3I4UA

Crystal structure analysis of a helicase associated domain
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
247
structure length
241
Chain Sequence
GSPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQTEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKSTVRVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQPEWVVYHELVLTTKEYMREVTTIDPRWLVEFAPAFFKVLDHGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ATP-dependent RNA helicase DHX8
publication title Structural analysis of the C-terminal domain of the spliceosomal helicase Prp22
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 79
structure length 241
sequence length 247
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2009-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04408 HA2 Helicase associated domain (HA2)
A PF07717 OB_NTP_bind Oligonucleotide/oligosaccharide-binding (OB)-fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1080 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3i4uA01
3I4UA
chains in the Genus database with same CATH superfamily
1K05A 4A4AA 3LS1A 4L6RA 2Q9CA 2NPUA 2L9JA 1PV3A 3ABKC 3M4BA 1PD1A 3NKEA 4XTKA 4AE4B 2R7UA 1VYIA 1NFOA 3S0XA 2XLHA 3TJ5A 1C17M 3WODF 4A2NB 1D0XA 4EBKA 3OWTA 5GPGB 5D91A 2A1DD 1LE2A 1I5NA 4U5BE 2XS8A 1Q0FA 5AC4A 4D4XA 2YL7A 1Z6AA 2OEXA 1GS9A 2J9BA 3T9OA 5A6KA 5JT4A 1G8XA 1RKCA 2H8AA 1Q0GA 2UUIA 1UFBA 4CDVA 3R2PA 3GODA 5BUOA 1QVXA 3B0PA 3DMDA 1O87A 2WZFA 1NG1A 4HFFB 2KSFA 1BZ4A 1TKNA 2PFDA 4OIRF 2XLDA 1CGOA 1V54C 1B68A 3C8ZA 3JRMO 1I4ZA 4CIPA 3L1MA 4CS9A 4KI2A 2KYHA 2GA0A 2J7PD 2OG2A 5L0GA 3W8HA 4IGGA 2MWQA 1L3PA 4RBNA 1LVKA 4U5EE 4O7GA 3TOMA 1E83A 1WWPA 2JPUA 2QY9A 2AWYA 4MNDA 3T6JA 4CS8C 1GQAA 2BC5A 3TJ6A 3N24A 1QKRA 3GM3A 2R02A 4NQFA 4YL3A 4OIPF 4U5FE 1BDJB 1H6GA 1NLXA 1BR4A 3F47A 5T1DB 1JPNA 5CI9A 3AG1C 3GEEA 4JEBA 5D92A 1VB5A 5L0JA 1EQ1A 2DGJA 2VC9A 1BBHA 5FZTA 3U8VA 1JOGA 3PDMP 2KNHA 4JJFA 3C8GA 3B0UX 3EJNA 1NFNA 3AJMA 4K0DA 1SYQA 4IJJA 4DOZA 3A9CA 2J9VA 4HE8D 4DVZA 1E85A 4P6IC 4YJWA 1OKKD 5A6BD 4JEAA 3AG4C 2XLVA 2X0CA 1O5HA 5T3TA 1H9GA 3SXZA 3QVYA 4NY3A 4U5CE 1HW1A 2PF4E 3X1OA 3G4XA 3ZTMA 4DBRA 4K1OA 1YVIA 1SMYF 2R7VA 2G3VA 3S29A 1M56C 1GM5A 1O3UA 4XEKA 3RYLA 4B6IA 3TOLA 4BPMA 1U6HA 3Q6NA 3RQEA 3V5XA 3L8IA 3QW0A 3JSEO 1LKXA 4PACA 4DXWA 3CAXA 4I3MA 2XXAA 1ZHZA 3DM5A 1XWJA 3G4ZA 3NMJA 1HMOA 1LIHA 5F5FA 4CS8A 3EG9A 5JVEA 1HY5A 1HE1A 2A6HF 3RIPA 1G4WR 1HE9A 2KJGA 2YZSA 4QDLA 3AGUA 4I1OB 5DS6A 5KYWB 1Z23A 1U0BB 3M15A 1J8YF 2DYRC 1VOMA 4R32A 3S28A 4FX5A 2KGOA 3RFYA 1OW6A 4XEVA 1PD0A 1A7VA 4HFKB 1JRAA 4C3EA 3AOUA 2QNLA 1Z3IX 4WGYA 3K1IC 1TWHA 5K0IA 3EZIA 4Q4ZF 4N6HA 3TK0A 2XSEA 1D0ZA 2XM4A 1TWCA 4FWVA 4GYTA 5L0FA 2J9UA 2YRFA 4E0IA 1T6QA 3EZHA 3S27A 2WZLA 2OJQA 1AEPA 2HUJA 3IPMO 4PFPA 1Z63A 2R7XA 3U3BA 2ZXWC 5E33A 2AVKA 4C3DA 3ZG1A 1VK5A 1RCPA 2EINC 2J0WA 3AGTA 1D1CA 4J7YA 3ZSUA 4OIOF 1Y4CA 1WTYA 2UUHA 2XLOA 3H2VA 3VYWA 4XWJA 1QPUA 4MVRA 3CZ6A 5TJ5E 3Q6MA 3T6BA 4EBBA 3RVYA 2DB4A 1YARO 3UGOA 1TWAA 4LDRA 1YLMA 3DXJF 3SXYA 2P61A 3CSKA 3GM2A 1TFKB 2YL1A 2PNOA 3ZWIA 1JPJA 3EHNA 5FCLA 5KYWA 1LPEA 4CDYA 2EPNA 1FMVA 3EPVA 2QE9A 3O39A 3FAJA 1NZEA 1FNTc 4G78A 5E3CA 1RKEA 4LDQA 4C7OB 3RQGA 3W8IA 3K1IA 2KK1A 3DAGA 1V55C 2J45A 3NMIA 2HZ8A 2IXOA 4Z9HA 3U8PA 5L0IA 1NSGB 3EGDA 2J46A 4OD5A 2KC3A 2B0HA 1RJ9A 3M4CA 1FTSA 1YAUO 1Y6DA 4PK4A 2HSBA 2EIJC 3I5QA 1YZAA 1OW8A 4P9FA 4DRIB 1CPQA 2A0BA 2XLEA 3JSZA 4PJNA 2OQMA 3PMRA 2YVKA 2G3KA 2ZXOA 2NSGA 1TFOB 4ER9A 2BE5F 3US6A 4JRZA 4XPXA 2LIGA 