A;  2IXO A;  2Y3D A;  2R03 A;  4P6I C;  4O6Y A;  3BRJ A;  3RVZ A;  4YL1 A;  4IGG A;  1D0Y A;  1MQV A;  3FMS A;  3U3B A;  4CDV A;  4JJF A;  2XXA A;  2VCC A;  3Q6N A;  3DZA A;  4PJJ A;  5D92 A;  3C8G B;  5E33 A;  2FAP B;  3ABK C;  1MNE A;  1TR2 A;  2IXN A;  1E86 A;  4U5E E;  2WZF A;  2HV7 A;  4BJ5 C;  1MMD A;  3HLZ A;  2R25 A;  3C63 A;  4G78 A;  1BDJ B;  4XEK A;  3Q7G A;  2C04 A;  3DJN B;  4BJT A;  2NSG A;  3AQC A;  2OEV A;  3TK0 A;  1I4Z A;  4BJ6 C;  5BUO A;  1BR4 A;  2P61 A;  3C18 A;  1M57 C;  4U5C E;  3V5X A;  4DXW A;  1YYX A;  1I5N A;  2Y39 A;  4U5B E;  4CIP A;  4G7H F;  3U5S A;  1VLS A;  3H2U A;  2ZXR A;  4K7B A;  3R7C A;  3T6G B;  4CJG A;  4WGZ A;  2R7U A;  3ITF A;  3KKB A;  1SMY F;  1K04 A;  4U5H A;  2VCA A;  3SNH A;  1L7C A;  3AG1 C;  4NCQ A;  4E7S A;  1CGO A;  1C03 A;  2FGY A;  1L3P A;  2ICW G;  4EHP A;  1VB5 A;  3VAY A;  2R7X A;  3T4R A;  3QW0 A;  1NFN A;  3Q6M A;  4U9E A;  2VC9 A;  3AGU A;  3SXZ A;  3TQO A;  2IOQ A;  3ZSU A;  1Z63 A;  1TWC A;  3L8J A;  4GEH A;  2J7P A;  3QMK A;  5DQT A;  3FDQ A;  4NQF A;  4C3E A;  2P1A A;  3I4U A;  3T6B A;  1WWP A;  2L7A A;  2HUJ A;  4XWJ A;  2A6H F;  1YJG A;  4N06 A;  1NFO A;  1HW1 A;  3DE8 A;  2PNO A;  4CS7 A;  2UUI A;  3EGD A;  3RQF A;  1GQA A;  5E3A A;  5L3V A;  2KQ9 A;  1M6T A;  1ZHX A;  3HNI A;  3RQG A;  2KGO A;  3TUL A;  4DVY P;  4LAC B;  1RXQ A;  2XS8 A;  2R7R A;  1WTY A;  3TJ5 A;  1EI7 A;  2PBE A;  4JRZ A;  1D1B A;  4RDA A;  4DVZ A;  2YEV A;  5DS4 A;  3ZDL A;  2ZXW C;  1M2V B;  1LI7 A;  3KH2 A;  3LNR A;  5BQG A;  1MMA A;  2EIN C;  1IZM A;  2XLM A;  1VK5 A;  2B0H A;  2XLD A;  5CI8 A;  2DI3 A;  3S29 A;  3WHN A;  3DXJ F;  2EPL X;  2HV6 A;  4R32 A;  3B9Q A;  1LM3 B;  3O55 A;  5JLI A;  2VB6 A;  1BBH A;  3LS0 A;  3MX3 A;  1Y6D A;  4U5F E;  3VRC A;  2PF4 E;  3FAP B;  4O7G A;  1MND A;  2A6E F;  3DE9 A;  4O6M A;  2LP4 A;  1Z23 A;  4J7T A;  3C8G A;  3UGP A;  3W8I A;  2GFH A;  3KPH A;  2Y69 C;  4XQ1 A;  3B0U X;  3ASO C;  2R7T A;  3GAN A;  1CGM E;  3DAG A;  1ZZP A;  3KYI A;  4JTA B;  4NC3 A;  1ZHT A;  4JW1 A;  1EA8 A;  1CPR A;  1OW7 A;  4ULV A;  4Z9J A;  4OIN F;  3U3F A;  1LS4 A;  3G50 A;  3DMD A;  4BEJ A;  4DRJ B;  