3I4UA

Crystal structure analysis of a helicase associated domain
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
247
structure length
241
Chain Sequence
GSPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQTEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKSTVRVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQPEWVVYHELVLTTKEYMREVTTIDPRWLVEFAPAFFKVLDHGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ATP-dependent RNA helicase DHX8
publication title Structural analysis of the C-terminal domain of the spliceosomal helicase Prp22
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 79
structure length 241
sequence length 247
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2009-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04408 HA2 Helicase associated domain (HA2)
A PF07717 OB_NTP_bind Oligonucleotide/oligosaccharide-binding (OB)-fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1080 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3i4uA01
3I4UA
chains in the Genus database with same CATH superfamily
2HSBA 2EPMX 2KC3A 1HE9A 4XPXA 1Y4CA 5DVWA 2R05A 4DRIB 1VB5A 3HJCA 2JX0A 3OA1A 5E3AA 2KK1A 1HE1A 2J45A 5JSLA 2M4EA 1DOVA 1KNYA 3GM2A 4D4XA 4MTGA 4E7SA 4BJ5C 2EIKC 2EPKX 4PJNA 4JTDB 4FESA 1BR1A 4ULWA 2QE9A 4GYTA 2VH3A 3TJ6A 3AJMA 1E86A 2J9UA 2XLMA 3ZIBA 4XWJA 1AUEA 2A6HF 1TFOB 4MVQA 1YYXA 3JYHA 4G78A 3I5QA 3RQFA 5JRAA 5JS5A 1YYJA 1WOLA 3F46A 3VM6A 3JZ0A 3U0CA 3DM5A 2W4MA 4I1MA 3MX3A 3S0XA 3NYLA 4M63A 1M57C 1QLEC 4C3BA 4MVSA 5COMA 1TQGA 3K1HA 3RVZA 3S27A 2ZXWC 2XLDA 4HFKB 3DD7A 3GEEA 2HS5A 2W4BA 3S90A 1LM3B 1Z23A 1Z63A 3DI5A 4LLEA 2W45A 3GANA 2Y3GA 2Q3TA 4MNDA 3KH2A 3RIPA 5L3QA 2HMQA 3U2MA 3L8IA 1VYIA 2XS1A 3W2WA 3FXHA 1JAFA 4XLNF 2PF4E 5DLJA 4BJ6C 5L0HA 3T6BA 3U2LA 1ZZPA 4ZLCA 2EPNA 2QNLA 3V5ZA 1CGME 1RJ9A 3RKOF 2R7UA 2OEXA 4E0IA 3EHNA 3RVYA 1QSPA 2Y3DA 2NG1A 4MVOA 4U5CE 1U6HA 2DYSC 1ZW3A 5FZTA 1FR0A 5D92A 1ZHZA 3EGDB 4IARA 3RFYA 2DYRC 3K7DA 1QQ3A 4U5DE 2CNWA 3KPHA 3QTHA 4BJ6A 5B3SC 5L0JA 1BR2A 3C8GA 5K0IA 4BPMA 5KYWB 5D91A 3IQ5A 1PD0A 1EA8A 1VK5A 1G5ZA 4MS2A 5KYUA 3S84A 3DE8A 4BEMJ 4C7OA 4J32B 1AEPA 4YK5A 1ORYA 2XRHA 2LFFA 4L6RA 1ZHXA 2R9RB 4E7ZA 4G7HF 2P6VA 3CAXA 1YA7O 3NYMA 3ZSUA 4DRHB 2CGEA 1MMAA 4JZAA 4U5HA 1JMWA 3UMIA 2VASA 4CS8A 1Q0FA 1LE2A 2A69F 2LIGA 3L8JA 4MVRA 3TULA 4NC3A 2KW3C 2I15A 4LDRA 3T6JA 1CPQA 1APCA 2J46A 2IXNA 3EJNA 4CX9A 2L6FA 2CW0F 3B71A 4PJLA 4E18A 1YJGA 2A0UA 1E84A 4CS7A 5JT4A 1FNTc 2J0XA 3UMKA 1XZQA 3US6A 1NZEA 2LD6A 4Q4ZF 4HFFB 2JPUA 1GGQA 3AG4C 3ZQYA 5EK0A 1BDJB 3FOOA 1K05A 2E87A 3GODA 1W2WA 4IGGA 3U9MA 1PCXA 256BA 3DXJF 2A0BA 1Z7Qc 4FAPB 4JURI 2R7QA 1OW7A 1YDIA 1TWCA 4YL0A 3SXZA 3EPVA 3RQEA 1VLSA 2Q7RA 4IAQA 4NTAA 1KU2A 4YT2A 4O6YA 1XZPA 3N24A 2MWQA 2XM0A 2MYSA 2HUJA 2PX0A 4KNVA 1Q0DA 3K1IC 5AGFA 2YLGA 3H2UA 4JEBA 4G0HA 2CDQA 3TQOA 3WHNA 5KYXA 2AU5A 4NQFA 4DOZA 1KTMA 2Y3HA 1QPUA 2NUTB 2OJED 3L34A 4OINF 4DBRA 1T01A 4CIHA 4YJWA 4CSAA 1I4ZA 3ATPA 5JP7A 2XLOA 4E0HA 5CIVA 3FOPA 2KJGA 2YEVA 3LLIA 3JTLO 2FGYA 4JVSA 1WTYA 2AWYA 4N06A 5GPGB 4JJGA 1CPRA 3TOMA 5F5HA 3QVZA 3ASOC 3V5XA 2CNWD 1H7IA 1WGWA 3OWTA 4XQ1A 3RF3A 1ZHYA 1UFBA 1BBHA 5L0GA 2H7BA 2YLDA 3C8GD 3KYJA 3EQLF 3KYIA 1S7ZA 2L6GA 3JCUQ 1T5OA 3O6XA 4YT8A 2XS8A 4BJTA 4P9TA 3C63A 5A6JA 4IB4A 3ZDLA 2RD9A 4G7ZF 1S05A 4E17A 3TK0A 3MLGA 1VLTA 5A6BA 4CJOA 4XEVA 1WWPA 4HE8D 2IXMA 3S29A 2EIMC 2M64A 4W8PA 1V4AA 3LESA 4Z9JA 1OCCC 1D1AA 2XM4A 3QZCA 4N6HA 4PK4A 3H2VA 3A11A 4C3DA 3LUTB 3ZTZA 2OOCA 3NKDA 