3I4UA

Crystal structure analysis of a helicase associated domain
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
247
structure length
241
Chain Sequence
b'GSPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQTEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKSTVRVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQPEWVVYHELVLTTKEYMREVTTIDPRWLVEFAPAFFKVLDHGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ATP-dependent RNA helicase DHX8
molecule tags Hydrolase
source organism Homo sapiens
publication title Structural analysis of the C-terminal domain of the spliceosomal helicase Prp22
pubmed doi rcsb
total genus 79
structure length 241
sequence length 247
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2009-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04408 HA2 Helicase associated domain (HA2)
A PF07717 OB_NTP_bind Oligonucleotide/oligosaccharide-binding (OB)-fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1080 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3i4uA01
3I4UA
chains in the Genus database with same CATH superfamily
4BPMA 2YWAA 1NFOA 4EBJA 2HJMA 3GEEA 4K7BA 2HZ8A 2I15A 4AX2A 2EILC 4BJ5A 5A6JA 2ZD9A 5L3VA 1YLMA 3RQEA 1G5ZA 3JT1A 3RH3A 2JD3A 2R7VA 5K0IA 3U8PA 2V26A 3T6GB 3GM2A 1C02A 3EQLF 2J9BA 1V55C 1H6GA 1BDJB 4P9TA 3R7CA 1LS1A 1QPUA 2A6HF 1TWAA 3H2VA 4Z9HA 1HY5A 3POVA 1U0BB 3JSEO 1BBHA 2KQ9A 2L81A 1OCOC 3CAXA 1G4WR 2Q9CA 3GWLA 2XLHA 3C7JA 3N24A 4E7ZA 1ZHTA 2XRHA 2GWWA 2VC9A 1OXBA 3U0CA 1YYJA 1XWJA 5L0HA 2VH3A 3FAJA 3B0UX 4LACB 3N2ZB 4GYTA 4IB4A 2FGYA 4LLEA 2XLVA 3RIPA 3ZTMA 3MLGA 2XS8A 4DXWA 2PFDA 1O5HA 5JLIA 4E18A 2X0CA 3MFNA 3GWNA 3SNHA 2J9WA 3AQBA 2IYLD 4BJ6A 1A0BA 4KBLA 2OCCC 2NUPB 2IXNA 3OA1A 5CI8A 1NZEA 2A68F 4IAQA 5E33A 4YT4A 4MTFA 3BRJA 5AGFA 4CS8A 3A11A 2VASA 4MQ9F 1ZU4A 5BQHA 4JURI 5A69A 2J7PD 5E3CA 4ZLDA 2M4EA 2OOCA 3ECSA 1FFTC 4J30B 5D91A 2AP3A 1VYKA 2IXMA 2XLMA 4G7ZF 1DOWA 2GDCA 1A41A 2LQGA 2CW0F 3S9OA 2J45A 3RF3A 4CDAA 2A0BA 2A1DD 5COMA 4Z9IA 4U5GA 3JCUQ 4ANJA 4IAOA 1VLTA 3NKDA 4E17A 1I4YA 3CSKA 3GORA 3EGXA 1TFKB 2Y3GA 1L3PA 2W45A 5JSLA 3ZSUA 2XXAB 4HE8D 1CGME 4J32B 5F28E 4EBBA 3W8HA 2Q7RA 4UDVA 3IEEA 2L9JA 3JTLO 3ZVRA 1LPEA 3GEHA 2NG1A 4RD9A 4EBKA 4XPYA 3RKOF 1ZHXA 2M64A 4H4KC 3PHF2 4ER9A 2R7RA 5DS5A 3L8JA 3JYHA 4HFKB 3AG2C 2OKUA 4LLCA 1HE1A 4OIRF 4Q5SF 2DYSC 4KNWA 1LKXA 2ZPAA 4BG0A 4CS9C 1FNTc 2FAPB 3CEXA 1YARO 2Q00A 5T3WA 1Z6AA 1QLEC 1ORJA 3NYLA 2YVKA 3U9MA 3S0XA 4DBQA 3IQTA 2C04A 1RJ9B 2YLIA 1TFOB 1Q0MA 3B71A 3NMIA 4Q7CA 3JRTA 1HMOA 4PJMA 4I1MA 3VYWA 1RKCA 2Y69C 3UMIA 3B0VC 2V3CC 3K66A 2RD9A 4WGZA 5DQZA 2WVNA 2BC5A 4MVUA 3DI5A 2YL3A 2F22A 1LE2A 2ZXWC 4LDQA 3U9JA 1ZU5A 1WWPA 2AWYA 3C18A 4JCHA 1AVOB 1ZHZA 2LFDA 3DMDA 1J8MF 4JC7A 2EIJC 5DVWA 4Z9JA 5KYUA 5JVEA 1VB5A 2EIKC 2NUTA 5COGA 2YL7A 3NMJA 4BEJA 3FXHA 3LS0A 3M1CB 3OWTA 1OCRC 4JJFA 4FX5A 4M63A 3EH1A 4MNDA 4C3EA 4JTDB 4PFPA 3V7OA 4CSAA 2KC3A 2CGEA 2XL4A 1YVIA 2KYHA 2LP4A 5B1AC 1C03A 2UUIA 1LM3B 1EKYA 3E70C 3LLKA 4W8KA 2CYDA 3HTKC 4MTOA 2R25A 1WGWA 1Z5ZA 4U9EA 4CJGA 1FR0A 5KYXB 4LERA 2WL8A 1T6UA 1RXQA 3U2LA 1VYIA 2EPLX 3NG1A 1NU7D 3L8IA 3ZWIA 3PDMP 4KC9A 3ABMC 4NCQA 1BR1A 4XPXA 3SZRA 1BZ4A 4XEKA 1MMNA 3NKEA 2XLOA 4G78A 2H7OA 1G8XA 2EPKX 3X2QC 3HKKA 4PJNA 4CIPA 3SYNA 3FOPA 2YEVA 4XWJA 5B3SC 3K1HA 5DLJA 3AGUA 3AOUA 4YT2A 3AG1C 3KYJA 2NSGA 2L6HA 3G50A 2Y3HA 1TWHA 1LS4A 3M15A 2PNOA 3DAFA 3KPHA 1Q0KA 5AC4A 3FMSA 2R7WA 3EG9A 1MQVA 2RSEB 4WABA 3DM5A 3B0PA 3HJCA 4XPWA 3T9OA 1RCPA 2R7QA 