2P1AA

Crystal structure of a putative metal-binding protein (bce_2162) from bacillus cereus atcc 10987 at 2.10 a resolution
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
143
structure length
143
Chain Sequence
GMFVQSALHQLKVAVDTSIQMLDQYTEIDLKIAPIQSKRSLFEMYAHLSLICHADLLILNGSTEKELHTFYKEQTPETIAQMQKTMIQGYDLLSKTFLSYSNEQLAEMKTAYWGISYSRFEWLLEIVAHFYHHRGQIHILLCE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein
publication title Crystal structure of hypothetical protein (NP_978475.1) from Bacillus cereus ATCC 10987 at 2.10 A resolution
rcsb
source organism Bacillus cereus
molecule tags Unknown function
total genus 48
structure length 143
sequence length 143
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12867 DinB_2 DinB superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.450 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) dinb family like domain 2p1aA00
1RXQA 2RD9A 5COGA 2NSGA 5COMA 3CEXA 2OU6A 2F22A 5COFA 2NSFA 2P1AA 3DI5A 2QE9A 3DKAA 5CIVA 3QTHA 2OQMA 3GORA 2YQYA 2HKVA 2QNLA 4N6CA
chains in the Genus database with same CATH superfamily
1HW1A 4MVQA 1YVIA 3V7OA 4AK9A 2RD9A 1Z7Qc 2R7XA 1QLEC 2YRFA 4EKWA 1I4YA 2R05A 5COMA 1LVKA 1QQ3A 2PX3A 3CEXA 2J9WA 5JUAA 1OXKA 3RYLA 1RMVA 1U6HA 3R7CA 3ZQYA 4CSAA 3NMJA 4OINF 2PF4E 3PMRA 3VRCA 4XEVA 1C17M 3LNMB 5L0DA 3EGDA 5FZTA 1FTSA 3JSEO 1S7ZA 3DE9A 2LFFA 4E0IA 4DVZA 5L3VA 5E3CA 4E7SA 1NG1A 1BR1A 1VTMP 3EH2A 2WVNA 2J7PD 3T6JA 3B0VC 3U3FA 1WN0A 3QVZA 2P61A 1E85A 1JPNA 2YL0A 1VYKA 4CS7A 4W8PA 5DQZA 2LQGA 2Q9BA 4O79A 4CS9C 3CSKA 5T3TA 2UUIA 4MVRA 3KYJA 2VH3A 5E2QA 2MHRA 1H6GA 2XM4A 1LE2A 1LI7A 4HE8D 4PJJA 5EHHA 5KYXA 2AWCA 2EIMC 2YKZA 1FR0A 4CJOA 4LDQA 4LLCA 3GEHA 4IB4A 2EIKC 4K1OA 3RQEA 3W2WA 4DOZA 4JEAA 1BBHA 2KQ9A 3NYLA 4RDAA 1MMGA 1WGWA 1KTMA 3QVYA 4XQ1A 2LIGA 4MTGA 3DMDA 4CIPA 1H9TA 1VOMA 3FOPA 1RKEB 2J0WA 3LNRA 5BQGA 3C8GD 2ZXWC 2J9UA 5CIVA 2OQMA 1ZU4A 3WODF 1WTYA 2HJMA 2KSFA 3I5QA 3GEIA 5KYUB 2AVKA 2O9XA 2OOCA 5A6KA 1TR2A 4NTBA 3W4YA 3HNKA 3V5ZA 4KI2A 2D4UA 3FVYA 1ZHWA 2A0UA 2I8BA 4WABA 3AGTA 1XZQA 3EGXA 1W2WA 2ZXOA 1GGQA 1H9GA 