1ZU4A 3N0TA 2R7SA 2LK4A 3FDQA 3KKBA 2B0HA 3R2PA 2Q9AA 1NSGB 1ORJA 2KSFA 2B0JA 2GWWA 2WVNA 1ZHWA 2P61A 4QI0A 5DS4A 1FTSA 1T9KA 2V26A 3FAPB 1OCZC 3UR3C 1OR2A 4ULVA 2DGJA 4J7TA 4JCZA 3B0UX 2YHSA 1M2OA 4JIOA 1A0BA 3QVYA 4KBLA 3TD7A 2R7OA 5COFA 2ZXOA 3QW1A 2GA0A 2HSQA 4DVZA 4DRJB 1LIHA 1CGNA 2ZD9A 2Z15A 3HTKC 2ETSA 3CZ6A 3DJUB 1Q0KA 2VCCA 5F5FA 1T6UA 2WZFA 2TMVP 4AL0A 2OG2A 4AE4B 2DB4A 4MQ9F 4U5GA 3K33A 3FHDA 4U5EE 4OIRF 1BR4A 1D1BA 4DBQA 4OIQF 3EGDA 3HKKA 1I4YA 3QMKA 4PFPA 3DMDA 4MVUA 1RCPA 3EHMA 2IBFA 3G4ZA 1IW7F 3KL4A 3UGPA 4P6IC 2EINC 3L1MA 5KYWA 4XPWA 4XPYA 2WZGA 1EI7A 2R03A 1C03A 5B1AC 4RD9A 1ST6A 3F47A 1OKKA 4O79A 5TJ5E 3U8VA 1TFKB 3W8IA 5A6KA 4Q5SF 1LKXA 2YL0A 3DJNB 3NKEA 4IRUA 1HY5A 5BQGA 1NU7D 2QUPA 3M1CB 3T6GB 2ZXRA 4XEKA 3LEVA 4ANJA 1NU9C 3X1OA 2LSEA 3CQZA 5KYYB 4OIOF 3A9CA 4I3MA 3G50A 3U8PA 1ZVZA 2VCAA 1CGOA 3FVYA 1C02A 1IZMA 3SZRA 1K40A 5DQTA 5F28E 4AL1A 3GM1A 4W8KA 2AVKA 2Q4FA 2J9BA 4CS8C 1U0BB 2J7PA 1L7CA 1K04A 5AC4A 4OIPF 5JUAA 3E9VA 3U5SA 3C18A 4JC7A 1V55C 4LLCA 1WASA 2YL7A 2HZ8A 1BZ4A 4MW8A 1MNEA 1OCOC 2PX3A 1G4WR 3V7OA 2Y3BA 2KNHA 3JSZA 1JPNA 1H9GA 2ICWG 4BJ1A 5L0FA 3Q7GA 4FX5A 4ZLDA 2WVOA 3ZTMA 1G4US 3WG7C 3ABKC 2I8BA 1B68A 1Q0MA 3VF0A 3MFNA 5BQHA 4H54A 3C8ZA 4JTCB 1ZW2A 5CI9A 1DOWA 4YL3A 4N4WA 3LLKA 1TWAA 1GQAA 5DS6A 3ZWIA 3DWWA 1OR3A 2GFHA 1EKYA 1ZHTA 5B3IA 2LP4A 2NUPA 4WGYA 4RBNA 1D0YA 1QKRA 2IYLD 3NMIA 3VYWA 4MVZA 2XXAB 3U9JA 3LEOA 3GORA 2HV6A 3LAYA 1SZIA 3HNJA 1PV3A 1RKEA 4I1OB 1V54C 2OJQA 2Y69C 3CSKA 4DVYP 3HNLA 1RXQA 3BRJA 4U9DA 2L81A 1Q0GA 1O5HA 4YT5A 4CSAC 5EHHA 2IXOA 1VMAA 3JSEO 1A7DA 1JR8A 2HV7A 3MYFA 3AQCA 4EBJA 1SR2A 3LNRA 1M6TA 1MQVA 2JD3A 3U3FA 2YLIA 3GM3A 4P9FA 4D4NA 1JRAA 3OEOA 2YL1A 1R4TA 1AVOB 2AWCA 1LE4A 2QY9A 4K0DA 3GWLA 3TOLA 3V5YA 2C03A 2VCBA 3ZQVA 3JYYA 4A2NB 4BG0A 4QI2A 5JVEA 3LNMB 4N6CA 4C7OB 3POVA 3I5PA 4DXWA 4IAOA 5T3WA 2D5RB 2EIJC 3ABMC 3EG9B 1VYKA 3GEIA 1QZXA 4JRZA 2EPLX 5COGA 1LI7A 2A1DD 4YN0B 5IY5C 3LS0A 4JEAA 5EGYA 2EILC 2J7PD 2NSGA 2J9VA 3PMRA 2FFHA 1J8YF 2KYHA 4JW1A 2R02A 3MBGA 4AK9A 2X51A 2NPUA 4G7OF 3SXYA 3UNGC 4AE4A 3AG2C 2H8AA 3W2VA 4HEAJ 3I4UA 3ECSA 1L3PA 3AGUA 2L7AA 1ZYRF 1YZAA 1YZCA 1XWJA 1MMGA 3UGOA 5DS5A 1TWHA 2HMZA 5E3CA 2XLHA 4Z9HA 5BQIA 1SF8A 2LQGA 3JRMO 3AG3C 1QVXA 2UUIA 3B9QA 3EFOB 4EHPA 4K7BA 4O6NA 3QW0A 2QTVA 2XL4A 3DZAA 2R7WA 5HSWA 1LI5A 2O9XA 2D4UA 3EGXB 2ZPAA 4CBEA 4LERA 3B0PA 4MTOA 2HJ3A 1TR2A 1YA9A 3IEEA 5JLIA 4ONSA 2XLVA 1H6GA 4Z9IA 4O7GA 1MMNA 3RH3A 5KYYA 5CI8A 4Q7CA 4UDVA 2R7XA 1D0XA 3ASNC 4J30B 1V74B 4CDYA 2OKUA 5AC5A 1SYQA 1M2VB 4CS9A 4JTAB 5KYNA 2YKZA 5E2QA 2F22A 3IQ6A 3WAQA 1TWGA 2KGOA 4GQHA 3NDBB 1VTMP 3X2QC 3EH1A 3RW0A 1HMDA 3EZIA 3N2ZB 4YT4A 3C62A 1R5ID 3GEHA 2ZXPA 3M4BA 4B6IA 2YVKA 1EQ1A 4U9EA 1JOGA 2VB6A 3BEHA 2RSEB 5A6AA 2XLWA 4RDAA 2Q9BA 4LACB 4EUKB 2A6EF 3IPMO 2R7VA 4CIPA 3M15A 3EH2A 3U3BA 1HMOA 1Z6AA 4MTFA 2XL6A 4WABA 1YAUO 4OD5A 2CYDA 2V3CC 2Q9CA 3DAFA 4NTBA 5T1DB 4BJ5A 4EIYA 1GM5A 3NMKA 3W4YA 3IQCA 2QLAA 3NYJA 3Q6NA 4OD4A 3UMHA 4XTKA 1G8XA 3M4CA 4MVMA 1FFHA 1LS4A 3HLZA 2PBEA 4J7YA 1WN0A 4MW3A 4GEHA 2AP3A 2R25A 2W9YA 2J9WA 2VC9A 2XXAA 2HJMA 2ASRA 3GWNA 3O10A 5A6BD 4PACA 3K6BA 3B29A 1E2XA 4YL1A 3E70C 3S9OA 5DQZA 3ZG1A 4CJGA 4EBKA 3B0VC 2OCCC 3ZC4A 3NMJA 1FFTC 2G3KA 3DM9B 4WJ0A 5B1BC 1T6IA 2G3VA 1Z3IX 2L9JA 3J06A 1I5NA 2HKVA 2WVQA 4QDLA 1SMYF 2YZSA 5FCLA 5L0CA 5HV9A 1NBBA 3H65A 3ZVRA 2WL8A 3IHUA 1M56C 5T3TA 3WODF 2L6HA 3SXKA 1E85A 1U89A 2YWAA 4YWQA 1UG7A 3W8HA 4C3EA 3O55A 2NUTA 2XLEA 1OXBA 4PJMA 2PP4A 2GDCA 