3I4UA

Crystal structure analysis of a helicase associated domain
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
247
structure length
241
Chain Sequence
GSPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQTEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKSTVRVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQPEWVVYHELVLTTKEYMREVTTIDPRWLVEFAPAFFKVLDHGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords ATP-dependent RNA helicase DHX8
publication title Structural analysis of the C-terminal domain of the spliceosomal helicase Prp22
pubmed doi rcsb
source organism Homo sapiens
total genus 79
structure length 241
sequence length 247
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2009-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04408 HA2 Helicase associated domain (HA2)
A PF07717 OB_NTP_bind Oligonucleotide/oligosaccharide-binding (OB)-fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1080 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3i4uA01
3I4UA
chains in the Genus database with same CATH superfamily
2IYLD 5BQGA 2E87A 2HSBA 2HFIA 3CEXA 3L8IA 3LUTB 1CGNA 4O6YA 2ICWG 2PX0A 1ORYA 4HEAJ 1GQAA 2Y39A 4L6RA 3V5XA 5JP7A 3FAJA 4C7OB 4CS7A 2HMQA 4XPXA 2OEXA 2B0JA 1AVOB 1QQ3A 4E0HA 2C03A 3JRMO 3LS0A 3ZG1A 1T01A 1N1CA 3PMRA 1TWCA 1ZYRF 2CNWD 2LQGA 2XLHA 4MQ9F 4JCZA 4W8KA 4U9EA 3G50A 2XLMA 3KPHA 4CDAA 3IHUA 2Q9AA 1Z63A 2OJQA 3LNMB 4G0HA 5AGFA 2XM0A 3MYFA 2H7VC 5K0IA 3QW0A 4I3MA 1NBBA 3QZCA 1RKEA 1MNDA 3V5YA 4YT4A 1YZCA 2AVKA 3AG2C 1S05A 3K7DA 3G4ZA 4HFFB 3VRCA 4D4NA 3AGUA 1IW7F 1TFKB 1TKNA 2J45A 2YL0A 2RD9A 3B29A 2YL3A 2QLAA 1W2WA 2AWYA 1V55C 3ABMC 3WG7C 4MW3A 4EKWA 2Y3GA 3CQZA 1Z7Qc 3AG4C 1Q0KA 2QY9A 2Y3DA 2AWCA 2YLDA 3I5QA 3KYJA 1O87A 5CI9A 2Q00A 3Q7GA 1M2OA 3RIPA 3L8JA 2V3CC 2R7XA 4P9FA 4AL1A 4A4AA 3W4YA 1F1MA 2A6EF 4O6NA 1HY5A 1EQ1A 5JS5A 3FAPB 3GM3A 4EUKB 1SZIA 2YRFA 1I4ZA 3DE9A 3EFOA 3EFOB 1FNTc 4B6IA 5E3AA 4Q4ZF 1NFNA 1QSPA 4ONSA 2NUTA 3SXMA 2P61A 2IXPA 2NUTB 5KYWA 1UG7A 1BR1A 3US6A 1H9GA 5KYXA 1JPNA 4J30B 3S90A 3A11A 5DS6A 4PFOA 1LI7A 1VMAA 1WATA 3C63A 3QVZA 4XTKA 5FCLA 3AG1C 4JIOA 4MNDA 4I1OB 2XSEA 1WWPA 3GWLA 2LFDA 1Z3IX 3L1MA 3M15A 3ITFA 2LP4A 2YQYA 3G4XA 4WGYA 2YKZA 5COGA 3LS1A 1WN0A 3OA1A 1CPQA 1VOMA 2L81A 4JVSA 2XS8A 5KYNA 1OCRC 2IOQA 5BUOA 1JRAA 2R7QA 3M4CA 3K1HA 2G3VA 5DS4A 1TQGA 1H6GA 1OKKD 1PV3A 3AGTA 3NDBB 2OJED 1YJGA 3AOUA 1VK5A 2WVNA 1DOWA 3GM1A 3T9OA 1Z5ZA 2XLEA 3DJUB 3W8IA 3OEOA 3U0CA 2WZLA 2WVQA 3MX3A 1TR2A 3I5PA 4XLPF 2B0HA 3GEIA 3V5ZA 3JRTA 2A69F 3UNGC 2R7TA 2UUHA 4C3EA 3U2MA 1T6UA 3E70C 3IQ5A 2IBFA 1VTMP 2XXAA 2KK1A 3KYIA 2IXNA 3C62A 2VCAA 4IAQA 1OCCC 2F22A 3M4BA 4MTFA 1JAFA 4JC7A 1VLTA 4JTDB 2H7BA 4CIHA 4YT2A 1SR2A 2LCHA 5GPGB 2JX0A 2ZXPA 3IQTA 2QUPA 4BEMJ 3J06A 2DYRC 5KYYB 3H65A 1RXQA 1ORJA 1IZMA 2MYSA 1VB5A 1HMOA 2ZXRA 4U9DA 3TK0A 2WB7A 4KC9A 2GA0A 3TULA 3ZQYA 2HV7A 4ZLCA 1C17M 3C8ZA 3S27A 4DVZA 4CJOA 1JOGA 2KGOA 1FTSA 5DS5A 2L6HA 3B0UX 1EA8A 1S7ZA 1ZVZA 2EIJC 4YL0A 2WZGA 5T3TA 1FR0A 3H2UA 3NKEA 5L0FA 2R7SA 2KSFA 4MW8A 3C18A 5TJ5E 4WABA 2J8WA 2J7PD 1ZHXA 1LI5A 1OR3A 1LIHA 3DD7A 4BG0A 4PR9A 3QVYA 3DWWA 3HNLA 1Q0DA 3ASOC 2LK4A 1FMVA 4XWJA 1O5HA 5B1BC 1GM5A 3O10A 4U5GA 4YJWA 4G7HF 3DE8A 3NMIA 4MVRA 4DXWA 1OR2A 3S28A 2HKVA 3U5SA 1I4YA 1J8YF 5HV9A 3TJ5A 2HV6A 3SXYA 2NSGA 5JT4A 3VM6A 4CJGA 3GEEA 4C3DA 3JYHA 1XZPA 3VYWA 2WVOA 3S0XA 3AJMA 3EG9A 3NRHA 4LDRA 2TMVP 2XS1A 4JE9A 3ZVRA 1QLEC 5B3IA 1YYJA 3SXZA 5HSWA 3GANA 1G8XA 2L9JA 1WTYA 3RF3A 