3I4UA

Crystal structure analysis of a helicase associated domain
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
247
structure length
241
Chain Sequence
GSPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQTEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKSTVRVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQPEWVVYHELVLTTKEYMREVTTIDPRWLVEFAPAFFKVLDHGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural analysis of the C-terminal domain of the spliceosomal helicase Prp22
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords ATP-dependent RNA helicase DHX8
total genus 79
structure length 241
sequence length 247
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2009-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04408 HA2 Helicase associated domain (HA2)
A PF07717 OB_NTP_bind Oligonucleotide/oligosaccharide-binding (OB)-fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1080 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3i4uA01
3I4UA
chains in the Genus database with same CATH superfamily
2EPMX 2L6GA 3LNMB 3M15A 4MVZA 1OXBA 2D4UA 2IXOA 1BZ4A 2XS1A 5EGYA 4UDVA 4XTKA 2CYDA 2WL8A 2B0JA 2J9VA 3TOLA 1YZAA 2GAQA 2HJ3A 3GM3A 2HSQA 2DGJA 3MLGA 4CS8C 3EG9A 4JCHA 4XPYA 3HNKA 3UGPA 3QW1A 2YKZA 3IQCA 1BDJB 4LLEA 1OW8A 2YLIA 3AGTA 4WABA 3ZQYA 4E17A 1NSGB 2ZD9A 3CZ6A 3NMJA 4KNVA 3S84A 1R5ID 4C7OA 3FOPA 4JZAA 3HKKA 4PFOA 1LPEA 3NKEA 3R7CA 1H9GA 3RKOF 4EBKA 3EHNA 3NDBB 2YZSA 3JTLO 1YYJA 4C7OB 3HLZA 1M2OA 2HZ8A 4PJLA 5KYUA 5E2QA 1WN0A 4FWVA 3LEOA 4EHPA 5A69A 2J45A 3WAQA 2NG1A 2JD3A 4F4BA 3HNLA 3JZ0A 3U8PA 1QLEC 3JRMO 2J8WA 4DBQA 4I1OB 3EGXB 2KK1A 4IWBA 3SXMA 2ZXOA 3JSZA 1C03A 5CIVA 2J46A 2XXAA 1ZHZA 2EIJC 2RSEB 1SYQA 4CDVA 5L0JA 1PCXA 1WOLA 1ZHXA 3NMKA 4LDQA 4OINF 3T6GB 1YYXA 4YJWA 2XSEA 1LIHA 2CGEA 2NUPB 2OKUA 4GYTA 4DVZA 3PCVA 1FNTc 4O6MA 2C04A 3DAGA 1DOWA 1WASA 2R05A 4O7GA 5L3QA 2R7UA 1HE9A 3E9VA 1O87A 4U5CE 5DQZA 3F46A 4BJTA 1OCRC 2AVKA 4C3BA 3DM9B 3OWTA 4ULVA 1GS9A 2ETSA 2OOCA 1JRAA 2XRHA 3X2QC 2OCCC 3MYFA 4KC9A 5T3TA 4JW1A 3V7OA 5DLJA 4YT2A 4Z9IA 3A11A 3LESA 1YA9A 1C17M 1QKRA 4AL0A 1FFHA 5JT4A 4KI2A 2W9YA 1D0ZA 4JJFA 5E3AA 1MMNA 2WVOA 1OR3A 2OQMA 4YT4A 2BL2A 3IHUA 1A7EA 2EPNA 1WWPA 1PD0A 2OEVA 1MMGA 4A4AA 1HY5A 1XZPA 4U5GA 2KW3C 1YZCA 5L0HA 3LNRA 3EGDA 3RW0A 2QLAA 2G62A 2J9BA 3ZSUA 3KYJA 4E7ZA 1M56C 3CAXA 2RD9A 2WVNA 5JSLA 3WHNA 4U9DA 4O6YA 2XXAB 4Q5SF 2JPUA 1FFTC 2AP3A 2AWYA 2DI3A 3EGXA 5AGFA 5T3WA 3ZWIA 5KYUB 2H7BA 4PJJA 3DKAA 4CS9A 4OIRF 4GEHA 3ZIBA 3K7DA 4DVYP 2HMQA 2PX0A 1TKNA 2GA0A 1WATA 3U8VA 3G4XA 4BJ6A 2YL1A 3GWNA 3RFYA 5JLIA 4LDKA 1SMYF 2LQGA 3JRTA 2A6HF 2P1AA 3CQZA 1LI5A 3OA1A 3VRCA 3EG9B 2QTVA 1XWJA 4YT8A 3SNHA 3POVA 3X1OA 2CCYA 3SXYA 4MTOA 4MVSA 3AG4C 1H7IA 2AWCA 3ABLC 4HFKB 3N0TA 1NFNA 2YL0A 4JC7A 1MMAA 2Y3HA 1FMVA 3GEIA 2KGOA 4JTAB 1H6GA 3VF0A 4CSAC 3ZTMA 2Y39A 1UG7A 4MQ9F 1J8YF 2R7QA 1YDIA 4PJNA 5L0CA 3FAJA 4MTGA 4L6RA 4JEAA 4ANJA 4JIOA 3LJBA 4O79A 1T6UA 3O6XA 3W2VA 3Q6NA 4JKVA 4ZLDA 1ZU4A 3U9JA 2OJED 1T6IA 1R4TA 1T9KA 2NUTB 4H54A 4HFFB 3JCUQ 1L7CA 1OCCC 3FAPB 5K0IA 3UMIA 4CS7A 2H8AA 2Z15A 1GGQA 2VCCA 3L8IA 1HW1A 3JYYA 4JTCB 2CNWD 3FXHA 5DS6A 2XM4A 2R7OA 3MX3A 4CJOA 3B0UX 3UR3C 4CDYA 4U5FE 1KNYA 4WJ0A 3S90A 3M4BA 1ST6A 2ICWG 3H65A 3IEEA 2Q3TA 3MYIA 1IZMA 4BJ5C 3U9MA 4IAQA 3K6BA 3EHMA 1OCOC 1V74B 2IOQA 2PFDA 3KL4A 1OW6A 3PMRA 3TULA 1H9TA 3FOOA 1A0BA 1Z3IX 2Y3DA 4ER9A 3IQ5A 1ORYA 3O55A 1I5NA 3AQBA 2PP4A 2YHSA 2R7VA 3LUTB 1Z23A 4G78A 3EZIA 3GODA 2DB4A 