1H9TA 4O6MA 4KI2A 2C04A 2YL3A 3SYNA 3VRCA 2P7VA 1RJ9B 3EG9A 3LJBA 4JJFA 4NTFA 4R32A 4A4AA 3RYLA 4PR9A 1E83A 2NSFA 2H7VC 1HW2A 2X0CA 2DI3A 5L0DA 1Z5ZA 4WGZA 1T6QA 1OCRC 4K1OA 2IOQA 2OEVA 3AGTA 3DE9A 4F4BA 3TJ5A 1OW8A 4EBBA 1ZU5A 2PFDA 3ITFA 3G4XA 1A7VA 1LPEA 4IJJA 4NY3A 4U5FE 3Q6MA 1FMVA 1RKCA 4XEFA 3C8GB 3HNIA 1OKKD 1MMDA 2PNOA 2R7TA 2P1AA 2WB7A 3DKAA 3FAJA 1TKNA 2KQ9A 2YRFA 5L3VA 5KYUB 3KMIA 3K66A 3PCVA 4JKVA 3Q7LA 2J8WA 5BUOA 3CEXA 3SXMA 2R7RA 3HNKA 1PD1A 1FMWA 1OXKA 1NG1A 2YQYA 1J8MF 2XSEA 4ER9A 2BE5F 2BL2A 1C17M 2FAPB 2Q00A 1F1MA 4EWCA 3JT1A 1MNDA 3SEOA 1RMVA 3EFOA 3LS1A 3O39A 1YVIA 3T9OA 4I44A 3PHF2 3M79A 1WATA 4LDQA 2GAQA 1FAPB 1YLMA 1YARO 3EGXA 3MYIA 4LDKA 2Y39A 4JE9A 4FWVA 4U5BE 2WZLA 4DJ9A 1LS1A 2HFIA 3VAYA 3C7JA 3RQGA 2NUPB 3EZHA 1GS9A 3JRTA 1LVKA 3AOUA 3L0IA 4CDVA 5L0IA 2J0WA 2LCHA 3SP1A 4BEJA 2A68F 2OQMA 5A69A 1NLXA 1JPJA 3IQTA 1Y6DA 2BC5A 2EPOA 1VOMA 3PDMP 1A7EA 1O3UA 4JCHA 1M2VA 4KNWA 1RKEB 2G62A 1A41A 3K1IA 4PJJA 2H7OA 3FMSA 1NFNA 1OQCA 3NG1A 4CS9C 2IXPA 2UUHA 4H4KC 1ORSC 4AX2A 1O87A 1D0ZA 3DAGA 4IWBA 4XLPF 4PFOA 2P0NA 3AG1C 2IM8A 1OW6A 1HW1A 3NRHA 4EKWA 3ABLC 3R7CA 2OU6A 2LFDA 5KYXB 3S28A 3AQBA 5E33A 3T4RA 3SNHA 4NCQA 1D1CA 4KC9A 1N1CA 4X0RA 2CCYA 1NFOA 2MHRA 4CDAA 2XL8A
chains in the Genus database with same CATH topology
5DVWA 3HJCA 3OA1A 5E3AA 2J45A 2M4EA 4E7SA 4BJ5C 2EIKC 4PJNA 4ULWA 4FESA 1BR1A 4GYTA 2VH3A 2J9UA 3ZIBA 4XWJA 2A6HF 3JYHA 3I5QA 3F46A 3DM5A 2W4MA 4I1MA 3MX3A 3S0XA 3NYLA 4M63A 1M57C 1QLEC 4C3BA 3K1HA 3S27A 2ZXWC 4HFKB 3DD7A 2W4BA 1Z63A 1Z23A 4LLEA 2W45A 3GANA 2Y3GA 2Q3TA 4MNDA 3KH2A 3RIPA 5L3QA 1VYIA 3W2WA 4BJ6C 4XLNF 2PF4E 5DLJA 3T6BA 2R7UA 1RJ9A 3RKOF 3EHNA 2Y3DA 2NG1A 4U5CE 2DYSC 5D92A 1ZHZA 3EGDB 3RFYA 2DYRC 3K7DA 4U5DE 2CNWA 4BJ6A 5B3SC 1BR2A 5KYWB 5D91A 1PD0A 1VK5A 5KYUA 4C7OA 4J32B 2XRHA 1ZHXA 4E7ZA 4G7HF 2P6VA 3NYMA 3ZSUA 2CGEA 1MMAA 4JZAA 4U5HA 3UMIA 2VASA 4CS8A 2A69F 2KW3C 3T6JA 2J46A 2IXNA 3EJNA 2CW0F 4PJLA 4CS7A 2J0XA 3UMKA 1NZEA 4Q4ZF 4HFFB 3AG4C 2E87A 3GODA 1W2WA 1PCXA 3DXJF 4JURI 2R7QA 1TWCA 3EPVA 1KU2A 4YT2A 4O6YA 3N24A 2MWQA 2MYSA 4KNVA 2PX0A 3K1IC 4G0HA 2CDQA 5KYXA 4DOZA 2Y3HA 2NUTB 3L34A 4OINF 4DBRA 4CIHA 4YJWA 4CSAA 2KJGA 2YEVA 3LLIA 2FGYA 4JVSA 4N06A 5F5HA 4ZLCA 4JJGA 3ASOC 2CNWD 1WGWA 3OWTA 1ZHYA 2H7BA 3B0UX 3O6XA 3EQLF 1S7ZA 3JCUQ 4YT8A 4BJTA 4G7ZF 3MLGA 4HE8D 2IXMA 3S29A 2EIMC 3LESA 1OCCC 1D1AA 3QZCA 4PK4A 4C3DA 3NKDA 1ZU4A 3N0TA 2R7SA 3FDQA 3KKBA 2Q9AA 2WVNA 3POVA 4OIPF 2B0JA 1ZHWA 4QI0A 5DS4A 1FTSA 3UR3C 2V26A 1OCZC 2DGJA 2YHSA 1M2OA 4KBLA 3TD7A 2R7OA 4DVZA 2ZXOA 3HTKC 2Z15A 3CZ6A 3DJUB 5F5FA 2WZFA 2OG2A 4AE4B 4MQ9F 4U5GA 3K33A 3FHDA 4U5EE 4OIRF 1BR4A 1D1BA 4DBQA 4OIQF 3EGDA 3QMKA 4PFPA 3DMDA 3EHMA 1IW7F 3KL4A 3UGPA 4P6IC 2EINC 5KYWA 2WZGA 5B1AC 4RD9A 1ST6A 3F47A 1OKKA 4O79A 3W8IA 4Q5SF 1LKXA 3NKEA 3DJNB 4IRUA 1NU7D 3M1CB 2ZXRA 4ANJA 3LEVA 1NU9C 3X1OA 2LSEA 3CQZA 5KYYB 4OIOF 4I3MA 3FVYA 1IZMA 3SZRA 5DQTA 4W8KA 4CS8C 2J7PA 3E9VA 1V55C 4LLCA 1MNEA 1OCOC 2PX3A 3V7OA 2Y3BA 2KNHA 3JSZA 1JPNA 4BJ1A 3Q7GA 4FX5A 4ZLDA 2WVOA 3WG7C 3ABKC 2I8BA 5CI9A 3LLKA 1TWAA 5DS6A 2GFHA 1ZHTA 2NUPA 4RBNA 1D0YA 2IYLD 3VYWA 2XXAB 2HV6A 3LAYA 1SZIA 4I1OB 1V54C 2Y69C 4DVYP 3CSKA 2L81A 1O5HA 4YT5A 4CSAC 5EHHA 2IXOA 1VMAA 2HV7A 3AQCA 3LNRA 2JD3A 3OEOA 2QY9A 4K0DA 4A2NB 4BG0A 4QI2A 2C03A 4C7OB 3I5PA 4IAOA 5T3WA 2D5RB 2EIJC 3ABMC 3EG9B 1VYKA 1QZXA 4YN0B 2A1DD 5IY5C 3LS0A 5EGYA 2EILC 2J7PD 2J9VA 3PMRA 2FFHA 1J8YF 4JW1A 4AK9A 2X51A 4G7OF 3UNGC 4AE4A 3AG2C 3W2VA 4HEAJ 3I4UA 3ECSA 