2JPUA 4JKVA 3SYNA 4AX2A 2GDCA 2VCAA 3PDMP 3RVZA 4U5EE 3UNGC 1VB5A 2HMQA 1M2OA 3M79A 4I1OB 4U5FE 2RSEB 1K04A 1OQCA 2DGJA 2HZ8A 2J45A 2AP3A 1GM5A 3BEHA 2ZXPA 2OJQA 2IXNA 4EWCA 4BJ1A 4CBEA 2TMVP 1E2XA 4LLEA 3S29A 5JSLA 3G4XA 5T3WA 4CS8A 2E87A 2Y3DA 3EHNA 2D5RB 2R7QA 3RFYA 2EPKX 2ZD9A 3ASNC 1Z6AA 3NG1A 1JRAA 4PFOA 3EQLF 3N24A 2HKVA 5EK0A 3T6BA 3VYWA 3VAYA 5DS6A 5JT4A 5L0CA 5L0IA 3C18A 2OG2A 2XLMA 4IAOA 4XEKA 2A6HF 2KNHA 4JCHA 2PBEA 1NSGB 2IXMA 3OA1A 2XL6A 4E0HA 1ZHXA 1V4AA 4MVZA 3C7JA 3EPVA 2HV7A 4NY3A 5AGFA 2V3CC 1M2VA 1UFBA 3JZ0A 3V5YA 3PCVA 4OIPF 1AVOB 2R7OA 3ASOC 5TJ5E 3X2QC 1MMNA 4WGYA 4M63A 3EGXB 2DB4A 1OKKA 5EGYA 2J9VA 1NBBA 2YHSA 5CI9A 2EPLX 1FFTC 3LUTB 3LLIA 2AU5A 5E33A 3V5XA 3EJNA 2HMZA 1V74B 3MYIA 3EFOB 3S28A 5L0GA 5E3AA 2YLGA 1VLSA 1A7VA 2L6FA 1YZAA 1TWHA 4BG0A 5BQHA 3W8HA 4CJGA 1WWPA 4KNWA 1HE1A 3SP1A 3IEEA 3JRMO 4QI2A 2R7VA 2HFIA 3EZIA 5JS5A 1Z3IX 3TQOA 2XLOA 3LS0A 2VCBA 3RF3A 3VF0A 2EILC 3ECSA 3ABKC 5A69A 2R7SA 4PACA 4AL1A 4I3MA 3N2ZB 3FMSA 4GEHA 3JRTA 1V54C 2JX0A 2L6GA 2OEXA 4KNVA 5L0JA 2Y3BA 1TWAA 4IWBA 2JD3A 4JW1A 2YEVA 1B68A 2H8AA 1V55C 2VC9A 4CS8C 4EBBA 1HY5A 3UMKA 1F1MA 3S90A 1O3UA 4PK4A 4OIOF 3ITFA 4FX5A 2CNWD 4U5GA 3JTLO 1R4TA 3H2UA 3LLKA 4ER9A 4J30B 1M57C 3B0PA 3G4ZA 3U9JA 2X51A 1OCRC 1RKEA 2A6EF 2PFDA 1FMVA 3JCUQ 5COGA 5K0IA 4BJ6A 2WVOA 3I5PA 5F5HA 1RCPA 1OW8A 3ZVRA 2AWYA 3GM2A 3Q6MA 4CDAA 3RW0A 2DI3A 1PCXA 4K7BA 3OEOA 3TJ5A 2BE5F 4MTFA 2BL2A 4JTCB 1TFOB 3M4CA 4KBLA 4QI0A 5KYUA 5L0HA 2LK4A 3KPHA 3SEOA 4MS2A 1D0ZA 1MNDA 4YT4A 4JRZA 4Z9JA 1YLMA 2IYLD 2P0NA 2DYRC 1L7CA 4JJGA 3UR3C 3W2VA 1XWJA 1HMDA 3T9OA 3SXZA 1LE4A 2EPNA 3DD7A 5D92A 3HKKA 3CZ6A 3DAFA 3FAPB 3WAQA 4D4NA 4YL3A 4P9FA 4DBQA 5FCLA 1EKYA 4PJMA 5KYWB 3JYHA 1T9KA 3U3BA 2B0JA 5B3IA 3EG9B 4LDRA 1CPRA 4ULWA 3GWNA 3NYJA 4L6RA 3K66A 1G4US 2HSBA 2J0XA 1LI5A 3KKBA 2KC3A 2J7PA 3FXHA 1ZW3A 5F28E 1MMDA 2YL7A 2HUJA 2CW0F 4O6YA 1Q0KA 3DZAA 3F47A 5T1DB 4Q4ZF 3QW0A 1G5ZA 4N06A 1YDIA 1OW6A 2P7VA 1U0BB 4XLNF 1NFOA 2M4EA 3K1HA 4B6IA 4ZLDA 4JTDB 1OXBA 4XPXA 1D0YA 3HNIA 4K0DA 2YLIA 2YQYA 1YJGA 4ANJA 1S05A 3DJUB 2A68F 2WVQA 2YWAA 5B1AC 