3H2UA 4JTAB 5EK0A 1M2VA 2M4EA 2Y3HA 1ZYRF 5KYXA 2R7SA 2R25A 1C03A 2C03A 3QMKA 1YDIA 4IRUA 2F22A 4N4WA 1MMNA 1QQ3A 4MTGA 3CQZA 3NG1A 2YLIA 1KU2A 1MMDA 3JTLO 3M1CB 2WL8A 3PHF2 3NMKA 2VCAA 3NKDA 3KYJA 2VCCA 4MW8A 4XPYA 1MNDA 4AL1A 1W2WA 2HS5A 2W9YA 3UMIA 4KNWA 2YEVA 5CI8A 1CPRA 1OCCC 3EGDB 3M79A 1V74B 3OEOA 2X51A 2YQYA 4J7TA 3JRTA 4DRJB 1MNEA 3RW0A 1E84A 1RJ9B 4OIQF 3HTKC 4CJOA 4EHPA 2J9WA 4E0HA 2KW3C 2E87A 3DWWA 3SXMA 3LAYA 2B0JA 1APCA 3RH3A 1NU7D 3S90A 5T3WA 4ZLDA 2DI3A 3LJBA 2H7OA 1WASA 2RSEB 3I4UA 4OD4A 2PX0A 1NU9C 3FVYA 1QSPA 1M2OA 2Y69C 1A7DA 2AU5A 4PR9A 4PJLA 3ZIBA 1R5ID 1M2VB 3E9VA 5B1AC 3ABMC 3FAPB 1XZQA 3IQ5A 3ZVRA 5BQHA 1YYJA 3AQCA 2NUTA 2R7QA 1M6TA 3MLGA 1U89A 1LI7A 4N06A 3V5YA 4E18A 2ASRA 4CDAA 4YT2A 3SXKA 2P0NA 4JW1A 4CBEA 2XS1A 1WOLA 3FOPA 3MFNA 2GAQA 4I1MA 4LERA 3VAYA 1SR2A 5IY5C 3I5PA 3SNHA 2WB7A 4KBLA 3WHNA 2P6VA 5DS5A 2WZGA 2EPKX 2HMQA 5COMA 3KMIA 5HV9A 1H9TA 2W4MA 2YLGA 2R05A 2LCHA 2G62A 4JIOA 4X0RA 1K04A 3U5SA 4YT8A 5A6BA 1OKKA 1WGWA 2FGYA 2OCCC 3SZRA 2Q7RA 2XL8A 3GEIA 4PJJA 2R9RB 1YZCA 1JAFA 3FOOA 3QTHA 3RKOF 1T6UA 3ATPA 2MYSA 5KYNA 2NUTB 3IHUA 4M63A 2QLAA 3DE9A 4LACB 3C18A 3ITFA 2AP3A 3RF3A 3C8GB 2CDQA 5KYUA 3TULA 3IQTA 2R03A 3V5ZA 3LNMB 3GORA 1E86A 3KL4A 2DYSC 1SF8A 1LM3B 4JJGA 4YT5A 2QTVA 3EH2A 4AE4A 5L0DA 2EPOA 3QZCA 3DKAA 2OOCA 2L7AA 1M57C 3LLKA 2H7BA 2CNWD 2NUPA 4Q7CA 3VM6A 3ZQYA 1ZW3A 2Y3GA 4C3BA 4BJ6C 4DBQA 1RMVA 3ZC4A 1FAPB 1SZIA 2LD6A 3U3FA 1FFHA 3LLIA 1S7ZA 3U9MA 2TMVP 1I4YA 4JCHA 1HMDA 5A69A 2CYDA 2XXAB 1GGQA 3K66A 3RQFA 3C62A 3K1HA 3DAFA 3SYNA 5B1BC 4Z9JA 4YWQA 3SP1A 1T6IA 4IAQA 4G7ZF 4EBJA 3EG9B 1FFTC 3QW1A 2IOQA 2EIKC 4JE9A 4JC7A 3UNGC 4KNVA 5KYUB 3U2LA 3IQ6A 1T9KA 1TWGA 2L6FA 1ZHWA 2HFIA 4NCQA 4U5DE 4MTFA 4E7SA 2IXMA 1IZMA 2I8BA 1Z5ZA 3BRJA 3W2VA 3N2ZB 1YJGA 3TQOA 2IM8A 2ZXRA 4HEAJ 3N0TA 1T5OA 2LQGA 3HNJA 3SEOA 3ZQVA 4BJ5C 2ZD9A 1OR2A 1AVOB 4GQHA 4J32B 3HKKA 3MYIA 4CS7A 2IYLD 3IEEA 2H7VC 1ZW2A 3BEHA 2XLMA 2IXPA 3L8JA 3KKBA 1YA9A 3L0IA 2C04A 1ORYA 2W4BA 4PJMA 5E3AA 4MVOA 1FR0A 4JURI 2A69F 2Y3BA 1MMGA 2LK4A 2IBFA 1LE4A 3C63A 1ZHYA 4WABA 5BQGA 4BJ6A 2EILC 3ZTZA 3JZ0A 3GWNA 5A6AA 4XQ1A 4WJ0A 4E7ZA 3ASOC 4O6MA 5L3QA 4UDVA 4F4BA 2Q9BA 4EWCA 2W45A 1NBBA 1VTMP 4MVQA 4WGZA 2QUPA 4NTFA 2Q9AA 4BG0A 3AG2C 2EPMX 3FDQA 2MHRA 1YYXA 2YKZA 5L3VA 3FMSA 3Q7LA 3PCVA 1QZXA 3S84A 3O55A 1G5ZA 5B3SC 2R7TA 1V4AA 3B71A 2LP4A 4MQ9F 4BJ1A 4CX9A 2HV6A 3U9JA 4ZLCA 1YA7O 5KYXB 3UGPA 4EIYA 4YK5A 1RKEB 3ASNC 4MW3A 4BJTA 1D0YA 1RXQA 4RD9A 4KC9A 1LI5A 2J0XA 2V26A 4NTBA 4EUKB 4QI2A 2HV7A 3U2MA 1N1CA 3G50A 3HLZA 1LS4A 1KNYA 3O6XA 3DM9B 4IWBA 5CIVA 3TD7A 1D1BA 1S05A 2ETSA 5F28E 4U9DA 3UR3C 5JP7A 4BJ5A 4DRHB 2PBEA 4H4KC 4JKVA 3ABLC 4XPWA 1FMWA 1OCRC 4I44A 5A6JA 1VLSA 4J30B 3VRCA 4MVUA 3DD7A 3EFOA 4W8KA 2OU6A 2J7PA 2BL2A 3GEHA 3HNKA 3HNLA 2PX3A 4ULVA 5F5HA 2JX0A 2YWAA 1C02A 1VYKA 3NRHA 4MVZA 1OCOC 4PFOA 3WG7C 4FAPB 1MMAA 5E2QA 4JTCB 4XLPF 1DOVA 1ZZPA 4MVSA 1J8MF 2Y3DA 1TR2A 1EI7A 4E17A 1R4TA 2I15A 2XL4A 2YL0A 3JYYA 1EA8A 4G0HA 1ZU4A 5DLJA 4CSAC 4CJGA 4W8PA 1TQGA 3EGXA 1BR2A 4H54A 5B3IA 4LLCA 1ZVZA 4XLNF 2YL3A 3DI5A 3KPHA 4QI0A 1ZU5A 3DZAA 4D4NA 2HKVA 4GEHA 1KTMA 1WATA 5JUAA 2KQ9A 1UG7A 1VLTA 5JS5A 2CGEA 2XLWA 3ECSA 3MYFA 5DVWA 2R7WA 4BEMJ 2VH3A 1CGME 1IW7F 3C8GD 2L81A 3EFOB 2EIMC 1D1AA 1QLEC 1BR1A 3AG3C 5DQTA 1K40A 4YN0B 5L0HA 3K6BA 1LS1A 1ORJA 4IARA 1MQVA 2OEVA 2P1AA 2OKUA 4LLEA 4EKWA 1G4US 2LFFA 4DVYP 4MTOA 3S9OA 3VF0A 3DJUB 3J06A 2Y39A 3B9QA 3E70C 2CW0F 3GM1A 2D5RB 3AQBA 2AWCA 3EGXB 4XEFA 3FXHA 