2P1AA

Crystal structure of a putative metal-binding protein (bce_2162) from bacillus cereus atcc 10987 at 2.10 a resolution
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
143
structure length
143
Chain Sequence
GMFVQSALHQLKVAVDTSIQMLDQYTEIDLKIAPIQSKRSLFEMYAHLSLICHADLLILNGSTEKELHTFYKEQTPETIAQMQKTMIQGYDLLSKTFLSYSNEQLAEMKTAYWGISYSRFEWLLEIVAHFYHHRGQIHILLCE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein
publication title Crystal structure of hypothetical protein (NP_978475.1) from Bacillus cereus ATCC 10987 at 2.10 A resolution
rcsb
source organism Bacillus cereus
molecule tags Unknown function
total genus 48
structure length 143
sequence length 143
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12867 DinB_2 DinB superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.450 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) dinb family like domain 2p1aA00
2RD9A 2OU6A 2HKVA 3GORA 5CIVA 5COGA 4N6CA 3DI5A 2F22A 2QE9A 2NSGA 3DKAA 5COMA 1RXQA 2OQMA 3QTHA 2NSFA 2P1AA 5COFA 3CEXA 2QNLA 2YQYA
chains in the Genus database with same CATH superfamily
4DRHB 4WGYA 2XS8A 2R7XA 1J8YF 1JOGA 1FMWA 2G3KA 3GEHA 3O10A 3ITFA 1WTYA 4BJ6C 1G4WR 4E0IA 3DMDA 1VK5A 3FAPB 4G78A 4YWQA 2YHSA 2ASRA 2LFFA 2CGEA 2E87A 1YYJA 4CJOA 3EFOB 1M57C 2KJGA 4AL1A 4RDAA 2QY9A 2WVQA 4J7TA 3SP1A 5K0IA 3PDMP 4DXWA 2VC9A 5KYUB 1Q0MA 2XLHA 3IEEA 1OR2A 4BG0A 2A6HF 3C8GA 3NYLA 5A6BA 4U5CE 2XLDA 2A69F 3BEHA 5F5HA 2R25A 4XTKA 3M15A 2J8WA 2R7OA 2ZXWC 3I5QA 4LDQA 4YJWA 4MVRA 1OW8A 2OCCC 4U9DA 2AVKA 4NTAA 4H54A 5JT4A 2JPUA 2XXAB 4QI2A 1QPUA 3EH1A 3SZRA 3ZDLA 2WZGA 4PJNA 2YKZA 1LPEA 5L0GA 5A6KA 2A0UA 2A6EF 1TWHA 3VAYA 3EG9B 3M4BA 1T6UA 1KTMA 1G8XA 4FWVA 4M63A 1LS4A 4MTOA 3IQCA 3H65A 1T9KA 3C18A 1RJ9A 2DI3A 1OCZC 1BR1A 1XWJA 3M79A 1FAPB 1ZU5A 4DJ9A 5AC5A 2EIKC 3K66A 2XM4A 3DXJF 3Q6NA 5CI8A 1BBHA 4K7BA 5GPGB 1HW2A 3EQLF 2OJQA 3G4ZA 3S27A 2WB7A 1VTMP 1NFOA 3ZQVA 3SXZA 2D4UA 2ZD9A 4JE9A 4KI2A 1YVIA 3U8VA 2JD3A 1QZXA 3EHNA 1I4YA 1FR0A 1ORSC 1D1BA 2J0WA 3C62A 4IJJA 3DZAA 5AC4A 1L7CA 5DLJA 3DM5A 3AQCA 4EUKB 3RKOF 5DQTA 1PCXA 2YL7A 3T6BA 5A6AA 5KYYB 4MTFA 3L1MA 4EBBA 5EHHA 2FFHA 1SZIA 4EBJA 1TQGA 4W8KA 3L34A 5L3QA 1TFKB 2XLMA 2WL8A 3NMKA 4IAQA 2X0CA 1APCA 4LLCA 4JIOA 3GM2A 2G3VA 1H9TA 2J7PA 3JT1A 4IB4A 4MVZA 5KYWA 1YLMA 2LIGA 4PJMA 2D5RB 1VYIA 4YN0B 4G7OF 1N1CA 1WN0A 1Z3IX 3FMSA 1XZQA 3AG3C 3FOPA 3NG1A 2NUTA 5COFA 3ZTZA 3CQZA 1NSGB 4U9EA 2O9XA 5F5FA 1TWGA 3ZVRA 2LK4A 1K05A 4F4BA 