4BJ5A 4DVYP 3ATPA 2A1DD 4MVUA 2H7BA 1BR2A 2QY9A 4OD4A 2CCYA 1Q0DA 2Y3GA 3B0UX 2G3KA 3U8PA 4WGZA 3C8GA 4YT5A 2OU6A 4BJ6C 2W45A 4U5DE 3Q7GA 5COFA 3ZG1A 2B0HA 4JJFA 1KNYA 3EFOA 2A69F 3DM5A 4P6IC 4U5CE 1A7EA 4CSAC 4O6MA 1JAFA 2EINC 2KYHA 2R25A 2ASRA 3K7DA 2J9BA 1MQVA 4DJ9A 3DKAA 5IY5C 2LFDA 2OJED 2OKUA 1NZEA 2EIJC 1LS4A 2ZXRA 3GM1A 3L34A 3QZCA 4W8KA 1O5HA 3RH3A 3US6A 3DXJF 3AQBA 4XLPF 3ABLC 3NYMA 2XSEA 3RIPA 2R7TA 1A0BA 5JP7A 4ZLCA 5BUOA 2XLWA 4BJTA 1ORJA 4J32B 1LKXA 4F4BA 1SR2A 3AJMA 1E83A 2F22A 4IAQA 1LPEA 2HJ3A 2Q9CA 3O10A 2IXPA 3U2MA 2W9YA 2M64A 1ZYRF 3DM9B 3ZTZA 2LSEA 2V26A 3GWLA 4XWJA 5DVWA 5HV9A 4NTFA 1QSPA 2LD6A 3SZRA 3C62A 4C7OB 4N6HA 2Y39A 4R32A 3RQFA 4AE4B 2XL8A 3HTKC 3S0XA 3C8GB 256BA 1TQGA 3IPMO 3I4UA 3UMHA 1K05A 3SNHA 1E86A 3U0CA 4JE9A 3MBGA 2NUPB 4GQHA 3RQGA 3RKOF 1HW2A 3AG3C 2P6VA 1YARO 3O6XA 3N0TA 1YZCA 4JVSA 4YT2A 2NG1A 1Z5ZA 4PJLA 3S27A 4BJ5C 2Q9AA 3B29A 4Q7CA 4YN0B 1WASA 3LS1A 4CDYA 2L6HA 4CX9A 4E7ZA 1EQ1A 3CQZA 2W4MA 3E9VA 3KL4A 3NMKA 1AUEA 4IJJA 4UDVA 4I44A 3LEOA 2G3VA 3IQ5A 1HMOA 1N1CA 3TD7A 2OCCC 4JZAA 4BEMJ 2YL3A 1DOVA 1OR2A 1BR4A 1TFKB 1VK5A 3R2PA 4OD5A 2WB7A 4MW3A 5GPGB 3L8IA 1QPUA 1NLXA 2IBFA 3KMIA 4C3EA 5AC4A 5DLJA 5A6BD 3MFNA 5KYNA 5KYWA 1WATA 2NUTA 4C3DA 4FAPB 3EG9A 1I5NA 2L81A 1G8XA 3UGPA 1T6UA 3KH2A 1M56C 1YYXA 1GQAA 3B9QA 4XPYA 5KYYB 2GAQA 4DXWA 1Z23A 1T6QA 1IW7F 3U5SA 3DJNB 4AL0A 5F5FA 2FAPB 3K1IA 1BDJB 2J46A 2L9JA 4HFKB 3TOLA 4C3BA 1WOLA 5DS5A 1LS1A 4DRIB 3GANA 1EA8A 1LIHA 1PD0A 2CGEA 3AG4C 4NTAA 1Q0FA 4MVSA 1JOGA 4Z9HA 4O6NA 5A6JA 1PD1A 1DOWA 5JLIA 2R7RA 2CNWA 4LERA 3SXYA 1SF8A 1T5OA 1T6IA 1C02A 1YAUO 4PJNA 1YA7O 3AGUA 3Q7LA 1ST6A 3MLGA 2ETSA 2C03A 3ZQVA 2OEVA 3BRJA 4U5BE 4IARA 2C04A 1FAPB 2FFHA 3G50A 4JC7A 3WHNA 2ICWG 1VLTA 2R7WA 3M15A 3TULA 3A11A 3IHUA 2WZGA 2NUTB 5AC5A 4G7ZF 2XLDA 1D1AA 3SXMA 3AQCA 3L8JA 4FWVA 4U9DA 1Z63A 4HEAJ 4D4XA 3M1CB 3H2VA 1ZHYA 1CGOA 1O87A 4KC9A 4U5HA 3PHF2 4DBRA 4X0RA 5KYXB 2VASA 3NDBB 3AOUA 2XS1A 5L0FA 4RBNA 3FOOA 1C03A 3JSZA 4G78A 4PR9A 5JVEA 1VYIA 1Q0MA 1SMYF 3M4BA 3NRHA 5HSWA 3DI5A 4A4AA 2IOQA 5BQIA 3VM6A 4JIOA 4ONSA 2IM8A 