1OCR C;  3OA1 A;  3T6J A;  4FAP B;  3U9J A;  2NG1 A;  5A69 A;  5A6K A;  4U9D A;  3GOR A;  2G62 A;  4WJ0 A;  4CJO A;  2EPM X;  3GEE A;  3JYY A;  2Q9A A;  5L0H A;  1VYI A;  3I5P A;  4XPX A;  2VAS A;  1LE2 A;  3PDM P;  2EIK C;  5JP7 A;  3POV A;  3NMK A;  1B68 A;  1PCX A;  2A69 F;  4LDK A;  4J30 B;  4JTD B;  4OIO F;  4EIY A;  4W8K A;  1YDI A;  3HKK A;  2X51 A;  4JEB A;  4LDQ A;  4XPW A;  4BJ1 A;  2EIJ C;  3NKE A;  3QVY A;  2PP4 A;  3HTK C;  4IAO A;  1E83 A;  1Q0D A;  3B0P A;  1JMW A;  3U2M A;  1IW7 F;  4OIP F;  3EGX B;  5E3C A;  1RCP A;  3EHN A;  3ZG1 A;  3KYJ A;  3I5Q A;  4P9T A;  2YVK A;  3SEO A;  2X0C A;  3MYF A;  2A0U A;  3AG3 C;  4YK5 A;  3CSK A;  3DD7 A;  3O10 A;  3WAQ A;  1NLX A;  4MQ9 F;  2AWC A;  2IBF A;  1LKX A;  4C3B A;  2NUT B;  2HJ3 A;  5CI9 A;  2RD9 A;  2XLV A;  5DQZ A;  4C7O B;  1CPQ A;  2TMV P;  1RKE B;  4OD5 A;  2H8A A;  2PFD A;  4YJW A;  4JCZ A;  2V26 A;  2OU6 A;  3C8Z A;  3V5Z A;  4DBQ A;  3A9C A;  3SXM A;  5B3S C;  4JUR I;  5KYU B;  1FNT c;  1KU2 A;  3K1I C;  2XLH A;  4Q4Z F;  3UNG C;  4BPM A;  4I1O B;  4FWV A;  4BJ5 A;  3VF0 A;  5JT4 A;  1Q0K A;  1ZHW A;  1ORJ A;  2Q9B A;  4LER A;  3SXY A;  4BJ6 A;  3DAF A;  1T9K A;  3KL4 A;  3K6B A;  1OW6 A;  1HMD A;  3NYL A;  4DJ9 A;  2J9B A;  2XL6 A;  1SZI A;  1NG1 A;  4WGY A;  4AE4 B;  1OCZ C;  5E2Q A;  4PFP A;  2DYR C;  4GQH A;  2R02 A;  3EH1 A;  3R2P A;  3F46 A;  4CS8 A;  2R7Q A;  2BE5 F;  4JE9 A;  2OQM A;  2H7V C;  3HNK A;  3MYI A;  3HNJ A;  2LIG A;  2LFF A;  1T6Q A;  3OEO A;  3M15 A;  2WZG A;  1ZHZ A;  1FMW A;  1A41 A;  1PD0 A;  3ECS A;  3N24 A;  2Q7R A;  2Q3T A;  3S84 A;  2D5R B;  4GYT A;  2I8B A;  1QVX A;  3LJB A;  4K0D A;  4U5G A;  2IXP A;  3ATP A;  3EH2 A;  4E0H A;  4HE8 D;  3HJC A;  2M4E A;  2IXM A;  4EUK B;  1LE4 A;  2L9J A;  2Z15 A;  1VMA A;  3TJ6 A;  2HSQ A;  4CDY A;  5T3T A;  3ZWI A;  2CDQ A;  2LFD A;  1M56 C;  5BQH A;  5KYY B;  2YL0 A;  5AC4 A;  2R7O A;  5JUA A;  3JZ0 A;  3B0V C;  3QVZ A;  2A68 F;  3NKD A;  3GWN A;  3F47 A;  2YL7 A;  3AG4 C;  1GGQ A;  2EPK X;  1ST6 A;  5FCL A;  2KW3 C;  2A0B A;  1O3U A;  3EGX A;  2L81 A;  1TKN A;  3KMI A;  2D4U A;  2LCH A;  4MND A;  1PD1 A;  3Q7L A;  