1MMNA 3UMKA 2XL6A 3LEOA 4FAPB 3ECSA 3EZHA 4NQFA 4G7OF 3HNJA 4JEBA 4OIPF 1E85A 1SF8A 1RJ9A 1XZQA 3B0VC 1KU2A 2HJ3A 1HW1A 1T9KA 1ZZPA 4OD5A 4RD9A 1T5OA 3TQOA 2IXMA 3B71A 2UUIA 4HE8D 4LDKA 1RKEB 3UR3C 1FAPB 2XLWA 4DOZA 5L3VA 2R7WA 5EHHA 4KBLA 2BL2A 4U5DE 1A0BA 2IM8A 1AUEA 3LEVA 1M2VA 1Z23A 1ZU4A 1G4US 2GWWA 3GORA 4IWBA 4EHPA 4ULWA 4EWCA 4YWQA 4OIRF 3FDQA 1TWGA 2J9UA 3EH2A 4N6HA 4Z9JA 4WGZA 2VCCA 1LM3B 3DM5A 4R32A 3FOPA 2CCYA 3MLGA 3QW1A 1MNEA 1Y6DA 2X51A 2D4UA 2PNOA 1H7IA 2QNLA 3SP1A 2DI3A 2HUJA 3VAYA 2DYSC 2A68F 3KMIA 4CDYA 2R02A 1Z6AA 1V4AA 1TWAA 3BRJA 3FHDA 1E86A 2ZXOA 2W4BA 2KNHA 4C3BA 4H4KC 1K40A 3W2WA 2ETSA 3RKOF 5L0DA 2YLGA 3IQCA 4N06A 2J46A 3PHF2 5KYWB 1EKYA 5COMA 3U8PA 4ZLDA 3ZQVA 5KYXB 4J7TA 1D0YA 2C04A 2H7OA 2Y3BA 3EZIA 5D91A 3MBGA 3T6GB 1H9TA 2H8AA 3NKDA 1SMYF 2EPOA 3EGXA 4KNVA 3EGXB 2M4EA 2GFHA 5D92A 5E3CA 5DQZA 4N4WA 3RW0A 1TFOB 3DI5A 1R5ID 4E0IA 4W8PA 1GS9A 2HMZA 1ST6A 2HS5A 1OQCA 5KYUA 1B68A 1BBHA 4Q5SF 1FFHA 4NTAA 1SYQA 2HZ8A 2PBEA 2LIGA 4JTAB 4Q7CA 2KW3C 3R7CA 1C02A 4PK4A 4E7ZA 5JSLA 2EINC 1HMDA 3NMKA 4OIQF 4PJNA 4AX2A 4MVSA 3EHNA 1LKXA 2XLOA 1A7EA 3JSZA 3C8GA 4EIYA 4JZAA 4K0DA 4BJ1A 2BC5A 2BE5F 4CDVA 2Y3HA 3WHNA 1YA7O 3K66A 3K33A 3HKKA 2HJMA 3DZAA 1U6HA 1OW6A 3HNIA 1TWHA 2XXAB 5F5FA 3C7JA 3KL4A 4G78A 1EI7A 1OW7A 2A6HF 4JRZA 5T1DB 2NUPA 2NUPB 4MTOA 4PFPA 3CAXA 4AE4A 4I1MA 4JKVA 3DAGA 2OU6A 4H54A 5A6KA 5DLJA 5BQIA 2P7VA 1A7VA 3ZWIA 4XPYA 1ZHWA 4U5HA 1LE2A 1PD0A 3RH3A 2YZSA 4Z9HA 2PX3A 3K1IC 1YDIA 3TD7A 1K04A 1NZEA 2EPKX 4PJLA 2Q9CA 1V54C 2HSQA 2OQMA 4WJ0A 4ER9A 5JLIA 1KNYA 1OCZC 3JZ0A 4J32B 2LD6A 3HLZA 4OINF 3K1IA 1NFOA 1U0BB 4K7BA 3VF0A 4RDAA 1D1AA 1WGWA 2W4MA 4NTFA 3A9CA 4CS9C 1MMDA 4E17A 2VASA 1Q0GA 2I8BA 2CYDA 3ZIBA 1M6TA 1BR2A 3NYJA 1OCOC 4GEHA 1NSGB 5L3QA 1ZHYA 4X0RA 1WASA 4O7GA 4CS9A 1L3PA 4QI0A 2KC3A 1OXBA 4XPWA 3AG3C 3L0IA 3RFYA 3X2QC 2W45A 2YEVA 4CX9A 1ZHTA 2J9BA 4JJFA 3JCUQ 3ABLC 1LVKA 2J9VA 4NTBA 4NY3A 3ASNC 2V26A 2JD3A 2OKUA 2L6GA 3AQCA 3B0PA 5F28E 4XEKA 4D4XA 5A6BA 2R7UA 1APCA 1GGQA 3RQEA 3JTLO 3POVA 4QI2A 2YL1A 3N2ZB 3F47A 4LERA 3DAFA 3PDMP 3QMKA 4MS2A 2KYHA 4JW1A 1A41A 4XEVA 3SNHA 3JSEO 2NPUA 2Z15A 3X1OA 3UGPA 4E18A 2EPMX 5A6AA 3EG9B 3N24A 3BEHA 1G4WR 2KJGA 3EQLF 4BPMA 3T6JA 3NYMA 3JYYA 2DB4A 4JEAA 4XLNF 4MVZA 4FWVA 1E84A 3SEOA 5JRAA 2NSFA 2CNWA 4G7ZF 2EILC 3DMDA 3EGDA 3LESA 3O6XA 3RVZA 3SXKA 5DQTA 4YT8A 4FX5A 2OCCC 3B9QA 1FFTC 1PCXA 4U5FE 4IGGA 2FAPB 3U9JA 3LAYA 5CI8A 1RJ9B 2XLDA 1J8MF 3I4UA 5T3WA 3ZSUA 1V74B 4GYTA 2ZD9A 1BZ4A 3Q7LA 3ZDLA 4MVMA 1ZW2A 5L0JA 4C7OA 2R7VA 2DGJA 3DM9B 3TOMA 1QVXA 3V7OA 4PACA 1WOLA 1M57C 2QTVA 3U2LA 2Q4FA 1M2VB 1VLSA 3DJNB 4LLEA 3S9OA 3M1CB 3ZTZA 5CIVA 3R2PA 5JUAA 4BJ5C 4J7YA 2Y69C 3WAQA 1LS4A 2VC9A 1VYKA 3SZRA 5JVEA 3MFNA 4AK9A 2R05A 4BJ5A 1FMWA 1ZW3A 1E83A 3UGOA 1D1BA 2W9YA 4MVQA 5F5HA 2Q3TA 2NG1A 3IPMO 1R4TA 3DKAA 3IQ6A 3IEEA 4NC3A 3S84A 1JMWA 1QKRA 4MVOA 4O6MA 1G5ZA 3CZ6A 3FOOA 1HE1A 3TOLA 4DBRA 5BQHA 3PCVA 2EPLX 1RKCA 4FESA 2JPUA 4EBKA 1MMGA 2L6FA 5COFA 3E9VA 1KTMA 4MTGA 4EBBA 2R7RA 4ANJA 4JJGA 1T6IA 2XL4A 2XM4A 3O55A 4PJJA 3T6BA 3NYLA 2J0WA 2D5RB 2OEVA 3W8HA 4BEJA 1LS1A 4MVUA 1YLMA 256BA 3HJCA 3GODA 4IAOA 3U9MA 1K05A 5L0IA 1NLXA 1LPEA 4JTCB 2RSEB 3QTHA 1D0XA 5KYUB 2XLVA 1I5NA 4DVYP 2YL7A 3JT1A 4LACB 2PFDA 3S29A 5A69A 4DRJB 5EGYA 3M79A 1OKKA 1T6QA 2P0NA 4JCHA 4JURI 3HTKC 4Z9IA 2J0XA 2GAQA 1ZHZA 2R9RB 2AU5A 3K6BA 5L0HA 5IY5C 1D1CA 3U3BA 1A7DA 1JPJA 2G62A 1OXKA 2GDCA 2PP4A 1DOVA 2YLIA 3C8GB 3H2VA 4PJMA 4YL3A 5AC5A 2XL8A 3O39A 4HFKB 4IRUA 