5L0IA 3EJNA 1NFNA 1S05A 1RJ9A 3PCVA 4YWQA 3ASOC 3X1OA 3SXKA 4N06A 4OD4A 5KYYA 2OU6A 3S90A 1GS9A 2YKZA 3T6BA 1G4US 1RMVA 3DZAA 2KGOA 1MNEA 1BR2A 5COFA 3Q6MA 4JCZA 1JPJA 1OW7A 3Q7GA 3W4YA 4CS9A 3H65A 1V4AA 5T1DB 3W8IA 1K04A 1TQGA 2NSFA 2QUPA 1K05A 2YQYA 4K1OA 4PK4A 2MWQA 5FCLA 2A69F 4CSAC 4OIPF 2IXPA 4JEBA 1EQ1A 1OR2A 3B9QA 4QI0A 3NMKA 1I5NA 1ZZPA 2J9UA 3Q7LA 4G0HA 4W8PA 4YL1A 4XLNF 4CS7A 4CDVA 3IQ6A 3R2PA 2I8BA 3FVYA 2DYRC 2OJED 4U5EE 1WOLA 2P6VA 2YHSA 1PCXA 3GM1A 2Z15A 4NTAA 4O6YA 3RVYA 4MVZA 2Y39A 3KL4A 4GQHA 2HFIA 2IOQA 2HSBA 2KNHA 3LESA 4JIOA 1A7DA 5L0DA 4O7GA 1K40A 3SXMA 4OIQF 4HFFB 4IJJA 1YA9A 1KNYA 2JPUA 3C63A 3LAYA 1U6HA 3LS1A 1FFHA 5DS4A 3SEOA 1I4ZA 1ORYA 4E7SA 2B0HA 1LVKA 2ZXRA 1SZIA 2MHRA 5JS5A 1Z63A 2BL2A 3U3BA 1CGOA 3WG7C 5KYWA 2XS1A 3QMKA 3UGOA 3AGTA 3C8ZA 3O39A 2VCCA 3TJ6A 3IPMO 4LDKA 2EPOA 2P7VA 2L6GA 4JE9A 5A6BA 3PMRA 2AU5A 1XZPA 2LIGA 1M2VB 2HSQA 1EA8A 1YYXA 2G3VA 2XLEA 3AJMA 1NSGB 3LUTB 2OG2A 4GEHA 2YZSA 3T6JA 3VRCA 3TULA 1F1MA 4Q4ZF 3EGDB 2QLAA 2AVKA 3M4CA 1D0XA 3FDQA 3DM9B 3EZIA 3AQCA 3AG3C 1B68A 3U2MA 4DVZA 3DWWA 2A6EF 2W9YA 2IXOA 2EPNA 4G7HF 1PD1A 3EH2A 3UR3C 4A4AA 5EHHA 2CCYA 3TOMA 3C8GA 5E3AA 4DJ9A 1SMYF 3VAYA 2HKVA 1T5OA 2Q9AA 3M4BA 3DKAA 4MVMA 3VF0A 3V5ZA 5DQTA 1D1BA 1OR3A 4NY3A 2YL0A 4JTCB 1UG7A 4OINF 5A6AA 3FOOA 1E85A 5JT4A 2CNWD 4WJ0A 2KSFA 4A2NB 2HUJA 2Q3TA 3HNLA 1PV3A 1OCCC 3I5PA 2KJGA 1R4TA 1TWCA 3UNGC 4N4WA 3ZC4A 1D1CA 1MMAA 1Z23A 3ZTZA 4CS8C 3MYFA 5B3IA 1VMAA 2JX0A 3EPVA 1KU2A 1YZAA 3NYJA 1Z7Qc 4E0HA 1JOGA 3JSZA 4WGYA 5KYXA 1HW1A 4C3BA 1SF8A 4IWBA 3UGPA 4AE4A 5T3TA 3WAQA 3LNRA 5GPGB 5BUOA 2LSEA 1DOVA 3S28A 1D1AA 1RKEB 4C7OA 2MYSA 2J0WA 3LNMB 1QVXA 4FWVA 3K1IA 4N6HA 3EFOA 3TK0A 3CZ6A 4U5FE 2R03A 3RQGA 2YRFA 3QVZA 3RVZA 1H9TA 1ZHYA 2OEXA 2Q9BA 3U8VA 4X0RA 1ZW3A 4YJWA 1OW8A 4CX9A 3KYIA 2ICWG 3BEHA 5L0GA 1E86A 1OKKD 2WZFA 4MS2A 4O6NA 2J9VA 1S7ZA 3IQCA 2R7XA 4MVQA 4NQFA 1TR2A 1L7CA 5HSWA 2H7BA 2W4MA 2X51A 5B1BC 4JW1A 3T4RA 2J46A 4LDRA 3DD7A 3TD7A 2IBFA 3EZHA 1T9KA 4XQ1A 4P6IC 1H9GA 2WVQA 2XLWA 4FESA 4XLPF 3QW0A 2WZLA 1YZCA 2D5RB 2P61A 3QTHA 5EGYA 1JR8A 3HNKA 1Q0GA 1RKEA 4C7OB 3V5YA 1TKNA 1T6QA 1T01A 2WVOA 5JP7A 3L34A 3S84A 3HNIA 4QDLA 3L1MA 2IM8A 4PR9A 4RBNA 2L7AA 3ZQVA 1M2OA 1BR4A 1WTYA 1YA7O 4IGGA 2H7VC 4AL1A 2R7TA 5L0JA 1O3UA 5DS6A 4G7OF 4N6CA 2YL1A 4CDYA 4B6IA 1SYQA 3HNJA 3QW1A 4J7TA 1MMGA 2W4BA 2XLDA 3U5SA 3UMHA 5D92A 2NPUA 3QVYA 2AWCA 4U5BE 3HLZA 3S27A 2QY9A 3GM3A 2VCBA 3ITFA 1CPQA 2HV7A 1CGNA 4MTGA 4KI2A 4EUKB 4BJTA 4JRZA 3KKBA 4DRIB 1JPNA 2TMVP 1FAPB 4J7YA 4ULVA 5TJ5E 4F4BA 1NU9C 3ABKC 4DBRA 3DJUB 4XEVA 3I5QA 2ASRA 3G4ZA 3K6BA 1ZVZA 3GANA 2PF4E 4YK5A 3ZIBA 4D4XA 1HMDA 1ZHWA 2D4UA 3AG4C 4NC3A 4PFOA 2OQMA 3F46A 2CNWA 4JTAB 3WODF 3EGXB 2OEVA 2XXAA 3LJBA 4IARA 4QI2A 3O55A 3EHNA 2ETSA 3US6A 3RQFA 1LI5A 3DE8A 2J8WA 1FTSA 4I3MA 5A6KA 4C3DA 5A6BD 256BA 3VM6A 3A9CA 2XL8A 3RFYA 3LEVA 2P1AA 1FMVA 2HMZA 2R02A 3ATPA 3N0TA 5JUAA 1IW7F 4ONSA 1VK5A 4DRHB 4DRJB 5BQIA 3GEIA 2J0XA 2WZGA 3LLIA 3JYYA 3TJ5A 1Y6DA 1E83A 1QQ3A 3I4UA 4ZLCA 2QTVA 1AUEA 1NLXA 2CDQA 2A0UA 3JZ0A 5FZTA 5KYWB 2HMQA 3C8GB 5L3QA 4YT8A 3L0IA 1EI7A 1M57C 1QZXA 2R9RB 2XM0A 4KNVA 4O6MA 3J06A 3ZG1A 2GFHA 3JRMO 1GM5A 3H2UA 4XEFA 1Y4CA 2EPMX 3MBGA 3TQOA 5BQGA 2KK1A 1QKRA 1A7EA 1WASA 3O6XA 3NDBB 1UFBA 3C8GD 3RW0A 3ABLC 2LCHA 1V74B 2Q4FA 4I1OB 5CIVA 4CJOA 5AC5A 4AK9A 3NRHA 4U5DE 1KTMA 2DI3A 2DB4A 1M2VA 4XTKA 3V5XA 2P0NA 3MYIA 5CI9A 3EFOB 5L0CA 4NTBA 1M6TA 2J7PA 4CIHA 4JEAA 4MW8A 4L6RA 1ZW2A 2E87A 1T6IA 4YL0A 2O9XA 5KYNA 3K33A 