2J0W A;  4EBJ A;  2UUH A;  1T01 A;  3EHM A;  3LLI A;  1E84 A;  3RF3 A;  3NYJ A;  3PCV A;  4IWB A;  3W2V A;  2OCC C;  4E17 A;  3GM3 A;  1U89 A;  3ASN C;  3U8V A;  4YT4 A;  2MHR A;  4FES A;  4JCH A;  2NUT A;  2ZXP A;  1ZHY A;  3MLG A;  4C7O A;  1C17 M;  2PX0 A;  1RKE A;  4PJL A;  1G4W R;  4QDL A;  4AX2 A;  5A6B A;  4N6C A;  2KC3 A;  1QQ3 A;  4XLP F;  3JYH A;  2OG2 A;  2F22 A;  4O79 A;  5KYU A;  4YWQ A;  3O39 A;  3L1M A;  4MTO A;  1RJ9 B;  2M64 A;  3G4X A;  2GA0 A;  3E9V A;  5TJ5 E;  1QSP A;  3MFN A;  3JSZ A;  4RBN A;  5DVW A;  1H9T A;  2YLI A;  5IY5 C;  1YZC A;  2CYD A;  1Z6A A;  1BR2 A;  2AVK A;  3V5Y A;  2CW0 F;  2ZD9 A;  2EIL C;  1UFB A;  1SR2 A;  2YL1 A;  3ZQV A;  1Y4C A;  1WOL A;  2WVN A;  3A11 A;  4IJJ A;  4PJN A;  3WG7 C;  4KNW A;  1OR3 A;  2Y3H A;  1N1C A;  3X2Q C;  4CS9 C;  4ULW A;  3J06 A;  3TOL A;  1AUE A;  2QE9 A;  2HMQ A;  2JPU A;  4U5D E;  4P9F A;  3S27 A;  2CGE A;  2R7W A;  2V3C C;  4Z9I A;  2BL2 A;  1TFK B;  1QLE C;  2QY9 A;  3TD7 A;  1NBB A;  3W4Y A;  3EG9 B;  2B0J A;  1C02 A;  1TWA A;  2LK4 A;  1JRA A;  3K66 A;  1VTM P;  1T6I A;  1XWJ A;  5COM A;  4PK4 A;  5L0G A;  4CX9 A;  5D91 A;  3GM1 A;  5GPG B;  1YA9 A;  3VYW A;  1H7I A;  2J8W A;  2YLD A;  4WAB A;  5JSL A;  2NUP B;  4ONS A;  1G5Z A;  4ER9 A;  3NMJ A;  5KYY A;  1BZ4 A;  3UMH A;  4YT5 A;  4MVR A;  5EHH A;  4ZLD A;  4I3M A;  1NSG B;  2EPO A;  3EFO B;  3NMI A;  4NTF A;  5AGF A;  3S90 A;  2YQY A;  3UMI A;  4C3D A;  4N4W A;  4FX5 A;  2DYS C;  2J9W A;  2OOC A;  3G4Z A;  3WOD F;  1RKC A;  3GEI A;  3X1O A;  4JIO A;  3K1I A;  4XPY A;  2P7V A;  3ZTZ A;  2LD6 A;  2J7P D;  2Y3B A;  2OJE D;  3FVY A;  3EJN A;  3IHU A;  2JX0 A;  4EBB A;  3W8H A;  1YVI A;  4LDR A;  1FR0 A;  2O9X A;  4CDA A;  4KBL A;  1ZW2 A;  3RYL A;  2WB7 A;  3M79 A;  4JTC B;  3SZR A;  5L3Q A;  1WN0 A;  2HS5 A;  3CZ6 A;  1E85 A;  3HNL A;  2OKU A;  3LEO A;  3RFY A;  5F5F A;  4H4K C;  1FMV A;  5T1D B;  4ZLC A;  4MW8 A;  1HE1 A;  1XZP A;  1M2O A;  2XM0 A;  3B29 A;  4HFF B;  5DS6 A;  4J7Y A;  5L0J A;  4DRI B;  3FHD A;  4I1M A;  1TWH A;  2G3V A;  1M2V A;  2KK1 A;  3LNM B;  1H9G A;  2OEX A;  3JRM O;  5T3W A;  1R4T A;  4O6N A;  5B3I A;  3ABM