1QZXA 5EK0A 3WODF 4LLCA 4DRHB 4BJTA 1Y4CA 3RQFA 2PF4E 4P6IC 3N0TA 4RBNA 5A6JA 4XEFA 1NG1A 2CGEA 3U3FA 4XQ1A 2VCBA 4N6CA 3LNRA 3LLKA 4KI2A 1E2XA 2VH3A 2J9WA 3TJ6A 3EHMA 1YZAA 2OOCA 4AE4B 5AC4A 1C03A 1LE4A 1MMAA 1L7CA 1ZU5A 1Q0MA 2LFFA 2M64A 2R7OA 3GWNA 4I44A 1HW2A 4LDQA 2I15A 4BJ6C 4O79A 3NG1A 3GM2A 2EIKC 2R03A 3C8GD 3FVYA 3RVYA 4YT5A 2ZXWC 3ATPA 4BJ6A 2G3KA 4P9TA 3F46A 1YYXA 1OW8A 1UFBA 2KQ9A 1O3UA 2WZFA 2AP3A 4OD4A 4QDLA 5B3SC 2ASRA 2FGYA 2Q9BA 2ZPAA 4K1OA 4YK5A 4YN0B 4EBJA 4U5BE 2EPNA 4CS8C 3W2VA 2LSEA 4KNWA 3DXJF 4A2NB 2A1DD 2P1AA 2Q7RA 2MHRA 2A0BA 3Q6MA 3SYNA 4CS8A 3UMHA 5E2QA 2R25A 1M56C 3ZC4A 3ABKC 3L34A 1JR8A 1BDJB 2EIMC 4CIPA 4DRIB 2J7PA 3Q6NA 5KYYA 1HE9A 4IARA 3LJBA 1Q0FA 3FMSA 3LLIA 1QPUA 5DVWA 3RYLA 3CSKA 1CGME 4NCQA 3UMIA 1CPRA 1VYIA 3ZTMA 1AEPA 2CW0F 3HNKA 5E33A 4DBQA 4U5EE 1RMVA 1NU9C 2YVKA 1ORSC 3MYIA 1PD1A 1YA9A 2OG2A 4IB4A 1YARO 5L0GA 1CGOA 4GQHA 2QE9A 4E7SA 1NU7D 5L0CA 4UDVA 4ULVA 3U8VA 3RQGA 3NMJA 2FFHA 2X0CA 1BR4A 2VB6A 2YHSA 4IJJA 1U89A 2L7AA 1D0ZA 5FZTA 4F4BA 4DJ9A 2YWAA 3KKBA 4CSAC 4YL1A 2MWQA 3GEHA 2IXOA 2O9XA 3KH2A 2XRHA 4CBEA 4M63A 4OIOF 2CDQA 2A0UA 4CSAA 2WL8A 1YAUO 1XWJA 3OWTA 3EPVA 5A6BD 1RCPA 3EJNA 4AL0A 3FXHA 3EGDB 1YVIA 5B1AC 3EH1A 2P6VA 1MQVA 4U5CE 3AQBA 3T4RA
chains in the Genus database with same CATH topology
2IYLD 2E87A 4O6YA 2PX0A 4HEAJ 2Y39A 3FAJA 4C7OB 4CS7A 2B0JA 2C03A 3LS0A 3ZG1A 1N1CA 3PMRA 1TWCA 1ZYRF 2CNWD 4MQ9F 4W8KA 2Q9AA 1Z63A 4G0HA 2H7VC 4I3MA 3QZCA 1MNDA 4YT4A 4HFFB 3AG2C 3K7DA 1IW7F 2J45A 1TKNA 3WG7C 1W2WA 3ABMC 1V55C 2Y3GA 3CQZA 3AG4C 2QY9A 2Y3DA 3I5QA 5CI9A 1O87A 3Q7GA 3RIPA 1M2OA 2V3CC 2R7XA 2A6EF 4O6NA 1SZIA 3EFOA 3EFOB 4B6IA 5E3AA 4Q4ZF 5KYWA 2NUTA 2IXPA 2NUTB 1BR1A 5KYXA 1JPNA 4J30B 5DS6A 4PFOA 1VMAA 4XTKA 5FCLA 3AG1C 4MNDA 4I1OB 2XSEA 1Z3IX 3ITFA 3LS1A 3OA1A 1VOMA 2L81A 4JVSA 5KYNA 1OCRC 2IOQA 5BUOA 2R7QA 3K1HA 2G3VA 5DS4A 3NDBB 1OKKD 1VK5A 2WVNA 3W8IA 1Z5ZA 3DJUB 3OEOA 2WZLA 2WVQA 3MX3A 1TR2A 3I5PA 4XLPF 3JRTA 2A69F 3UNGC 2R7TA 4C3EA 3E70C 2XXAA 2IXNA 1OCCC 2H7BA 4CIHA 4YT2A 2ZXPA 2DYRC 5KYYB 3H65A 1IZMA 2MYSA 2ZXRA 2WB7A 4KC9A 2HV7A 4ZLCA 3S27A 4DVZA 3B0UX 2KGOA 1FTSA 5DS5A 1S7ZA 2EIJC 2WZGA 5T3TA 3NKEA 2R7SA 2J7PD 1ZHXA 3DD7A 4BG0A 3ASOC 1FMVA 4XWJA 1O5HA 5B1BC 4U5GA 4YJWA 4G7HF 3S28A 1J8YF 2HV6A 4C3DA 3JYHA 3VYWA 3S0XA 2WVOA 3EG9A 3NRHA 3ZVRA 1QLEC 5HSWA 3GANA 1G8XA 2L9JA 1MMNA 3UMKA 3ECSA 3EZHA 4G7OF 4OIPF 1SF8A 1RJ9A 3B0VC 1KU2A 4RD9A 4OD5A 2IXMA 4HE8D 3UR3C 4DOZA 5L3VA 2R7WA 5EHHA 4KBLA 4U5DE 3LEVA 1M2VA 1Z23A 1ZU4A 4IWBA 4ULWA 4EWCA 4YWQA 4OIRF 3FDQA 1TWGA 2J9UA 3EH2A 3DM5A 3MLGA 1MNEA 2X51A 3SP1A 3VAYA 2DYSC 2A68F 3KMIA 1Z6AA 1TWAA 3FHDA 2ZXOA 2W4BA 2KNHA 4C3BA 4H4KC 3W2WA 3RKOF 4N06A 2J46A 3PHF2 5KYWB 4ZLDA 5KYXB 1D0YA 3EZIA 2C04A 2H7OA 2Y3BA 5D91A 3NKDA 1SMYF 3EGXA 5D92A 4KNVA 3EGXB 2M4EA 2GFHA 5E3CA 5DQZA 1ST6A 5KYUA 4Q5SF 1FFHA 4E7ZA 4Q7CA 2KW3C 4PK4A 2EINC 4OIQF 4PJNA 4AX2A 3EHNA 1LKXA 3JSZA 4JZAA 4K0DA 4BJ1A 2BE5F 2Y3HA 3K66A 3K33A 3DZAA 1TWHA 2XXAB 5F5FA 3KL4A 2A6HF 5T1DB 2NUPA 2NUPB 4PFPA 4AE4A 4I1MA 3DAGA 5DLJA 2P7VA 1ZHWA 4U5HA 1PD0A 3RH3A 3TD7A 2YZSA 2PX3A 3K1IC 1NZEA 4PJLA 2Q9CA 1V54C 4WJ0A 1OCZC 4J32B 3HLZA 4OINF 4K7BA 4RDAA 1D1AA 1WGWA 2W4MA 4CS9C 1MMDA 2VASA 2I8BA 3ZIBA 1BR2A 3NYJA 1OCOC 4GEHA 5L3QA 1ZHYA 4X0RA 4O7GA 4CS9A 4QI0A 3X2QC 3AG3C 3L0IA 3RFYA 2W45A 2YEVA 1ZHTA 4JJFA 3JCUQ 3ABLC 1LVKA 2J9VA 4NY3A 3ASNC 2V26A 2JD3A 2R7VA 3AQCA 3B0PA 2R7UA 3POVA 3N2ZB 3F47A 4LERA 3DAFA 3QMKA 4JW1A 3SNHA 2Z15A 3X1OA 3UGPA 3EG9B 3N24A 