1YAUO 1V54C 2B0JA 1J8YF 1LI7A 1CPRA 3M79A 4HEAJ 3F47A 4JZAA 1E2XA 1R5ID 1ORSC 4U5CE 1H7IA 4AE4B 1JAFA 5EK0A 2UUHA 1U89A 4YN0B 2FFHA 2HV6A 1TWGA 1NG1A 4PJJA 3W2VA 3C62A 1LIHA 1D0YA 5IY5C 3DXJF 3FHDA 2R05A 1Q0DA 2KW3C 3K1IC 4RDAA 3SP1A 4P9FA 4U9DA 1GGQA 5JRAA 1VTMP 1APCA 1HE9A 1OW6A 3DAGA 1VLSA 4BEMJ 2OJQA 2VB6A 1JMWA 4YT5A 4DOZA 1XZQA 4OIOF 3O10A 3U3FA 2EIMC 5L0FA 1YJGA 1VOMA 2LD6A 3W2WA 4EIYA 5HV9A 1N1CA 3IHUA 3G4XA 4BJ6C 2G3KA 3OEOA 4PJLA 4BJ1A 1HW2A 1WATA 4NTFA 1PD0A 1ST6A 4DVYP 2C03A 2EINC 3EG9B 3KMIA 3K7DA 1MNDA 2Y3DA 1W2WA 4R32A 2R7UA 1Q0FA 1QSPA 3DJNB 2QNLA 3ASNC 3EHMA 3Q6NA 2LK4A 2LFFA 2GAQA 2PBEA 4JJGA 4K0DA 1FMWA 1GQAA 1OXKA 3CQZA 3SXYA 5F5HA 1Z3IX 4EKWA 3ZQYA 2R7OA 3TOLA 3DE9A 2BE5F 2YLDA 1OQCA 3NYMA 4FAPB 1YDIA 2DGJA 2L6FA 4MVRA 4U5HA 5KYUB 1NBBA 4D4NA 4OD5A 1AEPA 3RYLA 4MW3A 3MX3A 2XSEA 5E2QA 2YLGA 4H54A 4YL3A 3B29A 4E0IA 4JKVA 1OKKA 1D0ZA 1MMDA 4ULWA 3KH2A 4MVSA 2NUPA 4EHPA 2XM4A 2ZXOA 1OCZC 2QE9A 4MVOA 4I44A 5KYYB 4JVSA 3E9VA 3QZCA 1SR2A 1LE4A 1E84A 2H8AA 2GA0A 1IZMA 2NUTB 2VCAA 4AL0A 4EWCA 3S29A 1O87A 3LEOA 3IQ5A 4BJ5C 3WHNA 2PX0A 2ZXPA 1WN0A 1JRAA 3EGDA 3SXZA 2HS5A 2PX3A 4O79A 2G62A 2PP4A 1ZYRF 2Y3BA 4IRUA 3ZDLA 1C17M 2WB7A 2XL6A 2R7SA 4CBEA 3GODA 1M56C 3UMKA 1A7VA 2HJ3A 5F5FA 3FAPB 4PACA
chains in the Genus database with same CATH topology
4AX2A 4K7BA 4BJ5A 2EILC 2R7VA 5L3VA 3RH3A 3JT1A 2JD3A 2V26A 3EQLF 1V55C 3POVA 1LS1A 2A6HF 1TWAA 2KQ9A 2L81A 1OCOC 2Q9CA 3N24A 4E7ZA 1ZHTA 2XRHA 2VH3A 3FAJA 3B0UX 4LACB 3N2ZB 4GYTA 4LLEA 2FGYA 3RIPA 3MLGA 2PFDA 1O5HA 4BJ6A 3SNHA 2J9WA 3AQBA 2IYLD 4KBLA 2OCCC 2NUPB 2IXNA 3OA1A 5CI8A 1NZEA 2A68F 5E33A 4YT4A 4CS8A 2VASA 4MQ9F 1ZU4A 4JURI 2J7PD 5E3CA 4ZLDA 2M4EA 3ECSA 1FFTC 4J30B 5D91A 4G7ZF 1VYKA 2IXMA 2CW0F 2J45A 2A1DD 4U5GA 3JCUQ 4ANJA 4IAOA 3NKDA 3CSKA 3ZSUA 3EGXA 2Y3GA 2XXAB 2W45A 4HE8D 4J32B 4EBBA 3W8HA 3IEEA 2L9JA 3ZVRA 2NG1A 4RD9A 3RKOF 1ZHXA 4H4KC 3PHF2 2R7RA 5DS5A 3JYHA 4HFKB 3AG2C 4OIRF 4LLCA 4Q5SF 2DYSC 4KNWA 1LKXA 2ZPAA 4BG0A 4CS9C 5T3WA 1Z6AA 1QLEC 3NYLA 3S0XA 4DBQA 2C04A 1RJ9B 4Q7CA 4PJMA 3JRTA 4I1MA 3VYWA 3B0VC 2Y69C 3UMIA 2V3CC 3K66A 5DQZA 2WVNA 2ZXWC 1ZU5A 4JCHA 1ZHZA 3DMDA 5DVWA 1J8MF 2EIJC 5KYUA 2EIKC 2NUTA 4BEJA 3LS0A 3OWTA 3M1CB 4JJFA 1OCRC 4MNDA 4FX5A 4M63A 3EH1A 4C3EA 4PFPA 3V7OA 4CSAA 2CGEA 2XL4A 5B1AC 3E70C 3LLKA 4W8KA 3HTKC 1WGWA 1Z5ZA 5KYXB 4LERA 2WL8A 1VYIA 3NG1A 1NU7D 4KC9A 3ABMC 1BR1A 3SZRA 1MMNA 3NKEA 2H7OA 1G8XA 3X2QC 4PJNA 3SYNA 2YEVA 4XWJA 5B3SC 3K1HA 5DLJA 4YT2A 3AG1C 2Y3HA 1TWHA 3DAFA 2R7WA 3EG9A 3DM5A 3B0PA 3HJCA 2R7QA 3EJNA 1RJ9A 4YWQA 3ASOC 3X1OA 4N06A 4OD4A 5KYYA 3T6BA 3DZAA 2KGOA 1MNEA 1BR2A 3Q6MA 1JPJA 4CS9A 3Q7GA 3H65A 5T1DB 3W8IA 4PK4A 2MWQA 5FCLA 2A69F 4CSAC 4OIPF 2IXPA 3B9QA 4QI0A 2J9UA 4XLNF 4G0HA 3Q7LA 4CS7A 2I8BA 3FVYA 2DYRC 4U5EE 2P6VA 2YHSA 1PCXA 2Z15A 4O6YA 2Y39A 3KL4A 2KNHA 2IOQA 3LESA 4O7GA 4OIQF 4HFFB 4IJJA 3LAYA 3LS1A 1FFHA 5DS4A 3SEOA 4E7SA 1LVKA 2ZXRA 1SZIA 1Z63A 3WG7C 5KYWA 3QMKA 3UGOA 3O39A 2P7VA 3PMRA 1M2VB 2G3VA 4GEHA 3T6JA 2OG2A 2YZSA 4Q4ZF 3EGDB 1D0XA 3FDQA 3DM9B 3EZIA 3AQCA 3AG3C 4DVZA 2A6EF 2W9YA 2IXOA 4G7HF 1PD1A 3EH2A 3UR3C 5EHHA 5E3AA 1SMYF 3VAYA 2Q9AA 5DQTA 1D1BA 4NY3A 4OINF 2CNWD 4WJ0A 4A2NB 2Q3TA 1OCCC 3I5PA 2KJGA 1TWCA 3UNGC 3ZC4A 1D1CA 1MMAA 1Z23A 4CS8C 1VMAA 3EPVA 1KU2A 3NYJA 3JSZA 5KYXA 4C3BA 1SF8A 4IWBA 3UGPA 4AE4A 5T3TA 3LNRA 5BUOA 2LSEA 3S28A 1D1AA 4C7OA 2MYSA 2J0WA 4FWVA 3EFOA 3CZ6A 4U5FE 1ZHYA 2Q9BA 4X0RA 4YJWA 1OKKD 2WZFA 4O6NA 2J9VA 1S7ZA 2R7XA 1TR2A 5HSWA 2H7BA 2W4MA 2X51A 