3F46A 3IQCA 1VMAA 4U5GA 1L7CA 3GWLA 1OW7A 3FHDA 3LEVA 5JLIA 4G7HF 3K33A 4DJ9A 4Z9IA 3KYIA 2LSEA 4K7BA 3UMHA 5EGYA 2P7VA 4G7OF 4AK9A 4CSAA 2L6GA 2Q00A 1AUEA 2XL6A 1ST6A 1F1MA 1ORSC 2VCBA 3A11A 3MBGA 1Q0KA 5JSLA 3R7CA 3U0CA 4U5HA 4O79A 5AGFA 1DOWA 3LEOA 5KYYA 3EH1A 4JCZA 3NYMA 3B0VC 2YLDA 2ZPAA 4JZAA 1OR3A 1JR8A 1Q0DA 2Z15A 3DJNB 3HJCA 3WAQA 1WN0A 1OQCA 3NYJA 2CNWA 3LUTB 3UMKA 3V7OA 2CCYA 1OXKA 4RDAA 5HSWA 2RD9A 1PCXA 2IXNA 3MX3A 4NTAA 2R7RA 5L0CA 1Z7Qc 2NSFA 2VB6A 1CGNA 256BA 2L6HA 3EHMA 4N6CA 4O6NA 5DS4A 4MVMA 3H65A 3POVA 1A7EA 3W2WA 2HMZA 2WVQA 4O6YA 3HNIA 4CIHA 1H7IA 5COGA 5JRAA 4JTDB 3X2QC 3T4RA 4ULWA 3W4YA 2EPLX 4BEJA 3B29A 2FAPB 3LS0A 3CEXA 3KH2A 4LDKA 3LNRA 4MS2A 2NUPB 2Q4FA 4ONSA 3RVZA 5AC5A 2V3CC 3OA1A 3JCUQ 5DQZA 2HJ3A 4AL0A 2LFDA 5KYYB 3C7JA 5BQIA 3O10A 4FESA 1XZPA 2A0UA 2PP4A 3GANA 2M64A 2WVNA 4C7OA 3JYHA 3DE8A 3T6GB 2OJED 2HJMA 3EQLF 2NG1A 1JMWA 1OXBA 1Q0MA 2JD3A 2VASA 3Q7GA 4Q5SF 2GFHA 5COFA 1T01A 2FFHA 2R7OA 2A6EF 2A68F 3L34A 2GWWA 2J8WA 4IB4A 4OINF 2GDCA 4AX2A 2XM0A 2WVOA 1ZHTA 2ICWG 3K7DA 4U9EA 4NC3A 1OCZC 2ZXPA 4IAOA 1EKYA 3LESA 4P9TA 2XRHA 5EHHA 4YL0A 1A0BA 4YT4A 2YHSA 4CS9C 2HSQA 1E2XA 4YL1A 3JT1A 3NDBB 2O9XA 3QVZA 2D4UA 3NYLA 1ZHXA 2Q3TA 4ANJA 1HW2A 3ZDLA 1A41A 4JVSA
chains in the Genus database with same CATH topology
3LS1A 2Q9CA 2L9JA 3ABKC 1PD1A 3NKEA 4XTKA 4AE4B 2R7UA 1VYIA 3S0XA 3WODF 4A2NB 1D0XA 3OWTA 5D91A 2A1DD 4U5BE 1Z6AA 1G8XA 3GODA 5BUOA 3B0PA 3DMDA 1O87A 2WZFA 1NG1A 4HFFB 4OIRF 1TKNA 2PFDA 1V54C 4CS9A 4KI2A 2J7PD 2OG2A 3W8HA 2MWQA 4RBNA 1LVKA 4U5EE 4O7GA 2QY9A 4MNDA 3T6JA 4CS8C 3N24A 4OIPF 4U5FE 1BR4A 3F47A 5T1DB 1JPNA 5CI9A 3AG1C 5D92A 2DGJA 2KNHA 4JJFA 3B0UX 3EJNA 4K0DA 4IJJA 4DOZA 2J9VA 4HE8D 4DVZA 4P6IC 4YJWA 1OKKD 5KYWA 3AG4C 1O5HA 5T3TA 4NY3A 4U5CE 2PF4E 3X1OA 4DBRA 1SMYF 2R7VA 2G3VA 3S29A 1M56C 3RYLA 4B6IA 3Q6NA 1LKXA 4I3MA 2XXAA 1ZHZA 3DM5A 5F5FA 4CS8A 3EG9A 2A6HF 3RIPA 2KJGA 2YZSA 4QDLA 4I1OB 5DS6A 5KYWB 1Z23A 1J8YF 2DYRC 1VOMA 3S28A 4FX5A 2KGOA 3RFYA 4C3EA 1PD0A 4HFKB 1Z3IX 3K1IC 1TWHA 3EZIA 4Q4ZF 2XSEA 1D0ZA 1TWCA 4FWVA 4GYTA 2J9UA 3S27A 3EZHA 2WZLA 4PFPA 1Z63A 2R7XA 2ZXWC 5E33A 4C3DA 3ZG1A 1VK5A 2EINC 2J0WA 1D1CA 3ZSUA 4OIOF 3VYWA 4XWJA 3CZ6A 4EBBA 3Q6MA 3T6BA 3UGOA 1TWAA 3DXJF 3CSKA 1JPJA 3EHNA 5FCLA 1FMVA 3EPVA 3O39A 3FAJA 1NZEA 5E3CA 4C7OB 3W8IA 3DAGA 1V55C 2J45A 2IXOA 3EGDA 2J46A 4OD5A 1RJ9A 1FTSA 4PK4A 2EIJC 3I5QA 4PJNA 3JSZA 3PMRA 2G3KA 2ZXOA 2BE5F 1M2VA 2M4EA 2Y3HA 1ZYRF 2R7SA 2C03A 3QMKA 4IRUA 1MMNA 3CQZA 3NG1A 1KU2A 1MMDA 3M1CB 2WL8A 3PHF2 3NKDA 1MNDA 1W2WA 2W9YA 3UMIA 4KNWA 2YEVA 5CI8A 3EGDB 1OCCC 3OEOA 2X51A 3JRTA 1MNEA 1RJ9B 4OIQF 3HTKC 2J9WA 2KW3C 2E87A 3LAYA 2B0JA 3RH3A 1NU7D 5T3WA 4ZLDA 3LJBA 2H7OA 3I4UA 4OD4A 2PX0A 1NU9C 3FVYA 3ZIBA 1M2OA 2Y69C 4PJLA 1M2VB 3E9VA 5B1AC 3ABMC 3ZVRA 2NUTA 3AQCA 2R7QA 3MLGA 4N06A 4YT2A 4JW1A 4CBEA 3VAYA 4LERA 4I1MA 5IY5C 3I5PA 3SNHA 2WB7A 4KBLA 2P6VA 5DS5A 2WZGA 3KMIA 2W4MA 2G62A 4X0RA 4YT8A 1OKKA 1WGWA 2FGYA 2OCCC 3SZRA 4PJJA 3RKOF 2MYSA 5KYNA 2NUTB 4M63A 4LACB 3ITFA 2CDQA 5KYUA 3KL4A 2DYSC 1SF8A 4JJGA 4YT5A 2QTVA 3EH2A 3QZCA 1M57C 3LLKA 2H7BA 2CNWD 2NUPA 4Q7CA 4C3BA 2Y3GA 4BJ6C 4DBQA 3ZC4A 1SZIA 1FFHA 3LLIA 1S7ZA 4JCHA 2XXAB 3K66A 3K1HA 3DAFA 3SYNA 5B1BC 4YWQA 3SP1A 4G7ZF 3EG9B 1FFTC 5KYUB 2IOQA 2EIKC 3UNGC 4KNVA 1TWGA 1ZHWA 4U5DE 4E7SA 2IXMA 1IZMA 2I8BA 1Z5ZA 3W2VA 3N2ZB 2ZXRA 4HEAJ 3N0TA 3SEOA 4BJ5C 4J32B 4CS7A 2IYLD 3IEEA 2H7VC 5KYXA 2IXPA 4AE4A 3KKBA 4PJMA 3L0IA 2C04A 2W4BA 5E3AA 4JURI 2A69F 2Y3BA 1MMGA 1ZHYA 4BJ6A 2EILC 4WJ0A 4E7ZA 3ASOC 4O6MA 5L3QA 4F4BA 2Q9BA 4EWCA 2W45A 4BG0A 2Q9AA 3AG2C 3FDQA 5L3VA 3Q7LA 1QZXA 5B3SC 2R7TA 4MQ9F 4BJ1A 2HV6A 4ZLCA 5KYXB 3UGPA 3ASNC 4BJTA 1D0YA 4RD9A 4KC9A 2V26A 2J0XA 4QI2A 2HV7A 1N1CA 3HLZA 4IWBA 3O6XA 3DM9B 3TD7A 1D1BA 3UR3C 4BJ5A 4H4KC 3ABLC 1FMWA 1OCRC 4I44A 4J30B 3DD7A 3EFOA 4W8KA 2J7PA 2PX3A 5F5HA 1VYKA 3NRHA 3WG7C 1OCOC 4PFOA 1MMAA 5E2QA 4XLPF 1J8MF 2Y3DA 1TR2A 2XL4A 4G0HA 4CSAC 5DLJA 1ZU4A 3EGXA 1BR2A 4LLCA 4XLNF 4QI0A 1ZU5A 3DZAA 4GEHA 2KQ9A 2CGEA 5DVWA 3ECSA 2R7WA 2VH3A 1IW7F 3EFOB 2L81A 2EIMC 1D1AA 1QLEC 1BR1A 3AG3C 5DQTA 4YN0B 3K6BA 1LS1A 4LLEA 4DVYP 3DJUB 2Y39A 3B9QA 3E70C 2CW0F 2D5RB 3AQBA 3EGXB 3F46A 1VMAA 4U5GA 3LEVA 3FHDA 4G7HF 3K33A 2LSEA 4K7BA 3UMHA 5EGYA 2P7VA 4G7OF 4AK9A 4CSAA 1ST6A 4U5HA 4O79A 5KYYA 3EH1A 3NYMA 3B0VC 2ZPAA 4JZAA 3DJNB 2Z15A 3HJCA 3NYJA 2CNWA 3UMKA 3V7OA 4RDAA 5HSWA 1PCXA 2IXNA 3MX3A 2R7RA 2VB6A 4O6NA 3EHMA 5DS4A 3POVA 3H65A 3W2WA 2WVQA 4O6YA 4CIHA 3X2QC 3T4RA 4ULWA 4BEJA 3LS0A 3KH2A 3LNRA 2NUPB 2V3CC 3OA1A 3JCUQ 5DQZA 5KYYB 4FESA 2PP4A 3GANA 2WVNA 4C7OA 3JYHA 3EQLF 2NG1A 2JD3A 2VASA 3Q7GA 4Q5SF 2GFHA 2FFHA 2R7OA 2A6EF 2A68F 3L34A 4OINF 4AX2A 2WVOA 1ZHTA 3K7DA 1OCZC 2ZXPA 4IAOA 3LESA 2XRHA 5EHHA 4YT4A 2YHSA 4CS9C 3JT1A 3NDBB 2O9XA 3NYLA 1ZHXA 2Q3TA 4ANJA 4JVSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I4U A; 
#chains in the Genus database with same CATH topology
 1K05 A;  4A4A A;  3LS1 A;  4L6R A;  2Q9C A;  2NPU A;  2L9J A;  1PV3 A;  3ABK C;  3M4B A;  1PD1 A;  3NKE A;  4XTK A;  4AE4 B;  2R7U A;  1VYI A;  1NFO A;  3S0X A;  2XLH A;  3TJ5 A;  1C17 M;  3WOD F;  4A2N B;  1D0X A;  4EBK A;  3OWT A;  5GPG B;  5D91 A;  2A1D D;  1LE2 A;  1I5N A;  4U5B E;  2XS8 A;  1Q0F A;  5AC4 A;  4D4X A;  2YL7 A;  1Z6A A;  2OEX A;  1GS9 A;  2J9B A;  3T9O A;  5A6K A;  5JT4 A;  1G8X A;  1RKC A;  2H8A A;  1Q0G A;  2UUI A;  1UFB A;  4CDV A;  3R2P A;  3GOD A;  5BUO A;  1QVX A;  3B0P A;  3DMD A;  1O87 A;  2WZF A;  1NG1 A;  4HFF B;  2KSF A;  1BZ4 A;  1TKN A;  2PFD A;  4OIR F;  2XLD A;  1CGO A;  1V54 C;  1B68 A;  3C8Z A;  3JRM O;  1I4Z A;  4CIP A;  3L1M A;  4CS9 A;  4KI2 A;  2KYH A;  2GA0 A;  2J7P D;  2OG2 A;  5L0G A;  3W8H A;  4IGG A;  2MWQ A;  1L3P A;  4RBN A;  1LVK A;  4U5E E;  4O7G A;  3TOM A;  1E83 A;  1WWP A;  2JPU A;  2QY9 A;  2AWY A;  4MND A;  3T6J A;  4CS8 C;  1GQA A;  2BC5 A;  3TJ6 A;  3N24 A;  1QKR A;  3GM3 A;  2R02 A;  4NQF A;  4YL3 A;  4OIP F;  4U5F E;  1BDJ B;  1H6G A;  1NLX A;  1BR4 A;  3F47 A;  5T1D B;  1JPN A;  5CI9 A;  3AG1 C;  3GEE A;  4JEB A;  5D92 A;  1VB5 A;  5L0J A;  1EQ1 A;  2DGJ A;  2VC9 A;  1BBH A;  5FZT A;  3U8V A;  1JOG A;  3PDM P;  2KNH A;  4JJF A;  3C8G A;  3B0U X;  3EJN A;  1NFN A;  3AJM A;  4K0D A;  1SYQ A;  4IJJ A;  4DOZ A;  3A9C A;  2J9V A;  4HE8 D;  4DVZ A;  1E85 A;  4P6I C;  4YJW A;  1OKK D;  5A6B D;  4JEA A;  3AG4 C;  2XLV A;  2X0C A;  1O5H A;  5T3T A;  1H9G A;  3SXZ A;  3QVY A;  4NY3 A;  4U5C E;  1HW1 A;  2PF4 E;  3X1O A;  3G4X A;  3ZTM A;  4DBR A;  4K1O A;  1YVI A;  1SMY F;  2R7V A;  2G3V A;  3S29 A;  1M56 C;  1GM5 A;  1O3U A;  4XEK A;  3RYL A;  4B6I A;  3TOL A;  4BPM A;  1U6H A;  3Q6N A;  3RQE A;  3V5X A;  3L8I A;  3QW0 A;  3JSE O;  1LKX A;  4PAC A;  4DXW A;  3CAX A;  4I3M A;  2XXA A;  1ZHZ A;  3DM5 A;  1XWJ A;  3G4Z A;  3NMJ A;  1HMO A;  1LIH A;  5F5F A;  4CS8 A;  3EG9 A;  5JVE A;  1HY5 A;  1HE1 A;  2A6H F;  3RIP A;  1G4W R;  1HE9 A;  2KJG A;  2YZS A;  4QDL A;  3AGU A;  4I1O B;  5DS6 A;  5KYW B;  1Z23 A;  1U0B