3I4UA

Crystal structure analysis of a helicase associated domain
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
247
structure length
241
Chain Sequence
GSPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQTEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKSTVRVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQPEWVVYHELVLTTKEYMREVTTIDPRWLVEFAPAFFKVLDHGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural analysis of the C-terminal domain of the spliceosomal helicase Prp22
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords ATP-dependent RNA helicase DHX8
total genus 79
structure length 241
sequence length 247
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2009-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04408 HA2 Helicase associated domain (HA2)
A PF07717 OB_NTP_bind Oligonucleotide/oligosaccharide-binding (OB)-fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1080 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3i4uA01
3I4UA
chains in the Genus database with same CATH superfamily
2KYHA 1YVIA 5HV9A 2ZXWC 2ZXRA 1FAPB 4X0RA 2DYSC 1Y4CA 4OIRF 3SEOA 4KNVA 2MWQA 5A6JA 3K33A 1NG1A 3GORA 3DD7A 2P6VA 4JZAA 5IY5C 4H54A 4YWQA 3NDBB 2CGEA 2HJ3A 2W45A 4IGGA 2XLOA 3RYLA 4XLPF 3UGPA 5T3TA 3PHF2 4XPWA 3JRMO 1G4WR 2EINC 2O9XA 2XM4A 2HUJA 2J0WA 2LFFA 4FESA 2JD3A 4GQHA 2X0CA 3RIPA 3NG1A 1OKKD 4I1MA 3SNHA 4BEMJ 3NKEA 2G3VA 1NU9C 3EHNA 3KKBA 3FOOA 4PJJA 5E3CA 1M57C 4K1OA 5JS5A 2HSBA 1MMGA 1APCA 2WZGA 1R5ID 2IYLD 2RSEB 4QDLA 5CI9A 1XZPA 3Q7LA 4R32A 3BRJA 2Q7RA 3L8JA 4D4NA 2YWAA 4MVUA 3ASOC 3LJBA 1RMVA 1M56C 4P9TA 1OCZC 3ZDLA 3AG3C 3H2UA 5L0CA 4YT2A 2XXAB 2LK4A 3CAXA 3ZC4A 2AU5A 1VK5A 3ITFA 2VC9A 2HJMA 1D0ZA 2XL4A 2QUPA 3RVZA 2YLGA 4BG0A 4CJGA 4DRIB 2XXAA 2KW3C 4DRHB 2W4MA 3HNJA 3EGXA 1JR8A 3DM9B 3FXHA 3U8PA 5BQHA 4NTBA 3DWWA 4G0HA 3U2MA 1H6GA 5COGA 2VCAA 2J9WA 5JSLA 3K6BA 2GDCA 2IXPA 1PV3A 2R7UA 1EI7A 4XPXA 4BJ1A 1QKRA 4XEFA 3T6BA 2Y69C 1JRAA 3UMIA 5TJ5E 5A6BA 2R7TA 2YLDA 2IXNA 3TOLA 4BJ6A 1VB5A 3QTHA 4MVZA 5L0GA 1Z5ZA 1M2VB 1RJ9B 3H2VA 1AVOB 1V54C 3HNIA 4DXWA 2LQGA 1Q0FA 5DS6A 2LCHA 1T6IA 3RW0A 1L3PA 3UR3C 1K40A 4O79A 4YL0A 3AGUA 3LLKA 1G5ZA 4E0IA 2WVNA 4JJGA 4PR9A 1E83A 1EA8A 3EGDB 5BQIA 3QVYA 2B0HA 1OW7A 1ZZPA 4JURI 1XZQA 1L7CA 4MVRA 2HMZA 2PFDA 3NRHA 4XWJA 2OOCA 4DVYP 2XLHA 1Z6AA 4O6YA 2D4UA 1KNYA 2OG2A 2PP4A 2ZD9A 3JT1A 3U0CA 4KI2A 2R05A 4ULWA 2Y39A 3S27A 1T5OA 3LUTB 2HKVA 4J7TA 4XPYA 1LS1A 2KJGA 4ULVA 2LP4A 2H7BA 2HSQA 2XS8A 4U9DA 5EHHA 1Q0KA 2CNWD 2OEVA 4IAOA 3HTKC 3TD7A 5L0DA 2XLVA 1Z63A 3AGTA 4O7GA 4NTAA 1VLSA 1U0BB 3GODA 1ZHYA 4XEVA 2H7VC 4FX5A 2R25A 2QTVA 5L0IA 3JRTA 5T1DB 3F46A 1HMOA 2J46A 2AP3A 3M4BA 1FMWA 3GANA 2HV7A 3M15A 3TJ5A 2PBEA 2IXOA 2ETSA 3RQGA 1SYQA 4BJ6C 3X1OA 4DJ9A 4U5DE 4EIYA 2R7WA 2EPLX 5KYWB 3RH3A 3A11A 4JCHA 4NC3A 3BEHA 2NUTA 1K04A 1PCXA 3C18A 4XEKA 2J9BA 1OCRC 2H8AA 1F1MA 1QLEC 2ZXOA 3CZ6A 4Z9JA 3SP1A 4XQ1A 3U3FA 3ZWIA 1ZW2A 3EG9B 3ZG1A 1QVXA 2R7OA 2PX0A 3J06A 1JAFA 4JRZA 3WODF 1BZ4A 4OIOF 2BL2A 2YL7A 4PACA 4YT8A 3IPMO 1CPRA 4JEAA 1NFOA 4G78A 3EG9A 4DVZA 4MNDA 3MYIA 4AE4B 5E3AA 2IXMA 4RBNA 3GEIA 5B3IA 1Z3IX 2EIJC 3DKAA 3TQOA 5KYNA 1LVKA 2GAQA 2J9VA 4ONSA 4EHPA 4OIPF 2R7SA 2WZFA 3QW1A 2Q9BA 5BQGA 4HEAJ 1H9GA 1NSGB 2Y3BA 4O6NA 3W2WA 4CX9A 1HMDA 2NG1A 4J30B 5KYXA 1RXQA 4CBEA 1FMVA 1TR2A 1M6TA 3GWNA 3HNLA 3VRCA 4CDVA 1YLMA 2QY9A 1E2XA 4QI2A 3A9CA 5DQZA 1ST6A 5KYXB 3GM2A 3Q6NA 5L3QA 3JSZA 2R7RA 3EGXB 2BE5F 2I15A 2YVKA 2EPMX 3ASNC 3GM1A 5DVWA 