5B1BC 4JW1A 3T4RA 2J46A 3DD7A 3TD7A 3EZHA 4P6IC 2WVQA 4FESA 4XLPF 2WZLA 2D5RB 5EGYA 4C7OB 1TKNA 2WVOA 3L34A 4QDLA 4RBNA 1M2OA 1BR4A 2H7VC 2R7TA 5DS6A 4G7OF 4B6IA 1MMGA 2W4BA 3UMHA 5D92A 4U5BE 3HLZA 3S27A 2QY9A 3ITFA 2HV7A 4KI2A 4BJTA 3KKBA 1JPNA 4F4BA 1NU9C 3ABKC 4DBRA 3DJUB 3I5QA 3K6BA 3GANA 2PF4E 3ZIBA 1ZHWA 3AG4C 4PFOA 3F46A 2CNWA 3WODF 3EGXB 2XXAA 3LJBA 4QI2A 3EHNA 1FTSA 4I3MA 4C3DA 3RFYA 3LEVA 1FMVA 3N0TA 1IW7F 1VK5A 2J0XA 2WZGA 3LLIA 3I4UA 4ZLCA 2QTVA 2CDQA 5L3QA 4YT8A 3L0IA 1M57C 1QZXA 4KNVA 4O6MA 3ZG1A 2GFHA 3O6XA 3NDBB 3ABLC 4I1OB 4AK9A 3NRHA 4U5DE 1M2VA 4XTKA 5CI9A 3EFOB 2J7PA 4CIHA 2E87A 2O9XA 5KYNA 3K33A 2B0JA 1V54C 1J8YF 4HEAJ 4JZAA 5KYWB 3F47A 4U5CE 4AE4B 4YN0B 2FFHA 2HV6A 1TWGA 1NG1A 4PJJA 3W2VA 1D0YA 5IY5C 3FHDA 3DXJF 2KW3C 3K1IC 4RDAA 3SP1A 3DAGA 2VB6A 4DOZA 4YT5A 4OIOF 2EIMC 3W2WA 1VOMA 1N1CA 4BJ1A 4BJ6C 2G3KA 3OEOA 4PJLA 1PD0A 1ST6A 4DVYP 2C03A 2EINC 3EG9B 3KMIA 3K7DA 1MNDA 2Y3DA 1W2WA 2R7UA 3DJNB 3ASNC 3EHMA 3Q6NA 4JJGA 4K0DA 1FMWA 3CQZA 5F5HA 1Z3IX 2R7OA 2BE5F 3NYMA 2DGJA 4U5HA 5KYUB 4OD5A 3RYLA 3MX3A 2XSEA 5E2QA 1OKKA 1D0ZA 1MMDA 4ULWA 3KH2A 2NUPA 2ZXOA 1OCZC 4I44A 5KYYB 4JVSA 3E9VA 3QZCA 1IZMA 2NUTB 4EWCA 3S29A 1O87A 4BJ5C 2PX0A 2ZXPA 3EGDA 2PX3A 4O79A 2G62A 2PP4A 1ZYRF 2Y3BA 4IRUA 2WB7A 2R7SA 4CBEA 3GODA 1M56C 3UMKA 5F5FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I4U A; 
#chains in the Genus database with same CATH topology
 4BPM A;  2YWA A;  1NFO A;  4EBJ A;  2HJM A;  3GEE A;  4K7B A;  2HZ8 A;  2I15 A;  4AX2 A;  2EIL C;  4BJ5 A;  5A6J A;  2ZD9 A;  5L3V A;  1YLM A;  3RQE A;  1G5Z A;  3JT1 A;  3RH3 A;  2JD3 A;  2R7V A;  5K0I A;  3U8P A;  2V26 A;  3T6G B;  3GM2 A;  1C02 A;  3EQL F;  2J9B A;  1V55 C;  1H6G A;  1BDJ B;  4P9T A;  3R7C A;  1LS1 A;  1QPU A;  2A6H F;  1TWA A;  3H2V A;  4Z9H A;  1HY5 A;  3POV A;  1U0B B;  3JSE O;  1BBH A;  2KQ9 A;  2L81 A;  1OCO C;  3CAX A;  1G4W R;  2Q9C A;  3GWL A;  2XLH A;  3C7J A;  3N24 A;  4E7Z A;  1ZHT A;  2XRH A;  2GWW A;  2VC9 A;  1OXB A;  3U0C A;  1YYJ A;  1XWJ A;  5L0H A;  2VH3 A;  3FAJ A;  3B0U X;  4LAC B;  3N2Z B;  4GYT A;  4IB4 A;  2FGY A;  4LLE A;  2XLV A;  3RIP A;  3ZTM A;  3MLG A;  2XS8 A;  4DXW A;  2PFD A;  1O5H A;  5JLI A;  4E18 A;  2X0C A;  3MFN A;  3GWN A;  3SNH A;  2J9W A;  3AQB A;  2IYL D;  4BJ6 A;  1A0B A;  4KBL A;  2OCC C;  2NUP B;  2IXN A;  3OA1 A;  5CI8 A;  1NZE A;  2A68 F;  4IAQ A;  5E33 A;  4YT4 A;  4MTF A;  3BRJ A;  5AGF A;  4CS8 A;  3A11 A;  2VAS A;  4MQ9 F;  1ZU4 A;  5BQH A;  4JUR I;  5A69 A;  2J7P D;  5E3C A;  4ZLD A;  2M4E A;  2OOC A;  3ECS A;  1FFT C;  4J30 B;  5D91 A;  2AP3 A;  1VYK A;  2IXM A;  2XLM A;  4G7Z F;  1DOW A;  2GDC A;  1A41 A;  2LQG A;  2CW0 F;  3S9O A;  2J45 A;  3RF3 A;  4CDA A;  2A0B A;  2A1D D;  5COM A;  4Z9I A;  4U5G A;  3JCU Q;  4ANJ A;  4IAO A;  1VLT A;  3NKD A;  4E17 A;  1I4Y A;  3CSK A;  3GOR A;  3EGX A;  1TFK B;  2Y3G A;  1L3P A;  2W45 A;  5JSL A;  3ZSU A;  2XXA B;  4HE8 D;  1CGM E;  4J32 B;  5F28 E;  4EBB A;  3W8H A;  2Q7R A;  4UDV A;  3IEE A;  2L9J A;  3JTL O;  3ZVR A;  1LPE A;  3GEH A;  2NG1 A;  4RD9 A;  4EBK A;  4XPY A;  3RKO F;  1ZHX A;  2M64 A;  4H4K C;  3PHF 2;  4ER9 A;  2R7R A;  5DS5 A;  3L8J A;  3JYH A;  4HFK B;  3AG2 C;  2OKU A;  4LLC A;  1HE1 A;  4OIR F;  4Q5S F;  2DYS C;  4KNW A;  1LKX A;  2ZPA A;  4BG0 A;  4CS9 C;  1FNT c;  2FAP B;  3CEX A;  1YAR O;  2Q00 A;  5T3W A;  1Z6A A;  1QLE C;  1ORJ A;  3NYL A;  2YVK A;  3U9M A;  3S0X A;  4DBQ A;  3IQT A;  2C04 A;  1RJ9 B;  2YLI A;  