2KJGA 3EQLF 3T6JA 3NYMA 4XLNF 4FWVA 3SEOA 2CNWA 4G7ZF 2EILC 3DMDA 3EGDA 3LESA 3O6XA 5DQTA 4YT8A 4FX5A 2OCCC 3B9QA 1FFTC 1PCXA 4U5FE 3LAYA 5CI8A 1RJ9B 1J8MF 3I4UA 5T3WA 3ZSUA 4GYTA 3Q7LA 4C7OA 2DGJA 3DM9B 3V7OA 1M57C 2QTVA 3DJNB 1M2VB 4LLEA 3M1CB 4BJ5C 2Y69C 1VYKA 3SZRA 4AK9A 4BJ5A 1FMWA 3UGOA 1D1BA 2W9YA 5F5HA 2Q3TA 2NG1A 3IEEA 4O6MA 3CZ6A 4DBRA 4FESA 1MMGA 3E9VA 4EBBA 2R7RA 4ANJA 4JJGA 4PJJA 2XL4A 3W8HA 3T6BA 4BEJA 3NYLA 2J0WA 2D5RB 1LS1A 3HJCA 3GODA 4IAOA 1D0XA 5KYUB 4DVYP 3JT1A 3S29A 4LACB 2PFDA 5EGYA 1OKKA 4JURI 4JCHA 3HTKC 2J0XA 1ZHZA 3K6BA 5IY5C 1D1CA 1JPJA 2G62A 2PP4A 4PJMA 3O39A 4HFKB 4IRUA 1QZXA 3WODF 4LLCA 4BJTA 2PF4E 4P6IC 3N0TA 4RBNA 1NG1A 2CGEA 4KI2A 3LNRA 3LLKA 2VH3A 2J9WA 3EHMA 4AE4B 1MMAA 2R7OA 1ZU5A 4QI2A 4I44A 4BJ6C 4O79A 3NG1A 2EIKC 3FVYA 4YT5A 2ZXWC 4BJ6A 2G3KA 3F46A 4OD4A 2KQ9A 2WZFA 5B3SC 4QDLA 2FGYA 2Q9BA 2ZPAA 4YN0B 4U5BE 4CS8C 3W2VA 2LSEA 4KNWA 3DXJF 4A2NB 2A1DD 3Q6MA 4CS8A 3SYNA 3UMHA 5E2QA 1M56C 3ZC4A 3ABKC 3L34A 2EIMC 2J7PA 3Q6NA 5KYYA 3LJBA 3LLIA 3RYLA 5DVWA 3CSKA 3UMIA 1VYIA 5E33A 2CW0F 4DBQA 4U5EE 1NU9C 1PD1A 2OG2A 4E7SA 1NU7D 2FFHA 1BR4A 2VB6A 2YHSA 4IJJA 1D0ZA 4F4BA 3KKBA 4CSAC 2MWQA 2IXOA 2O9XA 3KH2A 2XRHA 4CBEA 4M63A 4OIOF 2CDQA 4CSAA 2WL8A 3OWTA 3EPVA 3EJNA 3EGDB 5B1AC 3EH1A 2P6VA 4U5CE 3AQBA 3T4RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I4U A; 
#chains in the Genus database with same CATH topology
 2IYL D;  5BQG A;  2E87 A;  2HSB A;  2HFI A;  3CEX A;  3L8I A;  3LUT B;  1CGN A;  4O6Y A;  2ICW G;  2PX0 A;  1ORY A;  4HEA J;  1GQA A;  2Y39 A;  4L6R A;  3V5X A;  5JP7 A;  3FAJ A;  4C7O B;  4CS7 A;  2HMQ A;  4XPX A;  2OEX A;  2B0J A;  1AVO B;  1QQ3 A;  4E0H A;  2C03 A;  3JRM O;  3LS0 A;  3ZG1 A;  1T01 A;  1N1C A;  3PMR A;  1TWC A;  1ZYR F;  2CNW D;  2LQG A;  2XLH A;  4MQ9 F;  4JCZ A;  4W8K A;  4U9E A;  3G50 A;  2XLM A;  3KPH A;  4CDA A;  3IHU A;  2Q9A A;  1Z63 A;  2OJQ A;  3LNM B;  4G0H A;  5AGF A;  2XM0 A;  3MYF A;  2H7V C;  5K0I A;  3QW0 A;  4I3M A;  1NBB A;  3QZC A;  1RKE A;  1MND A;  3V5Y A;  4YT4 A;  1YZC A;  2AVK A;  3AG2 C;  1S05 A;  3K7D A;  3G4Z A;  4HFF B;  3VRC A;  4D4N A;  3AGU A;  1IW7 F;  1TFK B;  1TKN A;  2J45 A;  2YL0 A;  2RD9 A;  3B29 A;  2YL3 A;  2QLA A;  1W2W A;  2AWY A;  1V55 C;  3ABM C;  3WG7 C;  4MW3 A;  4EKW A;  2Y3G A;  3CQZ A;  1Z7Q c;  3AG4 C;  1Q0K A;  2QY9 A;  2Y3D A;  2AWC A;  2YLD A;  3I5Q A;  3KYJ A;  1O87 A;  5CI9 A;  2Q00 A;  3Q7G A;  1M2O A;  3RIP A;  3L8J A;  2V3C C;  2R7X A;  4P9F A;  4AL1 A;  4A4A A;  3W4Y A;  1F1M A;  2A6E F;  4O6N A;  1HY5 A;  1EQ1 A;  5JS5 A;  3FAP B;  3GM3 A;  4EUK B;  1SZI A;  2YRF A;  1I4Z A;  3DE9 A;  3EFO A;  3EFO B;  1FNT c;  4B6I A;  5E3A A;  4Q4Z F;  1NFN A;  1QSP A;  4ONS A;  2NUT A;  3SXM A;  2P61 A;  2IXP A;  2NUT B;  5KYW A;  1UG7 A;  1BR1 A;  3US6 A;  1H9G A;  5KYX A;  1JPN A;  4J30 B;  3S90 A;  3A11 A;  5DS6 A;  4PFO A;  1LI7 A;  1VMA A;  1WAT A;  3C63 A;  3QVZ A;  4XTK A;  5FCL A;  3AG1 C;  4JIO A;  4MND A;  4I1O B;  2XSE A;  1WWP A;  3GWL A;  2LFD A;  1Z3I X;  3L1M A;  3M15 A;  3ITF A;  2LP4 A;  2YQY A;  3G4X A;  4WGY A;  2YKZ A;  5COG A;  3LS1 A;  1WN0 A;  3OA1 A;  1CPQ A;  1VOM A;  2L81 A;  4JVS A;  2XS8 A;  5KYN A;  1OCR C;  2IOQ A;  5BUO A;  1JRA A;  2R7Q A;  3M4C A;  3K1H A;  2G3V A;  5DS4 A;  1TQG A;  1H6G A;  1OKK D;  1PV3 A;  3AGT A;  3NDB B;  2OJE D;  1YJG A;  3AOU A;  1VK5 A;  2WVN A;  1DOW A;  3GM1 A;  3T9O A;  1Z5Z A;  2XLE A;  3DJU B;  3W8I A;  3OEO A;  3U0C A;  2WZL A;  