3R7CA 4DRJB 2LD6A 1ZU5A 2P61A 2Y3GA 3C8GA 2A6HF 3V5ZA 4C3BA 4DBRA 2WB7A 1CPQA 2L7AA 3N0TA 3C8ZA 5A69A 5HSWA 3IQ5A 4DOZA 1T01A 1C03A 2KGOA 2VASA 3AQBA 3KPHA 5JP7A 3C7JA 3DAGA 1BBHA 3EH1A 1J8YF 3F47A 3DI5A 4MTOA 4PJLA 4U5CE 3L1MA 3PCVA 1EQ1A 2EPNA 3MX3A 3AJMA 5E2QA 2CW0F 3AG1C 4ZLCA 4N6HA 3K7DA 3VM6A 1OR3A 256BA 2YZSA 1YA7O 3SXMA 3W2VA 2C03A 3DZAA 1D1CA 1TFOB 2I8BA 5KYWA 5FZTA 1RKCA 4U5FE 4CIHA 1EKYA 1JPNA 2NSFA 4Z9HA 3LAYA 1W2WA 3ABMC 3JTLO 2OEXA 4N4WA 3FVYA 1QQ3A 4U5HA 3WAQA 4AL1A 5CIVA 3KYJA 2XRHA 4MVSA 4DBQA 3DM5A 5COMA 5AC5A 3ABLC 2P0NA 4RDAA 4U5EE 4WJ0A 5JVEA 4JCZA 1ZVZA 1TQGA 2Q4FA 2KC3A 3IQ6A 3T4RA 4BJTA 5FCLA 3B0UX 1LE2A 2NUPB 3JZ0A 3MBGA 2PX3A 3TOMA 1MMDA 1KTMA 4U5GA 3S9OA 3NYJA 4U5BE 2YEVA 5B1BC 4P9FA 3IQCA 4E17A 3U9JA 3ZTMA 1ORYA 2GA0A 3B29A 4XLNF 2QNLA 1JOGA 1JPJA 3U9MA 4E0HA 1Z23A 1MQVA 2WVOA 4JE9A 4L6RA 5F28E 1A0BA 3S0XA 1HE9A 1PD1A 3ATPA 1VYKA 3AG2C 5GPGB 4OINF 2FGYA 1BDJB 3M4CA 4NY3A 1S05A 4C3EA 4J32B 4IWBA 4E18A 3M79A 3NKDA 1OCOC 2YKZA 3FHDA 3EH2A 4MTGA 1IZMA 1RKEB 1SF8A 2EILC 3TK0A 1OKKA 3HKKA 2M4EA 3CSKA 4JTDB 4EUKB 5A6KA 3AQCA 1NLXA 3W8HA 4LERA 4CJOA 1O5HA 4NQFA 1GQAA 4YL1A 5KYUB 4YT4A 1XWJA 4MQ9F 1BR1A 4PJMA 5EK0A 1DOWA 2Q9AA 2A0BA 1OR2A 3AG4C 2CCYA 5DLJA 1OXBA 4AE4A 1DOVA 2JPUA 2L6GA 3G4XA 4EBKA 4KBLA 3ZSUA 3E70C 5KYUA 2IOQA 1VOMA 4YK5A 5DS4A 4HFFB 4J7YA 4ZLDA 1VLTA 4JC7A 2YL3A 1NZEA 3LESA 5EGYA 3RF3A 4BJ5C 2GFHA 2WVQA 3M1CB 1JMWA 2OJQA 1CGME 1I4YA 1TFKB 1LKXA 2P7VA 4GYTA 2CYDA 4MVQA 3H65A 3FOPA 1NBBA 3MFNA 3I5PA 1YZAA 5L3VA 3FDQA 2J9UA 1M2VA 1RJ9A 3UGOA 1WATA 2ZPAA 3HNKA 2J0XA 1T6QA 2A1DD 3KH2A 3T9OA 3LS0A 1J8MF 4CSAA 2AWYA 2J7PD 3RQEA 2Q00A 4AL0A 2Q9CA 3ZVRA 1O3UA 4N06A 1E86A 1V55C 2HS5A 1U6HA 3NYLA 3NYMA 3O6XA 3SXZA 3CEXA 2OJED 2A6EF 1WOLA 2H7OA 4AK9A 2DGJA 3K1HA 5JT4A 1C17M 1LI7A 1YYJA 3S28A 4K7BA 3UNGC 4CS8C 3EHMA 2ZXPA 1ZYRF 1Q0DA 3EZIA 3UMHA 4CDAA 2KQ9A 3TULA 4G7HF 1SR2A 1VYIA 1Q0MA 3VF0A 4CS9A 3E9VA 1GGQA 2VCBA 1FR0A 2MHRA 2YRFA 3EPVA 1LIHA 2A68F 3LEOA 5L0HA 3OWTA 2KK1A 4YJWA 2V26A 3B0PA 4PJNA 4A2NB 3V5YA 1RKEA 1T6UA 2R02A 3DE8A 5F5FA 1N1CA 2QLAA 4E7SA 1IW7F 2VCCA 1BR2A 1OW8A 3ECSA 3U3BA 3FAJA 1Y6DA 2OU6A 3C62A 3DJUB 3K1IA 4JJFA 1LS4A 2NUPA 5COFA 1SMYF 3EGDA 4MTFA 3N2ZB 3DAFA 4U9EA 3IEEA 4LDKA 4CS9C 4AX2A 2C04A 4P6IC 1WGWA 3RQFA 4WABA 4BPMA 2X51A 3RFYA 4BEJA 4BJ5A 2VB6A 1K05A 4YN0B 2D5RB 3O39A 1HY5A 4YL3A 1YA9A 3N24A 4YT5A 2JX0A 4ER9A 1HW1A 3SZRA 4C3DA 2R7QA 1A41A 4W8PA 4Q5SF 2YL0A 2XLDA 3T6JA 2L9JA 5A6AA 2G62A 4OD5A 3S90A 4I1OB 4OD4A 5B1AC 1B68A 4WGYA 1D1BA 1LPEA 1UG7A 3QVZA 1HW2A 3EJNA 1YAUO 1BR4A 4K0DA 4Q7CA 4RD9A 1ZHZA 1YDIA 3R2PA 1V4AA 4PK4A 2XLEA 2DI3A 3DE9A 4IRUA 2OQMA 4CDYA 1QPUA 4KNWA 1S7ZA 1H7IA 1G8XA 3AOUA 3L0IA 3QMKA 2HV6A 1I5NA 2EPOA 2QE9A 3B71A 1MNDA 3ZIBA 2FAPB 4A4AA 4FAPB 2FFHA 3OEOA 4Q4ZF 1U89A 3O10A 1TWHA 2MYSA 2R7VA 1YZCA 1PD0A 4IAQA 1R4TA 1ZHXA 3O55A 1ORSC 1ZHWA 5JLIA 3U5SA 5A6BD 4LDQA 4CS7A 5CI8A 2Y3DA 1FFTC 3C8GB 3RVYA 3B0VC 1WTYA 3MLGA 1H9TA 2XLMA 3G50A 5D91A 2WL8A 2L6FA 4XTKA 2XSEA 5K0IA 4WGZA 1CGNA 4H4KC 3I5QA 4C7OA 3B9QA 3GM3A 1HE1A 3TJ6A 3ZTZA 4NCQA 2V3CC 2PF4E 2XL8A 3NMJA 1KU2A 3L34A 3IQTA 3QZCA 5E33A 1UFBA 1Z7Qc 3ZQYA 1ZHTA 4EWCA 1FNTc 4PFPA 1WASA 1TWAA 3EFOB 1G4US 5JUAA 1OCCC 3U8VA 4C7OB 3S29A 2ASRA 4M63A 1MMNA 2WZLA 2P1AA 4LACB 5AGFA 1NFNA 4JVSA 3UMKA 3VAYA 1AEPA 3V7OA 1TWCA 2HMQA 3FAPB 1OQCA 4JTCB 2UUHA 4IJJA 1TKNA 1YJGA 3GEHA 2BC5A 1RCPA 1LI5A 3LS1A 4LLCA 1NU7D 2HZ8A 1E84A 4JEBA 2EPKX 2ICWG 3S84A 2AWCA 1M2OA 2VH3A 1FTSA 3EQLF 4NTFA 4O6MA 