B;  3M15 A;  1J8Y F;  2DYR C;  1VOM A;  4R32 A;  3S28 A;  4FX5 A;  2KGO A;  3RFY A;  1OW6 A;  4XEV A;  1PD0 A;  1A7V A;  4HFK B;  1JRA A;  4C3E A;  3AOU A;  2QNL A;  1Z3I X;  4WGY A;  3K1I C;  1TWH A;  5K0I A;  3EZI A;  4Q4Z F;  4N6H A;  3TK0 A;  2XSE A;  1D0Z A;  2XM4 A;  1TWC A;  4FWV A;  4GYT A;  5L0F A;  2J9U A;  2YRF A;  4E0I A;  1T6Q A;  3EZH A;  3S27 A;  2WZL A;  2OJQ A;  1AEP A;  2HUJ A;  3IPM O;  4PFP A;  1Z63 A;  2R7X A;  3U3B A;  2ZXW C;  5E33 A;  2AVK A;  4C3D A;  3ZG1 A;  1VK5 A;  1RCP A;  2EIN C;  2J0W A;  3AGT A;  1D1C A;  4J7Y A;  3ZSU A;  4OIO F;  1Y4C A;  1WTY A;  2UUH A;  2XLO A;  3H2V A;  3VYW A;  4XWJ A;  1QPU A;  4MVR A;  3CZ6 A;  5TJ5 E;  3Q6M A;  3T6B A;  4EBB A;  3RVY A;  2DB4 A;  1YAR O;  3UGO A;  1TWA A;  4LDR A;  1YLM A;  3DXJ F;  3SXY A;  2P61 A;  3CSK A;  3GM2 A;  1TFK B;  2YL1 A;  2PNO A;  3ZWI A;  1JPJ A;  3EHN A;  5FCL A;  5KYW A;  1LPE A;  4CDY A;  2EPN A;  1FMV A;  3EPV A;  2QE9 A;  3O39 A;  3FAJ A;  1NZE A;  1FNT c;  4G78 A;  5E3C A;  1RKE A;  4LDQ A;  4C7O B;  3RQG A;  3W8I A;  3K1I A;  2KK1 A;  3DAG A;  1V55 C;  2J45 A;  3NMI A;  2HZ8 A;  2IXO A;  4Z9H A;  3U8P A;  5L0I A;  1NSG B;  3EGD A;  2J46 A;  4OD5 A;  2KC3 A;  2B0H A;  1RJ9 A;  3M4C A;  1FTS A;  1YAU O;  1Y6D A;  4PK4 A;  2HSB A;  2EIJ C;  3I5Q A;  1YZA A;  1OW8 A;  4P9F A;  4DRI B;  1CPQ A;  2A0B A;  2XLE A;  3JSZ A;  4PJN A;  2OQM A;  3PMR A;  2YVK A;  2G3K A;  2ZXO A;  2NSG A;  1TFO B;  4ER9 A;  2BE5 F;  3US6 A;  4JRZ A;  4XPX A;  2LIG A;  3H2U A;  4JTA B;  5EK0 A;  1M2V A;  2M4E A;  2Y3H A;  1ZYR F;  5KYX A;  2R7S A;  2R25 A;  1C03 A;  2C03 A;  3QMK A;  1YDI A;  4IRU A;  2F22 A;  4N4W A;  1MMN A;  1QQ3 A;  4MTG A;  3CQZ A;  3NG1 A;  2YLI A;  1KU2 A;  1MMD A;  3JTL O;  3M1C B;  2WL8 A;  3PHF 2;  3NMK A;  2VCA A;  3NKD A;  3KYJ A;  2VCC A;  4MW8 A;  4XPY A;  1MND A;  4AL1 A;  1W2W A;  2HS5 A;  2W9Y A;  3UMI A;  4KNW A;  2YEV A;  5CI8 A;  1CPR A;  1OCC C;  3EGD B;  3M79 A;  1V74 B;  3OEO A;  2X51 A;  2YQY A;  4J7T A;  3JRT A;  4DRJ B;  1MNE A;  3RW0 A;  1E84 A;  1RJ9 B;  4OIQ F;  3HTK C;  4CJO A;  4EHP A;  2J9W A;  4E0H A;  2KW3 C;  2E87 A;  3DWW A;  3SXM A;  3LAY A;  2B0J A;  1APC A;  3RH3 A;  1NU7 D;  3S90 A;  5T3W A;  4ZLD A;  2DI3 A;  3LJB A;  2H7O A;  1WAS A;  2RSE B;  3I4U A;  4OD4 A;  2PX0 A;  1NU9 C;  3FVY A;  1QSP A;  1M2O A;  2Y69 C;  1A7D A;  2AU5 A;  4PR9 A;  4PJL A;  3ZIB A;  1R5I D;  1M2V B;  3E9V A;  5B1A C;  3ABM C;  3FAP B;  1XZQ A;  3IQ5 A;  3ZVR A;  5BQH A;  1YYJ A;  3AQC A;  2NUT A;  2R7Q A;  1M6T A;  3MLG A;  1U89 A;  1LI7 A;  4N06 A;  3V5Y A;  4E18 A;  2ASR A;  4CDA A;  4YT2 A;  3SXK A;  2P0N A;  4JW1 A;  4CBE A;  2XS1 A;  1WOL A;  3FOP A;  3MFN A;  2GAQ A;  4I1M A;  4LER A;  3VAY A;  1SR2 A;  5IY5 C;  3I5P A;  3SNH A;  2WB7 A;  4KBL A;  3WHN A;  2P6V A;  5DS5 A;  2WZG A;  2EPK X;  2HMQ A;  5COM A;  3KMI A;  5HV9 A;  1H9T A;  2W4M A;  2YLG A;  2R05 A;  2LCH A;  2G62 A;  4JIO A;  4X0R A;  1K04 A;  3U5S A;  4YT8 A;  5A6B A;  1OKK A;  1WGW A;  2FGY A;  2OCC C;  3SZR A;  2Q7R A;  2XL8 A;  3GEI A;  4PJJ A;  2R9R B;  1YZC A;  1JAF A;  3FOO A;  3QTH A;  3RKO F;  1T6U A;  3ATP A;  2MYS A;  5KYN A;  2NUT B;  3IHU A;  4M63 A;  2QLA A;  3DE9 A;  4LAC B;  3C18 A;  3ITF A;  2AP3 A;  3RF3 A;  3C8G B;  2CDQ A;  5KYU A;  3TUL A;  3IQT A;  2R03 A;  3V5Z A;  3LNM B;  3GOR A;  1E86 A;  3KL4 A;  2DYS C;  1SF8 A;  1LM3 B;  4JJG A;  4YT5 A;  2QTV A;  3EH2 A;  4AE4 A;  5L0D A;  2EPO A;  3QZC A;  3DKA A;  