2WVQ A;  3MX3 A;  1TR2 A;  3I5P A;  4XLP F;  2B0H A;  3GEI A;  3V5Z A;  3JRT A;  2A69 F;  3UNG C;  2R7T A;  2UUH A;  4C3E A;  3U2M A;  1T6U A;  3E70 C;  3IQ5 A;  2IBF A;  1VTM P;  2XXA A;  2KK1 A;  3KYI A;  2IXN A;  3C62 A;  2VCA A;  4IAQ A;  1OCC C;  2F22 A;  3M4B A;  4MTF A;  1JAF A;  4JC7 A;  1VLT A;  4JTD B;  2H7B A;  4CIH A;  4YT2 A;  1SR2 A;  2LCH A;  5GPG B;  2JX0 A;  2ZXP A;  3IQT A;  2QUP A;  4BEM J;  3J06 A;  2DYR C;  5KYY B;  3H65 A;  1RXQ A;  1ORJ A;  1IZM A;  2MYS A;  1VB5 A;  1HMO A;  2ZXR A;  4U9D A;  3TK0 A;  2WB7 A;  4KC9 A;  2GA0 A;  3TUL A;  3ZQY A;  2HV7 A;  4ZLC A;  1C17 M;  3C8Z A;  3S27 A;  4DVZ A;  4CJO A;  1JOG A;  2KGO A;  1FTS A;  5DS5 A;  2L6H A;  3B0U X;  1EA8 A;  1S7Z A;  1ZVZ A;  2EIJ C;  4YL0 A;  2WZG A;  5T3T A;  1FR0 A;  3H2U A;  3NKE A;  5L0F A;  2R7S A;  2KSF A;  4MW8 A;  3C18 A;  5TJ5 E;  4WAB A;  2J8W A;  2J7P D;  1ZHX A;  1LI5 A;  1OR3 A;  1LIH A;  3DD7 A;  4BG0 A;  4PR9 A;  3QVY A;  3DWW A;  3HNL A;  1Q0D A;  3ASO C;  2LK4 A;  1FMV A;  4XWJ A;  1O5H A;  5B1B C;  1GM5 A;  3O10 A;  4U5G A;  4YJW A;  4G7H F;  3DE8 A;  3NMI A;  4MVR A;  4DXW A;  1OR2 A;  3S28 A;  2HKV A;  3U5S A;  1I4Y A;  1J8Y F;  5HV9 A;  3TJ5 A;  2HV6 A;  3SXY A;  2NSG A;  5JT4 A;  3VM6 A;  4CJG A;  3GEE A;  4C3D A;  3JYH A;  1XZP A;  3VYW A;  2WVO A;  3S0X A;  3AJM A;  3EG9 A;  3NRH A;  4LDR A;  2TMV P;  2XS1 A;  4JE9 A;  3ZVR A;  1QLE C;  5B3I A;  1YYJ A;  3SXZ A;  5HSW A;  3GAN A;  1G8X A;  2L9J A;  1WTY A;  3RF3 A;  1MMN A;  3UMK A;  2XL6 A;  3LEO A;  4FAP B;  3ECS A;  3EZH A;  4NQF A;  4G7O F;  3HNJ A;  4JEB A;  4OIP F;  1E85 A;  1SF8 A;  1RJ9 A;  1XZQ A;  3B0V C;  1KU2 A;  2HJ3 A;  1HW1 A;  1T9K A;  1ZZP A;  4OD5 A;  4RD9 A;  1T5O A;  3TQO A;  2IXM A;  3B71 A;  2UUI A;  4HE8 D;  4LDK A;  1RKE B;  3UR3 C;  1FAP B;  2XLW A;  4DOZ A;  5L3V A;  2R7W A;  5EHH A;  4KBL A;  2BL2 A;  4U5D E;  1A0B A;  2IM8 A;  1AUE A;  3LEV A;  1M2V A;  1Z23 A;  1ZU4 A;  1G4U S;  2GWW A;  3GOR A;  4IWB A;  4EHP A;  4ULW A;  4EWC A;  4YWQ A;  4OIR F;  3FDQ A;  1TWG A;  2J9U A;  3EH2 A;  4N6H A;  4Z9J A;  4WGZ A;  2VCC A;  1LM3 B;  3DM5 A;  4R32 A;  3FOP A;  2CCY A;  3MLG A;  3QW1 A;  1MNE A;  1Y6D A;  2X51 A;  2D4U A;  2PNO A;  1H7I A;  2QNL A;  3SP1 A;  2DI3 A;  2HUJ A;  3VAY A;  2DYS C;  2A68 F;  3KMI A;  4CDY A;  2R02 A;  1Z6A A;  1V4A A;  1TWA A;  3BRJ A;  3FHD A;  1E86 A;  2ZXO A;  2W4B A;  2KNH A;  4C3B A;  4H4K C;  1K40 A;  3W2W A;  2ETS A;  3RKO F;  5L0D A;  2YLG A;  3IQC A;  4N06 A;  2J46 A;  3PHF 2;  5KYW B;  1EKY A;  5COM A;  3U8P A;  4ZLD A;  3ZQV A;  5KYX B;  4J7T A;  1D0Y A;  2C04 A;  2H7O A;  2Y3B A;  3EZI A;  5D91 A;  3MBG A;  3T6G B;  1H9T A;  2H8A A;  3NKD A;  1SMY F;  2EPO A;  3EGX A;  4KNV A;  3EGX B;  2M4E A;  2GFH A;  5D92 A;  5E3C A;  5DQZ A;  4N4W A;  3RW0 A;  1TFO B;  3DI5 A;  1R5I D;  4E0I A;  4W8P A;  1GS9 A;  2HMZ A;  1ST6 A;  2HS5 A;  1OQC A;  5KYU A;  1B68 A;  1BBH A;  4Q5S F;  1FFH A;  4NTA A;  1SYQ A;  2HZ8 A;  2PBE A;  2LIG A;  4JTA B;  4Q7C A;  2KW3 C;  3R7C A;  1C02 A;  4PK4 A;  4E7Z A;  5JSL A;  2EIN C;  1HMD A;  3NMK A;  4OIQ F;  4PJN A;  4AX2 A;  4MVS A;  3EHN A;  1LKX A;  2XLO A;  1A7E A;  3JSZ A;  3C8G A;  4EIY A;  4JZA A;  4K0D A;  4BJ1 A;  2BC5 A;  2BE5 F;  4CDV A;  2Y3H A;  3WHN A;  1YA7 O;  3K66 A;  3K33 A;  3HKK A;  2HJM A;  3DZA A;  1U6H A;  1OW6 A;  3HNI A;  1TWH A;  2XXA B;  5F5F A;  3C7J A;  3KL4 A;  4G78 A;  1EI7 A;  1OW7 A;  2A6H F;  4JRZ A;  5T1D B;  2NUP A;  2NUP