2P61A 4PR9A 1WWPA 4YT2A 3NRHA 1HMDA 4JTAB 3K6BA 1GM5A 3EZHA 4CDVA 2KC3A 2R05A 4YT5A 4CS7A 3I5PA 3N0TA 4BEMJ 3U0CA 3R7CA 4IARA 3KPHA 2QLAA 1H9GA 4DVYP 2NG1A 1YDIA 4XPYA 2LP4A 2JX0A 2MHRA 3N24A 2P7VA 3B9QA 3IQ6A 4P9FA 3ZTMA 5F28E 4Z9IA 3LEVA 1RCPA 4G7ZF 4JURI 5DS5A 3SXYA 1E84A 1ZHTA 2IM8A 2HMQA 1CGOA 3VM6A 1T5OA 4AE4A 1M6TA 2XLOA 2XLVA 2R7TA 4MTGA 4YL1A 4O6MA 2H7VC 4MW3A 5JLIA 3M1CB 3OWTA 1LI7A 1UFBA 2YLGA 2KQ9A 3GWLA 3UGPA 2PFDA 3K33A 3FDQA 2CW0F 3KMIA 3W2WA 1YJGA 3A11A 1FFTC 2B0HA 1BDJB 4MVOA 3U2MA 3VYWA 3U3BA 1WGWA 3VRCA 2GAQA 3ZIBA 4NY3A 2XM0A 4CS9C 3Q7GA 2X51A 5BQIA 1YYXA 3T6JA 2YWAA 2MYSA 2G62A 5D91A 3T6GB 1SYQA 2BE5F 1JAFA 4ZLDA 3TJ6A 2HV7A 3S90A 4I3MA 4LACB 3ASOC 1FFHA 2GWWA 4U5BE 1VLTA 1ZW3A 2XL6A 4Q7CA 1LE2A 4YL3A 1M2VB 2EIJC 4DRJB 2UUHA 1OKKA 4HFKB 3W8HA 5HV9A 1BR4A 2IBFA 4JEAA 4XQ1A 3G4XA 2R7RA 4CS8C 4YT4A 1QKRA 4DBRA 3V7OA 4EBKA 5JP7A 4XEFA 2YL0A 4OIPF 1VB5A 1M2OA 3DM9B 1FMVA 4PJJA 5BQGA 4Q4ZF 4CDYA 3A9CA 1D0ZA 2KYHA 3EGDA 1A7EA 1M56C 3T4RA 1E86A 5T3TA 3SNHA 2GDCA 1RMVA 4LERA 2NSGA 3KKBA 3MBGA 2V26A 2M4EA 2WZFA 5T3WA 2HJMA 3T9OA 5L3VA 2Y69C 3DKAA 3GWNA 2AU5A 4GQHA 4JC7A 4XWJA 3RVYA 4EHPA 1OCRC 4BJ6A 5EGYA 2L6HA 2HS5A 4KC9A 1IW7F 3EGXA 3DAGA 1NZEA 2PX3A 1QLEC 2W4MA 3QW0A 3RQGA 2HFIA 5FCLA 4JKVA 4JVSA 3S84A 2GA0A 3MYFA 3LJBA 3AGUA 2LQGA 5JRAA 3U8PA 1B68A 3H2UA 2FGYA 2EPNA 3RFYA 3M4CA 3NYJA 3B0PA 2AWYA 4C7OB 1OCOC 3UMKA 2Y39A 1T6IA 4AK9A 2J9WA 2BC5A 4RBNA 2R03A 2QE9A 3HJCA 3LESA 4K1OA 2QTVA 2RSEB 3JRMO 2XSEA 2A68F 2H7BA 4E17A 1GS9A 3UR3C 1LI5A 1NG1A 5JVEA 3AG2C 2H7OA 3ASNC 1RKEA 4EIYA 3C63A 2Q9AA 3NKDA 4WJ0A 3QW1A 1KNYA 2J9UA 4O6NA 1QVXA 3US6A 2ETSA 4JJFA 5L0DA 5JS5A 1TWAA 3JSZA 1C02A 2NUPB 3ABLC 3EJNA 3V5YA 5D92A 4N06A 3UMHA 4BEJA 2EIMC 3RF3A 3S29A 3V5XA 1YA9A 5COGA 4N6CA 1Q0DA 1Z7Qc 1D1AA 2L81A 3V5ZA 2R7SA 4I44A 2HSQA 4PFOA 1PD0A 1MMNA 3TD7A 1ZU4A 2PBEA 1TFOB 3DJUB 3ATPA 3E70C 1EQ1A 1E83A 3FVYA 1S7ZA 4C3EA 4NTBA 4FX5A 1G5ZA 2EPLX 2P6VA 3C8GD 4K0DA 4LDRA 3HNLA 5A6BD 5E2QA 2YRFA 4NTFA 3EFOA 4CSAC 3LS0A 5JSLA 4CDAA 3NDBB 1MMGA 5E3CA 1WOLA 4PK4A 2YL1A 3TK0A 3B71A 2QNLA 4DVZA 3SXKA 1PV3A 1T01A 2CYDA 2VASA 1UG7A 3Q6MA 2UUIA 1T6QA 2QUPA 3TOMA 3KYIA 3WHNA 2R7VA 2KW3C 1IZMA 3EHMA 1TWCA 2HUJA 5KYUA 1L3PA 3LEOA 5KYXB 1K04A 3AQBA 2IOQA 4P6IC 1R4TA 3LUTB 3VF0A 2Q3TA 2CNWA 3ABMC 4H4KC 1ZHXA 4IRUA 3RVZA 4JRZA 3W8IA 2YLDA 1F1MA 3W2VA 2VCAA 2HMZA 1NBBA 3IPMO 1J8MF 1Z63A 2XXAA 1U6HA 2OJED 1MMAA 3JSEO 4DBQA 4GEHA 1KU2A 1NFNA 1OQCA 4OD5A 4R32A 