4EBBA 1YARO 1A7EA 2KNHA 1SZIA 5F5HA 2EIKC 5B3SC 3EZHA 3LEVA 2KSFA 1LM3B 2CNWA 1D1AA 3GEEA 2XL6A 5L0JA 1TWGA 3DMDA 2NUTB 5L0FA 1A7DA 2TMVP 4B6IA 1GM5A 2M64A 2IM8A 4EBJA 3T6GB 1QSPA 1LE4A 1AUEA 4IB4A 3W8IA 4JW1A 1MNEA 1CGOA 2Z15A 1E85A 5JRAA 4HFKB 3IHUA 2R9RB 1ZW3A 3JYYA 4LDRA 5AC4A 3PDMP 1ORJA 2PNOA 3HLZA 3LLIA 3LNMB 3SXYA 5KYYB 3JSEO 2Y3HA 5DS5A 2A0UA 2A69F 2LIGA 1C02A 2OCCC 3L8IA 1OXKA 1D0YA 3MYFA 3US6A 3G4ZA 2IBFA 4W8KA 5KYYA 4I44A 4MS2A 4CIPA 4CS8A 4Z9IA 2NPUA 3I4UA 3Q7GA 2NSGA 3CQZA 1A7VA 4N6CA 2OKUA 4F4BA 3SXKA 3RKOF 2XM0A 2UUIA 3POVA 1GS9A 2J45A 3JCUQ 5BUOA 1WWPA 3C63A 3EFOA 2CDQA 1V74B 2LSEA 2DB4A 4IARA 2YL1A 2YLIA 4PFOA 1WN0A 3HJCA 1O87A 2L81A 3VYWA 1VMAA 5T3WA 3FMSA 5DQTA 3U2LA 2XLWA 2XS1A 2J7PA 3C8GD 3K1IC 1QZXA 1FFHA 4MW8A 1D0XA 4FWVA 2L6HA 3KMIA 3NMIA 4G7OF 2EIMC 3QW0A 4I3MA 2W4BA 3LNRA 1Q0GA 4G7ZF 4CSAC 2R7XA 3ZQVA 2B0JA 2HFIA 1YYXA 2GWWA 3W4YA 1T9KA 3WHNA 4UDVA 2G3KA 3DXJF 3ABKC 4JKVA 4LLEA 2R03A 2DYRC 3PMRA 4QI0A 4MVOA 1OW6A 4MVMA 3OA1A 2AVKA 2J8WA 4D4XA 4OIQF 2RD9A 4KC9A 4MW3A 2LFDA 4HE8D 5D92A 2YHSA 3SYNA 2YQYA 3KL4A 3DJNB 4JTAB 4EKWA 2W9YA 3GWLA 3KYIA 3WG7C 1VTMP 1ZU4A 3Q6MA 4GEHA 3JYHA 4JIOA 3X2QC 2F22A 2Q3TA 4ANJA 3NMKA 1MMAA 3K66A 1I4ZA 4E7ZA 3V5XA 2E87A
chains in the Genus database with same CATH topology
2ZXWC 2ZXRA 4X0RA 2DYSC 4OIRF 3SEOA 4KNVA 2MWQA 3K33A 1NG1A 3DD7A 2P6VA 4JZAA 5IY5C 3NDBB 4YWQA 2CGEA 2W45A 4XLPF 3RYLA 3UGPA 5T3TA 3PHF2 2EINC 2O9XA 4FESA 3RIPA 2J0WA 3SNHA 2JD3A 3NG1A 1OKKD 4I1MA 3NKEA 2G3VA 1NU9C 3EHNA 3KKBA 4PJJA 5E3CA 1M57C 1MMGA 2WZGA 5T1DB 2IYLD 5CI9A 4QDLA 3Q7LA 3ASOC 3LJBA 1M56C 1OCZC 3AG3C 4YT2A 2XXAB 3ZC4A 1VK5A 3ITFA 2XL4A 1D0ZA 4BG0A 2XXAA 2KW3C 2W4MA 3EGXA 3DM9B 4G0HA 2J9WA 3K6BA 2IXPA 2R7UA 4BJ1A 3T6BA 2Y69C 3UMIA 2R7TA 2IXNA 4BJ6A 1Z5ZA 1M2VB 1RJ9B 1V54C 5DS6A 3UR3C 4O79A 3LLKA 2WVNA 4JJGA 3EGDB 5DS5A 4JURI 4DVYP 2PFDA 3NRHA 4XWJA 1Z6AA 4O6YA 2OG2A 2PP4A 3JT1A 4KI2A 4ULWA 2Y39A 3S27A 1LS1A 2KJGA 2H7BA 5EHHA 2CNWD 4IAOA 3HTKC 3TD7A 1Z63A 4O7GA 3GODA 1ZHYA 2H7VC 4FX5A 2QTVA 3JRTA 3F46A 2J46A 1FMWA 3GANA 2HV7A 2IXOA 4BJ6C 2R7WA 3X1OA 4U5DE 5KYWB 3RH3A 4JCHA 2NUTA 1PCXA 3SP1A 1OCRC 2ZXOA 3CZ6A 1QLEC 2R7RA 3EG9B 3ZG1A 2R7OA 2PX0A 3WODF 4OIOF 4YT8A 3EG9A 4DVZA 4MNDA 4AE4B 5E3AA 2IXMA 4RBNA 1Z3IX 2EIJC 5KYNA 1LVKA 2J9VA 4OIPF 2R7SA 2WZFA 2Q9BA 4HEAJ 2Y3BA 3W2WA 4O6NA 2NG1A 4J30B 5KYXA 4CBEA 1FMVA 1TR2A 2QY9A 4QI2A 5DQZA 1ST6A 5KYXB 3Q6NA 5L3QA 3JSZA 3EGXB 2BE5F 3ASNC 5DVWA 1ZU5A 2Y3GA 2A6HF 4C3BA 4DBRA 2WB7A 3N0TA 5HSWA 4DOZA 2VASA 2KGOA 3AQBA 3B0UX 4ANJA 3EH1A 3DAGA 3F47A 1J8YF 4PJLA 4U5CE 5E2QA 3MX3A 2CW0F 3AG1C 4ZLCA 3K7DA 2YZSA 3W2VA 2C03A 3DZAA 1D1CA 2I8BA 5KYWA 4U5FE 4CIHA 1JPNA 3LAYA 1W2WA 3ABMC 3FVYA 4U5HA 2XRHA 4DBQA 3DM5A 3ABLC 4RDAA 4U5EE 4WJ0A 3T4RA 4BJTA 5FCLA 2NUPB 2PX3A 1MMDA 4U5GA 3NYJA 4U5BE 2YEVA 5B1BC 4XLNF 1JPJA 1Z23A 2WVOA 3S0XA 1PD1A 1VYKA 3AG2C 4OINF 2FGYA 4NY3A 4C3EA 4J32B 4IWBA 3NKDA 1OCOC 3FHDA 3EH2A 1IZMA 1SF8A 2EILC 1OKKA 2M4EA 3CSKA 3AQCA 3W8HA 4LERA 1O5HA 5KYUB 4YT4A 4MQ9F 1BR1A 4PJMA 2Q9AA 3AG4C 5DLJA 4AE4A 4KBLA 3ZSUA 3E70C 5KYUA 2IOQA 1VOMA 5DS4A 4HFFB 4ZLDA 1NZEA 3LESA 4BJ5C 2GFHA 2WVQA 3M1CB 1LKXA 2P7VA 4GYTA 3H65A 3I5PA 5L3VA 3FDQA 2J9UA 1M2VA 1RJ9A 3UGOA 2ZPAA 2J0XA 2A1DD 3KH2A 3LS0A 1J8MF 4CSAA 2J7PD 2Q9CA 3ZVRA 4N06A 1V55C 3NYLA 3NYMA 3O6XA 2A6EF 2H7OA 4AK9A 2DGJA 3K1HA 3S28A 3UNGC 4K7BA 4CS8C 3EHMA 2ZXPA 1ZYRF 3EZIA 3UMHA 2KQ9A 4G7HF 1VYIA 4CS9A 3E9VA 3EPVA 2A68F 3OWTA 4YJWA 2V26A 3B0PA 4PJNA 4A2NB 5F5FA 1N1CA 