1LM3B 2H7VC 4OIQF 2MWQA 1E84A 1ZW2A 1JR8A 1TWCA 1ORSC 2GA0A 3MYFA 4IRUA 3O39A 2XS8A 3L0IA 3O55A 2WZLA 1R5ID 2I15A 4MW8A 2XXAB 1I4ZA 2L7AA 1K40A 4O7GA 4YJWA 4FESA 3AG2C 4P9TA 1FFHA 2QTVA 1ZHTA 1CGME 2Y3HA 2R03A 4C7OA 3K1IC 2W4BA 2BC5A 4AE4A 4EUKB 2EPOA 1OCZC 2QLAA 3HNLA 4J7TA 3JT1A 4U9EA 3E70C 4YK5A 4GYTA 5B1BC 3UMIA 2NUPA 1Y6DA 2NSFA 4YL0A 4YL1A 1D1CA 3ZC4A 3GM3A 2HV6A 3IQCA 1NU7D 1IZMA 1ZU5A 3FDQA 2PP4A 3TOMA 2KK1A 4G7OF 1L3PA 1NFNA 2XM0A 3CAXA 4JEBA 4N4WA 1Q0GA 3UGOA 1PV3A 2Q3TA 1Y4CA 3J06A 1SYQA 1CGNA 3GORA 1KU2A 4E18A 1OR3A 2PNOA 2YZSA 1MMAA 3EHMA 1YA9A 4DRHB 2KW3C 2MYSA 4BPMA 1T01A 2QNLA 3EGDB 3ZDLA 4EBJA 1ORYA 5CI8A 4EBKA 2KGOA 3HNJA 4H4KC 2IXOA 4Z9IA 1D0XA 4YWQA 3POVA 2Q7RA 2VCCA 2Q00A 1JPJA 3B71A 2PX0A 4I1MA 4QDLA 5B3SC 1GS9A 4JURI 5JRAA 3ABMC 3L1MA 5DQTA 3NMIA 3T6GB 2R02A 3FHDA 3TK0A 4LACB 2YVKA 3EH1A 5KYYA 3S9OA 2XLEA 4OIRF 1VMAA 3K6BA 3RVYA 3K33A 1FMWA 4A2NB 4NQFA 3WG7C 3HJCA 1J8MF 2WZFA 3QW1A 4EHPA 1TWGA 1AEPA 1UG7A 3Q6NA 5L3QA 1FNTc 1BZ4A 3LAYA 3MX3A 1RJ9A 3T4RA 4MNDA 5DS4A 1APCA 4XPWA 3GODA 3TJ6A 3C63A 2NPUA 1YYJA 1ZHZA 1OKKD 2H7OA 3C8ZA 3W8IA 2NSGA 2R9RB 3AG1C 4CIHA 2J8WA 4G7HF 1ZZPA 4Q5SF 1CPQA 2LCHA 4XEFA 3A9CA 4IGGA 1A7DA 2DYSC 2GFHA 2Z15A 3NKDA 4XTKA 1QZXA 3IQ6A 2X0CA 2HS5A 3OWTA 4DRJB 3GEEA 4HFFB 2XRHA 2A0BA 2HSQA 3DWWA 3LJBA 4CDVA 4EIYA 3JYYA 2R7UA 2EPMX 3DE8A 4RD9A 2QUPA 4MTOA 2QE9A 3LESA 2LP4A 4PFPA 2VB6A 1A41A 4H54A 2Q4FA 1QKRA 2UUHA 4MQ9F 1U89A 3EZHA 1H7IA 1D1BA 2FGYA 2WL8A 3IQTA 4JTAB 3ZSUA 4WJ0A 1J8YF 4MVMA 4N6CA 4NCQA 4CS9A 1XZPA 2YLDA 3HLZA 1RXQA 4YT8A 1MNEA 2XL4A 2YL1A 4E17A 2ZPAA 5A6BA 1JMWA 1SZIA 3U8VA 4J7YA 5A6AA 1OW7A 3SXKA 4BEJA 1M6TA 2CYDA 2Y69C 2XLVA 1OCCC 1HE9A 1EI7A 1G4WR 1ZVZA 3KYIA 3QMKA 4MVOA 4ULVA 3S84A 3FAJA 2XXAA 3ZWIA 3U2LA 1RJ9B 2P1AA 3H65A 1QVXA 3ZTMA 4LDKA 1TKNA 1RKCA 4G0HA 5D91A 3LEVA 2XLHA 3F46A 1OCOC 2GWWA 3DAGA 3QTHA 4JCZA 4NC3A 1M2VB 3NKEA 3ZIBA 2G62A 2KJGA 3U9MA 3X1OA 1NU9C 2CDQA
chains in the Genus database with same CATH topology