2NSGA 1ZZPA 3K33A 3LLIA 3B29A 3RVZA 4YT5A 1DOVA 3EZHA 1E85A 2FGYA 2L6FA 3I4UA 3JSEO 3LS1A 2XLWA 1G4WR 4A2NB 2R25A 5EK0A 5B1BC 1ZHTA 3T6BA 3PHF2 2R03A 2PX3A 2WVQA 2PF4E 1NBBA 1K40A 2IYLD 3QVYA 3CEXA 4MTFA 4U5BE 1S7ZA 1LE4A 1BR1A 5KYXA 1NZEA 3AJMA 3S9OA 1K04A 256BA 4Z9JA 1ZU5A 2YL7A 4I3MA 4E0HA 3NG1A 4O6NA 1KU2A 1BR2A 4RBNA 4H4KC 2J0XA 4EBJA 1OCZC 2V26A 1WGWA 3DJNB 3NMIA 3SP1A 3NYLA 4DJ9A 3SXKA 4EIYA 3B9QA 3W8IA 4J32B 4XPXA 1V54C 2M64A 1E84A 3RQEA 4E18A 2YRFA 2XLDA 4NTFA 1QSPA 4LLCA 1KTMA 2D5RB 3RF3A 3EH1A 3WODF 3KMIA 3RVYA 3OEOA 2HMZA 2Q9AA 2W4BA 2Y69C 3K1IC 4CSAA 2OG2A 1Q0DA 5DS5A 1BBHA 2A0BA 3BEHA 2I8BA 5L0GA 3DM5A 1Z63A 4P6IC 2L7AA 2J7PD 5KYXB 2QNLA 1LM3B 3A9CA 4RD9A 4PK4A 2IXPA 3H2UA 2GWWA 1YVIA 2G3VA 3Q6MA 3B0PA 4CS8A 4M63A 4JEBA 2P7VA 3L34A 2IBFA 2R9RB 1T5OA 2BC5A 2NPUA 3AOUA 3ABKC 3NYJA 4YN0B 1MQVA 1LVKA 2XLHA 2W4MA 4JJGA 4YWQA 3JT1A 4BEJA 1OKKA 1J8MF 2VC9A 4I44A 4K7BA 5GPGB 2KSFA 3RH3A 4BG0A 4JE9A 3V5ZA 1BR4A 3GM2A 1WTYA 3IPMO 5TJ5E 4PACA 5KYNA 1F1MA 1RJ9A 3VM6A 5COGA 4N06A 5KYWA 1CGME 1TQGA 2BE5F 1NG1A 3LAYA 2G3KA 3LS0A 2L6HA 4WGZA 1IW7F 2YL3A 1V55C 5E3CA 5JUAA 1O3UA 3M79A 2HKVA 1A41A 1RJ9B 3L0IA 1LE2A 1OXKA 3DE8A 4DBRA 2R7SA 4YL1A 1D1AA 2NUPA 1TFKB 3DZAA 1JR8A 1RKEB 4CDAA 4ZLCA 2J0WA 1JMWA 1NLXA 1MNDA 4XEVA 1NU7D 4NY3A 4YK5A 1C02A 2YVKA 2MHRA 4BEMJ 1ORSC 2Y3GA 2YWAA 4N6HA 5F28E 3S0XA 5AC4A 3QMKA 4EWCA 1EKYA 1VLSA 2WZFA 3LLKA 3GEHA 3V5YA 3SYNA 4XPWA 3ZG1A 1TWHA 4DRHB 2WB7A 1HW2A 3TK0A 4K1OA 2XL4A 4CIHA 5KYYB 2J7PA 2HUJA 2LSEA 1ORJA 2VB6A 1SR2A 3IQ6A 4P9TA 1B68A 2CNWA 4J7TA 2XL8A 4J7YA 4N4WA 4OIOF 5DS4A 4PFPA 3C8GD 2C03A 1QQ3A 2VH3A 5L3VA 5CI9A 4MVQA 2O9XA 4X0RA 3RIPA 2LFFA 3K1HA 1L3PA 1VOMA 1CGNA 3GWLA 2HSBA 4Q7CA 1TWAA 1K05A 2H7VC 3L8JA 4DRIB 1ZHYA 4J30B 4XLPF 1I4ZA 4U5EE 2R7RA 1VYIA 2J9UA 3S27A 4KNWA 3M4CA 1RKEA 1JOGA 4WGYA 1PD1A 4OD4A 2E87A 4ULWA 2EIKC 2YEVA 2A68F 2Q00A 3UMHA 1TWGA 4ONSA 3AG2C 2I15A 2XLVA 3EFOB 4EKWA 5A6KA 5T1DB 2YLGA 4E0IA 4G7OF 3DMDA 3FHDA 3KH2A 2ZXWC 1VMAA 2HS5A 4AL1A 5E33A 2EINC 4U9EA 1G8XA 1NFOA 2VASA 1ZHWA 3NRHA 2EPLX 3QVZA 1E2XA 1ZW2A 3T9OA 1Q0MA 1N1CA 2HJMA 1E86A 3W8HA 1PV3A 2ZXRA 1M57C 3E70C 4CIPA 2LFDA 4G7ZF 1A7VA 3QTHA 2GDCA 4I1MA 2A0UA 1AUEA 2WZLA 1UFBA 2XL6A 3M1CB 3FMSA 3RYLA 2F22A 2HV6A 2XLEA 1M2VB 3MBGA 5B3SC 3KPHA 1LKXA 1YA7O 1ZVZA 5L0DA 2KJGA 4W8KA 5CI8A 3Q7GA 4D4XA 1RXQA 2PNOA 2Q7RA 4CX9A 3UGOA 3HNJA 2Q9BA 3U3BA 2JX0A 1AEPA 5COFA 4JURI 2M4EA 4JVSA 4AE4A 5DVWA 1V4AA 4NTAA 3TJ5A 1QPUA 1YJGA 3C18A 3W2WA 3W4YA 4FAPB 5HV9A 5B1AC 1E83A 1OR2A 3DAFA 2R7XA 4NQFA 3RQGA 2EIMC 1YLMA 3DJUB 4HE8D 4NC3A 4XLNF 1CPRA 2KYHA 3K66A 3TQOA 5BUOA 4QI2A 1LS4A 3H2VA 2NUTA 4FESA 1HE1A 4G0HA 4JTDB 2A69F 1AVOB 4MVMA 1Q0GA 2XLOA 4QDLA 3NKDA 3C8ZA 3F47A 5IY5C 1O5HA 2QY9A 3ATPA 2XM0A 1OKKD 4P9FA 4PR9A 2LK4A 3C62A 3VAYA 3G50A 3JYHA 2VCAA 1MNEA 2XLMA 1MMDA 4IB4A 2CW0F 3BRJA 1S05A 3LEVA 1T6QA 1YARO 3TJ6A 3IQTA 3EH2A 2R7WA 2IM8A 2W45A 1D0YA 4BJ1A 3T6JA 4LDRA 2GFHA 4LACB 2P6VA 3MFNA 2Q9CA 3U2LA 4DXWA 2EPOA 4G7HF 2IXNA 1Q0KA 3EQLF 1Y6DA 1GQAA 3ECSA 4XEFA 2MYSA 3GM1A 3B0VC 2YQYA 3DWWA 2L81A 4HEAJ 1RKCA 4Z9HA 3T4RA 2ZPAA 1Y4CA 1VLTA 3ASOC 1W2WA 3S29A 4DRJB 5A6BA 5BQHA 4E7SA 3FDQA 3NYMA 3S28A 3DI5A 4RDAA 1FR0A 4BJ6C 1M6TA 3KKBA 2L9JA 4JCZA 1CGOA 3AG3C 1SZIA 3Q7LA 1CPQA 2R02A 3SEOA 2LP4A 1TFOB 1XZQA 2UUIA 1RMVA 3ZC4A 1G4US 3C8GB 3VYWA 1VYKA 3C7JA 4YL0A 3U0CA 5D92A 2FAPB 4MW8A 3U3FA 4R32A 3WG7C 3ZQVA 5A6AA 1Z5ZA 2OU6A 4C3EA 4W8PA 4K0DA 4MS2A 1NU9C 4OIQF 4MVOA 5BQIA 4LERA 3ABMC 3TOMA 4CBEA 