1ZYRF 3UGOA 5DS5A 1MMGA 1TWHA 5E3CA 1SF8A 3AG3C 3B9QA 3EFOB 4K7BA 4O6NA 2QTVA 2XL4A 3DZAA 2R7WA 5HSWA 2O9XA 3EGXB 2ZPAA 4CBEA 4LERA 3B0PA 3IEEA 1TR2A 4O7GA 1MMNA 3RH3A 5KYYA 5CI8A 4Q7CA 2R7XA 1D0XA 3ASNC 4J30B 4CS9A 1M2VB 5KYNA 5E2QA 1TWGA 2KGOA 3NDBB 3X2QC 3EH1A 3EZIA 3N2ZB 4YT4A 2ZXPA 4B6IA 2VB6A 4RDAA 2Q9BA 4LACB 2A6EF 2R7VA 3EH2A 1Z6AA 4OD5A 2V3CC 2Q9CA 3DAFA 5T1DB 4BJ5A 3NYJA 3Q6NA 4OD4A 3UMHA 4XTKA 1G8XA 1FFHA 3HLZA 4GEHA 2W9YA 2J9WA 2XXAA 3K6BA 3E70C 5DQZA 3ZG1A 3B0VC 2OCCC 3ZC4A 1FFTC 2G3KA 3DM9B 4WJ0A 5B1BC 2G3VA 1Z3IX 2L9JA 4QDLA 2WVQA 1SMYF 2YZSA 5FCLA 3H65A 3ZVRA 2WL8A 1M56C 3WODF 4YWQA 3W8HA 4C3EA 2NUTA 4PJMA 2PP4A 4KI2A 4O6MA 2C04A 3SYNA 2P7VA 1RJ9B 3EG9A 3LJBA 4JJFA 3RYLA 2H7VC 1Z5ZA 4F4BA 1OCRC 2IOQA 4EBBA 1ZU5A 2PFDA 3ITFA 4IJJA 4NY3A 4U5FE 3Q6MA 1FMVA 1OKKD 1MMDA 2R7TA 2WB7A 3FAJA 1TKNA 2KQ9A 5KYUB 5L3VA 3KMIA 3K66A 3Q7LA 5BUOA 2R7RA 1PD1A 1FMWA 1NG1A 1J8MF 2XSEA 2BE5F 4EWCA 3JT1A 1MNDA 3SEOA 3EFOA 3LS1A 3O39A 3PHF2 4I44A 3EGXA 2Y39A 4FWVA 4U5BE 2WZLA 1LS1A 3VAYA 2NUPB 3EZHA 3JRTA 3L0IA 1LVKA 2J0WA 4BEJA 3SP1A 2A68F 1JPJA 1VOMA 4JCHA 1M2VA 4KNWA 2G62A 4PJJA 2H7OA 3NG1A 4CS9C 2IXPA 4H4KC 4AX2A 1O87A 1D0ZA 3DAGA 4IWBA 4XLPF 4PFOA 3AG1C 3NRHA 3ABLC 5KYXB 3S28A 3AQBA 5E33A 3T4RA 3SNHA 1D1CA 4KC9A 1N1CA 4X0RA 5T3TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I4U A; 
#chains in the Genus database with same CATH topology
 2HSB A;  2EPM X;  2KC3 A;  1HE9 A;  4XPX A;  1Y4C A;  5DVW A;  2R05 A;  4DRI B;  1VB5 A;  3HJC A;  2JX0 A;  3OA1 A;  5E3A A;  2KK1 A;  1HE1 A;  2J45 A;  5JSL A;  2M4E A;  1DOV A;  1KNY A;  3GM2 A;  4D4X A;  4MTG A;  4E7S A;  4BJ5 C;  2EIK C;  2EPK X;  4PJN A;  4JTD B;  4FES A;  1BR1 A;  4ULW A;  2QE9 A;  4GYT A;  2VH3 A;  3TJ6 A;  3AJM A;  1E86 A;  2J9U A;  2XLM A;  3ZIB A;  4XWJ A;  1AUE A;  2A6H F;  1TFO B;  4MVQ A;  1YYX A;  3JYH A;  4G78 A;  3I5Q A;  3RQF A;  5JRA A;  5JS5 A;  1YYJ A;  1WOL A;  3F46 A;  3VM6 A;  3JZ0 A;  3U0C A;  3DM5 A;  2W4M A;  4I1M A;  3MX3 A;  3S0X A;  3NYL A;  4M63 A;  1M57 C;  1QLE C;  4C3B A;  4MVS A;  5COM A;  1TQG A;  3K1H A;  3RVZ A;  3S27 A;  2ZXW C;  2XLD A;  4HFK B;  3DD7 A;  3GEE A;  2HS5 A;  2W4B A;  3S90 A;  1LM3 B;  1Z23 A;  1Z63 A;  3DI5 A;  4LLE A;  2W45 A;  3GAN A;  2Y3G A;  2Q3T A;  4MND A;  3KH2 A;  3RIP A;  5L3Q A;  2HMQ A;  3U2M A;  3L8I A;  1VYI A;  2XS1 A;  3W2W A;  3FXH A;  1JAF A;  4XLN F;  2PF4 E;  5DLJ A;  4BJ6 C;  5L0H A;  3T6B A;  3U2L A;  1ZZP A;  4ZLC A;  2EPN A;  2QNL A;  3V5Z A;  1CGM E;  1RJ9 A;  3RKO F;  2R7U A;  2OEX A;  4E0I A;  3EHN A;  3RVY A;  1QSP A;  2Y3D A;  2NG1 A;  4MVO A;  4U5C E;  1U6H A;  2DYS C;  1ZW3 A;  5FZT A;  1FR0 A;  5D92 A;  1ZHZ A;  3EGD B;  4IAR A;  3RFY A;  2DYR C;  3K7D A;  1QQ3 A;  4U5D E;  2CNW A;  3KPH A;  3QTH A;  4BJ6 A;  5B3S C;  5L0J A;  1BR2 A;  3C8G A;  5K0I A;  4BPM A;  5KYW B;  5D91 A;  3IQ5 A;  1PD0 A;  1EA8 A;  1VK5 A;  1G5Z A;  4MS2 A;  5KYU A;  3S84 A;  3DE8 A;  4BEM J;  4C7O A;  4J32 B;  1AEP A;  4YK5 A;  1ORY A;  2XRH A;  2LFF A;  4L6R A;  1ZHX A;  2R9R B;  4E7Z A;  4G7H F;  2P6V A;  3CAX A;  1YA7 O;  3NYM A;  3ZSU A;  4DRH B;  2CGE A;  1MMA A;  4JZA A;  4U5H A;  1JMW A;  3UMI A;  2VAS A;  4CS8 A;  1Q0F A;  1LE2 A;  2A69 F;  2LIG A;  3L8J A;  4MVR A;  3TUL A;  4NC3 A;  2KW3 C;  2I15 A;  4LDR A;  3T6J A;  1CPQ A;  1APC A;  2J46 A;  2IXN A;  3EJN A;  4CX9 A;  2L6F A;  2CW0 F;  3B71 A;  4PJL A;  4E18 A;  1YJG A;  2A0U A;  1E84 A;  4CS7 A;  5JT4 A;  1FNT c;  2J0X