2OOC A;  2L7A A;  1M57 C;  3LLK A;  2H7B A;  2CNW D;  2NUP A;  4Q7C A;  3VM6 A;  3ZQY A;  1ZW3 A;  2Y3G A;  4C3B A;  4BJ6 C;  4DBQ A;  1RMV A;  3ZC4 A;  1FAP B;  1SZI A;  2LD6 A;  3U3F A;  1FFH A;  3LLI A;  1S7Z A;  3U9M A;  2TMV P;  1I4Y A;  4JCH A;  1HMD A;  5A69 A;  2CYD A;  2XXA B;  1GGQ A;  3K66 A;  3RQF A;  3C62 A;  3K1H A;  3DAF A;  3SYN A;  5B1B C;  4Z9J A;  4YWQ A;  3SP1 A;  1T6I A;  4IAQ A;  4G7Z F;  4EBJ A;  3EG9 B;  1FFT C;  3QW1 A;  2IOQ A;  2EIK C;  4JE9 A;  4JC7 A;  3UNG C;  4KNV A;  5KYU B;  3U2L A;  3IQ6 A;  1T9K A;  1TWG A;  2L6F A;  1ZHW A;  2HFI A;  4NCQ A;  4U5D E;  4MTF A;  4E7S A;  2IXM A;  1IZM A;  2I8B A;  1Z5Z A;  3BRJ A;  3W2V A;  3N2Z B;  1YJG A;  3TQO A;  2IM8 A;  2ZXR A;  4HEA J;  3N0T A;  1T5O A;  2LQG A;  3HNJ A;  3SEO A;  3ZQV A;  4BJ5 C;  2ZD9 A;  1OR2 A;  1AVO B;  4GQH A;  4J32 B;  3HKK A;  3MYI A;  4CS7 A;  2IYL D;  3IEE A;  2H7V C;  1ZW2 A;  3BEH A;  2XLM A;  2IXP A;  3L8J A;  3KKB A;  1YA9 A;  3L0I A;  2C04 A;  1ORY A;  2W4B A;  4PJM A;  5E3A A;  4MVO A;  1FR0 A;  4JUR I;  2A69 F;  2Y3B A;  1MMG A;  2LK4 A;  2IBF A;  1LE4 A;  3C63 A;  1ZHY A;  4WAB A;  5BQG A;  4BJ6 A;  2EIL C;  3ZTZ A;  3JZ0 A;  3GWN A;  5A6A A;  4XQ1 A;  4WJ0 A;  4E7Z A;  3ASO C;  4O6M A;  5L3Q A;  4UDV A;  4F4B A;  2Q9B A;  4EWC A;  2W45 A;  1NBB A;  1VTM P;  4MVQ A;  4WGZ A;  2QUP A;  4NTF A;  2Q9A A;  4BG0 A;  3AG2 C;  2EPM X;  3FDQ A;  2MHR A;  1YYX A;  2YKZ A;  5L3V A;  3FMS A;  3Q7L A;  3PCV A;  1QZX A;  3S84 A;  3O55 A;  1G5Z A;  5B3S C;  2R7T A;  1V4A A;  3B71 A;  2LP4 A;  4MQ9 F;  4BJ1 A;  4CX9 A;  2HV6 A;  3U9J A;  4ZLC A;  1YA7 O;  5KYX B;  3UGP A;  4EIY A;  4YK5 A;  1RKE B;  3ASN C;  4MW3 A;  4BJT A;  1D0Y A;  1RXQ A;  4RD9 A;  4KC9 A;  1LI5 A;  2J0X A;  2V26 A;  4NTB A;  4EUK B;  4QI2 A;  2HV7 A;  3U2M A;  1N1C A;  3G50 A;  3HLZ A;  1LS4 A;  1KNY A;  3O6X A;  3DM9 B;  4IWB A;  5CIV A;  3TD7 A;  1D1B A;  1S05 A;  2ETS A;  5F28 E;  4U9D A;  3UR3 C;  5JP7 A;  4BJ5 A;  4DRH B;  2PBE A;  4H4K C;  4JKV A;  3ABL C;  4XPW A;  1FMW A;  1OCR C;  4I44 A;  5A6J A;  1VLS A;  4J30 B;  3VRC A;  4MVU A;  3DD7 A;  3EFO A;  4W8K A;  2OU6 A;  2J7P A;  2BL2 A;  3GEH A;  3HNK A;  3HNL A;  2PX3 A;  4ULV A;  5F5H A;  2JX0 A;  2YWA A;  1C02 A;  1VYK A;  3NRH A;  4MVZ A;  1OCO C;  4PFO A;  3WG7 C;  4FAP B;  1MMA A;  5E2Q A;  4JTC B;  4XLP F;  1DOV A;  1ZZP A;  4MVS A;  1J8M F;  2Y3D A;  1TR2 A;  1EI7 A;  4E17 A;  1R4T A;  2I15 A;  2XL4 A;  2YL0 A;  3JYY A;  1EA8 A;  4G0H A;  1ZU4 A;  5DLJ A;  4CSA C;  4CJG A;  4W8P A;  1TQG A;  3EGX A;  1BR2 A;  4H54 A;  5B3I A;  4LLC A;  1ZVZ A;  4XLN F;  2YL3 A;  3DI5 A;  3KPH A;  4QI0 A;  1ZU5 A;  3DZA A;  4D4N A;  2HKV A;  4GEH A;  1KTM A;  1WAT A;  5JUA A;  2KQ9 A;  1UG7 A;  1VLT A;  5JS5 A;  2CGE A;  2XLW A;  3ECS A;  3MYF A;  5DVW A;  2R7W A;  4BEM J;  2VH3 A;  1CGM E;  1IW7 F;  3C8G D;  2L81 A;  3EFO B;  2EIM C;  1D1A A;  1QLE C;  1BR1 A;  3AG3 C;  5DQT A;  1K40 A;  4YN0 B;  5L0H A;  3K6B A;  1LS1 A;  1ORJ A;  4IAR A;  1MQV A;  2OEV A;  2P1A A;  2OKU A;  4LLE A;  4EKW A;  1G4U S;  2LFF A;  4DVY P;  4MTO A;  3S9O A;  3VF0 A;  3DJU B;  3J06 A;  2Y39 A;  3B9Q A;  3E70 C;  2CW0 F;  3GM1 A;  2D5R B;  3AQB A;  2AWC A;  3EGX B;  4XEF A;  3FXH A;  3F46 A;  3IQC A;  1VMA A;  4U5G A;  1L7C A;  3GWL A;  1OW7 A;  3FHD A;  3LEV A;  5JLI A;  4G7H F;  3K33 A;  4DJ9 A;  4Z9I A;  3KYI A;  2LSE A;  4K7B A;  3UMH A;  5EGY A;  2P7V A;  4G7O F;  4AK9 A;  4CSA A;  2L6G A;  2Q00 A;  