4E7SA 1IW7F 1BR2A 3ECSA 3FAJA 3DJUB 4JJFA 2NUPA 1SMYF 3EGDA 3N2ZB 3DAFA 3IEEA 4CS9C 4AX2A 2C04A 4P6IC 1WGWA 2X51A 3RFYA 4BEJA 4BJ5A 2VB6A 4YN0B 2D5RB 3O39A 3N24A 4YT5A 3SZRA 4C3DA 2R7QA 4Q5SF 3T6JA 2L9JA 2G62A 4OD5A 4I1OB 4OD4A 5B1AC 1D1BA 3EJNA 1BR4A 4K0DA 4Q7CA 4RD9A 1ZHZA 4PK4A 4IRUA 4KNWA 1S7ZA 3L0IA 1G8XA 3QMKA 5EGYA 2HV6A 3ZIBA 1MNDA 2FFHA 3OEOA 4Q4ZF 1TWHA 2MYSA 2R7VA 1PD0A 1ZHXA 1ZHWA 4CS7A 5CI8A 2Y3DA 1FFTC 3B0VC 3MLGA 5D91A 2WL8A 4XTKA 2XSEA 4H4KC 3I5QA 4C7OA 3B9QA 2V3CC 2PF4E 5E33A 1KU2A 3L34A 3QZCA 4EWCA 1ZHTA 4PFPA 1TWAA 3EFOB 4C7OB 1OCCC 3S29A 4M63A 1MMNA 2WZLA 4LACB 4JVSA 3UMKA 3VAYA 3V7OA 1TWCA 4IJJA 1TKNA 3LS1A 4LLCA 1NU7D 1M2OA 2VH3A 1FTSA 3EQLF 4O6MA 4EBBA 2KNHA 1SZIA 5F5HA 2EIKC 5B3SC 3EZHA 3LEVA 2CNWA 1D1AA 1TWGA 3DMDA 2NUTB 4B6IA 3W8IA 4JW1A 1MNEA 2Z15A 4HFKB 3HLZA 3LLIA 5KYYB 2Y3HA 2A69F 2OCCC 1D0YA 4W8KA 5KYYA 4I44A 4CS8A 3I4UA 3Q7GA 3CQZA 4F4BA 3RKOF 3POVA 2J45A 3JCUQ 5BUOA 3EFOA 2CDQA 2LSEA 4PFOA 3HJCA 1O87A 2L81A 3VYWA 1VMAA 5T3WA 5DQTA 2J7PA 3K1IC 1QZXA 1FFHA 1D0XA 4FWVA 3KMIA 4G7OF 2EIMC 4G7ZF 2R7XA 2W4BA 3LNRA 4CSAC 2B0JA 2G3KA 3DXJF 3ABKC 4LLEA 2DYRC 3PMRA 4QI0A 3OA1A 4OIQF 4KC9A 4HE8D 5D92A 2YHSA 3SYNA 3KL4A 3DJNB 2W9YA 3WG7C 1ZU4A 3Q6MA 4GEHA 3JYHA 3X2QC 2Q3TA 1MMAA 3K66A 4I3MA 4E7ZA 2E87A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I4U A; 
#chains in the Genus database with same CATH topology
 2KYH A;  1YVI A;  5HV9 A;  2ZXW C;  2ZXR A;  1FAP B;  4X0R A;  2DYS C;  1Y4C A;  4OIR F;  3SEO A;  4KNV A;  2MWQ A;  5A6J A;  3K33 A;  1NG1 A;  3GOR A;  3DD7 A;  2P6V A;  4JZA A;  5IY5 C;  4H54 A;  4YWQ A;  3NDB B;  2CGE A;  2HJ3 A;  2W45 A;  4IGG A;  2XLO A;  3RYL A;  4XLP F;  3UGP A;  5T3T A;  3PHF 2;  4XPW A;  3JRM O;  1G4W R;  2EIN C;  2O9X A;  2XM4 A;  2HUJ A;  2J0W A;  2LFF A;  4FES A;  2JD3 A;  4GQH A;  2X0C A;  3RIP A;  3NG1 A;  1OKK D;  4I1M A;  3SNH A;  4BEM J;  3NKE A;  2G3V A;  1NU9 C;  3EHN A;  3KKB A;  3FOO A;  4PJJ A;  5E3C A;  1M57 C;  4K1O A;  5JS5 A;  2HSB A;  1MMG A;  1APC A;  2WZG A;  1R5I D;  2IYL D;  2RSE B;  4QDL A;  5CI9 A;  1XZP A;  3Q7L A;  4R32 A;  3BRJ A;  2Q7R A;  3L8J A;  4D4N A;  2YWA A;  4MVU A;  3ASO C;  3LJB A;  1RMV A;  1M56 C;  4P9T A;  1OCZ C;  3ZDL A;  3AG3 C;  3H2U A;  5L0C A;  4YT2 A;  2XXA B;  2LK4 A;  3CAX A;  3ZC4 A;  2AU5 A;  1VK5 A;  3ITF A;  2VC9 A;  2HJM A;  1D0Z A;  2XL4 A;  2QUP A;  3RVZ A;  2YLG A;  4BG0 A;  4CJG A;  4DRI B;  2XXA A;  2KW3 C;  4DRH B;  2W4M A;  3HNJ A;  3EGX A;  1JR8 A;  3DM9 B;  3FXH A;  3U8P A;  5BQH A;  4NTB A;  3DWW A;  4G0H A;  3U2M A;  1H6G A;  5COG A;  2VCA A;  2J9W A;  5JSL A;  3K6B A;  2GDC A;  2IXP A;  1PV3 A;  2R7U A;  1EI7 A;  4XPX A;  4BJ1 A;  1QKR A;  4XEF A;  3T6B A;  2Y69 C;  1JRA A;  3UMI A;  5TJ5 E;  5A6B A;  2R7T A;  2YLD A;  2IXN A;  3TOL A;  4BJ6 A;  1VB5 A;  3QTH A;  4MVZ A;  5L0G A;  1Z5Z A;  1M2V B;  1RJ9 B;  3H2V A;  1AVO B;  1V54 C;  3HNI A;  4DXW A;  2LQG A;  1Q0F A;  5DS6 A;  2LCH A;  1T6I A;  3RW0 A;  1L3P A;  3UR3 C;  1K40 A;  4O79 A;  4YL0 A;  3AGU A;  3LLK A;  1G5Z A;  4E0I A;  2WVN A;  4JJG A;  4PR9 A;  1E83 A;  1EA8 A;  3EGD B;  5BQI A;  3QVY A;  2B0H A;  1OW7 A;  1ZZP A;  4JUR I;  1XZQ A;  1L7C A;  4MVR A;  2HMZ A;  2PFD A;  3NRH A;  4XWJ A;  2OOC A;  4DVY P;  2XLH A;  1Z6A A;  4O6Y A;  2D4U A;  1KNY A;  2OG2 A;  2PP4 A;  2ZD9 A;  3JT1 A;  3U0C A;  4KI2 A;  2R05 A;  4ULW A;  2Y39 A;  3S27 A;  1T5O A;  3LUT B;  2HKV A;  4J7T A;  4XPY A;  1LS1 A;  2KJG A;  4ULV A;  