1TFO B;  1Q0M A;  3B71 A;  3NMI A;  4Q7C A;  3JRT A;  1HMO A;  4PJM A;  4I1M A;  3VYW A;  1RKC A;  2Y69 C;  3UMI A;  3B0V C;  2V3C C;  3K66 A;  2RD9 A;  4WGZ A;  5DQZ A;  2WVN A;  2BC5 A;  4MVU A;  3DI5 A;  2YL3 A;  2F22 A;  1LE2 A;  2ZXW C;  4LDQ A;  3U9J A;  1ZU5 A;  1WWP A;  2AWY A;  3C18 A;  4JCH A;  1AVO B;  1ZHZ A;  2LFD A;  3DMD A;  1J8M F;  4JC7 A;  2EIJ C;  5DVW A;  4Z9J A;  5KYU A;  5JVE A;  1VB5 A;  2EIK C;  2NUT A;  5COG A;  2YL7 A;  3NMJ A;  4BEJ A;  3FXH A;  3LS0 A;  3M1C B;  3OWT A;  1OCR C;  4JJF A;  4FX5 A;  4M63 A;  3EH1 A;  4MND A;  4C3E A;  4JTD B;  4PFP A;  3V7O A;  4CSA A;  2KC3 A;  2CGE A;  2XL4 A;  1YVI A;  2KYH A;  2LP4 A;  5B1A C;  1C03 A;  2UUI A;  1LM3 B;  1EKY A;  3E70 C;  3LLK A;  4W8K A;  2CYD A;  3HTK C;  4MTO A;  2R25 A;  1WGW A;  1Z5Z A;  4U9E A;  4CJG A;  1FR0 A;  5KYX B;  4LER A;  2WL8 A;  1T6U A;  1RXQ A;  3U2L A;  1VYI A;  2EPL X;  3NG1 A;  1NU7 D;  3L8I A;  3ZWI A;  3PDM P;  4KC9 A;  3ABM C;  4NCQ A;  1BR1 A;  4XPX A;  3SZR A;  1BZ4 A;  4XEK A;  1MMN A;  3NKE A;  2XLO A;  4G78 A;  2H7O A;  1G8X A;  2EPK X;  3X2Q C;  3HKK A;  4PJN A;  4CIP A;  3SYN A;  3FOP A;  2YEV A;  4XWJ A;  5B3S C;  3K1H A;  5DLJ A;  3AGU A;  3AOU A;  4YT2 A;  3AG1 C;  3KYJ A;  2NSG A;  2L6H A;  3G50 A;  2Y3H A;  1TWH A;  1LS4 A;  3M15 A;  2PNO A;  3DAF A;  3KPH A;  1Q0K A;  5AC4 A;  3FMS A;  2R7W A;  3EG9 A;  1MQV A;  2RSE B;  4WAB A;  3DM5 A;  3B0P A;  3HJC A;  4XPW A;  3T9O A;  1RCP A;  2R7Q A;  5L0I A;  3EJN A;  1NFN A;  1S05 A;  1RJ9 A;  3PCV A;  4YWQ A;  3ASO C;  3X1O A;  3SXK A;  4N06 A;  4OD4 A;  5KYY A;  2OU6 A;  3S90 A;  1GS9 A;  2YKZ A;  3T6B A;  1G4U S;  1RMV A;  3DZA A;  2KGO A;  1MNE A;  1BR2 A;  5COF A;  3Q6M A;  4JCZ A;  1JPJ A;  1OW7 A;  3Q7G A;  3W4Y A;  4CS9 A;  3H65 A;  1V4A A;  5T1D B;  3W8I A;  1K04 A;  1TQG A;  2NSF A;  2QUP A;  1K05 A;  2YQY A;  4K1O A;  4PK4 A;  2MWQ A;  5FCL A;  2A69 F;  4CSA C;  4OIP F;  2IXP A;  4JEB A;  1EQ1 A;  1OR2 A;  3B9Q A;  4QI0 A;  3NMK A;  1I5N A;  1ZZP A;  2J9U A;  3Q7L A;  4G0H A;  4W8P A;  4YL1 A;  4XLN F;  4CS7 A;  4CDV A;  3IQ6 A;  3R2P A;  2I8B A;  3FVY A;  2DYR C;  2OJE D;  4U5E E;  1WOL A;  2P6V A;  2YHS A;  1PCX A;  3GM1 A;  2Z15 A;  4NTA A;  4O6Y A;  3RVY A;  4MVZ A;  2Y39 A;  3KL4 A;  4GQH A;  2HFI A;  2IOQ A;  2HSB A;  2KNH A;  3LES A;  4JIO A;  1A7D A;  5L0D A;  4O7G A;  1K40 A;  3SXM A;  4OIQ F;  4HFF B;  4IJJ A;  1YA9 A;  1KNY A;  2JPU A;  3C63 A;  3LAY A;  1U6H A;  3LS1 A;  1FFH A;  5DS4 A;  3SEO A;  1I4Z A;  1ORY A;  4E7S A;  2B0H A;  1LVK A;  2ZXR A;  1SZI A;  2MHR A;  5JS5 A;  1Z63 A;  2BL2 A;  3U3B A;  1CGO A;  3WG7 C;  5KYW A;  2XS1 A;  3QMK A;  3UGO A;  3AGT A;  3C8Z A;  3O39 A;  2VCC A;  3TJ6 A;  3IPM O;  4LDK A;  2EPO A;  2P7V A;  2L6G A;  4JE9 A;  5A6B A;  3PMR A;  2AU5 A;  1XZP A;  2LIG A;  1M2V B;  2HSQ A;  1EA8 A;  1YYX A;  2G3V A;  2XLE A;  3AJM A;  1NSG B;  3LUT B;  2OG2 A;  4GEH A;  2YZS A;  3T6J A;  3VRC A;  3TUL A;  1F1M A;  4Q4Z F;  3EGD B;  2QLA A;  2AVK A;  3M4C A;  1D0X A;  3FDQ A;  3DM9 B;  3EZI A;  3AQC A;  3AG3 C;  1B68 A;  3U2M A;  4DVZ A;  3DWW A;  2A6E F;  2W9Y A;  2IXO A;  2EPN A;  4G7H F;  1PD1 A;  3EH2 A;  3UR3 C;  4A4A A;  5EHH A;  2CCY A;  3TOM A;  3C8G A;  5E3A A;  4DJ9 A;  1SMY F;  3VAY A;  2HKV A;  1T5O A;  2Q9A A;  3M4B A;  3DKA A;  4MVM A;  3VF0 A;  3V5Z A;  5DQT A;  1D1B A;  1OR3 A;  4NY3 A;  2YL0 A;  4JTC B;  1UG7 A;  4OIN F;  5A6A A;  3FOO A;  1E85 A;  5JT4 A;  2CNW D;  4WJ0 A;  2KSF