5DVWA 3JYHA 1O5HA 3G50A 3EG9A 4KNVA 4XPXA 3X1OA 4D4XA 5L0HA 1PD1A 4GYTA 4CX9A 3QMKA 1EKYA 1JRAA 2LSEA 4BJTA 3C7JA 3DJNB 5L0FA 1OXBA 5B3IA 2A0BA 1MMDA 3U9JA 1XZPA 4IWBA 4X0RA 1Y4CA 1CPQA 4ANJA 3H2VA 1WASA 2HZ8A 2HSBA 3GANA 3L8JA 5A69A 3C8ZA 3C8GB 2EILC 1GQAA 4A4AA 2J7PD 1I4ZA 2AWCA 3J06A 3DE9A 1I5NA 1LIHA 2J45A 2KGOA 5COMA 3EZIA 3K7DA 1YZAA 2KNHA 1SR2A 3AG1C 1RXQA 1OW6A 1LE4A 2VB6A 3GM3A 3K1IC 4MQ9F 1LM3B 2XL8A 5BUOA 5KYYA 3ZQYA 2B0JA 2VCBA 3DE8A 4P9TA 4U5GA 4XLPF 1TKNA 3PMRA 1JPNA 2OG2A 2RD9A 3CEXA 4ULWA 4L6RA 2J46A 4JW1A 4Z9HA 3KH2A 4LDKA 4CS9A 1MQVA 3X2QC 2OU6A 3LNMB 1A7DA 1RJ9B 4J32B 1H7IA 1EA8A 3UNGC 3TOLA 2F22A 2XS1A 1AUEA 3AOUA 3K1IA 2Y3GA 1VYKA 2C03A 2DYRC 2R02A 3HNJA 3MLGA 3PHF2 5DQZA 4ZLCA 3ZC4A 2A1DD 2CCYA 1NU9C 2LCHA 3DAFA 2DYSC 3Q7LA 3U3FA 1V4AA 4CS8A 5E3AA 3O6XA 2IXOA 2Q7RA 1Z5ZA 3LNRA 4E18A 4UDVA 3RYLA 1OCCC 1U89A 3PCVA 2EINC 4IAOA 1GGQA 3IQ5A 4O6YA 1HE1A 4MVMA 3I4UA 2ZXOA 2C04A 3HNKA 2VCCA 3JRTA 1VOMA 2Z15A 4J30B 2LD6A 4OIOF 3ZSUA 1W2WA 4PFPA 2P0NA 3L8IA 1EI7A 4AX2A 3K1HA 3U2LA 1DOWA 4KNWA 3EH2A 3QVYA 1YAUO 5B1AC 4FESA 3S0XA 5KYWB 3BRJA 1CGME 5TJ5E 4HE8D 2I15A 4JCHA 2NUTB 3DD7A 4J7YA 5DS4A 2OEXA 1VMAA 2DB4A 1Z23A 3SEOA 1D0XA 4XEVA 1LS1A 3ABKC 1O87A 2I8BA 2ZPAA 3GM1A 3RW0A 4DOZA 5DS6A 5KYNA 2Q00A 4E0HA 2WVNA 2EPOA 1Z6AA 4U5HA 3RQFA 5AGFA 3FXHA 1OKKD 3AG4C 2XLEA 3O39A 4I1OB 2WZLA 1QSPA 2NSFA 2P1AA 1JPJA 4HEAJ 4U5EE 2L7AA 3TJ5A 4A2NB 2TMVP 4G7HF 3HLZA 4HFFB 2PP4A 4W8PA 3ECSA 4BPMA 2YQYA 3JTLO 4CJGA 1HMOA 4ER9A 4BJ5C 4MNDA 4O7GA 4C3BA 3MFNA 4E7ZA 5CIVA 4U5FE 1ST6A 3RH3A 1D1CA 2FAPB 4N6HA 4XEKA 3ZWIA 1M2VA 1A0BA 2Y3HA 1Q0KA 2Y3BA 3OEOA 3IQTA 2XL4A 5HSWA 4DRIB 4AE4B 1QQ3A 2YL3A 2W4BA 2OKUA 4MVUA 4OINF 3QVZA 3IHUA 2PNOA 3R2PA 4CBEA 4MVQA 4BJ1A 5L0IA 2EPKX 1BZ4A 2ZXRA 3UMIA 5B1BC 4JTCB 3B0UX 4BJ5A 3HNIA 3L0IA 1HE9A 1ZYRF 4N4WA 3WG7C 3TQOA 5IY5C 3KL4A 3U9MA 2W9YA 2KK1A 2VH3A 3LAYA 4KBLA 1V55C 4U5DE 3TULA 3QZCA 2H8AA 4JEBA 2Q9CA 3RQEA 1R5ID 4CIHA 4MS2A 1SMYF 4D4NA 1YA7O 2J0XA 1AEPA 1ZW2A 3HKKA 4YK5A 5CI9A 4ONSA 4QDLA 1LVKA 4WGZA 1JR8A 2R9RB 4I1MA 1ORYA 1SF8A 3POVA 1OR3A 2AP3A 4PACA 2XRHA 1ZHYA 4OD4A 4JCZA 1ZHWA 3HTKC 3W4YA 4CSAA 2XLWA 3SYNA 3AJMA 1ORJA 4CIPA 2KSFA 1O3UA 4YT8A 3FOOA 1YARO 3U5SA 2YZSA 4EWCA 2NPUA 3WAQA 3RIPA 2HJ3A 4C7OA 1TR2A 1A7VA 1OXKA 2ICWG 3DWWA 2OEVA 3F47A 3ZG1A 4E7SA 1ZZPA 2Y3DA 3EGDB 1ZHZA 1E2XA 3EPVA 4LLEA 1YZCA 4O79A 3OA1A 4JJGA 5L0JA 5EK0A 2R7UA 1RKCA 1D0YA 3KYJA 4QI0A 3NYMA 3NMIA 2DGJA 3CSKA 1S05A 2LFDA 1Y6DA 