1RXQA 2RD9A 5COGA 2NSGA 5COMA 3CEXA 2OU6A 2F22A 5COFA 2NSFA 2P1AA 3DI5A 2QE9A 3DKAA 5CIVA 3QTHA 2OQMA 3GORA 2YQYA 2HKVA 2QNLA 4N6CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RXQ A;  2RD9 A;  5COG A;  2NSG A;  5COM A;  3CEX A;  2OU6 A;  2F22 A;  5COF A;  2NSF A;  2P1A A;  3DI5 A;  2QE9 A;  3DKA A;  5CIV A;  3QTH A;  2OQM A;  3GOR A;  2YQY A;  2HKV A;  2QNL A;  4N6C A; 
#chains in the Genus database with same CATH topology
 1HW1 A;  4MVQ A;  1YVI A;  3V7O A;  4AK9 A;  2RD9 A;  1Z7Q c;  2R7X A;  1QLE C;  2YRF A;  4EKW A;  1I4Y A;  2R05 A;  5COM A;  1LVK A;  1QQ3 A;  2PX3 A;  3CEX A;  2J9W A;  5JUA A;  1OXK A;  3RYL A;  1RMV A;  1U6H A;  3R7C A;  3ZQY A;  4CSA A;  3NMJ A;  4OIN F;  2PF4 E;  3PMR A;  3VRC A;  4XEV A;  1C17 M;  3LNM B;  5L0D A;  3EGD A;  5FZT A;  1FTS A;  3JSE O;  1S7Z A;  3DE9 A;  2LFF A;  4E0I A;  4DVZ A;  5L3V A;  5E3C A;  4E7S A;  1NG1 A;  1BR1 A;  1VTM P;  3EH2 A;  2WVN A;  2J7P D;  3T6J A;  3B0V C;  3U3F A;  1WN0 A;  3QVZ A;  2P61 A;  1E85 A;  1JPN A;  2YL0 A;  1VYK A;  4CS7 A;  4W8P A;  5DQZ A;  2LQG A;  2Q9B A;  4O79 A;  4CS9 C;  3CSK A;  5T3T A;  2UUI A;  4MVR A;  3KYJ A;  2VH3 A;  5E2Q A;  2MHR A;  1H6G A;  2XM4 A;  1LE2 A;  1LI7 A;  4HE8 D;  4PJJ A;  5EHH A;  5KYX A;  2AWC A;  2EIM C;  2YKZ A;  1FR0 A;  4CJO A;  4LDQ A;  4LLC A;  3GEH A;  4IB4 A;  2EIK C;  4K1O A;  3RQE A;  3W2W A;  4DOZ A;  4JEA A;  1BBH A;  2KQ9 A;  3NYL A;  4RDA A;  1MMG A;  1WGW A;  1KTM A;  3QVY A;  4XQ1 A;  2LIG A;  4MTG A;  3DMD A;  4CIP A;  1H9T A;  1VOM A;  3FOP A;  1RKE B;  2J0W A;  3LNR A;  5BQG A;  3C8G D;  2ZXW C;  2J9U A;  5CIV A;  2OQM A;  1ZU4 A;  3WOD F;  1WTY A;  2HJM A;  2KSF A;  3I5Q A;  3GEI A;  5KYU B;  2AVK A;  2O9X A;  2OOC A;  5A6K A;  1TR2 A;  4NTB A;  3W4Y A;  3HNK A;  3V5Z A;  4KI2 A;  2D4U A;  3FVY A;  1ZHW A;  2A0U A;  2I8B A;  4WAB A;  3AGT A;  1XZQ A;  3EGX A;  1W2W A;  2ZXO A;  1GGQ A;  1H9G A;  2JPU A;  4JKV A;  3SYN A;  4AX2 A;  2GDC A;  2VCA A;  3PDM P;  3RVZ A;  4U5E E;  3UNG C;  1VB5 A;  2HMQ A;  1M2O A;  3M79 A;  4I1O B;  4U5F E;  2RSE B;  1K04 A;  1OQC A;  2DGJ A;  2HZ8 A;  2J45 A;  2AP3 A;  1GM5 A;  3BEH A;  2ZXP A;  2OJQ A;  2IXN A;  4EWC A;  4BJ1 A;  4CBE A;  