A;  3UMK A;  1XZQ A;  3US6 A;  1NZE A;  2LD6 A;  4Q4Z F;  4HFF B;  2JPU A;  1GGQ A;  3AG4 C;  3ZQY A;  5EK0 A;  1BDJ B;  3FOO A;  1K05 A;  2E87 A;  3GOD A;  1W2W A;  4IGG A;  3U9M A;  1PCX A;  256B A;  3DXJ F;  2A0B A;  1Z7Q c;  4FAP B;  4JUR I;  2R7Q A;  1OW7 A;  1YDI A;  1TWC A;  4YL0 A;  3SXZ A;  3EPV A;  3RQE A;  1VLS A;  2Q7R A;  4IAQ A;  4NTA A;  1KU2 A;  4YT2 A;  4O6Y A;  1XZP A;  3N24 A;  2MWQ A;  2XM0 A;  2MYS A;  2HUJ A;  2PX0 A;  4KNV A;  1Q0D A;  3K1I C;  5AGF A;  2YLG A;  3H2U A;  4JEB A;  4G0H A;  2CDQ A;  3TQO A;  3WHN A;  5KYX A;  2AU5 A;  4NQF A;  4DOZ A;  1KTM A;  2Y3H A;  1QPU A;  2NUT B;  2OJE D;  3L34 A;  4OIN F;  4DBR A;  1T01 A;  4CIH A;  4YJW A;  4CSA A;  1I4Z A;  3ATP A;  5JP7 A;  2XLO A;  4E0H A;  5CIV A;  3FOP A;  2KJG A;  2YEV A;  3LLI A;  3JTL O;  2FGY A;  4JVS A;  1WTY A;  2AWY A;  4N06 A;  5GPG B;  4JJG A;  1CPR A;  3TOM A;  5F5H A;  3QVZ A;  3ASO C;  3V5X A;  2CNW D;  1H7I A;  1WGW A;  3OWT A;  4XQ1 A;  3RF3 A;  1ZHY A;  1UFB A;  1BBH A;  5L0G A;  2H7B A;  2YLD A;  3C8G D;  3KYJ A;  3EQL F;  3KYI A;  1S7Z A;  2L6G A;  3JCU Q;  1T5O A;  3O6X A;  4YT8 A;  2XS8 A;  4BJT A;  4P9T A;  3C63 A;  5A6J A;  4IB4 A;  3ZDL A;  2RD9 A;  4G7Z F;  1S05 A;  4E17 A;  3TK0 A;  3MLG A;  1VLT A;  5A6B A;  4CJO A;  4XEV A;  1WWP A;  4HE8 D;  2IXM A;  3S29 A;  2EIM C;  2M64 A;  4W8P A;  1V4A A;  3LES A;  4Z9J A;  1OCC C;  1D1A A;  2XM4 A;  3QZC A;  4N6H A;  4PK4 A;  3H2V A;  3A11 A;  4C3D A;  3LUT B;  3ZTZ A;  2OOC A;  3NKD A;  1ZU4 A;  3N0T A;  2R7S A;  2LK4 A;  3FDQ A;  3KKB A;  2B0H A;  3R2P A;  2Q9A A;  1NSG B;  1ORJ A;  2KSF A;  2B0J A;  2GWW A;  2WVN A;  1ZHW A;  2P61 A;  4QI0 A;  5DS4 A;  1FTS A;  1T9K A;  2V26 A;  3FAP B;  1OCZ C;  3UR3 C;  1OR2 A;  4ULV A;  2DGJ A;  4J7T A;  4JCZ A;  3B0U X;  2YHS A;  1M2O A;  4JIO A;  1A0B A;  3QVY A;  4KBL A;  3TD7 A;  2R7O A;  5COF A;  2ZXO A;  3QW1 A;  2GA0 A;  2HSQ A;  4DVZ A;  4DRJ B;  1LIH A;  1CGN A;  2ZD9 A;  2Z15 A;  3HTK C;  2ETS A;  3CZ6 A;  3DJU B;  1Q0K A;  2VCC A;  5F5F A;  1T6U A;  2WZF A;  2TMV P;  4AL0 A;  2OG2 A;  4AE4 B;  2DB4 A;  4MQ9 F;  4U5G A;  3K33 A;  3FHD A;  4U5E E;  4OIR F;  1BR4 A;  1D1B A;  4DBQ A;  4OIQ F;  3EGD A;  3HKK A;  1I4Y A;  3QMK A;  4PFP A;  3DMD A;  4MVU A;  1RCP A;  3EHM A;  2IBF A;  3G4Z A;  1IW7 F;  3KL4 A;  3UGP A;  4P6I C;  2EIN C;  3L1M A;  5KYW A;  4XPW A;  4XPY A;  2WZG A;  1EI7 A;  2R03 A;  1C03 A;  5B1A C;  4RD9 A;  1ST6 A;  3F47 A;  1OKK A;  4O79 A;  5TJ5 E;  3U8V A;  1TFK B;  3W8I A;  5A6K A;  4Q5S F;  1LKX A;  2YL0 A;  3DJN B;  3NKE A;  4IRU A;  1HY5 A;  5BQG A;  1NU7 D;  2QUP A;  3M1C B;  3T6G B;  2ZXR A;  4XEK A;  3LEV A;  4ANJ A;  1NU9 C;  3X1O A;  2LSE A;  3CQZ A;  5KYY B;  4OIO F;  3A9C A;  4I3M A;  3G50 A;  3U8P A;  1ZVZ A;  2VCA A;  1CGO A;  3FVY A;  1C02 A;  1IZM A;  3SZR A;  1K40 A;  5DQT A;  5F28 E;  4AL1 A;  3GM1 A;  4W8K A;  2AVK A;  2Q4F A;  2J9B A;  4CS8 C;  1U0B B;  2J7P A;  1L7C A;  1K04 A;  5AC4 A;  4OIP F;  5JUA A;  3E9V A;  3U5S A;  3C18 A;  4JC7 A;  1V55 C;  4LLC A;  1WAS A;  2YL7 A;  2HZ8 A;  1BZ4 A;  4MW8 A;  1MNE A;  1OCO C;  2PX3 A;  1G4W R;  3V7O A;  2Y3B A;  2KNH A;  3JSZ A;  1JPN A;  1H9G A;  2ICW G;  4BJ1 A;  5L0F A;  3Q7G A;  4FX5 A;  4ZLD A;  2WVO A;  3ZTM A;  1G4U S;  3WG7 C;  3ABK C;  2I8B A;  1B68 A;  1Q0M A;  3VF0 A;  3MFN A;  5BQH A;  4H54 A;  3C8Z A;  4JTC B;  1ZW2 A;  5CI9 A;  1DOW A;  4YL3 A;  4N4W A;  3LLK A;  1TWA A;  1GQA A;  5DS6 A;  3ZWI A;  3DWW A;  