3DI5A 2L9JA 3B29A 3GEIA 3O55A 1BR2A 4NC3A 2MWQA 1NLXA 2EPMX 3S28A 4EKWA 1E85A 2IYLD 2NUPA 4YL0A 2R7WA 1Q0GA 4MVSA 4MW8A 4Z9JA 3EGXB 5E33A 4B6IA 4RD9A 5A6JA 2YVKA 1FNTc 3MYIA 1V74B 5JUAA 2OOCA 4G0HA 3JYYA 4WABA 3WODF 2OQMA 3S9OA 1G4US 4NCQA 4FAPB 3LS1A 4OIQF 2CDQA 2IXNA 5T1DB 1WATA 3NKEA 1A41A 1AVOB 3JZ0A 1VLSA 1MNDA 2GFHA 2L6GA 3SXMA 1DOVA 3CZ6A 1C03A 1OW7A 2HKVA 1HW1A 2PF4E 2ZXPA 3GORA 3NMJA 1JMWA 4ULVA 1MNEA 3FHDA 3B0VC 2L6FA 1K40A 1RKEB 1LKXA 2CNWD 2YEVA 4JTDB 4NQFA 2IXMA 5L0CA 3LLIA 1HY5A 4AL0A 2YLIA 2IXPA 1FTSA 3GODA 3F46A 4JZAA 4IGGA 3GEEA 4PJLA 4Q5SF 3MX3A 4XPWA 1V54C 3E9VA 2BL2A 2R7QA 4XLNF 3LLKA 5KYXA 2J9BA 1CPRA 2Q4FA 2W45A 3AGTA 4C3DA 3UGOA 5B3SC 2V3CC 2J9VA 1U0BB 3QTHA 1C17M 2WVOA 1CGNA 5FZTA 5BQHA 3CAXA 2HV6A 2Q9BA 256BA 3JCUQ 2PX0A 4OIRF 1ZVZA 1H6GA 2M64A 1NU7D 1Q0FA 3FAJA 3N2ZB
chains in the Genus database with same CATH topology
2RD9A 2OU6A 2HKVA 3GORA 5CIVA 5COGA 4N6CA 3DI5A 2F22A 2QE9A 2NSGA 3DKAA 5COMA 1RXQA 2OQMA 3QTHA 2NSFA 2P1AA 5COFA 3CEXA 2QNLA 2YQYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RD9 A;  2OU6 A;  2HKV A;  3GOR A;  5CIV A;  5COG A;  4N6C A;  3DI5 A;  2F22 A;  2QE9 A;  2NSG A;  3DKA A;  5COM A;  1RXQ A;  2OQM A;  3QTH A;  2NSF A;  2P1A A;  5COF A;  3CEX A;  2QNL A;  2YQY A; 
#chains in the Genus database with same CATH topology
 4DRH B;  4WGY A;  2XS8 A;  2R7X A;  1J8Y F;  1JOG A;  1FMW A;  2G3K A;  3GEH A;  3O10 A;  3ITF A;  1WTY A;  4BJ6 C;  1G4W R;  4E0I A;  3DMD A;  1VK5 A;  3FAP B;  4G78 A;  4YWQ A;  2YHS A;  2ASR A;  2LFF A;  2CGE A;  2E87 A;  1YYJ A;  4CJO A;  3EFO B;  1M57 C;  2KJG A;  4AL1 A;  4RDA A;  2QY9 A;  2WVQ A;  4J7T A;  3SP1 A;  5K0I A;  3PDM P;  4DXW A;  2VC9 A;  5KYU B;  1Q0M A;  2XLH A;  3IEE A;  1OR2 A;  4BG0 A;  2A6H F;  3C8G A;  3NYL A;  5A6B A;  4U5C E;  2XLD A;  2A69 F;  3BEH A;  5F5H A;  2R25 A;  4XTK A;  3M15 A;  2J8W A;  2R7O A;  2ZXW C;  3I5Q A;  4LDQ A;  4YJW A;  4MVR A;  1OW8 A;  2OCC C;  4U9D A;  2AVK A;  4NTA A;  4H54 A;  5JT4 A;  2JPU A;  2XXA B;  4QI2 A;  1QPU A;  3EH1 A;  3SZR A;  3ZDL A;  2WZG A;  4PJN A;  2YKZ A;  1LPE A;  5L0G A;  5A6K A;  2A0U A;  2A6E F;  1TWH A;  3VAY A;  3EG9 B;  3M4B A;  1T6U A;  1KTM A;  1G8X A;  4FWV A;  4M63 A;  1LS4 A;  4MTO A;  3IQC A;  3H65 A;  1T9K A;  3C18 A;  1RJ9 A;  2DI3 A;  1OCZ C;  1BR1 A;  1XWJ A;  3M79 A;  1FAP B;  1ZU5 A;  4DJ9 A;  5AC5 A;  2EIK C;  3K66 A;  2XM4 A;  3DXJ F;  3Q6N A;  5CI8 A;  1BBH A;  4K7B A;  5GPG