B;  4MTO A;  4PFP A;  3CAX A;  4AE4 A;  4I1M A;  4JKV A;  3DAG A;  2OU6 A;  4H54 A;  5A6K A;  5DLJ A;  5BQI A;  2P7V A;  1A7V A;  3ZWI A;  4XPY A;  1ZHW A;  4U5H A;  1LE2 A;  1PD0 A;  3RH3 A;  2YZS A;  4Z9H A;  2PX3 A;  3K1I C;  1YDI A;  3TD7 A;  1K04 A;  1NZE A;  2EPK X;  4PJL A;  2Q9C A;  1V54 C;  2HSQ A;  2OQM A;  4WJ0 A;  4ER9 A;  5JLI A;  1KNY A;  1OCZ C;  3JZ0 A;  4J32 B;  2LD6 A;  3HLZ A;  4OIN F;  3K1I A;  1NFO A;  1U0B B;  4K7B A;  3VF0 A;  4RDA A;  1D1A A;  1WGW A;  2W4M A;  4NTF A;  3A9C A;  4CS9 C;  1MMD A;  4E17 A;  2VAS A;  1Q0G A;  2I8B A;  2CYD A;  3ZIB A;  1M6T A;  1BR2 A;  3NYJ A;  1OCO C;  4GEH A;  1NSG B;  5L3Q A;  1ZHY A;  4X0R A;  1WAS A;  4O7G A;  4CS9 A;  1L3P A;  4QI0 A;  2KC3 A;  1OXB A;  4XPW A;  3AG3 C;  3L0I A;  3RFY A;  3X2Q C;  2W45 A;  2YEV A;  4CX9 A;  1ZHT A;  2J9B A;  4JJF A;  3JCU Q;  3ABL C;  1LVK A;  2J9V A;  4NTB A;  4NY3 A;  3ASN C;  2V26 A;  2JD3 A;  2OKU A;  2L6G A;  3AQC A;  3B0P A;  5F28 E;  4XEK A;  4D4X A;  5A6B A;  2R7U A;  1APC A;  1GGQ A;  3RQE A;  3JTL O;  3POV A;  4QI2 A;  2YL1 A;  3N2Z B;  3F47 A;  4LER A;  3DAF A;  3PDM P;  3QMK A;  4MS2 A;  2KYH A;  4JW1 A;  1A41 A;  4XEV A;  3SNH A;  3JSE O;  2NPU A;  2Z15 A;  3X1O A;  3UGP A;  4E18 A;  2EPM X;  5A6A A;  3EG9 B;  3N24 A;  3BEH A;  1G4W R;  2KJG A;  3EQL F;  4BPM A;  3T6J A;  3NYM A;  3JYY A;  2DB4 A;  4JEA A;  4XLN F;  4MVZ A;  4FWV A;  1E84 A;  3SEO A;  5JRA A;  2NSF A;  2CNW A;  4G7Z F;  2EIL C;  3DMD A;  3EGD A;  3LES A;  3O6X A;  3RVZ A;  3SXK A;  5DQT A;  4YT8 A;  4FX5 A;  2OCC C;  3B9Q A;  1FFT C;  1PCX A;  4U5F E;  4IGG A;  2FAP B;  3U9J A;  3LAY A;  5CI8 A;  1RJ9 B;  2XLD A;  1J8M F;  3I4U A;  5T3W A;  3ZSU A;  1V74 B;  4GYT A;  2ZD9 A;  1BZ4 A;  3Q7L A;  3ZDL A;  4MVM A;  1ZW2 A;  5L0J A;  4C7O A;  2R7V A;  2DGJ A;  3DM9 B;  3TOM A;  1QVX A;  3V7O A;  4PAC A;  1WOL A;  1M57 C;  2QTV A;  3U2L A;  2Q4F A;  1M2V B;  1VLS A;  3DJN B;  4LLE A;  3S9O A;  3M1C B;  3ZTZ A;  5CIV A;  3R2P A;  5JUA A;  4BJ5 C;  4J7Y A;  2Y69 C;  3WAQ A;  1LS4 A;  2VC9 A;  1VYK A;  3SZR A;  5JVE A;  3MFN A;  4AK9 A;  2R05 A;  4BJ5 A;  1FMW A;  1ZW3 A;  1E83 A;  3UGO A;  1D1B A;  2W9Y A;  4MVQ A;  5F5H A;  2Q3T A;  2NG1 A;  3IPM O;  1R4T A;  3DKA A;  3IQ6 A;  3IEE A;  4NC3 A;  3S84 A;  1JMW A;  1QKR A;  4MVO A;  4O6M A;  1G5Z A;  3CZ6 A;  3FOO A;  1HE1 A;  3TOL A;  4DBR A;  5BQH A;  3PCV A;  2EPL X;  1RKC A;  4FES A;  2JPU A;  4EBK A;  1MMG A;  2L6F A;  5COF A;  3E9V A;  1KTM A;  4MTG A;  4EBB A;  2R7R A;  4ANJ A;  4JJG A;  1T6I A;  2XL4 A;  2XM4 A;  3O55 A;  4PJJ A;  3T6B A;  3NYL A;  2J0W A;  2D5R B;  2OEV A;  3W8H A;  4BEJ A;  1LS1 A;  4MVU A;  1YLM A;  256B A;  3HJC A;  3GOD A;  4IAO A;  3U9M A;  1K05 A;  5L0I A;  1NLX A;  1LPE A;  4JTC B;  2RSE B;  3QTH A;  1D0X A;  5KYU B;  2XLV A;  1I5N A;  4DVY P;  2YL7 A;  3JT1 A;  4LAC B;  2PFD A;  3S29 A;  5A69 A;  4DRJ B;  5EGY A;  3M79 A;  1OKK A;  1T6Q A;  2P0N A;  4JCH A;  4JUR I;  3HTK C;  4Z9I A;  2J0X A;  2GAQ A;  1ZHZ A;  2R9R B;  2AU5 A;  3K6B A;  5L0H A;  5IY5 C;  1D1C A;  3U3B A;  1A7D A;  1JPJ A;  2G62 A;  1OXK A;  2GDC A;  2PP4 A;  1DOV A;  2YLI A;  3C8G B;  3H2V A;  4PJM A;  4YL3 A;  5AC5 A;  2XL8 A;  3O39 A;  4HFK B;  4IRU A;  1QZX A;  5EK0 A;  3WOD F;  4LLC A;  4DRH B;  4BJT A;  1Y4C A;  3RQF A;  2PF4 E;  4P6I C;  3N0T A;  4RBN A;  5A6J A;  4XEF A;  1NG1 A;  2CGE A;  3U3F A;  4XQ1 A;  2VCB A;  4N6C A;  3LNR A;  3LLK A;  4KI2 A;  1E2X A;  2VH3 A;  2J9W A;  