A;  4A2N B;  2HUJ A;  2Q3T A;  3HNL A;  1PV3 A;  1OCC C;  3I5P A;  2KJG A;  1R4T A;  1TWC A;  3UNG C;  4N4W A;  3ZC4 A;  1D1C A;  1MMA A;  1Z23 A;  3ZTZ A;  4CS8 C;  3MYF A;  5B3I A;  1VMA A;  2JX0 A;  3EPV A;  1KU2 A;  1YZA A;  3NYJ A;  1Z7Q c;  4E0H A;  1JOG A;  3JSZ A;  4WGY A;  5KYX A;  1HW1 A;  4C3B A;  1SF8 A;  4IWB A;  3UGP A;  4AE4 A;  5T3T A;  3WAQ A;  3LNR A;  5GPG B;  5BUO A;  2LSE A;  1DOV A;  3S28 A;  1D1A A;  1RKE B;  4C7O A;  2MYS A;  2J0W A;  3LNM B;  1QVX A;  4FWV A;  3K1I A;  4N6H A;  3EFO A;  3TK0 A;  3CZ6 A;  4U5F E;  2R03 A;  3RQG A;  2YRF A;  3QVZ A;  3RVZ A;  1H9T A;  1ZHY A;  2OEX A;  2Q9B A;  3U8V A;  4X0R A;  1ZW3 A;  4YJW A;  1OW8 A;  4CX9 A;  3KYI A;  2ICW G;  3BEH A;  5L0G A;  1E86 A;  1OKK D;  2WZF A;  4MS2 A;  4O6N A;  2J9V A;  1S7Z A;  3IQC A;  2R7X A;  4MVQ A;  4NQF A;  1TR2 A;  1L7C A;  5HSW A;  2H7B A;  2W4M A;  2X51 A;  5B1B C;  4JW1 A;  3T4R A;  2J46 A;  4LDR A;  3DD7 A;  3TD7 A;  2IBF A;  3EZH A;  1T9K A;  4XQ1 A;  4P6I C;  1H9G A;  2WVQ A;  2XLW A;  4FES A;  4XLP F;  3QW0 A;  2WZL A;  1YZC A;  2D5R B;  2P61 A;  3QTH A;  5EGY A;  1JR8 A;  3HNK A;  1Q0G A;  1RKE A;  4C7O B;  3V5Y A;  1TKN A;  1T6Q A;  1T01 A;  2WVO A;  5JP7 A;  3L34 A;  3S84 A;  3HNI A;  4QDL A;  3L1M A;  2IM8 A;  4PR9 A;  4RBN A;  2L7A A;  3ZQV A;  1M2O A;  1BR4 A;  1WTY A;  1YA7 O;  4IGG A;  2H7V C;  4AL1 A;  2R7T A;  5L0J A;  1O3U A;  5DS6 A;  4G7O F;  4N6C A;  2YL1 A;  4CDY A;  4B6I A;  1SYQ A;  3HNJ A;  3QW1 A;  4J7T A;  1MMG A;  2W4B A;  2XLD A;  3U5S A;  3UMH A;  5D92 A;  2NPU A;  3QVY A;  2AWC A;  4U5B E;  3HLZ A;  3S27 A;  2QY9 A;  3GM3 A;  2VCB A;  3ITF A;  1CPQ A;  2HV7 A;  1CGN A;  4MTG A;  4KI2 A;  4EUK B;  4BJT A;  4JRZ A;  3KKB A;  4DRI B;  1JPN A;  2TMV P;  1FAP B;  4J7Y A;  4ULV A;  5TJ5 E;  4F4B A;  1NU9 C;  3ABK C;  4DBR A;  3DJU B;  4XEV A;  3I5Q A;  2ASR A;  3G4Z A;  3K6B A;  1ZVZ A;  3GAN A;  2PF4 E;  4YK5 A;  3ZIB A;  4D4X A;  1HMD A;  1ZHW A;  2D4U A;  3AG4 C;  4NC3 A;  4PFO A;  2OQM A;  3F46 A;  2CNW A;  4JTA B;  3WOD F;  3EGX B;  2OEV A;  2XXA A;  3LJB A;  4IAR A;  4QI2 A;  3O55 A;  3EHN A;  2ETS A;  3US6 A;  3RQF A;  1LI5 A;  3DE8 A;  2J8W A;  1FTS A;  4I3M A;  5A6K A;  4C3D A;  5A6B D;  256B A;  3VM6 A;  3A9C A;  2XL8 A;  3RFY A;  3LEV A;  2P1A A;  1FMV A;  2HMZ A;  2R02 A;  3ATP A;  3N0T A;  5JUA A;  1IW7 F;  4ONS A;  1VK5 A;  4DRH B;  4DRJ B;  5BQI A;  3GEI A;  2J0X A;  2WZG A;  3LLI A;  3JYY A;  3TJ5 A;  1Y6D A;  1E83 A;  1QQ3 A;  3I4U A;  4ZLC A;  2QTV A;  1AUE A;  1NLX A;  2CDQ A;  2A0U A;  3JZ0 A;  5FZT A;  5KYW B;  2HMQ A;  3C8G B;  5L3Q A;  4YT8 A;  3L0I A;  1EI7 A;  1M57 C;  1QZX A;  2R9R B;  2XM0 A;  4KNV A;  4O6M A;  3J06 A;  3ZG1 A;  2GFH A;  3JRM O;  1GM5 A;  3H2U A;  4XEF A;  1Y4C A;  2EPM X;  3MBG A;  3TQO A;  5BQG A;  2KK1 A;  1QKR A;  1A7E A;  1WAS A;  3O6X A;  3NDB B;  1UFB A;  3C8G D;  3RW0 A;  3ABL C;  2LCH A;  1V74 B;  2Q4F A;  4I1O B;  5CIV A;  4CJO A;  5AC5 A;  4AK9 A;  3NRH A;  4U5D E;  1KTM A;  2DI3 A;  2DB4 A;  1M2V A;  4XTK A;  3V5X A;  2P0N A;  3MYI A;  5CI9 A;  3EFO B;  5L0C A;  4NTB A;  1M6T A;  2J7P A;  4CIH A;  4JEA A;  4MW8 A;  4L6R A;  1ZW2 A;  2E87 A;  1T6I A;  4YL0 A;  2O9X A;  5KYN A;  3K33 A;  1YAU O;  1V54 C;  2B0J A;  1J8Y F;  1LI7 A;  1CPR A;  3M79 A;  4HEA J;  3F47 A;  4JZA A;  1E2X A;  1R5I D;  1ORS C;  4U5C E;  1H7I A;  4AE4 B;  1JAF A;  5EK0 A;  2UUH A;  1U89 A;  4YN0 B;  2FFH A;  2HV6 A;  1TWG A;  1NG1 A;  4PJJ A;  3W2V A;  3C62 