B;  1HW2 A;  3EQL F;  2OJQ A;  3G4Z A;  3S27 A;  2WB7 A;  1VTM P;  1NFO A;  3ZQV A;  3SXZ A;  2D4U A;  2ZD9 A;  4JE9 A;  4KI2 A;  1YVI A;  3U8V A;  2JD3 A;  1QZX A;  3EHN A;  1I4Y A;  1FR0 A;  1ORS C;  1D1B A;  2J0W A;  3C62 A;  4IJJ A;  3DZA A;  5AC4 A;  1L7C A;  5DLJ A;  3DM5 A;  3AQC A;  4EUK B;  3RKO F;  5DQT A;  1PCX A;  2YL7 A;  3T6B A;  5A6A A;  5KYY B;  4MTF A;  3L1M A;  4EBB A;  5EHH A;  2FFH A;  1SZI A;  4EBJ A;  1TQG A;  4W8K A;  3L34 A;  5L3Q A;  1TFK B;  2XLM A;  2WL8 A;  3NMK A;  4IAQ A;  2X0C A;  1APC A;  4LLC A;  4JIO A;  3GM2 A;  2G3V A;  1H9T A;  2J7P A;  3JT1 A;  4IB4 A;  4MVZ A;  5KYW A;  1YLM A;  2LIG A;  4PJM A;  2D5R B;  1VYI A;  4YN0 B;  4G7O F;  1N1C A;  1WN0 A;  1Z3I X;  3FMS A;  1XZQ A;  3AG3 C;  3FOP A;  3NG1 A;  2NUT A;  5COF A;  3ZTZ A;  3CQZ A;  1NSG B;  4U9E A;  2O9X A;  5F5F A;  1TWG A;  3ZVR A;  2LK4 A;  1K05 A;  4F4B A;  2P61 A;  4PR9 A;  1WWP A;  4YT2 A;  3NRH A;  1HMD A;  4JTA B;  3K6B A;  1GM5 A;  3EZH A;  4CDV A;  2KC3 A;  2R05 A;  4YT5 A;  4CS7 A;  3I5P A;  3N0T A;  4BEM J;  3U0C A;  3R7C A;  4IAR A;  3KPH A;  2QLA A;  1H9G A;  4DVY P;  2NG1 A;  1YDI A;  4XPY A;  2LP4 A;  2JX0 A;  2MHR A;  3N24 A;  2P7V A;  3B9Q A;  3IQ6 A;  4P9F A;  3ZTM A;  5F28 E;  4Z9I A;  3LEV A;  1RCP A;  4G7Z F;  4JUR I;  5DS5 A;  3SXY A;  1E84 A;  1ZHT A;  2IM8 A;  2HMQ A;  1CGO A;  3VM6 A;  1T5O A;  4AE4 A;  1M6T A;  2XLO A;  2XLV A;  2R7T A;  4MTG A;  4YL1 A;  4O6M A;  2H7V C;  4MW3 A;  5JLI A;  3M1C B;  3OWT A;  1LI7 A;  1UFB A;  2YLG A;  2KQ9 A;  3GWL A;  3UGP A;  2PFD A;  3K33 A;  3FDQ A;  2CW0 F;  3KMI A;  3W2W A;  1YJG A;  3A11 A;  1FFT C;  2B0H A;  1BDJ B;  4MVO A;  3U2M A;  3VYW A;  3U3B A;  1WGW A;  3VRC A;  2GAQ A;  3ZIB A;  4NY3 A;  2XM0 A;  4CS9 C;  3Q7G A;  2X51 A;  5BQI A;  1YYX A;  3T6J A;  2YWA A;  2MYS A;  2G62 A;  5D91 A;  3T6G B;  1SYQ A;  2BE5 F;  1JAF A;  4ZLD A;  3TJ6 A;  2HV7 A;  3S90 A;  4I3M A;  4LAC B;  3ASO C;  1FFH A;  2GWW A;  4U5B E;  1VLT A;  1ZW3 A;  2XL6 A;  4Q7C A;  1LE2 A;  4YL3 A;  1M2V B;  2EIJ C;  4DRJ B;  2UUH A;  1OKK A;  4HFK B;  3W8H A;  5HV9 A;  1BR4 A;  2IBF A;  4JEA A;  4XQ1 A;  3G4X A;  2R7R A;  4CS8 C;  4YT4 A;  1QKR A;  4DBR A;  3V7O A;  4EBK A;  5JP7 A;  4XEF A;  2YL0 A;  4OIP F;  1VB5 A;  1M2O A;  3DM9 B;  1FMV A;  4PJJ A;  5BQG A;  4Q4Z F;  4CDY A;  3A9C A;  1D0Z A;  2KYH A;  3EGD A;  1A7E A;  1M56 C;  3T4R A;  1E86 A;  5T3T A;  3SNH A;  2GDC A;  1RMV A;  4LER A;  2NSG A;  