3TJ6 A;  3EHM A;  1YZA A;  2OOC A;  4AE4 B;  5AC4 A;  1C03 A;  1LE4 A;  1MMA A;  1L7C A;  1ZU5 A;  1Q0M A;  2LFF A;  2M64 A;  2R7O A;  3GWN A;  4I44 A;  1HW2 A;  4LDQ A;  2I15 A;  4BJ6 C;  4O79 A;  3NG1 A;  3GM2 A;  2EIK C;  2R03 A;  3C8G D;  3FVY A;  3RVY A;  4YT5 A;  2ZXW C;  3ATP A;  4BJ6 A;  2G3K A;  4P9T A;  3F46 A;  1YYX A;  1OW8 A;  1UFB A;  2KQ9 A;  1O3U A;  2WZF A;  2AP3 A;  4OD4 A;  4QDL A;  5B3S C;  2ASR A;  2FGY A;  2Q9B A;  2ZPA A;  4K1O A;  4YK5 A;  4YN0 B;  4EBJ A;  4U5B E;  2EPN A;  4CS8 C;  3W2V A;  2LSE A;  4KNW A;  3DXJ F;  4A2N B;  2A1D D;  2P1A A;  2Q7R A;  2MHR A;  2A0B A;  3Q6M A;  3SYN A;  4CS8 A;  3UMH A;  5E2Q A;  2R25 A;  1M56 C;  3ZC4 A;  3ABK C;  3L34 A;  1JR8 A;  1BDJ B;  2EIM C;  4CIP A;  4DRI B;  2J7P A;  3Q6N A;  5KYY A;  1HE9 A;  4IAR A;  3LJB A;  1Q0F A;  3FMS A;  3LLI A;  1QPU A;  5DVW A;  3RYL A;  3CSK A;  1CGM E;  4NCQ A;  3UMI A;  1CPR A;  1VYI A;  3ZTM A;  1AEP A;  2CW0 F;  3HNK A;  5E33 A;  4DBQ A;  4U5E E;  1RMV A;  1NU9 C;  2YVK A;  1ORS C;  3MYI A;  1PD1 A;  1YA9 A;  2OG2 A;  4IB4 A;  1YAR O;  5L0G A;  1CGO A;  4GQH A;  2QE9 A;  4E7S A;  1NU7 D;  5L0C A;  4UDV A;  4ULV A;  3U8V A;  3RQG A;  3NMJ A;  2FFH A;  2X0C A;  1BR4 A;  2VB6 A;  2YHS A;  4IJJ A;  1U89 A;  2L7A A;  1D0Z A;  5FZT A;  4F4B A;  4DJ9 A;  2YWA A;  3KKB A;  4CSA C;  4YL1 A;  2MWQ A;  3GEH A;  2IXO A;  2O9X A;  3KH2 A;  2XRH A;  4CBE A;  4M63 A;  4OIO F;  2CDQ A;  2A0U A;  4CSA A;  2WL8 A;  1YAU O;  1XWJ A;  3OWT A;  3EPV A;  5A6B D;  1RCP A;  3EJN A;  4AL0 A;  3FXH A;  3EGD B;  1YVI A;  5B1A C;  3EH1 A;  2P6V A;  1MQV A;  4U5C E;  3AQB A;  3T4R A; 
#chains in the Genus database with same CATH homology
 2IYL D;  2E87 A;  4O6Y A;  2PX0 A;  4HEA J;  2Y39 A;  3FAJ A;  4C7O B;  4CS7 A;  2B0J A;  2C03 A;  3LS0 A;  3ZG1 A;  1N1C A;  3PMR A;  1TWC A;  1ZYR F;  2CNW D;  4MQ9 F;  4W8K A;  2Q9A A;  1Z63 A;  4G0H A;  2H7V C;  4I3M A;  3QZC A;  1MND A;  4YT4 A;  4HFF B;  3AG2 C;  3K7D A;  1IW7 F;  2J45 A;  1TKN A;  3WG7 C;  1W2W A;  3ABM C;  1V55 C;  2Y3G A;  3CQZ A;  3AG4 C;  2QY9 A;  2Y3D A;  3I5Q A;  5CI9 A;  1O87 A;  3Q7G A;  3RIP A;  1M2O A;  2V3C C;  2R7X A;  2A6E F;  4O6N A;  1SZI A;  3EFO A;  3EFO B;  4B6I A;  5E3A A;  4Q4Z F;  5KYW A;  2NUT A;  2IXP A;  2NUT B;  1BR1 A;  5KYX A;  1JPN A;  4J30 B;  5DS6 A;  4PFO A;  1VMA A;  4XTK A;  5FCL A;  3AG1 C;  4MND A;  4I1O B;  2XSE A;  1Z3I X;  3ITF A;  3LS1 A;  3OA1 A;  1VOM A;  2L81 A;  4JVS A;  5KYN A;  1OCR C;  2IOQ A;  5BUO A;  2R7Q A;  3K1H A;  2G3V A;  5DS4 A;  3NDB B;  1OKK D;  1VK5 A;  2WVN A;  3W8I A;  1Z5Z A;  3DJU B;  3OEO A;  2WZL A;  2WVQ A;  3MX3 A;  1TR2 A;  3I5P A;  4XLP F;  3JRT A;  2A69 F;  3UNG C;  2R7T A;  4C3E A;  3E70 C;  2XXA A;  2IXN A;  1OCC C;  2H7B A;  4CIH A;  4YT2 A;  2ZXP A;  2DYR C;  5KYY B;  3H65 A;  1IZM A;  2MYS A;  2ZXR A;  2WB7 A;  4KC9 A;  2HV7 A;  4ZLC A;  3S27 A;  4DVZ A;  3B0U X;  2KGO A;  1FTS A;  5DS5 A;  1S7Z A;  2EIJ C;  2WZG A;  5T3T A;  3NKE A;  2R7S A;  2J7P D;  1ZHX A;  3DD7 A;  4BG0 A;  3ASO C;  1FMV A;  4XWJ A;  1O5H A;  5B1B C;  4U5G A;  4YJW A;  4G7H F;  3S28 A;  1J8Y F;  2HV6 A;  4C3D A;  3JYH A;  3VYW A;  3S0X A;  2WVO A;  3EG9 A;  3NRH A;  3ZVR A;  1QLE C;  5HSW A;  3GAN A;  1G8X A;  2L9J A;  1MMN A;  3UMK A;  3ECS A;  3EZH A;  4G7O F;  4OIP F;  1SF8 A;  1RJ9 A;  3B0V C;  1KU2 A;  4RD9 A;  4OD5 A;  2IXM A;  4HE8 D;  3UR3 C;  4DOZ A;  5L3V A;  2R7W A;  5EHH A;  4KBL A;  4U5D E;  3LEV A;  1M2V A;  