1OR3 A;  2GFH A;  1EKY A;  1ZHT A;  5B3I A;  2LP4 A;  2NUP A;  4WGY A;  4RBN A;  1D0Y A;  1QKR A;  2IYL D;  3NMI A;  3VYW A;  4MVZ A;  2XXA B;  3U9J A;  3LEO A;  3GOR A;  2HV6 A;  3LAY A;  1SZI A;  3HNJ A;  1PV3 A;  1RKE A;  4I1O B;  1V54 C;  2OJQ A;  2Y69 C;  3CSK A;  4DVY P;  3HNL A;  1RXQ A;  3BRJ A;  4U9D A;  2L81 A;  1Q0G A;  1O5H A;  4YT5 A;  4CSA C;  5EHH A;  2IXO A;  1VMA A;  3JSE O;  1A7D A;  1JR8 A;  2HV7 A;  3MYF A;  3AQC A;  4EBJ A;  1SR2 A;  3LNR A;  1M6T A;  1MQV A;  2JD3 A;  3U3F A;  2YLI A;  3GM3 A;  4P9F A;  4D4N A;  1JRA A;  3OEO A;  2YL1 A;  1R4T A;  1AVO B;  2AWC A;  1LE4 A;  2QY9 A;  4K0D A;  3GWL A;  3TOL A;  3V5Y A;  2C03 A;  2VCB A;  3ZQV A;  3JYY A;  4A2N B;  4BG0 A;  4QI2 A;  5JVE A;  3LNM B;  4N6C A;  4C7O B;  3POV A;  3I5P A;  4DXW A;  4IAO A;  5T3W A;  2D5R B;  2EIJ C;  3ABM C;  3EG9 B;  1VYK A;  3GEI A;  1QZX A;  4JRZ A;  2EPL X;  5COG A;  1LI7 A;  2A1D D;  4YN0 B;  5IY5 C;  3LS0 A;  4JEA A;  5EGY A;  2EIL C;  2J7P D;  2NSG A;  2J9V A;  3PMR A;  2FFH A;  1J8Y F;  2KYH A;  4JW1 A;  2R02 A;  3MBG A;  4AK9 A;  2X51 A;  2NPU A;  4G7O F;  3SXY A;  3UNG C;  4AE4 A;  3AG2 C;  2H8A A;  3W2V A;  4HEA J;  3I4U A;  3ECS A;  1L3P A;  3AGU A;  2L7A A;  1ZYR F;  1YZA A;  1YZC A;  1XWJ A;  1MMG A;  3UGO A;  5DS5 A;  1TWH A;  2HMZ A;  5E3C A;  2XLH A;  4Z9H A;  5BQI A;  1SF8 A;  2LQG A;  3JRM O;  3AG3 C;  1QVX A;  2UUI A;  3B9Q A;  3EFO B;  4EHP A;  4K7B A;  4O6N A;  3QW0 A;  2QTV A;  2XL4 A;  3DZA A;  2R7W A;  5HSW A;  1LI5 A;  2O9X A;  2D4U A;  3EGX B;  2ZPA A;  4CBE A;  4LER A;  3B0P A;  4MTO A;  2HJ3 A;  1TR2 A;  1YA9 A;  3IEE A;  5JLI A;  4ONS A;  2XLV A;  1H6G A;  4Z9I A;  4O7G A;  1MMN A;  3RH3 A;  5KYY A;  5CI8 A;  4Q7C A;  4UDV A;  2R7X A;  1D0X A;  3ASN C;  4J30 B;  1V74 B;  4CDY A;  2OKU A;  5AC5 A;  1SYQ A;  1M2V B;  4CS9 A;  4JTA B;  5KYN A;  2YKZ A;  5E2Q A;  2F22 A;  3IQ6 A;  3WAQ A;  1TWG A;  2KGO A;  4GQH A;  3NDB B;  1VTM P;  3X2Q C;  3EH1 A;  3RW0 A;  1HMD A;  3EZI A;  3N2Z B;  4YT4 A;  3C62 A;  1R5I D;  3GEH A;  2ZXP A;  3M4B A;  4B6I A;  2YVK A;  1EQ1 A;  4U9E A;  1JOG A;  2VB6 A;  3BEH A;  2RSE B;  5A6A A;  2XLW A;  4RDA A;  2Q9B A;  4LAC B;  4EUK B;  2A6E F;  3IPM O;  2R7V A;  4CIP A;  3M15 A;  3EH2 A;  3U3B A;  1HMO A;  1Z6A A;  4MTF A;  2XL6 A;  4WAB A;  1YAU O;  4OD5 A;  2CYD A;  2V3C C;  2Q9C A;  3DAF A;  4NTB A;  5T1D B;  4BJ5 A;  4EIY A;  1GM5 A;  3NMK A;  3W4Y A;  3IQC A;  2QLA A;  3NYJ A;  3Q6N A;  4OD4 A;  3UMH A;  4XTK A;  1G8X A;  3M4C A;  4MVM A;  1FFH A;  1LS4 A;  3HLZ A;  2PBE A;  4J7Y A;  1WN0 A;  4MW3 A;  4GEH A;  2AP3 A;  2R25 A;  2W9Y A;  2J9W A;  2VC9 A;  2XXA A;  2HJM A;  2ASR A;  3GWN A;  3O10 A;  5A6B D;  4PAC A;  3K6B A;  3B29 A;  1E2X A;  4YL1 A;  3E70 C;  3S9O A;  5DQZ A;  3ZG1 A;  4CJG A;  4EBK A;  3B0V C;  2OCC C;  3ZC4 A;  3NMJ A;  1FFT C;  2G3K A;  3DM9 B;  4WJ0 A;  5B1B C;  1T6I A;  2G3V A;  1Z3I X;  2L9J A;  3J06 A;  1I5N A;  2HKV A;  2WVQ A;  4QDL A;  1SMY F;  2YZS A;  5FCL A;  5L0C A;  5HV9 A;  1NBB A;  3H65 A;  3ZVR A;  2WL8 A;  3IHU A;  1M56 C;  5T3T A;  3WOD F;  2L6H A;  3SXK A;  1E85 A;  1U89 A;  2YWA A;  4YWQ A;  1UG7 A;  3W8H A;  4C3E A;  3O55 A;  2NUT A;  2XLE A;  1OXB A;  4PJM A;  2PP4 A;  2GDC A;  1H9T A;  4O6M A;  4KI2 A;  2C04 A;  2YL3 A;  3SYN A;  3VRC A;  2P7V A;  1RJ9 B;  3EG9 A;  3LJB A;  4JJF A;  4NTF A;  4R32 A;  4A4A A;  3RYL A;  4PR9 A;  1E83 A;  2NSF A;  2H7V C;  1HW2 A;  2X0C A;  2DI3 A;  5L0D A;  1Z5Z A;  