2R7TA 1U6HA 2OJQA 3DXJF 1APCA 3SXZA 4DOZA 2EPKX 3B71A 5JVEA 2LD6A 2P61A 2TMVP 5KYYA 5BQGA 1VK5A 4D4NA 3EJNA 4CS9C 2Q4FA 2XS8A 3EPVA 2FFHA 2HV7A 4XQ1A 4EUKB 5EHHA 1U0BB 3DE9A 4IRUA 3DD7A 3ZDLA 2MWQA 4NCQA 4XEKA 3GORA 3SZRA 4IAOA 4NTBA 3U5SA 1HMOA 2ASRA 5HSWA 3U2MA 5FCLA 3HJCA 3EFOA 4JRZA 2QUPA 1LS1A 4EBBA 1GM5A 1LI7A 3I5QA 1OQCA 1RCPA 3KYIA 2J9WA 5D91A 2HFIA 2NSFA 1Z7Qc 3ITFA 1ZW3A 4IJJA 2H7OA 3PDMP 4BJ5A 5B3IA 3N24A 3US6A 5KYWB 2YLDA 1I4YA 2PBEA 3HTKC 4BPMA 4Q4ZF 2B0HA 2WZGA 4KBLA 3J06A 4U5HA 1G5ZA 2X0CA 1JPJA 5JRAA 3C8GA 4OD5A 5F5HA 2AU5A 3QZCA 4AK9A 3L1MA 2IXMA 4U5DE 2KC3A 5JS5A 4FX5A 4C3DA 2QE9A 1TWCA 4IARA 5L0IA 2ZXPA 3UMKA 3AQCA 1VTMP 3C63A 2DYSC 3V5XA 5F5FA 2EILC 5FZTA 5JP7A 4AE4B 3TD7A 1M2VA 1Z6AA 3ZTZA 1EQ1A 1SF8A 4B6IA 4OIPF 1T01A 4MW3A 4N6CA 4MNDA 3O10A 4YL3A 1FMWA 1Q0FA 2KQ9A 3ZVRA 2LIGA 3O39A 1OW7A 3R2PA 2LCHA 2CDQA 5A6BD 1ZYRF 3FVYA 4GQHA 4PJMA 1JAFA 1QVXA 2A6EF 1YAUO 1EA8A 3N2ZB 2KNHA 3I5PA 5DQTA 4IGGA 2A1DD 2X51A 4CJGA 3AGUA 2UUHA 1U89A 5COMA 2VCBA 3GANA 4QI0A 3GEEA 3UNGC 4AX2A 4XWJA 3HNIA 3K1IA 4MVUA 3RQFA 1D1CA 3QW0A 5A6JA 1JPNA 1QZXA 5L0FA 3ASNC 1D1BA 2V3CC 2DYRC 1FTSA 2P0NA 1TR2A 3AG1C 2OEXA 1HMDA 1D0XA 3EGDB 4MVRA 3CSKA 1EI7A 1VB5A 3G4ZA 1A7DA 5AC5A 2Y3BA 1FAPB
chains in the Genus database with same CATH topology
2IXOA 5EGYA 4XTKA 2WL8A 2B0JA 2J9VA 2DGJA 3MLGA 4CS8C 3EG9A 4JCHA 3UGPA 4LLEA 4C7OA 3CZ6A 4KNVA 4JZAA 4PFOA 3RKOF 3NKEA 3NDBB 3EHNA 4C7OB 2YZSA 3HLZA 1M2OA 5KYUA 4PJLA 5E2QA 4FWVA 2J45A 2NG1A 2JD3A 4F4BA 1QLEC 4DBQA 4I1OB 3EGXB 4IWBA 2ZXOA 3JSZA 2J46A 2XXAA 1ZHZA 2EIJC 1PCXA 1ZHXA 4OINF 4YJWA 2XSEA 2CGEA 2NUPB 4GYTA 4DVZA 4O6MA 2C04A 3DAGA 4O7GA 5L3QA 2R7UA 3E9VA 5DQZA 1O87A 4U5CE 3F46A 4BJTA 1OCRC 4C3BA 3DM9B 3OWTA 3X2QC 2XRHA 4BG0A 2OCCC 5T3TA 4KC9A 3V7OA 4JW1A 5DLJA 4YT2A 3LESA 1FFHA 4KI2A 2W9YA 1D0ZA 4JJFA 5E3AA 1MMNA 2WVOA 4YT4A 1PD0A 1MMGA 4U5GA 2KW3C 3LNRA 3EGDA 2G62A 3ZSUA 5KYYA 4E7ZA 1M56C 2XXAB 2WVNA 4Q5SF 4O6YA 1FFTC 3EGXA 5T3WA 5KYUB 2H7BA 4PJJA 4CS9A 4OIRF 4GEHA 3ZIBA 3K7DA 4DVYP 2PX0A 1TKNA 2R7SA 4BJ6A 3RFYA 1SMYF 3JRTA 2A6HF 3CQZA 3OA1A 3EG9B 2QTVA 4YT8A 3SNHA 3POVA 3X1OA 3AG4C 3ABLC 4HFKB 3N0TA 1MMAA 2Y3HA 1FMVA 2KGOA 4CSAC 2Y39A 4MQ9F 1J8YF 2R7QA 4PJNA 3FAJA 4ANJA 3LJBA 4O79A 3O6XA 3W2VA 3Q6NA 4ZLDA 1ZU4A 2NUTB 4HFFB 3JCUQ 1OCCC 3UMIA 4CS7A 2Z15A 2CNWD 5DS6A 2R7OA 3MX3A 3B0UX 3UR3C 4U5FE 4WJ0A 1ST6A 3H65A 3IEEA 2Q3TA 1IZMA 4BJ5C 3K6BA 3EHMA 1OCOC 2PFDA 2IOQA 3KL4A 3PMRA 1Z3IX 2Y3DA 3AQBA 2PP4A 2YHSA 2R7VA 1Z23A 3EZIA 3GODA 3K33A 3LLIA 4YT5A 3EZHA 2FGYA 3I4UA 3LS1A 4A2NB 3PHF2 5B1BC 1ZHTA 3T6BA 2PX3A 2WVQA 2PF4E 2IYLD 4U5BE 1S7ZA 5KYXA 1BR1A 1NZEA 1ZU5A 4I3MA 3NG1A 4O6NA 1KU2A 1BR2A 4RBNA 4H4KC 2J0XA 1OCZC 2V26A 1WGWA 3DJNB 3SP1A 3NYLA 3B9QA 3W8IA 4J32B 1V54C 4LLCA 2D5RB 3EH1A 3WODF 3KMIA 3OEOA 2Q9AA 2W4BA 2Y69C 3K1IC 4CSAA 2OG2A 5DS5A 2I8BA 3DM5A 1Z63A 4P6IC 2J7PD 5KYXB 4RD9A 4PK4A 2IXPA 2G3VA 3Q6MA 3B0PA 4CS8A 4M63A 2P7VA 3L34A 3ABKC 3NYJA 4YN0B 1LVKA 2W4MA 4JJGA 4YWQA 3JT1A 4BEJA 1OKKA 1J8MF 4I44A 4K7BA 3RH3A 1BR4A 5KYNA 1RJ9A 4N06A 5KYWA 2BE5F 1NG1A 3LAYA 2G3KA 3LS0A 1IW7F 1V55C 5E3CA 1RJ9B 3L0IA 4DBRA 1D1AA 2NUPA 3DZAA 4ZLCA 2J0WA 1MNDA 1NU7D 4NY3A 2Y3GA 3S0XA 3QMKA 4EWCA 2WZFA 3LLKA 3SYNA 3ZG1A 1TWHA 2WB7A 2XL4A 4CIHA 5KYYB 2J7PA 2LSEA 2VB6A 2CNWA 4OIOF 5DS4A 4PFPA 2C03A 2VH3A 5L3VA 5CI9A 2O9XA 4X0RA 3RIPA 3K1HA 1VOMA 4Q7CA 1TWAA 2H7VC 2R7RA 4XLPF 1ZHYA 4J30B 4U5EE 1VYIA 2J9UA 3S27A 4KNWA 1PD1A 4OD4A 2E87A 4ULWA 2EIKC 2YEVA 2A68F 3UMHA 1TWGA 3AG2C 