C;  4NY3 A;  2CNW D;  1MMG A;  4Z9H A;  3AJM A;  4MTG A;  4XTK A;  3RQE A;  3ZTM A;  4QI2 A;  2QUP A;  3M4C A;  5B1B C;  3N0T A;  1Q0F A;  3L0I A;  3NRH A;  4JVS A;  1QKR A;  1V55 C;  1ZYR F;  1PV3 A;  3BEH A;  4B6I A;  3PMR A;  1APC A;  2KJG A;  3IPM O;  1TQG A;  1SF8 A;  2I15 A;  3NYM A;  1EQ1 A;  3U0C A;  3RIP A;  1JAF A;  3US6 A;  2WZL A;  2AP3 A;  1H6G A;  2YZS A;  5KYW B;  5HSW A;  3IQ6 A;  3NDB B;  1A7D A;  2HFI A;  1KTM A;  2XLE A;  3C62 A;  3IQ5 A;  3GM2 A;  1HY5 A;  1LS1 A;  1AVO B;  3ABL C;  3EG9 A;  5F28 E;  4YT2 A;  3AOU A;  1J8Y F;  3LLK A;  1ZU5 A;  1TWG A;  3IQC A;  1T6U A;  4YL3 A;  4X0R A;  2XSE A;  5KYX B;  4G0H A;  2XL8 A;  4N6H A;  3IQT A;  4JC7 A;  3AQB A;  2OJQ A;  5BQI A;  1OQC A;  2NUP A;  1O87 A;  1YYJ A;  5EGY A;  4MTF A;  1O5H A;  1E2X A;  2YRF A;  1WGW A;  1GM5 A;  3EFO A;  4CBE A;  4I44 A;  3JRT A;  2DB4 A;  2E87 A;  2L6G A;  4OIQ F;  2AWY A;  3MBG A; 
#chains in the Genus database with same CATH homology
 4CJO A;  4D4X A;  2XLW A;  2YLI A;  3FOO A;  4JEA A;  1EKY A;  1YZC A;  5JP7 A;  2YL1 A;  3NMK A;  3ZQV A;  3M4B A;  4EIY A;  1YZA A;  4JEB A;  3TOL A;  3QVY A;  1S05 A;  1E83 A;  1A7V A;  3QW1 A;  3ZQY A;  1QPU A;  3U8P A;  1RCP A;  2XLO A;  1NBB A;  1MQV A;  4CDV A;  4CX9 A;  2J8W A;  2XLV A;  2YLD A;  5JSL A;  1CPQ A;  1E86 A;  4ER9 A;  3NMJ A;  2BC5 A;  3C63 A;  5JVE A;  5AGF A;  3NMI A;  2XLH A;  4N4W A;  4IAQ A;  5JT4 A;  1YYX A;  3ZTZ A;  4CIP A;  4CJG A;  4WGZ A;  2J9B A;  2XL6 A;  4WGY A;  5JRA A;  4CDA A;  1CGO A;  3M79 A;  4IB4 A;  2YL3 A;  1E85 A;  3QW0 A;  3HNL A;  4U9E A;  2CCY A;  4JE9 A;  3HNK A;  2YLG A;  3HNJ A;  2XM0 A;  2QLA A;  3M15 A;  3DE8 A;  1GQA A;  3TOM A;  5B3I A;  1M6T A;  3HNI A;  4IAR A;  4CDY A;  3ZTM A;  3M4C A;  3ZWI A;  2YL0 A;  5JUA A;  3FOP A;  1APC A;  3QVZ A;  2XLM A;  2XLD A;  1JAF A;  2YL7 A;  5JS5 A;  3IQ6 A;  1LM3 B;  2XLE A;  5JLI A;  3C62 A;  3IQ5 A;  4L6R A;  1BBH A;  1E84 A;  3VRC A;  4D4N A;  3DE9 A;  256B A;  2XL8 A;  4N6H A;  1YYJ A;  4JKV A;  1QQ3 A;  4NC3 A;  4ULV A;  1CPR A;  2XM4 A;  3L1M A;  1CGN A;  2YKZ A;  4U9D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...