4WGZ A;  1T6Q A;  1OCR C;  4K1O A;  2IOQ A;  2OEV A;  3AGT A;  3DE9 A;  4F4B A;  3TJ5 A;  1OW8 A;  4EBB A;  1ZU5 A;  2PFD A;  3ITF A;  3G4X A;  1A7V A;  1LPE A;  4IJJ A;  4NY3 A;  4U5F E;  3Q6M A;  1FMV A;  1RKC A;  4XEF A;  3C8G B;  3HNI A;  1OKK D;  1MMD A;  2PNO A;  2R7T A;  2P1A A;  2WB7 A;  3DKA A;  3FAJ A;  1TKN A;  2KQ9 A;  2YRF A;  5L3V A;  5KYU B;  3KMI A;  3K66 A;  3PCV A;  4JKV A;  3Q7L A;  2J8W A;  5BUO A;  3CEX A;  3SXM A;  2R7R A;  3HNK A;  1PD1 A;  1FMW A;  1OXK A;  1NG1 A;  2YQY A;  1J8M F;  2XSE A;  4ER9 A;  2BE5 F;  2BL2 A;  1C17 M;  2FAP B;  2Q00 A;  1F1M A;  4EWC A;  3JT1 A;  1MND A;  3SEO A;  1RMV A;  3EFO A;  3LS1 A;  3O39 A;  1YVI A;  3T9O A;  4I44 A;  3PHF 2;  3M79 A;  1WAT A;  4LDQ A;  2GAQ A;  1FAP B;  1YLM A;  1YAR O;  3EGX A;  3MYI A;  4LDK A;  2Y39 A;  4JE9 A;  4FWV A;  4U5B E;  2WZL A;  4DJ9 A;  1LS1 A;  2HFI A;  3VAY A;  3C7J A;  3RQG A;  2NUP B;  3EZH A;  1GS9 A;  3JRT A;  1LVK A;  3AOU A;  3L0I A;  4CDV A;  5L0I A;  2J0W A;  2LCH A;  3SP1 A;  4BEJ A;  2A68 F;  2OQM A;  5A69 A;  1NLX A;  1JPJ A;  3IQT A;  1Y6D A;  2BC5 A;  2EPO A;  1VOM A;  3PDM P;  1A7E A;  1O3U A;  4JCH A;  1M2V A;  4KNW A;  1RKE B;  2G62 A;  1A41 A;  3K1I A;  4PJJ A;  2H7O A;  3FMS A;  1NFN A;  1OQC A;  3NG1 A;  4CS9 C;  2IXP A;  2UUH A;  4H4K C;  1ORS C;  4AX2 A;  1O87 A;  1D0Z A;  3DAG A;  4IWB A;  4XLP F;  4PFO A;  2P0N A;  3AG1 C;  2IM8 A;  1OW6 A;  1HW1 A;  3NRH A;  4EKW A;  3ABL C;  3R7C A;  2OU6 A;  2LFD A;  5KYX B;  3S28 A;  3AQB A;  5E33 A;  3T4R A;  3SNH A;  4NCQ A;  1D1C A;  4KC9 A;  1N1C A;  4X0R A;  2CCY A;  1NFO A;  2MHR A;  4CDA A;  2XL8 A; 
#chains in the Genus database with same CATH homology
 5DVW A;  3HJC A;  3OA1 A;  5E3A A;  2J45 A;  2M4E A;  4E7S A;  4BJ5 C;  2EIK C;  4PJN A;  4ULW A;  4FES A;  1BR1 A;  4GYT A;  2VH3 A;  2J9U A;  3ZIB A;  4XWJ A;  2A6H F;  3JYH A;  3I5Q A;  3F46 A;  3DM5 A;  2W4M A;  4I1M A;  3MX3 A;  3S0X A;  3NYL A;  4M63 A;  1M57 C;  1QLE C;  4C3B A;  3K1H A;  3S27 A;  2ZXW C;  4HFK B;  3DD7 A;  2W4B A;  1Z63 A;  1Z23 A;  4LLE A;  2W45 A;  3GAN A;  2Y3G A;  2Q3T A;  4MND A;  3KH2 A;  3RIP A;  5L3Q A;  1VYI A;  3W2W A;  4BJ6 C;  4XLN F;  2PF4 E;  5DLJ A;  3T6B A;  2R7U A;  1RJ9 A;  3RKO F;  3EHN A;  2Y3D A;  2NG1 A;  4U5C E;  2DYS C;  5D92 A;  1ZHZ A;  3EGD B;  3RFY A;  2DYR C;  3K7D A;  4U5D E;  2CNW A;  4BJ6 A;  5B3S C;  1BR2 A;  5KYW B;  5D91 A;  1PD0 A;  1VK5 A;  5KYU A;  4C7O A;  4J32 B;  2XRH A;  1ZHX A;  4E7Z A;  4G7H F;  2P6V A;  3NYM A;  3ZSU A;  2CGE A;  1MMA A;  4JZA A;  4U5H A;  3UMI A;  2VAS A;  4CS8 A;  2A69 F;  2KW3 C;  3T6J A;  2J46 A;  2IXN A;  3EJN A;  2CW0 F;  4PJL A;  4CS7 A;  2J0X A;  3UMK A;  1NZE A;  4Q4Z F;  4HFF B;  3AG4 C;  2E87 A;  3GOD A;  1W2W A;  1PCX A;  3DXJ F;  4JUR I;  2R7Q A;  1TWC A;  3EPV A;  1KU2 A;  4YT2 A;  4O6Y A;  3N24 A;  2MWQ A;  2MYS A;  4KNV A;  2PX0 A;  3K1I C;  4G0H A;  2CDQ A;  5KYX A;  4DOZ A;  2Y3H A;  2NUT B;  3L34 A;  4OIN F;  4DBR A;  4CIH A;  4YJW A;  4CSA A;  2KJG A;  2YEV A;  3LLI A;  2FGY A;  4JVS A;  4N06 A;  5F5H A;  4ZLC A;  4JJG A;  3ASO C;  2CNW D;  1WGW A;  3OWT A;  1ZHY A;  2H7B A;  3B0U X;  3O6X A;  3EQL F;  1S7Z A;  3JCU Q;  4YT8 A;  4BJT A;  4G7Z F;  3MLG A;  4HE8 D;  2IXM A;  3S29 A;  2EIM C;  3LES A;  1OCC C;  1D1A A;  3QZC A;  4PK4 A;  4C3D A;  3NKD A;  1ZU4 A;  3N0T A;  2R7S A;  3FDQ A;  3KKB A;  2Q9A A;  2WVN A;  3POV A;  4OIP F;  2B0J A;  1ZHW A;  4QI0 A;  5DS4 A;  1FTS A;  3UR3 C;  2V26 