3EFOB 5T1DB 4G7OF 3DMDA 3FHDA 3KH2A 2ZXWC 1VMAA 5E33A 2EINC 1G8XA 2VASA 1ZHWA 3NRHA 1N1CA 3W8HA 2ZXRA 4G7ZF 1M57C 3E70C 4I1MA 3M1CB 2WZLA 3RYLA 2HV6A 1M2VB 5B3SC 1LKXA 2KJGA 4W8KA 5CI8A 3Q7GA 3UGOA 2Q9BA 4JURI 2M4EA 4JVSA 4AE4A 5DVWA 3W2WA 5B1AC 3DAFA 2R7XA 2EIMC 3DJUB 4HE8D 4XLNF 3K66A 5BUOA 4QI2A 2NUTA 4FESA 4G0HA 2A69F 4QDLA 3NKDA 3F47A 5IY5C 1O5HA 2QY9A 1OKKD 3VAYA 3JYHA 1MNEA 1MMDA 2CW0F 3LEVA 2R7WA 3EH2A 2W45A 1D0YA 4BJ1A 3T6JA 2GFHA 4LACB 2P6VA 2Q9CA 4G7HF 2IXNA 3EQLF 3ECSA 2MYSA 3B0VC 2L81A 4HEAJ 3T4RA 2ZPAA 3ASOC 1W2WA 3S29A 4E7SA 3FDQA 3NYMA 3S28A 4RDAA 4BJ6C 3KKBA 2L9JA 3AG3C 1SZIA 3Q7LA 3SEOA 3ZC4A 3VYWA 1VYKA 5D92A 3WG7C 1Z5ZA 4C3EA 4K0DA 1NU9C 4OIQF 4LERA 3ABMC 4CBEA 2R7TA 3DXJF 4DOZA 1VK5A 3EJNA 4CS9C 3EPVA 2FFHA 2HV7A 5EHHA 4IRUA 3DD7A 2MWQA 3SZRA 4IAOA 5HSWA 5FCLA 3HJCA 3EFOA 1LS1A 4EBBA 3I5QA 2J9WA 5D91A 3ITFA 4IJJA 2H7OA 4BJ5A 3N24A 5KYWB 3HTKC 4Q4ZF 2WZGA 4KBLA 4U5HA 1JPJA 4OD5A 5F5HA 3QZCA 4AK9A 2IXMA 4U5DE 4FX5A 4C3DA 1TWCA 2ZXPA 3UMKA 3AQCA 2DYSC 5F5FA 2EILC 4AE4B 3TD7A 1M2VA 1Z6AA 1SF8A 4B6IA 4OIPF 4MNDA 1FMWA 3ZVRA 2KQ9A 3O39A 2CDQA 1ZYRF 3FVYA 4PJMA 2A6EF 3N2ZB 2KNHA 3I5PA 5DQTA 2A1DD 2X51A 3GANA 4QI0A 3UNGC 4AX2A 4XWJA 1D1CA 1JPNA 1QZXA 3ASNC 1D1BA 2V3CC 2DYRC 1FTSA 1TR2A 3AG1C 1D0XA 3EGDB 3CSKA 2Y3BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I4U A; 
#chains in the Genus database with same CATH topology
 2EPM X;  2L6G A;  3LNM B;  3M15 A;  4MVZ A;  1OXB A;  2D4U A;  2IXO A;  1BZ4 A;  2XS1 A;  5EGY A;  4UDV A;  4XTK A;  2CYD A;  2WL8 A;  2B0J A;  2J9V A;  3TOL A;  1YZA A;  2GAQ A;  2HJ3 A;  3GM3 A;  2HSQ A;  2DGJ A;  3MLG A;  4CS8 C;  3EG9 A;  4JCH A;  4XPY A;  3HNK A;  3UGP A;  3QW1 A;  2YKZ A;  3IQC A;  1BDJ B;  4LLE A;  1OW8 A;  2YLI A;  3AGT A;  4WAB A;  3ZQY A;  4E17 A;  1NSG B;  2ZD9 A;  3CZ6 A;  3NMJ A;  4KNV A;  3S84 A;  1R5I D;  4C7O A;  3FOP A;  4JZA A;  3HKK A;  4PFO A;  1LPE A;  3NKE A;  3R7C A;  1H9G A;  3RKO F;  4EBK A;  3EHN A;  3NDB B;  2YZS A;  3JTL O;  1YYJ A;  4C7O B;  3HLZ A;  1M2O A;  2HZ8 A;  4PJL A;  5KYU A;  5E2Q A;  1WN0 A;  4FWV A;  3LEO A;  4EHP A;  5A69 A;  2J45 A;  3WAQ A;  2NG1 A;  2JD3 A;  4F4B A;  3HNL A;  3JZ0 A;  3U8P A;  1QLE C;  3JRM O;  2J8W A;  4DBQ A;  4I1O B;  3EGX B;  2KK1 A;  4IWB A;  3SXM A;  2ZXO A;  3JSZ A;  1C03 A;  5CIV A;  2J46 A;  2XXA A;  1ZHZ A;  2EIJ C;  2RSE B;  1SYQ A;  4CDV A;  5L0J A;  1PCX A;  1WOL A;  1ZHX A;  3NMK A;  4LDQ A;  4OIN F;  3T6G B;  1YYX A;  4YJW A;  2XSE A;  1LIH A;  2CGE A;  2NUP B;  2OKU A;  4GYT A;  4DVZ A;  3PCV A;  1FNT c;  4O6M A;  2C04 A;  3DAG A;  1DOW A;  1WAS A;  2R05 A;  4O7G A;  5L3Q A;  2R7U A;  1HE9 A;  3E9V A;  1O87 A;  4U5C E;  5DQZ A;  3F46 A;  4BJT A;  1OCR C;  2AVK A;  4C3B A;  3DM9 B;  3OWT A;  4ULV A;  1GS9 A;  2ETS A;  2OOC A;  1JRA A;  2XRH A;  3X2Q C;  2OCC C;  3MYF A;  4KC9 A;  5T3T A;  4JW1 A;  3V7O A;  5DLJ A;  4YT2 A;  4Z9I A;  3A11 A;  3LES A;  1YA9 A;  1C17 M;  1QKR A;  4AL0 A;  1FFH A;  5JT4 A;  4KI2 A;  2W9Y A;  1D0Z A;  4JJF A;  5E3A A;  1MMN A;  2WVO A;  1OR3 A;  2OQM A;  4YT4 A;  2BL2 A;  3IHU A;  1A7E A;  2EPN A;  1WWP A;  1PD0 A;  2OEV A;  1MMG A;  4A4A A;  1HY5 A;  1XZP A;  4U5G A;  2KW3 C;  1YZC A;  5L0H A;  3LNR A;  3EGD A;  3RW0 A;  2QLA A;  2G62 A;  2J9B A;  3ZSU A;  3KYJ A;  4E7Z A;  1M56 C;  3CAX A;  2RD9 A;  2WVN A;  5JSL A;  3WHN A;  4U9D A;  4O6Y A;  2XXA B;  4Q5S F;  2JPU A;  1FFT C;  2AP3 A;  2AWY A;  2DI3 A;  3EGX A;  5AGF A;  5T3W A;  3ZWI A;  