3KKB A;  3MBG A;  2V26 A;  2M4E A;  2WZF A;  5T3W A;  2HJM A;  3T9O A;  5L3V A;  2Y69 C;  3DKA A;  3GWN A;  2AU5 A;  4GQH A;  4JC7 A;  4XWJ A;  3RVY A;  4EHP A;  1OCR C;  4BJ6 A;  5EGY A;  2L6H A;  2HS5 A;  4KC9 A;  1IW7 F;  3EGX A;  3DAG A;  1NZE A;  2PX3 A;  1QLE C;  2W4M A;  3QW0 A;  3RQG A;  2HFI A;  5FCL A;  4JKV A;  4JVS A;  3S84 A;  2GA0 A;  3MYF A;  3LJB A;  3AGU A;  2LQG A;  5JRA A;  3U8P A;  1B68 A;  3H2U A;  2FGY A;  2EPN A;  3RFY A;  3M4C A;  3NYJ A;  3B0P A;  2AWY A;  4C7O B;  1OCO C;  3UMK A;  2Y39 A;  1T6I A;  4AK9 A;  2J9W A;  2BC5 A;  4RBN A;  2R03 A;  2QE9 A;  3HJC A;  3LES A;  4K1O A;  2QTV A;  2RSE B;  3JRM O;  2XSE A;  2A68 F;  2H7B A;  4E17 A;  1GS9 A;  3UR3 C;  1LI5 A;  1NG1 A;  5JVE A;  3AG2 C;  2H7O A;  3ASN C;  1RKE A;  4EIY A;  3C63 A;  2Q9A A;  3NKD A;  4WJ0 A;  3QW1 A;  1KNY A;  2J9U A;  4O6N A;  1QVX A;  3US6 A;  2ETS A;  4JJF A;  5L0D A;  5JS5 A;  1TWA A;  3JSZ A;  1C02 A;  2NUP B;  3ABL C;  3EJN A;  3V5Y A;  5D92 A;  4N06 A;  3UMH A;  4BEJ A;  2EIM C;  3RF3 A;  3S29 A;  3V5X A;  1YA9 A;  5COG A;  4N6C A;  1Q0D A;  1Z7Q c;  1D1A A;  2L81 A;  3V5Z A;  2R7S A;  4I44 A;  2HSQ A;  4PFO A;  1PD0 A;  1MMN A;  3TD7 A;  1ZU4 A;  2PBE A;  1TFO B;  3DJU B;  3ATP A;  3E70 C;  1EQ1 A;  1E83 A;  3FVY A;  1S7Z A;  4C3E A;  4NTB A;  4FX5 A;  1G5Z A;  2EPL X;  2P6V A;  3C8G D;  4K0D A;  4LDR A;  3HNL A;  5A6B D;  5E2Q A;  2YRF A;  4NTF A;  3EFO A;  4CSA C;  3LS0 A;  5JSL A;  4CDA A;  3NDB B;  1MMG A;  5E3C A;  1WOL A;  4PK4 A;  2YL1 A;  3TK0 A;  3B71 A;  2QNL A;  4DVZ A;  3SXK A;  1PV3 A;  1T01 A;  2CYD A;  2VAS A;  1UG7 A;  3Q6M A;  2UUI A;  1T6Q A;  2QUP A;  3TOM A;  3KYI A;  3WHN A;  2R7V A;  2KW3 C;  1IZM A;  3EHM A;  1TWC A;  2HUJ A;  5KYU A;  1L3P A;  3LEO A;  5KYX B;  1K04 A;  3AQB A;  2IOQ A;  4P6I C;  1R4T A;  3LUT B;  3VF0 A;  2Q3T A;  2CNW A;  3ABM C;  4H4K C;  1ZHX A;  4IRU A;  3RVZ A;  4JRZ A;  3W8I A;  2YLD A;  1F1M A;  3W2V A;  2VCA A;  2HMZ A;  1NBB A;  3IPM O;  1J8M F;  1Z63 A;  2XXA A;  1U6H A;  2OJE D;  1MMA A;  3JSE O;  4DBQ A;  4GEH A;  1KU2 A;  1NFN A;  1OQC A;  4OD5 A;  4R32 A;  5DVW A;  3JYH A;  1O5H A;  3G50 A;  3EG9 A;  4KNV A;  4XPX A;  3X1O A;  4D4X A;  5L0H A;  1PD1 A;  4GYT A;  4CX9 A;  3QMK A;  1EKY A;  1JRA A;  2LSE A;  4BJT A;  3C7J A;  3DJN B;  5L0F A;  1OXB A;  5B3I A;  2A0B A;  1MMD A;  3U9J A;  1XZP A;  4IWB A;  4X0R A;  1Y4C A;  1CPQ A;  4ANJ A;  3H2V A;  1WAS A;  2HZ8 A;  2HSB A;  