A;  1LIH A;  1D0Y A;  5IY5 C;  3DXJ F;  3FHD A;  2R05 A;  1Q0D A;  2KW3 C;  3K1I C;  4RDA A;  3SP1 A;  4P9F A;  4U9D A;  1GGQ A;  5JRA A;  1VTM P;  1APC A;  1HE9 A;  1OW6 A;  3DAG A;  1VLS A;  4BEM J;  2OJQ A;  2VB6 A;  1JMW A;  4YT5 A;  4DOZ A;  1XZQ A;  4OIO F;  3O10 A;  3U3F A;  2EIM C;  5L0F A;  1YJG A;  1VOM A;  2LD6 A;  3W2W A;  4EIY A;  5HV9 A;  1N1C A;  3IHU A;  3G4X A;  4BJ6 C;  2G3K A;  3OEO A;  4PJL A;  4BJ1 A;  1HW2 A;  1WAT A;  4NTF A;  1PD0 A;  1ST6 A;  4DVY P;  2C03 A;  2EIN C;  3EG9 B;  3KMI A;  3K7D A;  1MND A;  2Y3D A;  1W2W A;  4R32 A;  2R7U A;  1Q0F A;  1QSP A;  3DJN B;  2QNL A;  3ASN C;  3EHM A;  3Q6N A;  2LK4 A;  2LFF A;  2GAQ A;  2PBE A;  4JJG A;  4K0D A;  1FMW A;  1GQA A;  1OXK A;  3CQZ A;  3SXY A;  5F5H A;  1Z3I X;  4EKW A;  3ZQY A;  2R7O A;  3TOL A;  3DE9 A;  2BE5 F;  2YLD A;  1OQC A;  3NYM A;  4FAP B;  1YDI A;  2DGJ A;  2L6F A;  4MVR A;  4U5H A;  5KYU B;  1NBB A;  4D4N A;  4OD5 A;  1AEP A;  3RYL A;  4MW3 A;  3MX3 A;  2XSE A;  5E2Q A;  2YLG A;  4H54 A;  4YL3 A;  3B29 A;  4E0I A;  4JKV A;  1OKK A;  1D0Z A;  1MMD A;  4ULW A;  3KH2 A;  4MVS A;  2NUP A;  4EHP A;  2XM4 A;  2ZXO A;  1OCZ C;  2QE9 A;  4MVO A;  4I44 A;  5KYY B;  4JVS A;  3E9V A;  3QZC A;  1SR2 A;  1LE4 A;  1E84 A;  2H8A A;  2GA0 A;  1IZM A;  2NUT B;  2VCA A;  4AL0 A;  4EWC A;  3S29 A;  1O87 A;  3LEO A;  3IQ5 A;  4BJ5 C;  3WHN A;  2PX0 A;  2ZXP A;  1WN0 A;  1JRA A;  3EGD A;  3SXZ A;  2HS5 A;  2PX3 A;  4O79 A;  2G62 A;  2PP4 A;  1ZYR F;  2Y3B A;  4IRU A;  3ZDL A;  1C17 M;  2WB7 A;  2XL6 A;  2R7S A;  4CBE A;  3GOD A;  1M56 C;  3UMK A;  1A7V A;  2HJ3 A;  5F5F A;  3FAP B;  4PAC A; 
#chains in the Genus database with same CATH homology
 4AX2 A;  4K7B A;  4BJ5 A;  2EIL C;  2R7V A;  5L3V A;  3RH3 A;  3JT1 A;  2JD3 A;  2V26 A;  3EQL F;  1V55 C;  3POV A;  1LS1 A;  2A6H F;  1TWA A;  2KQ9 A;  2L81 A;  1OCO C;  2Q9C A;  3N24 A;  4E7Z A;  1ZHT A;  2XRH A;  2VH3 A;  3FAJ A;  3B0U X;  4LAC B;  3N2Z B;  4GYT A;  4LLE A;  2FGY A;  3RIP A;  3MLG A;  2PFD A;  1O5H A;  4BJ6 A;  3SNH A;  2J9W A;  3AQB A;  2IYL D;  4KBL A;  2OCC C;  2NUP B;  2IXN A;  3OA1 A;  5CI8 A;  1NZE A;  2A68 F;  5E33 A;  4YT4 A;  4CS8 A;  2VAS A;  4MQ9 F;  1ZU4 A;  4JUR I;  2J7P D;  5E3C A;  4ZLD A;  2M4E A;  3ECS A;  1FFT C;  4J30 B;  5D91 A;  4G7Z F;  1VYK A;  2IXM A;  2CW0 F;  2J45 A;  2A1D D;  4U5G A;  3JCU Q;  4ANJ A;  4IAO A;  3NKD A;  3CSK A;  3ZSU A;  3EGX A;  2Y3G A;  2XXA B;  2W45 A;  4HE8 D;  4J32 B;  4EBB A;  3W8H A;  3IEE A;  2L9J A;  3ZVR A;  2NG1 A;  4RD9 A;  3RKO F;  1ZHX A;  4H4K C;  3PHF 2;  2R7R A;  5DS5 A;  3JYH A;  4HFK B;  3AG2 C;  4OIR F;  4LLC A;  4Q5S F;  2DYS C;  4KNW A;  1LKX A;  2ZPA A;  4BG0 A;  4CS9 C;  5T3W A;  1Z6A A;  1QLE C;  3NYL A;  3S0X A;  4DBQ A;  2C04 A;  1RJ9 B;  4Q7C A;  4PJM A;  3JRT A;  4I1M A;  3VYW A;  3B0V C;  2Y69 C;  3UMI A;  2V3C C;  3K66 A;  5DQZ A;  2WVN A;  2ZXW C;  1ZU5 A;  4JCH A;  1ZHZ A;  3DMD A;  5DVW A;  1J8M F;  2EIJ C;  5KYU A;  2EIK C;  2NUT A;  4BEJ A;  3LS0 A;  3OWT A;  3M1C B;  4JJF A;  1OCR C;  4MND A;  4FX5 A;  4M63 A;  3EH1 A;  4C3E A;  4PFP A;  3V7O A;  4CSA A;  2CGE A;  2XL4 A;  5B1A C;  3E70 C;  3LLK A;  4W8K A;  3HTK C;  1WGW A;  1Z5Z A;  5KYX B;  4LER A;  2WL8 A;  1VYI A;  3NG1 A;  1NU7 D;  4KC9 A;  3ABM C;  1BR1 A;  3SZR A;  1MMN A;  3NKE A;  2H7O A;  1G8X A;  3X2Q C;  4PJN A;  3SYN A;  2YEV A;  4XWJ A;  5B3S C;  3K1H A;  5DLJ A;  4YT2 A;  3AG1 C;  2Y3H A;  1TWH A;  3DAF A;  2R7W A;  3EG9 A;  