5KYU B;  2H7B A;  4PJJ A;  3DKA A;  4CS9 A;  4OIR F;  4GEH A;  3ZIB A;  3K7D A;  4DVY P;  2HMQ A;  2PX0 A;  1TKN A;  2GA0 A;  1WAT A;  3U8V A;  3G4X A;  4BJ6 A;  2YL1 A;  3GWN A;  3RFY A;  5JLI A;  4LDK A;  1SMY F;  2LQG A;  3JRT A;  2A6H F;  2P1A A;  3CQZ A;  1LI5 A;  3OA1 A;  3VRC A;  3EG9 B;  2QTV A;  1XWJ A;  4YT8 A;  3SNH A;  3POV A;  3X1O A;  2CCY A;  3SXY A;  4MTO A;  4MVS A;  3AG4 C;  1H7I A;  2AWC A;  3ABL C;  4HFK B;  3N0T A;  1NFN A;  2YL0 A;  4JC7 A;  1MMA A;  2Y3H A;  1FMV A;  3GEI A;  2KGO A;  4JTA B;  1H6G A;  3VF0 A;  4CSA C;  3ZTM A;  2Y39 A;  1UG7 A;  4MQ9 F;  1J8Y F;  2R7Q A;  1YDI A;  4PJN A;  5L0C A;  3FAJ A;  4MTG A;  4L6R A;  4JEA A;  4ANJ A;  4JIO A;  3LJB A;  4O79 A;  1T6U A;  3O6X A;  3W2V A;  3Q6N A;  4JKV A;  4ZLD A;  1ZU4 A;  3U9J A;  2OJE D;  1T6I A;  1R4T A;  1T9K A;  2NUT B;  4H54 A;  4HFF B;  3JCU Q;  1L7C A;  1OCC C;  3FAP B;  5K0I A;  3UMI A;  4CS7 A;  2H8A A;  2Z15 A;  1GGQ A;  2VCC A;  3L8I A;  1HW1 A;  3JYY A;  4JTC B;  2CNW D;  3FXH A;  5DS6 A;  2XM4 A;  2R7O A;  3MX3 A;  4CJO A;  3B0U X;  3UR3 C;  4CDY A;  4U5F E;  1KNY A;  4WJ0 A;  3S90 A;  3M4B A;  1ST6 A;  2ICW G;  3H65 A;  3IEE A;  2Q3T A;  3MYI A;  1IZM A;  4BJ5 C;  3U9M A;  4IAQ A;  3K6B A;  3EHM A;  1OCO C;  1V74 B;  2IOQ A;  2PFD A;  3KL4 A;  1OW6 A;  3PMR A;  3TUL A;  1H9T A;  3FOO A;  1A0B A;  1Z3I X;  2Y3D A;  4ER9 A;  3IQ5 A;  1ORY A;  3O55 A;  1I5N A;  3AQB A;  2PP4 A;  2YHS A;  2R7V A;  3LUT B;  1Z23 A;  4G78 A;  3EZI A;  3GOD A;  2DB4 A;  2NSG A;  1ZZP A;  3K33 A;  3LLI A;  3B29 A;  3RVZ A;  4YT5 A;  1DOV A;  3EZH A;  1E85 A;  2FGY A;  2L6F A;  3I4U A;  3JSE O;  3LS1 A;  2XLW A;  1G4W R;  4A2N B;  2R25 A;  5EK0 A;  5B1B C;  1ZHT A;  3T6B A;  3PHF 2;  2R03 A;  2PX3 A;  2WVQ A;  2PF4 E;  1NBB A;  1K40 A;  2IYL D;  3QVY A;  3CEX A;  4MTF A;  4U5B E;  1S7Z A;  1LE4 A;  1BR1 A;  5KYX A;  1NZE A;  3AJM A;  3S9O A;  1K04 A;  256B A;  4Z9J A;  1ZU5 A;  2YL7 A;  4I3M A;  4E0H A;  3NG1 A;  4O6N A;  1KU2 A;  1BR2 A;  4RBN A;  4H4K C;  2J0X A;  4EBJ A;  1OCZ C;  2V26 A;  1WGW A;  3DJN B;  3NMI A;  3SP1 A;  3NYL A;  4DJ9 A;  3SXK A;  4EIY A;  3B9Q A;  3W8I A;  4J32 B;  4XPX A;  1V54 C;  2M64 A;  1E84 A;  3RQE A;  4E18 A;  2YRF A;  2XLD A;  4NTF A;  1QSP A;  4LLC A;  1KTM A;  2D5R B;  3RF3 A;  3EH1 A;  3WOD F;  3KMI A;  3RVY A;  3OEO A;  2HMZ A;  2Q9A A;  2W4B A;  2Y69 C;  3K1I C;  4CSA A;  2OG2 A;  1Q0D A;  5DS5 A;  1BBH A;  2A0B A;  3BEH A;  2I8B A;  5L0G A;  3DM5 A;  1Z63 A;  4P6I C;  2L7A A;  2J7P D;  5KYX B;  2QNL A;  1LM3 B;  3A9C A;  4RD9 A;  4PK4 A;  2IXP A;  3H2U A;  2GWW A;  1YVI A;  2G3V A;  3Q6M A;  3B0P A;  4CS8 A;  4M63 A;  4JEB A;  2P7V A;  3L34 A;  2IBF A;  2R9R B;  1T5O A;  2BC5 A;  2NPU A;  3AOU A;  3ABK C;  3NYJ A;  4YN0 B;  1MQV A;  1LVK A;  2XLH A;  2W4M A;  4JJG A;  4YWQ A;  3JT1 A;  4BEJ A;  1OKK A;  1J8M F;  2VC9 A;  4I44 A;  4K7B A;  5GPG B;  2KSF A;  3RH3 A;  4BG0 A;  4JE9 A;  3V5Z A;  1BR4 A;  3GM2 A;  1WTY A;  3IPM O;  5TJ5 E;  4PAC A;  5KYN A;  1F1M A;  1RJ9 A;  3VM6 A;  5COG A;  4N06 A;  5KYW A;  1CGM E;  1TQG A;  2BE5 F;  1NG1 A;  3LAY A;  2G3K A;  3LS0 A;  2L6H A;  4WGZ A;  1IW7 F;  2YL3 A;  1V55 C;  5E3C A;  5JUA A;  1O3U A;  3M79 A;  2HKV A;  1A41 A;  1RJ9 B;  3L0I A;  1LE2 A;  1OXK A;  3DE8 A;  4DBR A;  2R7S A;  4YL1 A;  1D1A A;  2NUP A;  1TFK B;  3DZA A;  1JR8 A;  1RKE B;  4CDA A;  4ZLC A;  2J0W A;  1JMW A;  1NLX A;  1MND A;  4XEV A;  1NU7 D;  4NY3 A;  4YK5 A;  1C02 A;  