1AUE A;  2XL6 A;  1ST6 A;  1F1M A;  1ORS C;  2VCB A;  3A11 A;  3MBG A;  1Q0K A;  5JSL A;  3R7C A;  3U0C A;  4U5H A;  4O79 A;  5AGF A;  1DOW A;  3LEO A;  5KYY A;  3EH1 A;  4JCZ A;  3NYM A;  3B0V C;  2YLD A;  2ZPA A;  4JZA A;  1OR3 A;  1JR8 A;  1Q0D A;  2Z15 A;  3DJN B;  3HJC A;  3WAQ A;  1WN0 A;  1OQC A;  3NYJ A;  2CNW A;  3LUT B;  3UMK A;  3V7O A;  2CCY A;  1OXK A;  4RDA A;  5HSW A;  2RD9 A;  1PCX A;  2IXN A;  3MX3 A;  4NTA A;  2R7R A;  5L0C A;  1Z7Q c;  2NSF A;  2VB6 A;  1CGN A;  256B A;  2L6H A;  3EHM A;  4N6C A;  4O6N A;  5DS4 A;  4MVM A;  3H65 A;  3POV A;  1A7E A;  3W2W A;  2HMZ A;  2WVQ A;  4O6Y A;  3HNI A;  4CIH A;  1H7I A;  5COG A;  5JRA A;  4JTD B;  3X2Q C;  3T4R A;  4ULW A;  3W4Y A;  2EPL X;  4BEJ A;  3B29 A;  2FAP B;  3LS0 A;  3CEX A;  3KH2 A;  4LDK A;  3LNR A;  4MS2 A;  2NUP B;  2Q4F A;  4ONS A;  3RVZ A;  5AC5 A;  2V3C C;  3OA1 A;  3JCU Q;  5DQZ A;  2HJ3 A;  4AL0 A;  2LFD A;  5KYY B;  3C7J A;  5BQI A;  3O10 A;  4FES A;  1XZP A;  2A0U A;  2PP4 A;  3GAN A;  2M64 A;  2WVN A;  4C7O A;  3JYH A;  3DE8 A;  3T6G B;  2OJE D;  2HJM A;  3EQL F;  2NG1 A;  1JMW A;  1OXB A;  1Q0M A;  2JD3 A;  2VAS A;  3Q7G A;  4Q5S F;  2GFH A;  5COF A;  1T01 A;  2FFH A;  2R7O A;  2A6E F;  2A68 F;  3L34 A;  2GWW A;  2J8W A;  4IB4 A;  4OIN F;  2GDC A;  4AX2 A;  2XM0 A;  2WVO A;  1ZHT A;  2ICW G;  3K7D A;  4U9E A;  4NC3 A;  1OCZ C;  2ZXP A;  4IAO A;  1EKY A;  3LES A;  4P9T A;  2XRH A;  5EHH A;  4YL0 A;  1A0B A;  4YT4 A;  2YHS A;  4CS9 C;  2HSQ A;  1E2X A;  4YL1 A;  3JT1 A;  3NDB B;  2O9X A;  3QVZ A;  2D4U A;  3NYL A;  1ZHX A;  2Q3T A;  4ANJ A;  1HW2 A;  3ZDL A;  1A41 A;  4JVS A; 
#chains in the Genus database with same CATH homology
 3LS1 A;  2Q9C A;  2L9J A;  3ABK C;  1PD1 A;  3NKE A;  4XTK A;  4AE4 B;  2R7U A;  1VYI A;  3S0X A;  3WOD F;  4A2N B;  1D0X A;  3OWT A;  5D91 A;  2A1D D;  4U5B E;  1Z6A A;  1G8X A;  3GOD A;  5BUO A;  3B0P A;  3DMD A;  1O87 A;  2WZF A;  1NG1 A;  4HFF B;  4OIR F;  1TKN A;  2PFD A;  1V54 C;  4CS9 A;  4KI2 A;  2J7P D;  2OG2 A;  3W8H A;  2MWQ A;  4RBN A;  1LVK A;  4U5E E;  4O7G A;  2QY9 A;  4MND A;  3T6J A;  4CS8 C;  3N24 A;  4OIP F;  4U5F E;  1BR4 A;  3F47 A;  5T1D B;  1JPN A;  5CI9 A;  3AG1 C;  5D92 A;  2DGJ A;  2KNH A;  4JJF A;  3B0U X;  3EJN A;  4K0D A;  4IJJ A;  4DOZ A;  2J9V A;  4HE8 D;  4DVZ A;  4P6I C;  4YJW A;  1OKK D;  5KYW A;  3AG4 C;  1O5H A;  5T3T A;  4NY3 A;  4U5C E;  2PF4 E;  3X1O A;  4DBR A;  1SMY F;  2R7V A;  2G3V A;  3S29 A;  1M56 C;  3RYL A;  4B6I A;  3Q6N A;  1LKX A;  4I3M A;  2XXA A;  1ZHZ A;  3DM5 A;  5F5F A;  4CS8 A;  3EG9 A;  2A6H F;  3RIP A;  2KJG A;  2YZS A;  4QDL A;  4I1O B;  5DS6 A;  5KYW B;  1Z23 A;  1J8Y F;  2DYR C;  1VOM A;  3S28 A;  4FX5 A;  2KGO A;  3RFY A;  4C3E A;  1PD0 A;  4HFK B;  1Z3I X;  3K1I C;  1TWH A;  3EZI A;  4Q4Z F;  2XSE A;  1D0Z A;  1TWC A;  4FWV A;  4GYT A;  2J9U A;  3S27 A;  3EZH A;  2WZL A;  4PFP A;  1Z63 A;  2R7X A;  2ZXW C;  5E33 A;  4C3D A;  3ZG1 A;  1VK5 A;  2EIN C;  2J0W A;  1D1C A;  3ZSU A;  4OIO F;  3VYW A;  4XWJ A;  3CZ6 A;  4EBB A;  3Q6M A;  3T6B A;  3UGO A;  1TWA A;  3DXJ F;  3CSK A;  1JPJ A;  3EHN A;  5FCL A;  1FMV A;  3EPV A;  3O39 A;  3FAJ A;  1NZE A;  5E3C A;  4C7O B;  3W8I A;  3DAG A;  1V55 C;  2J45 A;  2IXO A;  3EGD A;  2J46 A;  4OD5 A;  1RJ9 A;  1FTS A;  4PK4 A;  2EIJ C;  3I5Q A;  4PJN A;  3JSZ A;  3PMR A;  2G3K A;  2ZXO A;  2BE5 F;  1M2V A;  2M4E A;  2Y3H A;  1ZYR F;  2R7S A;  2C03 A;  3QMK A;  4IRU A;  1MMN A;  3CQZ A;  3NG1 A;  1KU2 