3GAN A;  3L8J A;  5A69 A;  3C8Z A;  3C8G B;  2EIL C;  1GQA A;  4A4A A;  2J7P D;  1I4Z A;  2AWC A;  3J06 A;  3DE9 A;  1I5N A;  1LIH A;  2J45 A;  2KGO A;  5COM A;  3EZI A;  3K7D A;  1YZA A;  2KNH A;  1SR2 A;  3AG1 C;  1RXQ A;  1OW6 A;  1LE4 A;  2VB6 A;  3GM3 A;  3K1I C;  4MQ9 F;  1LM3 B;  2XL8 A;  5BUO A;  5KYY A;  3ZQY A;  2B0J A;  2VCB A;  3DE8 A;  4P9T A;  4U5G A;  4XLP F;  1TKN A;  3PMR A;  1JPN A;  2OG2 A;  2RD9 A;  3CEX A;  4ULW A;  4L6R A;  2J46 A;  4JW1 A;  4Z9H A;  3KH2 A;  4LDK A;  4CS9 A;  1MQV A;  3X2Q C;  2OU6 A;  3LNM B;  1A7D A;  1RJ9 B;  4J32 B;  1H7I A;  1EA8 A;  3UNG C;  3TOL A;  2F22 A;  2XS1 A;  1AUE A;  3AOU A;  3K1I A;  2Y3G A;  1VYK A;  2C03 A;  2DYR C;  2R02 A;  3HNJ A;  3MLG A;  3PHF 2;  5DQZ A;  4ZLC A;  3ZC4 A;  2A1D D;  2CCY A;  1NU9 C;  2LCH A;  3DAF A;  2DYS C;  3Q7L A;  3U3F A;  1V4A A;  4CS8 A;  5E3A A;  3O6X A;  2IXO A;  2Q7R A;  1Z5Z A;  3LNR A;  4E18 A;  4UDV A;  3RYL A;  1OCC C;  1U89 A;  3PCV A;  2EIN C;  4IAO A;  1GGQ A;  3IQ5 A;  4O6Y A;  1HE1 A;  4MVM A;  3I4U A;  2ZXO A;  2C04 A;  3HNK A;  2VCC A;  3JRT A;  1VOM A;  2Z15 A;  4J30 B;  2LD6 A;  4OIO F;  3ZSU A;  1W2W A;  4PFP A;  2P0N A;  3L8I A;  1EI7 A;  4AX2 A;  3K1H A;  3U2L A;  1DOW A;  4KNW A;  3EH2 A;  3QVY A;  1YAU O;  5B1A C;  4FES A;  3S0X A;  5KYW B;  3BRJ A;  1CGM E;  5TJ5 E;  4HE8 D;  2I15 A;  4JCH A;  2NUT B;  3DD7 A;  4J7Y A;  5DS4 A;  2OEX A;  1VMA A;  2DB4 A;  1Z23 A;  3SEO A;  1D0X A;  4XEV A;  1LS1 A;  3ABK C;  1O87 A;  2I8B A;  2ZPA A;  3GM1 A;  3RW0 A;  4DOZ A;  5DS6 A;  5KYN A;  2Q00 A;  4E0H A;  2WVN A;  2EPO A;  1Z6A A;  4U5H A;  3RQF A;  5AGF A;  3FXH A;  1OKK D;  3AG4 C;  2XLE A;  3O39 A;  4I1O B;  2WZL A;  1QSP A;  2NSF A;  2P1A A;  1JPJ A;  4HEA J;  4U5E E;  2L7A A;  3TJ5 A;  4A2N B;  2TMV P;  4G7H F;  3HLZ A;  4HFF B;  2PP4 A;  4W8P A;  3ECS A;  4BPM A;  2YQY A;  3JTL O;  4CJG A;  1HMO A;  4ER9 A;  4BJ5 C;  4MND A;  4O7G A;  4C3B A;  3MFN A;  4E7Z A;  5CIV A;  4U5F E;  1ST6 A;  3RH3 A;  1D1C A;  2FAP B;  4N6H A;  4XEK A;  3ZWI A;  1M2V A;  1A0B A;  2Y3H A;  1Q0K A;  2Y3B A;  3OEO A;  3IQT A;  2XL4 A;  5HSW A;  4DRI B;  4AE4 B;  1QQ3 A;  2YL3 A;  2W4B A;  2OKU A;  4MVU A;  4OIN F;  3QVZ A;  3IHU A;  2PNO A;  3R2P A;  4CBE A;  4MVQ A;  4BJ1 A;  5L0I A;  2EPK X;  1BZ4 A;  2ZXR A;  3UMI A;  5B1B C;  4JTC B;  3B0U X;  4BJ5 A;  3HNI A;  3L0I A;  1HE9 A;  1ZYR F;  4N4W A;  3WG7 C;  3TQO A;  5IY5 C;  3KL4 A;  3U9M A;  2W9Y A;  2KK1 