2YVK A;  2MHR A;  4BEM J;  1ORS C;  2Y3G A;  2YWA A;  4N6H A;  5F28 E;  3S0X A;  5AC4 A;  3QMK A;  4EWC A;  1EKY A;  1VLS A;  2WZF A;  3LLK A;  3GEH A;  3V5Y A;  3SYN A;  4XPW A;  3ZG1 A;  1TWH A;  4DRH B;  2WB7 A;  1HW2 A;  3TK0 A;  4K1O A;  2XL4 A;  4CIH A;  5KYY B;  2J7P A;  2HUJ A;  2LSE A;  1ORJ A;  2VB6 A;  1SR2 A;  3IQ6 A;  4P9T A;  1B68 A;  2CNW A;  4J7T A;  2XL8 A;  4J7Y A;  4N4W A;  4OIO F;  5DS4 A;  4PFP A;  3C8G D;  2C03 A;  1QQ3 A;  2VH3 A;  5L3V A;  5CI9 A;  4MVQ A;  2O9X A;  4X0R A;  3RIP A;  2LFF A;  3K1H A;  1L3P A;  1VOM A;  1CGN A;  3GWL A;  2HSB A;  4Q7C A;  1TWA A;  1K05 A;  2H7V C;  3L8J A;  4DRI B;  1ZHY A;  4J30 B;  4XLP F;  1I4Z A;  4U5E E;  2R7R A;  1VYI A;  2J9U A;  3S27 A;  4KNW A;  3M4C A;  1RKE A;  1JOG A;  4WGY A;  1PD1 A;  4OD4 A;  2E87 A;  4ULW A;  2EIK C;  2YEV A;  2A68 F;  2Q00 A;  3UMH A;  1TWG A;  4ONS A;  3AG2 C;  2I15 A;  2XLV A;  3EFO B;  4EKW A;  5A6K A;  5T1D B;  2YLG A;  4E0I A;  4G7O F;  3DMD A;  3FHD A;  3KH2 A;  2ZXW C;  1VMA A;  2HS5 A;  4AL1 A;  5E33 A;  2EIN C;  4U9E A;  1G8X A;  1NFO A;  2VAS A;  1ZHW A;  3NRH A;  2EPL X;  3QVZ A;  1E2X A;  1ZW2 A;  3T9O A;  1Q0M A;  1N1C A;  2HJM A;  1E86 A;  3W8H A;  1PV3 A;  2ZXR A;  1M57 C;  3E70 C;  4CIP A;  2LFD A;  4G7Z F;  1A7V A;  3QTH A;  2GDC A;  4I1M A;  2A0U A;  1AUE A;  2WZL A;  1UFB A;  2XL6 A;  3M1C B;  3FMS A;  3RYL A;  2F22 A;  2HV6 A;  2XLE A;  1M2V B;  3MBG A;  5B3S C;  3KPH A;  1LKX A;  1YA7 O;  1ZVZ A;  5L0D A;  2KJG A;  4W8K A;  5CI8 A;  3Q7G A;  4D4X A;  1RXQ A;  2PNO A;  2Q7R A;  4CX9 A;  3UGO A;  3HNJ A;  2Q9B A;  3U3B A;  2JX0 A;  1AEP A;  5COF A;  4JUR I;  2M4E A;  4JVS A;  4AE4 A;  5DVW A;  1V4A A;  4NTA A;  3TJ5 A;  1QPU A;  1YJG A;  3C18 A;  3W2W A;  3W4Y A;  4FAP B;  5HV9 A;  5B1A C;  1E83 A;  1OR2 A;  3DAF A;  2R7X A;  4NQF A;  3RQG A;  2EIM C;  1YLM A;  3DJU B;  4HE8 D;  4NC3 A;  4XLN F;  1CPR A;  2KYH A;  3K66 A;  3TQO A;  5BUO A;  4QI2 A;  1LS4 A;  3H2V A;  2NUT A;  4FES A;  1HE1 A;  4G0H A;  4JTD B;  2A69 F;  1AVO B;  4MVM A;  1Q0G A;  2XLO A;  4QDL A;  3NKD A;  3C8Z A;  3F47 A;  5IY5 C;  1O5H A;  2QY9 A;  3ATP A;  2XM0 A;  1OKK D;  4P9F A;  4PR9 A;  2LK4 A;  3C62 A;  3VAY A;  3G50 A;  3JYH A;  2VCA A;  1MNE A;  2XLM A;  1MMD A;  4IB4 A;  2CW0 F;  3BRJ A;  1S05 A;  3LEV A;  1T6Q A;  1YAR O;  3TJ6 A;  3IQT A;  3EH2 A;  2R7W A;  2IM8 A;  2W45 A;  1D0Y A;  4BJ1 A;  3T6J A;  4LDR A;  2GFH A;  4LAC B;  2P6V A;  3MFN A;  2Q9C A;  3U2L A;  4DXW A;  2EPO A;  4G7H F;  2IXN A;  1Q0K A;  3EQL F;  1Y6D A;  1GQA A;  3ECS A;  4XEF A;  2MYS A;  3GM1 A;  3B0V C;  2YQY A;  3DWW A;  2L81 A;  4HEA J;  1RKC A;  4Z9H A;  3T4R A;  2ZPA A;  1Y4C A;  1VLT A;  3ASO C;  1W2W A;  3S29 A;  4DRJ B;  5A6B A;  5BQH A;  4E7S A;  3FDQ A;  3NYM A;  3S28 A;  3DI5 A;  4RDA A;  1FR0 A;  4BJ6 C;  1M6T A;  3KKB A;  2L9J A;  4JCZ A;  1CGO A;  3AG3 C;  1SZI A;  3Q7L A;  1CPQ A;  2R02 A;  3SEO A;  2LP4 A;  1TFO B;  1XZQ A;  2UUI A;  1RMV A;  3ZC4 A;  1G4U S;  3C8G B;  3VYW A;  1VYK A;  3C7J A;  4YL0 A;  3U0C A;  5D92 A;  2FAP B;  4MW8 A;  3U3F A;  4R32 A;  3WG7 C;  3ZQV A;  5A6A A;  1Z5Z A;  2OU6 A;  4C3E A;  4W8P A;  4K0D A;  4MS2 A;  1NU9 C;  4OIQ F;  4MVO A;  5BQI A;  4LER A;  3ABM C;  3TOM A;  4CBE A;  2R7T A;  1U6H A;  2OJQ A;  3DXJ F;  1APC A;  3SXZ A;  4DOZ A;  2EPK X;  3B71 A;  5JVE A;  2LD6 A;  2P61 A;  2TMV P;  5KYY A;  5BQG A;  1VK5 A;  4D4N A;  3EJN A;  4CS9 C;  2Q4F A;  2XS8 A;  3EPV A;  2FFH A;  2HV7 A;  4XQ1 