2LP4 A;  2H7B A;  2HSQ A;  2XS8 A;  4U9D A;  5EHH A;  1Q0K A;  2CNW D;  2OEV A;  4IAO A;  3HTK C;  3TD7 A;  5L0D A;  2XLV A;  1Z63 A;  3AGT A;  4O7G A;  4NTA A;  1VLS A;  1U0B B;  3GOD A;  1ZHY A;  4XEV A;  2H7V C;  4FX5 A;  2R25 A;  2QTV A;  5L0I A;  3JRT A;  5T1D B;  3F46 A;  1HMO A;  2J46 A;  2AP3 A;  3M4B A;  1FMW A;  3GAN A;  2HV7 A;  3M15 A;  3TJ5 A;  2PBE A;  2IXO A;  2ETS A;  3RQG A;  1SYQ A;  4BJ6 C;  3X1O A;  4DJ9 A;  4U5D E;  4EIY A;  2R7W A;  2EPL X;  5KYW B;  3RH3 A;  3A11 A;  4JCH A;  4NC3 A;  3BEH A;  2NUT A;  1K04 A;  1PCX A;  3C18 A;  4XEK A;  2J9B A;  1OCR C;  2H8A A;  1F1M A;  1QLE C;  2ZXO A;  3CZ6 A;  4Z9J A;  3SP1 A;  4XQ1 A;  3U3F A;  3ZWI A;  1ZW2 A;  3EG9 B;  3ZG1 A;  1QVX A;  2R7O A;  2PX0 A;  3J06 A;  1JAF A;  4JRZ A;  3WOD F;  1BZ4 A;  4OIO F;  2BL2 A;  2YL7 A;  4PAC A;  4YT8 A;  3IPM O;  1CPR A;  4JEA A;  1NFO A;  4G78 A;  3EG9 A;  4DVZ A;  4MND A;  3MYI A;  4AE4 B;  5E3A A;  2IXM A;  4RBN A;  3GEI A;  5B3I A;  1Z3I X;  2EIJ C;  3DKA A;  3TQO A;  5KYN A;  1LVK A;  2GAQ A;  2J9V A;  4ONS A;  4EHP A;  4OIP F;  2R7S A;  2WZF A;  3QW1 A;  2Q9B A;  5BQG A;  4HEA J;  1H9G A;  1NSG B;  2Y3B A;  4O6N A;  3W2W A;  4CX9 A;  1HMD A;  2NG1 A;  4J30 B;  5KYX A;  1RXQ A;  4CBE A;  1FMV A;  1TR2 A;  1M6T A;  3GWN A;  3HNL A;  3VRC A;  4CDV A;  1YLM A;  2QY9 A;  1E2X A;  4QI2 A;  3A9C A;  5DQZ A;  1ST6 A;  5KYX B;  3GM2 A;  3Q6N A;  5L3Q A;  3JSZ A;  2R7R A;  3EGX B;  2BE5 F;  2I15 A;  2YVK A;  2EPM X;  3ASN C;  3GM1 A;  5DVW A;  3R7C A;  4DRJ B;  2LD6 A;  1ZU5 A;  2P61 A;  2Y3G A;  3C8G A;  2A6H F;  3V5Z A;  4C3B A;  4DBR A;  2WB7 A;  1CPQ A;  2L7A A;  3N0T A;  3C8Z A;  5A69 A;  5HSW A;  3IQ5 A;  4DOZ A;  1T01 A;  1C03 A;  2KGO A;  2VAS A;  3AQB A;  3KPH A;  5JP7 A;  3C7J A;  3DAG A;  1BBH A;  3EH1 A;  1J8Y F;  3F47 A;  3DI5 A;  4MTO A;  4PJL A;  4U5C E;  3L1M A;  3PCV A;  1EQ1 A;  2EPN A;  3MX3 A;  3AJM A;  5E2Q A;  2CW0 F;  3AG1 C;  4ZLC A;  4N6H A;  3K7D A;  3VM6 A;  1OR3 A;  256B A;  2YZS A;  1YA7 O;  3SXM A;  3W2V A;  2C03 A;  3DZA A;  1D1C A;  1TFO B;  2I8B A;  5KYW A;  5FZT A;  1RKC A;  4U5F E;  4CIH A;  1EKY A;  1JPN A;  2NSF A;  4Z9H A;  3LAY A;  1W2W A;  3ABM C;  3JTL O;  2OEX A;  4N4W A;  3FVY A;  1QQ3 A;  4U5H A;  3WAQ A;  4AL1 A;  5CIV A;  3KYJ A;  2XRH A;  4MVS A;  4DBQ A;  3DM5 A;  5COM A;  5AC5 A;  3ABL C;  2P0N A;  4RDA A;  4U5E E;  4WJ0 A;  5JVE A;  4JCZ A;  1ZVZ A;  1TQG A;  2Q4F A;  2KC3 A;  3IQ6 A;  3T4R A;  4BJT A;  5FCL A;  3B0U X;  1LE2 A;  2NUP B;  3JZ0 A;  3MBG A;  2PX3 A;  3TOM A;  1MMD A;  1KTM A;  4U5G A;  3S9O A;  3NYJ A;  4U5B E;  2YEV A;  5B1B C;  4P9F A;  3IQC A;  4E17 A;  3U9J A;  3ZTM A;  1ORY A;  2GA0 A;  3B29 A;  4XLN F;  2QNL A;  1JOG A;  1JPJ A;  3U9M A;  4E0H A;  1Z23 A;  1MQV A;  2WVO A;  4JE9 A;  4L6R A;  5F28 E;  1A0B A;  3S0X A;  1HE9 A;  1PD1 A;  3ATP A;  1VYK A;  3AG2 C;  5GPG B;  4OIN F;  2FGY A;  1BDJ B;  3M4C A;  4NY3 A;  1S05 A;  4C3E A;  4J32 B;  4IWB A;  4E18 A;  3M79 A;  3NKD A;  1OCO C;  2YKZ A;  3FHD A;  3EH2 A;  4MTG A;  1IZM A;  1RKE B;  1SF8 A;  2EIL C;  3TK0 A;  1OKK A;  3HKK A;  2M4E A;  3CSK A;  4JTD B;  4EUK B;  5A6K A;  3AQC A;  1NLX A;  3W8H A;  4LER A;  4CJO A;  1O5H A;  4NQF A;  1GQA A;  4YL1 A;  5KYU B;  4YT4 A;  1XWJ A;  4MQ9 F;  1BR1 A;  4PJM A;  5EK0 A;  1DOW A;  2Q9A A;  2A0B A;  1OR2 A;  3AG4 C;  2CCY A;  5DLJ A;  1OXB A;  4AE4 A;  1DOV A;  2JPU A;  2L6G A;  3G4X A;  4EBK A;  4KBL A;  3ZSU A;  3E70 C;  5KYU A;  2IOQ A;  1VOM A;  4YK5 A;  5DS4 A;  4HFF B;  4J7Y A;  4ZLD A;  1VLT A;  4JC7 A;  2YL3 A;  1NZE A;  3LES A;  5EGY A;  3RF3 A;  4BJ5 C;  2GFH A;  2WVQ A;  3M1C B;  1JMW A;  2OJQ A;  1CGM E;  1I4Y A;  1TFK B;  1LKX A;  2P7V A;  4GYT A;  2CYD A;  4MVQ A;  3H65 A;  3FOP A;  1NBB A;  3MFN A;  3I5P A;  1YZA A;  5L3V A;  3FDQ A;  2J9U A;  1M2V A;  1RJ9 A;  3UGO A;  1WAT A;  2ZPA A;  3HNK A;  2J0X A;  1T6Q A;  2A1D D;  3KH2 A;  3T9O A;  3LS0 A;  1J8M F;  4CSA A;  2AWY A;  2J7P D;  3RQE A;  2Q00 A;  4AL0 A;  2Q9C A;  3ZVR A;  1O3U A;  4N06 A;  1E86 A;  1V55 C;  2HS5 A;  1U6H A;  3NYL A;  3NYM A;  3O6X A;  3SXZ A;  3CEX A;  2OJE D;  2A6E F;  1WOL A;  2H7O A;  4AK9 A;  2DGJ A;  3K1H A;  5JT4 A;  1C17 M;  1LI7 A;  1YYJ A;  3S28 A;  4K7B A;  3UNG C;  4CS8 C;  3EHM A;  2ZXP A;  1ZYR F;  1Q0D A;  3EZI A;  3UMH A;  4CDA A;  2KQ9 A;  3TUL A;  4G7H F;  1SR2 A;  1VYI A;  1Q0M A;  3VF0 A;  4CS9 A;  3E9V A;  1GGQ A;  2VCB A;  1FR0 A;  2MHR A;  2YRF A;  3EPV A;  1LIH A;  2A68 F;  3LEO A;  5L0H A;  3OWT A;  2KK1 A;  4YJW A;  2V26 A;  3B0P A;  4PJN A;  4A2N B;  3V5Y A;  1RKE A;  1T6U A;  2R02 A;  3DE8 A;  5F5F A;  1N1C A;  2QLA A;  4E7S A;  1IW7 F;  2VCC A;  1BR2 A;  1OW8 A;  3ECS A;  3U3B A;  3FAJ A;  1Y6D A;  2OU6 A;  3C62 A;  3DJU B;  3K1I A;  4JJF A;  1LS4 A;  2NUP A;  5COF A;  1SMY F;  3EGD A;  4MTF A;  3N2Z B;  3DAF A;  4U9E A;  3IEE A;  4LDK A;  4CS9 C;  4AX2 A;  2C04 A;  4P6I C;  1WGW A;  3RQF A;  4WAB A;  4BPM A;  2X51 A;  3RFY A;  4BEJ A;  4BJ5 A;  2VB6 A;  1K05 A;  4YN0 B;  2D5R B;  3O39 A;  1HY5 A;  4YL3 A;  1YA9 A;  3N24 A;  4YT5 A;  2JX0 A;  4ER9 A;  1HW1 A;  3SZR A;  4C3D A;  2R7Q A;  1A41 A;  4W8P A;  4Q5S F;  2YL0 A;  2XLD A;  3T6J A;  2L9J A;  5A6A A;  2G62 A;  4OD5 A;  3S90 A;  4I1O B;  4OD4 A;  5B1A C;  1B68 A;  4WGY A;  1D1B A;  1LPE A;  1UG7 A;  3QVZ A;  1HW2 A;  3EJN A;  1YAU O;  1BR4 A;  4K0D A;  4Q7C A;  4RD9 A;  1ZHZ A;  1YDI A;  3R2P A;  1V4A A;  4PK4 A;  2XLE A;  2DI3 A;  3DE9 A;  4IRU A;  2OQM A;  4CDY A;  1QPU A;  4KNW A;  1S7Z A;  1H7I A;  1G8X A;  3AOU A;  3L0I A;  3QMK A;  2HV6 A;  1I5N A;  2EPO A;  2QE9 A;  3B71 A;  1MND A;  3ZIB A;  2FAP B;  4A4A A;  4FAP B;  2FFH A;  3OEO A;  4Q4Z F;  1U89 A;  3O10 A;  1TWH A;  2MYS A;  2R7V A;  1YZC A;  1PD0 A;  4IAQ A;  1R4T A;  1ZHX A;  3O55 A;  1ORS C;  1ZHW A;  5JLI A;  3U5S A;  5A6B D;  4LDQ A;  4CS7 A;  5CI8 A;  2Y3D A;  1FFT C;  3C8G B;  3RVY A;  3B0V C;  1WTY A;  3MLG A;  1H9T A;  2XLM A;  3G50 A;  5D91 A;  2WL8 A;  2L6F A;  4XTK A;  2XSE A;  5K0I A;  4WGZ A;  1CGN A;  4H4K C;  3I5Q A;  4C7O A;  3B9Q A;  3GM3 A;  1HE1 A;  3TJ6 A;  3ZTZ A;  4NCQ A;  2V3C C;  2PF4 E;  2XL8 A;  3NMJ A;  1KU2 A;  3L34 A;  3IQT A;  3QZC A;  5E33 A;  1UFB A;  1Z7Q c;  3ZQY A;  1ZHT A;  4EWC A;  1FNT c;  4PFP A;  1WAS A;  1TWA A;  3EFO B;  1G4U S;  5JUA A;  1OCC C;  3U8V A;  4C7O B;  3S29 A;  2ASR A;  4M63 A;  1MMN A;  2WZL A;  2P1A A;  4LAC B;  5AGF A;  1NFN A;  4JVS A;  3UMK A;  3VAY A;  1AEP A;  3V7O A;  1TWC A;  2HMQ A;  3FAP B;  1OQC A;  4JTC B;  2UUH A;  4IJJ A;  1TKN A;  1YJG A;  3GEH A;  2BC5 A;  1RCP A;  1LI5 A;  3LS1 A;  4LLC A;  1NU7 D;  2HZ8 A;  1E84 A;  4JEB A;  2EPK X;  2ICW G;  3S84 A;  2AWC A;  1M2O A;  2VH3 A;  1FTS A;  3EQL F;  4NTF A;  4O6M A;  4EBB A;  1YAR O;  1A7E A;  2KNH A;  1SZI A;  5F5H A;  2EIK C;  5B3S C;  3EZH A;  3LEV A;  2KSF A;  1LM3 B;  2CNW A;  1D1A A;  3GEE A;  2XL6 A;  5L0J A;  1TWG A;  3DMD A;  2NUT B;  5L0F A;  1A7D A;  2TMV P;  4B6I