A;  1OCZ C;  2DGJ A;  2YHS A;  1M2O A;  4KBL A;  3TD7 A;  2R7O A;  4DVZ A;  2ZXO A;  3HTK C;  2Z15 A;  3CZ6 A;  3DJU B;  5F5F A;  2WZF A;  2OG2 A;  4AE4 B;  4MQ9 F;  4U5G A;  3K33 A;  3FHD A;  4U5E E;  4OIR F;  1BR4 A;  1D1B A;  4DBQ A;  4OIQ F;  3EGD A;  3QMK A;  4PFP A;  3DMD A;  3EHM A;  1IW7 F;  3KL4 A;  3UGP A;  4P6I C;  2EIN C;  5KYW A;  2WZG A;  5B1A C;  4RD9 A;  1ST6 A;  3F47 A;  1OKK A;  4O79 A;  3W8I A;  4Q5S F;  1LKX A;  3NKE A;  3DJN B;  4IRU A;  1NU7 D;  3M1C B;  2ZXR A;  4ANJ A;  3LEV A;  1NU9 C;  3X1O A;  2LSE A;  3CQZ A;  5KYY B;  4OIO F;  4I3M A;  3FVY A;  1IZM A;  3SZR A;  5DQT A;  4W8K A;  4CS8 C;  2J7P A;  3E9V A;  1V55 C;  4LLC A;  1MNE A;  1OCO C;  2PX3 A;  3V7O A;  2Y3B A;  2KNH A;  3JSZ A;  1JPN A;  4BJ1 A;  3Q7G A;  4FX5 A;  4ZLD A;  2WVO A;  3WG7 C;  3ABK C;  2I8B A;  5CI9 A;  3LLK A;  1TWA A;  5DS6 A;  2GFH A;  1ZHT A;  2NUP A;  4RBN A;  1D0Y A;  2IYL D;  3VYW A;  2XXA B;  2HV6 A;  3LAY A;  1SZI A;  4I1O B;  1V54 C;  2Y69 C;  4DVY P;  3CSK A;  2L81 A;  1O5H A;  4YT5 A;  4CSA C;  5EHH A;  2IXO A;  1VMA A;  2HV7 A;  3AQC A;  3LNR A;  2JD3 A;  3OEO A;  2QY9 A;  4K0D A;  4A2N B;  4BG0 A;  4QI2 A;  2C03 A;  4C7O B;  3I5P A;  4IAO A;  5T3W A;  2D5R B;  2EIJ C;  3ABM C;  3EG9 B;  1VYK A;  1QZX A;  4YN0 B;  2A1D D;  5IY5 C;  3LS0 A;  5EGY A;  2EIL C;  2J7P D;  2J9V A;  3PMR A;  2FFH A;  1J8Y F;  4JW1 A;  4AK9 A;  2X51 A;  4G7O F;  3UNG C;  4AE4 A;  3AG2 C;  3W2V A;  4HEA J;  3I4U A;  3ECS A;  1ZYR F;  3UGO A;  5DS5 A;  1MMG A;  1TWH A;  5E3C A;  1SF8 A;  3AG3 C;  3B9Q A;  3EFO B;  4K7B A;  4O6N A;  2QTV A;  2XL4 A;  3DZA A;  2R7W A;  5HSW A;  2O9X A;  3EGX B;  2ZPA A;  4CBE A;  4LER A;  3B0P A;  3IEE A;  1TR2 A;  4O7G A;  1MMN A;  3RH3 A;  5KYY A;  5CI8 A;  4Q7C A;  2R7X A;  1D0X A;  3ASN C;  4J30 B;  4CS9 A;  1M2V B;  5KYN A;  5E2Q A;  1TWG A;  2KGO A;  3NDB B;  3X2Q C;  3EH1 A;  3EZI A;  3N2Z B;  4YT4 A;  2ZXP A;  4B6I A;  2VB6 A;  4RDA A;  2Q9B A;  4LAC B;  2A6E F;  2R7V A;  3EH2 A;  1Z6A A;  4OD5 A;  2V3C C;  2Q9C A;  3DAF A;  5T1D B;  4BJ5 A;  3NYJ A;  3Q6N A;  4OD4 A;  3UMH A;  4XTK A;  1G8X A;  1FFH A;  3HLZ A;  4GEH A;  2W9Y A;  2J9W A;  2XXA A;  3K6B A;  3E70 C;  5DQZ A;  3ZG1 A;  3B0V C;  2OCC C;  3ZC4 A;  1FFT C;  2G3K A;  3DM9 B;  4WJ0 A;  5B1B C;  2G3V A;  1Z3I X;  2L9J A;  4QDL A;  2WVQ A;  1SMY F;  2YZS A;  5FCL A;  3H65 A;  3ZVR A;  2WL8 A;  1M56 C;  3WOD F;  4YWQ A;  3W8H A;  4C3E A;  2NUT A;  4PJM A;  2PP4 A;  4KI2 A;  4O6M A;  2C04 A;  3SYN A;  2P7V A;  1RJ9 B;  3EG9 A;  3LJB A;  4JJF A;  3RYL A;  2H7V C;  1Z5Z A;  4F4B A;  1OCR C;  2IOQ A;  4EBB A;  1ZU5 A;  2PFD A;  3ITF A;  4IJJ A;  4NY3 A;  4U5F E;  3Q6M A;  1FMV A;  1OKK D;  1MMD A;  2R7T A;  2WB7 A;  3FAJ A;  1TKN A;  2KQ9 A;  5KYU B;  5L3V A;  3KMI A;  3K66 A;  3Q7L A;  5BUO A;  2R7R A;  1PD1 A;  1FMW A;  1NG1 A;  1J8M F;  2XSE A;  2BE5 F;  4EWC A;  3JT1 A;  1MND A;  3SEO A;  3EFO A;  3LS1 A;  3O39 A;  3PHF 2;  4I44 A;  3EGX A;  2Y39 A;  4FWV A;  4U5B E;  2WZL A;  1LS1 A;  3VAY A;  2NUP B;  3EZH A;  3JRT A;  3L0I A;  1LVK A;  2J0W A;  4BEJ A;  3SP1 A;  2A68 F;  1JPJ A;  1VOM A;  4JCH A;  1M2V A;  4KNW A;  2G62 A;  4PJJ A;  2H7O A;  3NG1 A;  4CS9 C;  2IXP A;  4H4K C;  4AX2 A;  1O87 A;  1D0Z A;  3DAG A;  4IWB A;  4XLP F;  4PFO A;  3AG1 C;  3NRH A;  3ABL C;  5KYX B;  3S28 A;  3AQB A;  5E33 A;  3T4R A;  3SNH A;  1D1C A;  4KC9 A;  1N1C A;  4X0R A;  5T3T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...