A;  4EUK B;  5EHH A;  1U0B B;  3DE9 A;  4IRU A;  3DD7 A;  3ZDL A;  2MWQ A;  4NCQ A;  4XEK A;  3GOR A;  3SZR A;  4IAO A;  4NTB A;  3U5S A;  1HMO A;  2ASR A;  5HSW A;  3U2M A;  5FCL A;  3HJC A;  3EFO A;  4JRZ A;  2QUP A;  1LS1 A;  4EBB A;  1GM5 A;  1LI7 A;  3I5Q A;  1OQC A;  1RCP A;  3KYI A;  2J9W A;  5D91 A;  2HFI A;  2NSF A;  1Z7Q c;  3ITF A;  1ZW3 A;  4IJJ A;  2H7O A;  3PDM P;  4BJ5 A;  5B3I A;  3N24 A;  3US6 A;  5KYW B;  2YLD A;  1I4Y A;  2PBE A;  3HTK C;  4BPM A;  4Q4Z F;  2B0H A;  2WZG A;  4KBL A;  3J06 A;  4U5H A;  1G5Z A;  2X0C A;  1JPJ A;  5JRA A;  3C8G A;  4OD5 A;  5F5H A;  2AU5 A;  3QZC A;  4AK9 A;  3L1M A;  2IXM A;  4U5D E;  2KC3 A;  5JS5 A;  4FX5 A;  4C3D A;  2QE9 A;  1TWC A;  4IAR A;  5L0I A;  2ZXP A;  3UMK A;  3AQC A;  1VTM P;  3C63 A;  2DYS C;  3V5X A;  5F5F A;  2EIL C;  5FZT A;  5JP7 A;  4AE4 B;  3TD7 A;  1M2V A;  1Z6A A;  3ZTZ A;  1EQ1 A;  1SF8 A;  4B6I A;  4OIP F;  1T01 A;  4MW3 A;  4N6C A;  4MND A;  3O10 A;  4YL3 A;  1FMW A;  1Q0F A;  2KQ9 A;  3ZVR A;  2LIG A;  3O39 A;  1OW7 A;  3R2P A;  2LCH A;  2CDQ A;  5A6B D;  1ZYR F;  3FVY A;  4GQH A;  4PJM A;  1JAF A;  1QVX A;  2A6E F;  1YAU O;  1EA8 A;  3N2Z B;  2KNH A;  3I5P A;  5DQT A;  4IGG A;  2A1D D;  2X51 A;  4CJG A;  3AGU A;  2UUH A;  1U89 A;  5COM A;  2VCB A;  3GAN A;  4QI0 A;  3GEE A;  3UNG C;  4AX2 A;  4XWJ A;  3HNI A;  3K1I A;  4MVU A;  3RQF A;  1D1C A;  3QW0 A;  5A6J A;  1JPN A;  1QZX A;  5L0F A;  3ASN C;  1D1B A;  2V3C C;  2DYR C;  1FTS A;  2P0N A;  1TR2 A;  3AG1 C;  2OEX A;  1HMD A;  1D0X A;  3EGD B;  4MVR A;  3CSK A;  1EI7 A;  1VB5 A;  3G4Z A;  1A7D A;  5AC5 A;  2Y3B A;  1FAP B; 
#chains in the Genus database with same CATH homology
 2IXO A;  5EGY A;  4XTK A;  2WL8 A;  2B0J A;  2J9V A;  2DGJ A;  3MLG A;  4CS8 C;  3EG9 A;  4JCH A;  3UGP A;  4LLE A;  4C7O A;  3CZ6 A;  4KNV A;  4JZA A;  4PFO A;  3RKO F;  3NKE A;  3NDB B;  3EHN A;  4C7O B;  2YZS A;  3HLZ A;  1M2O A;  5KYU A;  4PJL A;  5E2Q A;  4FWV A;  2J45 A;  2NG1 A;  2JD3 A;  4F4B A;  1QLE C;  4DBQ A;  4I1O B;  3EGX B;  4IWB A;  2ZXO A;  3JSZ A;  2J46 A;  2XXA A;  1ZHZ A;  2EIJ C;  1PCX A;  1ZHX A;  4OIN F;  4YJW A;  2XSE A;  2CGE A;  2NUP B;  4GYT A;  4DVZ A;  4O6M A;  2C04 A;  3DAG A;  4O7G A;  5L3Q A;  2R7U A;  3E9V A;  5DQZ A;  1O87 A;  4U5C E;  3F46 A;  4BJT A;  1OCR C;  4C3B A;  3DM9 B;  3OWT A;  3X2Q C;  2XRH A;  4BG0 A;  2OCC C;  5T3T A;  4KC9 A;  3V7O A;  4JW1 A;  5DLJ A;  4YT2 A;  3LES A;  1FFH A;  4KI2 A;  2W9Y A;  1D0Z A;  4JJF A;  5E3A A;  1MMN A;  2WVO A;  4YT4 A;  1PD0 A;  1MMG A;  4U5G A;  2KW3 C;  3LNR A;  3EGD A;  2G62 A;  3ZSU A;  5KYY A;  4E7Z A;  1M56 C;  2XXA B;  2WVN A;  4Q5S F;  4O6Y A;  1FFT C;  3EGX A;  5T3W A;  5KYU B;  2H7B A;  4PJJ A;  4CS9 A;  4OIR F;  4GEH A;  3ZIB A;  3K7D A;  4DVY P;  2PX0 A;  1TKN A;  2R7S A;  4BJ6 A;  3RFY A;  1SMY F;  3JRT A;  2A6H F;  3CQZ A;  3OA1 A;  3EG9 B;  2QTV A;  4YT8 A;  3SNH A;  3POV A;  3X1O A;  3AG4 C;  3ABL C;  4HFK B;  3N0T A;  1MMA A;  2Y3H A;  1FMV A;  2KGO A;  4CSA C;  2Y39 A;  4MQ9 F;  1J8Y F;  2R7Q A;  4PJN A;  3FAJ A;  4ANJ A;  3LJB A;  4O79 A;  3O6X A;  3W2V A;  3Q6N A;  4ZLD A;  1ZU4 A;  2NUT B;  4HFF B;  3JCU Q;  1OCC C;  3UMI A;  4CS7 A;  2Z15 A;  2CNW D;  5DS6 A;  2R7O A;  3MX3 A;  3B0U X;  3UR3 C;  4U5F E;  4WJ0 A;  1ST6 A;  3H65 A;  3IEE A;  2Q3T A;  1IZM A;  4BJ5 C;  3K6B A;  3EHM A;  1OCO C;  2PFD A;  2IOQ A;  3KL4 A;  3PMR A;  1Z3I X;  2Y3D A;  3AQB A;  2PP4 A;  2YHS A;  2R7V A;  1Z23 A;  3EZI