A;  1GM5 A;  2M64 A;  2IM8 A;  4EBJ A;  3T6G B;  1QSP A;  1LE4 A;  1AUE A;  4IB4 A;  3W8I A;  4JW1 A;  1MNE A;  1CGO A;  2Z15 A;  1E85 A;  5JRA A;  4HFK B;  3IHU A;  2R9R B;  1ZW3 A;  3JYY A;  4LDR A;  5AC4 A;  3PDM P;  1ORJ A;  2PNO A;  3HLZ A;  3LLI A;  3LNM B;  3SXY A;  5KYY B;  3JSE O;  2Y3H A;  5DS5 A;  2A0U A;  2A69 F;  2LIG A;  1C02 A;  2OCC C;  3L8I A;  1OXK A;  1D0Y A;  3MYF A;  3US6 A;  3G4Z A;  2IBF A;  4W8K A;  5KYY A;  4I44 A;  4MS2 A;  4CIP A;  4CS8 A;  4Z9I A;  2NPU A;  3I4U A;  3Q7G A;  2NSG A;  3CQZ A;  1A7V A;  4N6C A;  2OKU A;  4F4B A;  3SXK A;  3RKO F;  2XM0 A;  2UUI A;  3POV A;  1GS9 A;  2J45 A;  3JCU Q;  5BUO A;  1WWP A;  3C63 A;  3EFO A;  2CDQ A;  1V74 B;  2LSE A;  2DB4 A;  4IAR A;  2YL1 A;  2YLI A;  4PFO A;  1WN0 A;  3HJC A;  1O87 A;  2L81 A;  3VYW A;  1VMA A;  5T3W A;  3FMS A;  5DQT A;  3U2L A;  2XLW A;  2XS1 A;  2J7P A;  3C8G D;  3K1I C;  1QZX A;  1FFH A;  4MW8 A;  1D0X A;  4FWV A;  2L6H A;  3KMI A;  3NMI A;  4G7O F;  2EIM C;  3QW0 A;  4I3M A;  2W4B A;  3LNR A;  1Q0G A;  4G7Z F;  4CSA C;  2R7X A;  3ZQV A;  2B0J A;  2HFI A;  1YYX A;  2GWW A;  3W4Y A;  1T9K A;  3WHN A;  4UDV A;  2G3K A;  3DXJ F;  3ABK C;  4JKV A;  4LLE A;  2R03 A;  2DYR C;  3PMR A;  4QI0 A;  4MVO A;  1OW6 A;  4MVM A;  3OA1 A;  2AVK A;  2J8W A;  4D4X A;  4OIQ F;  2RD9 A;  4KC9 A;  4MW3 A;  2LFD A;  4HE8 D;  5D92 A;  2YHS A;  3SYN A;  2YQY A;  3KL4 A;  3DJN B;  4JTA B;  4EKW A;  2W9Y A;  3GWL A;  3KYI A;  3WG7 C;  1VTM P;  1ZU4 A;  3Q6M A;  4GEH A;  3JYH A;  4JIO A;  3X2Q C;  2F22 A;  2Q3T A;  4ANJ A;  3NMK A;  1MMA A;  3K66 A;  1I4Z A;  4E7Z A;  3V5X A;  2E87 A; 
#chains in the Genus database with same CATH homology
 2ZXW C;  2ZXR A;  4X0R A;  2DYS C;  4OIR F;  3SEO A;  4KNV A;  2MWQ A;  3K33 A;  1NG1 A;  3DD7 A;  2P6V A;  4JZA A;  5IY5 C;  3NDB B;  4YWQ A;  2CGE A;  2W45 A;  4XLP F;  3RYL A;  3UGP A;  5T3T A;  3PHF 2;  2EIN C;  2O9X A;  4FES A;  3RIP A;  2J0W A;  3SNH A;  2JD3 A;  3NG1 A;  1OKK D;  4I1M A;  3NKE A;  2G3V A;  1NU9 C;  3EHN A;  3KKB A;  4PJJ A;  5E3C A;  1M57 C;  1MMG A;  2WZG A;  5T1D B;  2IYL D;  5CI9 A;  4QDL A;  3Q7L A;  3ASO C;  3LJB A;  1M56 C;  1OCZ C;  3AG3 C;  4YT2 A;  2XXA B;  3ZC4 A;  1VK5 A;  3ITF A;  2XL4 A;  1D0Z A;  4BG0 A;  2XXA A;  2KW3 C;  2W4M A;  3EGX A;  3DM9 B;  4G0H A;  2J9W A;  3K6B A;  2IXP A;  2R7U A;  4BJ1 A;  3T6B A;  2Y69 C;  3UMI A;  2R7T A;  2IXN A;  4BJ6 A;  1Z5Z A;  1M2V B;  1RJ9 B;  1V54 C;  5DS6 A;  3UR3 C;  4O79 A;  3LLK A;  2WVN A;  4JJG A;  3EGD B;  5DS5 A;  4JUR I;  4DVY P;  2PFD A;  3NRH A;  4XWJ A;  1Z6A A;  4O6Y A;  2OG2 A;  2PP4 A;  3JT1 A;  4KI2 A;  4ULW A;  2Y39 A;  3S27 A;  1LS1 A;  2KJG A;  2H7B A;  5EHH A;  2CNW D;  4IAO A;  3HTK C;  3TD7 A;  1Z63 A;  4O7G A;  3GOD A;  1ZHY A;  2H7V C;  4FX5 A;  2QTV A;  3JRT A;  3F46 A;  2J46 A;  1FMW A;  3GAN A;  2HV7 A;  2IXO A;  4BJ6 C;  2R7W A;  3X1O A;  4U5D E;  5KYW B;  3RH3 A;  4JCH A;  2NUT A;  1PCX A;  3SP1 A;  1OCR C;  2ZXO A;  3CZ6 A;  1QLE C;  2R7R A;  3EG9 B;  3ZG1 A;  2R7O A;  2PX0 A;  3WOD F;  4OIO F;  4YT8 A;  3EG9 A;  4DVZ A;  4MND A;  4AE4 B;  5E3A A;  2IXM A;  4RBN A;  1Z3I X;  2EIJ C;  5KYN A;  1LVK A;  2J9V A;  4OIP F;  2R7S A;  2WZF A;  2Q9B A;  4HEA J;  2Y3B A;  3W2W A;  4O6N A;  2NG1 A;  4J30 B;  5KYX A;  4CBE A;  1FMV A;  1TR2 A;  2QY9 A;  4QI2 A;  5DQZ A;  1ST6 A;  5KYX B;  3Q6N A;  5L3Q A;  3JSZ A;  3EGX B;  2BE5 F;  3ASN C;  5DVW A;  1ZU5 A;  2Y3G A;  2A6H F;  4C3B A;  4DBR A;  2WB7 