3DM5 A;  3B0P A;  3HJC A;  2R7Q A;  3EJN A;  1RJ9 A;  4YWQ A;  3ASO C;  3X1O A;  4N06 A;  4OD4 A;  5KYY A;  3T6B A;  3DZA A;  2KGO A;  1MNE A;  1BR2 A;  3Q6M A;  1JPJ A;  4CS9 A;  3Q7G A;  3H65 A;  5T1D B;  3W8I A;  4PK4 A;  2MWQ A;  5FCL A;  2A69 F;  4CSA C;  4OIP F;  2IXP A;  3B9Q A;  4QI0 A;  2J9U A;  4XLN F;  4G0H A;  3Q7L A;  4CS7 A;  2I8B A;  3FVY A;  2DYR C;  4U5E E;  2P6V A;  2YHS A;  1PCX A;  2Z15 A;  4O6Y A;  2Y39 A;  3KL4 A;  2KNH A;  2IOQ A;  3LES A;  4O7G A;  4OIQ F;  4HFF B;  4IJJ A;  3LAY A;  3LS1 A;  1FFH A;  5DS4 A;  3SEO A;  4E7S A;  1LVK A;  2ZXR A;  1SZI A;  1Z63 A;  3WG7 C;  5KYW A;  3QMK A;  3UGO A;  3O39 A;  2P7V A;  3PMR A;  1M2V B;  2G3V A;  4GEH A;  3T6J A;  2OG2 A;  2YZS A;  4Q4Z F;  3EGD B;  1D0X A;  3FDQ A;  3DM9 B;  3EZI A;  3AQC A;  3AG3 C;  4DVZ A;  2A6E F;  2W9Y A;  2IXO A;  4G7H F;  1PD1 A;  3EH2 A;  3UR3 C;  5EHH A;  5E3A A;  1SMY F;  3VAY A;  2Q9A A;  5DQT A;  1D1B A;  4NY3 A;  4OIN F;  2CNW D;  4WJ0 A;  4A2N B;  2Q3T A;  1OCC C;  3I5P A;  2KJG A;  1TWC A;  3UNG C;  3ZC4 A;  1D1C A;  1MMA A;  1Z23 A;  4CS8 C;  1VMA A;  3EPV A;  1KU2 A;  3NYJ A;  3JSZ A;  5KYX A;  4C3B A;  1SF8 A;  4IWB A;  3UGP A;  4AE4 A;  5T3T A;  3LNR A;  5BUO A;  2LSE A;  3S28 A;  1D1A A;  4C7O A;  2MYS A;  2J0W A;  4FWV A;  3EFO A;  3CZ6 A;  4U5F E;  1ZHY A;  2Q9B A;  4X0R A;  4YJW A;  1OKK D;  2WZF A;  4O6N A;  2J9V A;  1S7Z A;  2R7X A;  1TR2 A;  5HSW A;  2H7B A;  2W4M A;  2X51 A;  5B1B C;  4JW1 A;  3T4R A;  2J46 A;  3DD7 A;  3TD7 A;  3EZH A;  4P6I C;  2WVQ A;  4FES A;  4XLP F;  2WZL A;  2D5R B;  5EGY A;  4C7O B;  1TKN A;  2WVO A;  3L34 A;  4QDL A;  4RBN A;  1M2O A;  1BR4 A;  2H7V C;  2R7T A;  5DS6 A;  4G7O F;  4B6I A;  1MMG A;  2W4B A;  3UMH A;  5D92 A;  4U5B E;  3HLZ A;  3S27 A;  2QY9 A;  3ITF A;  2HV7 A;  4KI2 A;  4BJT A;  3KKB A;  1JPN A;  4F4B A;  1NU9 C;  3ABK C;  4DBR A;  3DJU B;  3I5Q A;  3K6B A;  3GAN A;  2PF4 E;  3ZIB A;  1ZHW A;  3AG4 C;  4PFO A;  3F46 A;  2CNW A;  3WOD F;  3EGX B;  2XXA A;  3LJB A;  4QI2 A;  3EHN A;  1FTS A;  4I3M A;  4C3D A;  3RFY A;  3LEV A;  1FMV A;  3N0T A;  1IW7 F;  1VK5 A;  2J0X A;  2WZG A;  3LLI A;  3I4U A;  4ZLC A;  2QTV A;  2CDQ A;  5L3Q A;  4YT8 A;  3L0I A;  1M57 C;  1QZX A;  4KNV A;  4O6M A;  3ZG1 A;  2GFH A;  3O6X A;  3NDB B;  3ABL C;  4I1O B;  4AK9 A;  3NRH A;  4U5D E;  1M2V A;  4XTK A;  5CI9 A;  3EFO B;  2J7P A;  4CIH A;  2E87 A;  2O9X A;  5KYN A;  3K33 A;  2B0J A;  1V54 C;  1J8Y F;  4HEA J;  4JZA A;  5KYW B;  3F47 A;  4U5C E;  4AE4 B;  4YN0 B;  2FFH A;  2HV6 A;  1TWG A;  1NG1 A;  4PJJ A;  3W2V A;  1D0Y A;  5IY5 C;  3FHD A;  3DXJ F;  2KW3 C;  3K1I C;  4RDA A;  3SP1 A;  3DAG A;  2VB6 A;  4DOZ A;  4YT5 A;  4OIO F;  2EIM C;  3W2W A;  1VOM A;  1N1C A;  4BJ1 A;  4BJ6 C;  2G3K A;  3OEO A;  4PJL A;  1PD0 A;  1ST6 A;  4DVY P;  2C03 A;  2EIN C;  3EG9 B;  3KMI A;  3K7D A;  1MND A;  2Y3D A;  1W2W A;  2R7U A;  3DJN B;  3ASN C;  3EHM A;  3Q6N A;  4JJG A;  4K0D A;  1FMW A;  3CQZ A;  5F5H A;  1Z3I X;  2R7O A;  2BE5 F;  3NYM A;  2DGJ A;  4U5H A;  5KYU B;  4OD5 A;  3RYL A;  3MX3 A;  2XSE A;  5E2Q A;  1OKK A;  1D0Z A;  1MMD A;  4ULW A;  3KH2 A;  2NUP A;  2ZXO A;  1OCZ C;  4I44 A;  5KYY B;  4JVS A;  3E9V A;  3QZC A;  1IZM A;  2NUT B;  4EWC A;  3S29 A;  1O87 A;  4BJ5 C;  2PX0 A;  2ZXP A;  3EGD A;  2PX3 A;  4O79 A;  2G62 A;  2PP4 A;  1ZYR F;  2Y3B A;  4IRU A;  2WB7 A;  2R7S A;  4CBE A;  3GOD A;  1M56 C;  3UMK A;  5F5F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...