A;  3GOD A;  3K33 A;  3LLI A;  4YT5 A;  3EZH A;  2FGY A;  3I4U A;  3LS1 A;  4A2N B;  3PHF 2;  5B1B C;  1ZHT A;  3T6B A;  2PX3 A;  2WVQ A;  2PF4 E;  2IYL D;  4U5B E;  1S7Z A;  5KYX A;  1BR1 A;  1NZE A;  1ZU5 A;  4I3M A;  3NG1 A;  4O6N A;  1KU2 A;  1BR2 A;  4RBN A;  4H4K C;  2J0X A;  1OCZ C;  2V26 A;  1WGW A;  3DJN B;  3SP1 A;  3NYL A;  3B9Q A;  3W8I A;  4J32 B;  1V54 C;  4LLC A;  2D5R B;  3EH1 A;  3WOD F;  3KMI A;  3OEO A;  2Q9A A;  2W4B A;  2Y69 C;  3K1I C;  4CSA A;  2OG2 A;  5DS5 A;  2I8B A;  3DM5 A;  1Z63 A;  4P6I C;  2J7P D;  5KYX B;  4RD9 A;  4PK4 A;  2IXP A;  2G3V A;  3Q6M A;  3B0P A;  4CS8 A;  4M63 A;  2P7V A;  3L34 A;  3ABK C;  3NYJ A;  4YN0 B;  1LVK A;  2W4M A;  4JJG A;  4YWQ A;  3JT1 A;  4BEJ A;  1OKK A;  1J8M F;  4I44 A;  4K7B A;  3RH3 A;  1BR4 A;  5KYN A;  1RJ9 A;  4N06 A;  5KYW A;  2BE5 F;  1NG1 A;  3LAY A;  2G3K A;  3LS0 A;  1IW7 F;  1V55 C;  5E3C A;  1RJ9 B;  3L0I A;  4DBR A;  1D1A A;  2NUP A;  3DZA A;  4ZLC A;  2J0W A;  1MND A;  1NU7 D;  4NY3 A;  2Y3G A;  3S0X A;  3QMK A;  4EWC A;  2WZF A;  3LLK A;  3SYN A;  3ZG1 A;  1TWH A;  2WB7 A;  2XL4 A;  4CIH A;  5KYY B;  2J7P A;  2LSE A;  2VB6 A;  2CNW A;  4OIO F;  5DS4 A;  4PFP A;  2C03 A;  2VH3 A;  5L3V A;  5CI9 A;  2O9X A;  4X0R A;  3RIP A;  3K1H A;  1VOM A;  4Q7C A;  1TWA A;  2H7V C;  2R7R A;  4XLP F;  1ZHY A;  4J30 B;  4U5E E;  1VYI A;  2J9U A;  3S27 A;  4KNW A;  1PD1 A;  4OD4 A;  2E87 A;  4ULW A;  2EIK C;  2YEV A;  2A68 F;  3UMH A;  1TWG A;  3AG2 C;  3EFO B;  5T1D B;  4G7O F;  3DMD A;  3FHD A;  3KH2 A;  2ZXW C;  1VMA A;  5E33 A;  2EIN C;  1G8X A;  2VAS A;  1ZHW A;  3NRH A;  1N1C A;  3W8H A;  2ZXR A;  4G7Z F;  1M57 C;  3E70 C;  4I1M A;  3M1C B;  2WZL A;  3RYL A;  2HV6 A;  1M2V B;  5B3S C;  1LKX A;  2KJG A;  4W8K A;  5CI8 A;  3Q7G A;  3UGO A;  2Q9B A;  4JUR I;  2M4E A;  4JVS A;  4AE4 A;  5DVW A;  3W2W A;  5B1A C;  3DAF A;  2R7X A;  2EIM C;  3DJU B;  4HE8 D;  4XLN F;  3K66 A;  5BUO A;  4QI2 A;  2NUT A;  4FES A;  4G0H A;  2A69 F;  4QDL A;  3NKD A;  3F47 A;  5IY5 C;  1O5H A;  2QY9 A;  1OKK D;  3VAY A;  3JYH A;  1MNE A;  1MMD A;  2CW0 F;  3LEV A;  2R7W A;  3EH2 A;  2W45 A;  1D0Y A;  4BJ1 A;  3T6J A;  2GFH A;  4LAC B;  2P6V A;  2Q9C A;  4G7H F;  2IXN A;  3EQL F;  3ECS A;  2MYS A;  3B0V C;  2L81 A;  4HEA J;  3T4R A;  2ZPA A;  3ASO C;  1W2W A;  3S29 A;  4E7S A;  3FDQ A;  3NYM A;  3S28 A;  4RDA A;  4BJ6 C;  3KKB A;  2L9J A;  3AG3 C;  1SZI A;  3Q7L A;  3SEO A;  3ZC4 A;  3VYW A;  1VYK A;  5D92 A;  3WG7 C;  1Z5Z A;  4C3E A;  4K0D A;  1NU9 C;  4OIQ F;  4LER A;  3ABM C;  4CBE A;  2R7T A;  3DXJ F;  4DOZ A;  1VK5 A;  3EJN A;  4CS9 C;  3EPV A;  2FFH A;  2HV7 A;  5EHH A;  4IRU A;  3DD7 A;  2MWQ A;  3SZR A;  4IAO A;  5HSW A;  5FCL A;  3HJC A;  3EFO A;  1LS1 A;  4EBB A;  3I5Q A;  2J9W A;  5D91 A;  3ITF A;  4IJJ A;  2H7O A;  4BJ5 A;  3N24 A;  5KYW B;  3HTK C;  4Q4Z F;  2WZG A;  4KBL A;  4U5H A;  1JPJ A;  4OD5 A;  5F5H A;  3QZC A;  4AK9 A;  2IXM A;  4U5D E;  4FX5 A;  4C3D A;  1TWC A;  2ZXP A;  3UMK A;  3AQC A;  2DYS C;  5F5F A;  2EIL C;  4AE4 B;  3TD7 A;  1M2V A;  1Z6A A;  1SF8 A;  4B6I A;  4OIP F;  4MND A;  1FMW A;  3ZVR A;  2KQ9 A;  3O39 A;  2CDQ A;  1ZYR F;  3FVY A;  4PJM A;  2A6E F;  3N2Z B;  2KNH A;  3I5P A;  5DQT A;  2A1D D;  2X51 A;  3GAN A;  4QI0 A;  3UNG C;  4AX2 A;  4XWJ A;  1D1C A;  1JPN A;  1QZX A;  3ASN C;  1D1B A;  2V3C C;  2DYR C;  1FTS A;  1TR2 A;  3AG1 C;  1D0X A;  3EGD B;  3CSK A;  2Y3B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...