A;  1MMD A;  3M1C B;  2WL8 A;  3PHF 2;  3NKD A;  1MND A;  1W2W A;  2W9Y A;  3UMI A;  4KNW A;  2YEV A;  5CI8 A;  3EGD B;  1OCC C;  3OEO A;  2X51 A;  3JRT A;  1MNE A;  1RJ9 B;  4OIQ F;  3HTK C;  2J9W A;  2KW3 C;  2E87 A;  3LAY A;  2B0J A;  3RH3 A;  1NU7 D;  5T3W A;  4ZLD A;  3LJB A;  2H7O A;  3I4U A;  4OD4 A;  2PX0 A;  1NU9 C;  3FVY A;  3ZIB A;  1M2O A;  2Y69 C;  4PJL A;  1M2V B;  3E9V A;  5B1A C;  3ABM C;  3ZVR A;  2NUT A;  3AQC A;  2R7Q A;  3MLG A;  4N06 A;  4YT2 A;  4JW1 A;  4CBE A;  3VAY A;  4LER A;  4I1M A;  5IY5 C;  3I5P A;  3SNH A;  2WB7 A;  4KBL A;  2P6V A;  5DS5 A;  2WZG A;  3KMI A;  2W4M A;  2G62 A;  4X0R A;  4YT8 A;  1OKK A;  1WGW A;  2FGY A;  2OCC C;  3SZR A;  4PJJ A;  3RKO F;  2MYS A;  5KYN A;  2NUT B;  4M63 A;  4LAC B;  3ITF A;  2CDQ A;  5KYU A;  3KL4 A;  2DYS C;  1SF8 A;  4JJG A;  4YT5 A;  2QTV A;  3EH2 A;  3QZC A;  1M57 C;  3LLK A;  2H7B A;  2CNW D;  2NUP A;  4Q7C A;  4C3B A;  2Y3G A;  4BJ6 C;  4DBQ A;  3ZC4 A;  1SZI A;  1FFH A;  3LLI A;  1S7Z A;  4JCH A;  2XXA B;  3K66 A;  3K1H A;  3DAF A;  3SYN A;  5B1B C;  4YWQ A;  3SP1 A;  4G7Z F;  3EG9 B;  1FFT C;  5KYU B;  2IOQ A;  2EIK C;  3UNG C;  4KNV A;  1TWG A;  1ZHW A;  4U5D E;  4E7S A;  2IXM A;  1IZM A;  2I8B A;  1Z5Z A;  3W2V A;  3N2Z B;  2ZXR A;  4HEA J;  3N0T A;  3SEO A;  4BJ5 C;  4J32 B;  4CS7 A;  2IYL D;  3IEE A;  2H7V C;  5KYX A;  2IXP A;  4AE4 A;  3KKB A;  4PJM A;  3L0I A;  2C04 A;  2W4B A;  5E3A A;  4JUR I;  2A69 F;  2Y3B A;  1MMG A;  1ZHY A;  4BJ6 A;  2EIL C;  4WJ0 A;  4E7Z A;  3ASO C;  4O6M A;  5L3Q A;  4F4B A;  2Q9B A;  4EWC A;  2W45 A;  4BG0 A;  2Q9A A;  3AG2 C;  3FDQ A;  5L3V A;  3Q7L A;  1QZX A;  5B3S C;  2R7T A;  4MQ9 F;  4BJ1 A;  2HV6 A;  4ZLC A;  5KYX B;  3UGP A;  3ASN C;  4BJT A;  1D0Y A;  4RD9 A;  4KC9 A;  2V26 A;  2J0X A;  4QI2 A;  2HV7 A;  1N1C A;  3HLZ A;  4IWB A;  3O6X A;  3DM9 B;  3TD7 A;  1D1B A;  3UR3 C;  4BJ5 A;  4H4K C;  3ABL C;  1FMW A;  1OCR C;  4I44 A;  4J30 B;  3DD7 A;  3EFO A;  4W8K A;  2J7P A;  2PX3 A;  5F5H A;  1VYK A;  3NRH A;  3WG7 C;  1OCO C;  4PFO A;  1MMA A;  5E2Q A;  4XLP F;  1J8M F;  2Y3D A;  1TR2 A;  2XL4 A;  4G0H A;  4CSA C;  5DLJ A;  1ZU4 A;  3EGX A;  1BR2 A;  4LLC A;  4XLN F;  4QI0 A;  1ZU5 A;  3DZA A;  4GEH A;  2KQ9 A;  2CGE A;  5DVW A;  3ECS A;  2R7W A;  2VH3 A;  1IW7 F;  3EFO B;  2L81 A;  2EIM C;  1D1A A;  1QLE C;  1BR1 A;  3AG3 C;  5DQT A;  4YN0 B;  3K6B A;  1LS1 A;  4LLE A;  4DVY P;  3DJU B;  2Y39 A;  3B9Q A;  3E70 C;  2CW0 F;  2D5R B;  3AQB A;  3EGX B;  3F46 A;  1VMA A;  4U5G A;  3LEV A;  3FHD A;  4G7H F;  3K33 A;  2LSE A;  4K7B A;  3UMH A;  5EGY A;  2P7V A;  4G7O F;  4AK9 A;  4CSA A;  1ST6 A;  4U5H A;  4O79 A;  5KYY A;  3EH1 A;  3NYM A;  3B0V C;  2ZPA A;  4JZA A;  3DJN B;  2Z15 A;  3HJC A;  3NYJ A;  2CNW A;  3UMK A;  3V7O A;  4RDA A;  5HSW A;  1PCX A;  2IXN A;  3MX3 A;  2R7R A;  2VB6 A;  4O6N A;  3EHM A;  5DS4 A;  3POV A;  3H65 A;  3W2W A;  2WVQ A;  4O6Y A;  4CIH A;  3X2Q C;  3T4R A;  4ULW A;  4BEJ A;  3LS0 A;  3KH2 A;  3LNR A;  2NUP B;  2V3C C;  3OA1 A;  3JCU Q;  5DQZ A;  5KYY B;  4FES A;  2PP4 A;  3GAN A;  2WVN A;  4C7O A;  3JYH A;  3EQL F;  2NG1 A;  2JD3 A;  2VAS A;  3Q7G A;  4Q5S F;  2GFH A;  2FFH A;  2R7O A;  2A6E F;  2A68 F;  3L34 A;  4OIN F;  4AX2 A;  2WVO A;  1ZHT A;  3K7D A;  1OCZ C;  2ZXP A;  4IAO A;  3LES A;  2XRH A;  5EHH A;  4YT4 A;  2YHS A;  4CS9 C;  3JT1 A;  3NDB B;  2O9X A;  3NYL A;  1ZHX A;  2Q3T A;  4ANJ A;  4JVS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...