A;  3N0T A;  5HSW A;  4DOZ A;  2VAS A;  2KGO A;  3AQB A;  3B0U X;  4ANJ A;  3EH1 A;  3DAG A;  3F47 A;  1J8Y F;  4PJL A;  4U5C E;  5E2Q A;  3MX3 A;  2CW0 F;  3AG1 C;  4ZLC A;  3K7D A;  2YZS A;  3W2V A;  2C03 A;  3DZA A;  1D1C A;  2I8B A;  5KYW A;  4U5F E;  4CIH A;  1JPN A;  3LAY A;  1W2W A;  3ABM C;  3FVY A;  4U5H A;  2XRH A;  4DBQ A;  3DM5 A;  3ABL C;  4RDA A;  4U5E E;  4WJ0 A;  3T4R A;  4BJT A;  5FCL A;  2NUP B;  2PX3 A;  1MMD A;  4U5G A;  3NYJ A;  4U5B E;  2YEV A;  5B1B C;  4XLN F;  1JPJ A;  1Z23 A;  2WVO A;  3S0X A;  1PD1 A;  1VYK A;  3AG2 C;  4OIN F;  2FGY A;  4NY3 A;  4C3E A;  4J32 B;  4IWB A;  3NKD A;  1OCO C;  3FHD A;  3EH2 A;  1IZM A;  1SF8 A;  2EIL C;  1OKK A;  2M4E A;  3CSK A;  3AQC A;  3W8H A;  4LER A;  1O5H A;  5KYU B;  4YT4 A;  4MQ9 F;  1BR1 A;  4PJM A;  2Q9A A;  3AG4 C;  5DLJ A;  4AE4 A;  4KBL A;  3ZSU A;  3E70 C;  5KYU A;  2IOQ A;  1VOM A;  5DS4 A;  4HFF B;  4ZLD A;  1NZE A;  3LES A;  4BJ5 C;  2GFH A;  2WVQ A;  3M1C B;  1LKX A;  2P7V A;  4GYT A;  3H65 A;  3I5P A;  5L3V A;  3FDQ A;  2J9U A;  1M2V A;  1RJ9 A;  3UGO A;  2ZPA A;  2J0X A;  2A1D D;  3KH2 A;  3LS0 A;  1J8M F;  4CSA A;  2J7P D;  2Q9C A;  3ZVR A;  4N06 A;  1V55 C;  3NYL A;  3NYM A;  3O6X A;  2A6E F;  2H7O A;  4AK9 A;  2DGJ A;  3K1H A;  3S28 A;  3UNG C;  4K7B A;  4CS8 C;  3EHM A;  2ZXP A;  1ZYR F;  3EZI A;  3UMH A;  2KQ9 A;  4G7H F;  1VYI A;  4CS9 A;  3E9V A;  3EPV A;  2A68 F;  3OWT A;  4YJW A;  2V26 A;  3B0P A;  4PJN A;  4A2N B;  5F5F A;  1N1C A;  4E7S A;  1IW7 F;  1BR2 A;  3ECS A;  3FAJ A;  3DJU B;  4JJF A;  2NUP A;  1SMY F;  3EGD A;  3N2Z B;  3DAF A;  3IEE A;  4CS9 C;  4AX2 A;  2C04 A;  4P6I C;  1WGW A;  2X51 A;  3RFY A;  4BEJ A;  4BJ5 A;  2VB6 A;  4YN0 B;  2D5R B;  3O39 A;  3N24 A;  4YT5 A;  3SZR A;  4C3D A;  2R7Q A;  4Q5S F;  3T6J A;  2L9J A;  2G62 A;  4OD5 A;  4I1O B;  4OD4 A;  5B1A C;  1D1B A;  3EJN A;  1BR4 A;  4K0D A;  4Q7C A;  4RD9 A;  1ZHZ A;  4PK4 A;  4IRU A;  4KNW A;  1S7Z A;  3L0I A;  1G8X A;  3QMK A;  5EGY A;  2HV6 A;  3ZIB A;  1MND A;  2FFH A;  3OEO A;  4Q4Z F;  1TWH A;  2MYS A;  2R7V A;  1PD0 A;  1ZHX A;  1ZHW A;  4CS7 A;  5CI8 A;  2Y3D A;  1FFT C;  3B0V C;  3MLG A;  5D91 A;  2WL8 A;  4XTK A;  2XSE A;  4H4K C;  3I5Q A;  4C7O A;  3B9Q A;  2V3C C;  2PF4 E;  5E33 A;  1KU2 A;  3L34 A;  3QZC A;  4EWC A;  1ZHT A;  4PFP A;  1TWA A;  3EFO B;  4C7O B;  1OCC C;  3S29 A;  4M63 A;  1MMN A;  2WZL A;  4LAC B;  4JVS A;  3UMK A;  3VAY A;  3V7O A;  1TWC A;  4IJJ A;  1TKN A;  3LS1 A;  4LLC A;  1NU7 D;  1M2O A;  2VH3 A;  1FTS A;  3EQL F;  4O6M A;  4EBB A;  2KNH A;  1SZI A;  5F5H A;  2EIK C;  5B3S C;  3EZH A;  3LEV A;  2CNW A;  1D1A A;  1TWG A;  3DMD A;  2NUT B;  4B6I A;  3W8I A;  4JW1 A;  1MNE A;  2Z15 A;  4HFK B;  3HLZ A;  3LLI A;  5KYY B;  2Y3H A;  2A69 F;  2OCC C;  1D0Y A;  4W8K A;  5KYY A;  4I44 A;  4CS8 A;  3I4U A;  3Q7G A;  3CQZ A;  4F4B A;  3RKO F;  3POV A;  2J45 A;  3JCU Q;  5BUO A;  3EFO A;  2CDQ A;  2LSE A;  4PFO A;  3HJC A;  1O87 A;  2L81 A;  3VYW A;  1VMA A;  5T3W A;  5DQT A;  2J7P A;  3K1I C;  1QZX A;  1FFH A;  1D0X A;  4FWV A;  3KMI A;  4G7O F;  2EIM C;  4G7Z F;  2R7X A;  2W4B A;  3LNR A;  4CSA C;  2B0J A;  2G3K A;  3DXJ F;  3ABK C;  4LLE A;  2DYR C;  3PMR A;  4QI0 A;  3OA1 A;  4OIQ F;  4KC9 A;  4HE8 D;  5D92 A;  2YHS A;  3SYN A;  3KL4 A;  3DJN B;  2W9Y A;  3WG7 C;  1ZU4 A;  3Q6M A;  4GEH A;  3JYH A;  3X2Q C;  2Q3T A;  1MMA A;  3K66 A;  4I3M A;  4E7Z A;  2E87 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...