1Z23 A;  1ZU4 A;  4IWB A;  4ULW A;  4EWC A;  4YWQ A;  4OIR F;  3FDQ A;  1TWG A;  2J9U A;  3EH2 A;  3DM5 A;  3MLG A;  1MNE A;  2X51 A;  3SP1 A;  3VAY A;  2DYS C;  2A68 F;  3KMI A;  1Z6A A;  1TWA A;  3FHD A;  2ZXO A;  2W4B A;  2KNH A;  4C3B A;  4H4K C;  3W2W A;  3RKO F;  4N06 A;  2J46 A;  3PHF 2;  5KYW B;  4ZLD A;  5KYX B;  1D0Y A;  3EZI A;  2C04 A;  2H7O A;  2Y3B A;  5D91 A;  3NKD A;  1SMY F;  3EGX A;  5D92 A;  4KNV A;  3EGX B;  2M4E A;  2GFH A;  5E3C A;  5DQZ A;  1ST6 A;  5KYU A;  4Q5S F;  1FFH A;  4E7Z A;  4Q7C A;  2KW3 C;  4PK4 A;  2EIN C;  4OIQ F;  4PJN A;  4AX2 A;  3EHN A;  1LKX A;  3JSZ A;  4JZA A;  4K0D A;  4BJ1 A;  2BE5 F;  2Y3H A;  3K66 A;  3K33 A;  3DZA A;  1TWH A;  2XXA B;  5F5F A;  3KL4 A;  2A6H F;  5T1D B;  2NUP A;  2NUP B;  4PFP A;  4AE4 A;  4I1M A;  3DAG A;  5DLJ A;  2P7V A;  1ZHW A;  4U5H A;  1PD0 A;  3RH3 A;  3TD7 A;  2YZS A;  2PX3 A;  3K1I C;  1NZE A;  4PJL A;  2Q9C A;  1V54 C;  4WJ0 A;  1OCZ C;  4J32 B;  3HLZ A;  4OIN F;  4K7B A;  4RDA A;  1D1A A;  1WGW A;  2W4M A;  4CS9 C;  1MMD A;  2VAS A;  2I8B A;  3ZIB A;  1BR2 A;  3NYJ A;  1OCO C;  4GEH A;  5L3Q A;  1ZHY A;  4X0R A;  4O7G A;  4CS9 A;  4QI0 A;  3X2Q C;  3AG3 C;  3L0I A;  3RFY A;  2W45 A;  2YEV A;  1ZHT A;  4JJF A;  3JCU Q;  3ABL C;  1LVK A;  2J9V A;  4NY3 A;  3ASN C;  2V26 A;  2JD3 A;  2R7V A;  3AQC A;  3B0P A;  2R7U A;  3POV A;  3N2Z B;  3F47 A;  4LER A;  3DAF A;  3QMK A;  4JW1 A;  3SNH A;  2Z15 A;  3X1O A;  3UGP A;  3EG9 B;  3N24 A;  2KJG A;  3EQL F;  3T6J A;  3NYM A;  4XLN F;  4FWV A;  3SEO A;  2CNW A;  4G7Z F;  2EIL C;  3DMD A;  3EGD A;  3LES A;  3O6X A;  5DQT A;  4YT8 A;  4FX5 A;  2OCC C;  3B9Q A;  1FFT C;  1PCX A;  4U5F E;  3LAY A;  5CI8 A;  1RJ9 B;  1J8M F;  3I4U A;  5T3W A;  3ZSU A;  4GYT A;  3Q7L A;  4C7O A;  2DGJ A;  3DM9 B;  3V7O A;  1M57 C;  2QTV A;  3DJN B;  1M2V B;  4LLE A;  3M1C B;  4BJ5 C;  2Y69 C;  1VYK A;  3SZR A;  4AK9 A;  4BJ5 A;  1FMW A;  3UGO A;  1D1B A;  2W9Y A;  5F5H A;  2Q3T A;  2NG1 A;  3IEE A;  4O6M A;  3CZ6 A;  4DBR A;  4FES A;  1MMG A;  3E9V A;  4EBB A;  2R7R A;  4ANJ A;  4JJG A;  4PJJ A;  2XL4 A;  3W8H A;  3T6B A;  4BEJ A;  3NYL A;  2J0W A;  2D5R B;  1LS1 A;  3HJC A;  3GOD A;  4IAO A;  1D0X A;  5KYU B;  4DVY P;  3JT1 A;  3S29 A;  4LAC B;  2PFD A;  5EGY A;  1OKK A;  4JUR I;  4JCH A;  3HTK C;  2J0X A;  1ZHZ A;  3K6B A;  5IY5 C;  1D1C A;  1JPJ A;  2G62 A;  2PP4 A;  4PJM A;  3O39 A;  4HFK B;  4IRU A;  1QZX A;  3WOD F;  4LLC A;  4BJT A;  2PF4 E;  4P6I C;  3N0T A;  4RBN A;  1NG1 A;  2CGE A;  4KI2 A;  3LNR A;  3LLK A;  2VH3 A;  2J9W A;  3EHM A;  4AE4 B;  1MMA A;  2R7O A;  1ZU5 A;  4QI2 A;  4I44 A;  4BJ6 C;  4O79 A;  3NG1 A;  2EIK C;  3FVY A;  4YT5 A;  2ZXW C;  4BJ6 A;  2G3K A;  3F46 A;  4OD4 A;  2KQ9 A;  2WZF A;  5B3S C;  4QDL A;  2FGY A;  2Q9B A;  2ZPA A;  4YN0 B;  4U5B E;  4CS8 C;  3W2V A;  2LSE A;  4KNW A;  3DXJ F;  4A2N B;  2A1D D;  3Q6M A;  4CS8 A;  3SYN A;  3UMH A;  5E2Q A;  1M56 C;  3ZC4 A;  3ABK C;  3L34 A;  2EIM C;  2J7P A;  3Q6N A;  5KYY A;  3LJB A;  3LLI A;  3RYL A;  5DVW A;  3CSK A;  3UMI A;  1VYI A;  5E33 A;  2CW0 F;  4DBQ A;  4U5E E;  1NU9 C;  1PD1 A;  2OG2 A;  4E7S A;  1NU7 D;  2FFH A;  1BR4 A;  2VB6 A;  2YHS A;  4IJJ A;  1D0Z A;  4F4B A;  3KKB A;  4CSA C;  2MWQ A;  2IXO A;  2O9X A;  3KH2 A;  2XRH A;  4CBE A;  4M63 A;  4OIO F;  2CDQ A;  4CSA A;  2WL8 A;  3OWT A;  3EPV A;  3EJN A;  3EGD B;  5B1A C;  3EH1 A;  2P6V A;  4U5C E;  3AQB A;  3T4R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...