A;  2VH3 A;  3LAY A;  4KBL A;  1V55 C;  4U5D E;  3TUL A;  3QZC A;  2H8A A;  4JEB A;  2Q9C A;  3RQE A;  1R5I D;  4CIH A;  4MS2 A;  1SMY F;  4D4N A;  1YA7 O;  2J0X A;  1AEP A;  1ZW2 A;  3HKK A;  4YK5 A;  5CI9 A;  4ONS A;  4QDL A;  1LVK A;  4WGZ A;  1JR8 A;  2R9R B;  4I1M A;  1ORY A;  1SF8 A;  3POV A;  1OR3 A;  2AP3 A;  4PAC A;  2XRH A;  1ZHY A;  4OD4 A;  4JCZ A;  1ZHW A;  3HTK C;  3W4Y A;  4CSA A;  2XLW A;  3SYN A;  3AJM A;  1ORJ A;  4CIP A;  2KSF A;  1O3U A;  4YT8 A;  3FOO A;  1YAR O;  3U5S A;  2YZS A;  4EWC A;  2NPU A;  3WAQ A;  3RIP A;  2HJ3 A;  4C7O A;  1TR2 A;  1A7V A;  1OXK A;  2ICW G;  3DWW A;  2OEV A;  3F47 A;  3ZG1 A;  4E7S A;  1ZZP A;  2Y3D A;  3EGD B;  1ZHZ A;  1E2X A;  3EPV A;  4LLE A;  1YZC A;  4O79 A;  3OA1 A;  4JJG A;  5L0J A;  5EK0 A;  2R7U A;  1RKC A;  1D0Y A;  3KYJ A;  4QI0 A;  3NYM A;  3NMI A;  2DGJ A;  3CSK A;  1S05 A;  2LFD A;  1Y6D A;  3DI5 A;  2L9J A;  3B29 A;  3GEI A;  3O55 A;  1BR2 A;  4NC3 A;  2MWQ A;  1NLX A;  2EPM X;  3S28 A;  4EKW A;  1E85 A;  2IYL D;  2NUP A;  4YL0 A;  2R7W A;  1Q0G A;  4MVS A;  4MW8 A;  4Z9J A;  3EGX B;  5E33 A;  4B6I A;  4RD9 A;  5A6J A;  2YVK A;  1FNT c;  3MYI A;  1V74 B;  5JUA A;  2OOC A;  4G0H A;  3JYY A;  4WAB A;  3WOD F;  2OQM A;  3S9O A;  1G4U S;  4NCQ A;  4FAP B;  3LS1 A;  4OIQ F;  2CDQ A;  2IXN A;  5T1D B;  1WAT A;  3NKE A;  1A41 A;  1AVO B;  3JZ0 A;  1VLS A;  1MND A;  2GFH A;  2L6G A;  3SXM A;  1DOV A;  3CZ6 A;  1C03 A;  1OW7 A;  2HKV A;  1HW1 A;  2PF4 E;  2ZXP A;  3GOR A;  3NMJ A;  1JMW A;  4ULV A;  1MNE A;  3FHD A;  3B0V C;  2L6F A;  1K40 A;  1RKE B;  1LKX A;  2CNW D;  2YEV A;  4JTD B;  4NQF A;  2IXM A;  5L0C A;  3LLI A;  1HY5 A;  4AL0 A;  2YLI A;  2IXP A;  1FTS A;  3GOD A;  3F46 A;  4JZA A;  4IGG A;  3GEE A;  4PJL A;  4Q5S F;  3MX3 A;  4XPW A;  1V54 C;  3E9V A;  2BL2 A;  2R7Q A;  4XLN F;  3LLK A;  5KYX A;  2J9B A;  1CPR A;  2Q4F A;  2W45 A;  3AGT A;  4C3D A;  3UGO A;  5B3S C;  2V3C C;  2J9V A;  1U0B B;  3QTH A;  1C17 M;  2WVO A;  1CGN A;  5FZT A;  5BQH A;  3CAX A;  2HV6 A;  2Q9B A;  256B A;  3JCU Q;  2PX0 A;  4OIR F;  1ZVZ A;  1H6G A;  2M64 A;  1NU7 D;  1Q0F A;  3FAJ A;  3N2Z B; 
#chains in the Genus database with same CATH homology
 2RD9 A;  2OU6 A;  2HKV A;  3GOR A;  5CIV A;  5COG A;  4N6C A;  3DI5 A;  2F22 A;  2QE9 A;  2NSG A;  3DKA A;  5COM A;  1RXQ A;  2OQM A;  3QTH A;  2NSF A;  2P1A A;  5COF A;  3CEX A;  2QNL A;  2YQY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...