2TMV P;  1E2X A;  4LLE A;  3S29 A;  5JSL A;  3G4X A;  5T3W A;  4CS8 A;  2E87 A;  2Y3D A;  3EHN A;  2D5R B;  2R7Q A;  3RFY A;  2EPK X;  2ZD9 A;  3ASN C;  1Z6A A;  3NG1 A;  1JRA A;  4PFO A;  3EQL F;  3N24 A;  2HKV A;  5EK0 A;  3T6B A;  3VYW A;  3VAY A;  5DS6 A;  5JT4 A;  5L0C A;  5L0I A;  3C18 A;  2OG2 A;  2XLM A;  4IAO A;  4XEK A;  2A6H F;  2KNH A;  4JCH A;  2PBE A;  1NSG B;  2IXM A;  3OA1 A;  2XL6 A;  4E0H A;  1ZHX A;  1V4A A;  4MVZ A;  3C7J A;  3EPV A;  2HV7 A;  4NY3 A;  5AGF A;  2V3C C;  1M2V A;  1UFB A;  3JZ0 A;  3V5Y A;  3PCV A;  4OIP F;  1AVO B;  2R7O A;  3ASO C;  5TJ5 E;  3X2Q C;  1MMN A;  4WGY A;  4M63 A;  3EGX B;  2DB4 A;  1OKK A;  5EGY A;  2J9V A;  1NBB A;  2YHS A;  5CI9 A;  2EPL X;  1FFT C;  3LUT B;  3LLI A;  2AU5 A;  5E33 A;  3V5X A;  3EJN A;  2HMZ A;  1V74 B;  3MYI A;  3EFO B;  3S28 A;  5L0G A;  5E3A A;  2YLG A;  1VLS A;  1A7V A;  2L6F A;  1YZA A;  1TWH A;  4BG0 A;  5BQH A;  3W8H A;  4CJG A;  1WWP A;  4KNW A;  1HE1 A;  3SP1 A;  3IEE A;  3JRM O;  4QI2 A;  2R7V A;  2HFI A;  3EZI A;  5JS5 A;  1Z3I X;  3TQO A;  2XLO A;  3LS0 A;  2VCB A;  3RF3 A;  3VF0 A;  2EIL C;  3ECS A;  3ABK C;  5A69 A;  2R7S A;  4PAC A;  4AL1 A;  4I3M A;  3N2Z B;  3FMS A;  4GEH A;  3JRT A;  1V54 C;  2JX0 A;  2L6G A;  2OEX A;  4KNV A;  5L0J A;  2Y3B A;  1TWA A;  4IWB A;  2JD3 A;  4JW1 A;  2YEV A;  1B68 A;  2H8A A;  1V55 C;  2VC9 A;  4CS8 C;  4EBB A;  1HY5 A;  3UMK A;  1F1M A;  3S90 A;  1O3U A;  4PK4 A;  4OIO F;  3ITF A;  4FX5 A;  2CNW D;  4U5G A;  3JTL O;  1R4T A;  3H2U A;  3LLK A;  4ER9 A;  4J30 B;  1M57 C;  3B0P A;  3G4Z A;  3U9J A;  2X51 A;  1OCR C;  1RKE A;  2A6E F;  2PFD A;  1FMV A;  3JCU Q;  5COG A;  5K0I A;  4BJ6 A;  2WVO A;  3I5P A;  5F5H A;  1RCP A;  1OW8 A;  3ZVR A;  2AWY A;  3GM2 A;  3Q6M A;  4CDA A;  3RW0 A;  2DI3 A;  1PCX A;  4K7B A;  3OEO A;  3TJ5 A;  2BE5 F;  4MTF A;  2BL2 A;  4JTC B;  1TFO B;  3M4C A;  4KBL A;  4QI0 A;  5KYU A;  5L0H A;  2LK4 A;  3KPH A;  3SEO A;  4MS2 A;  1D0Z A;  1MND A;  4YT4 A;  4JRZ A;  4Z9J A;  1YLM A;  2IYL D;  2P0N A;  2DYR C;  1L7C A;  4JJG A;  3UR3 C;  3W2V A;  1XWJ A;  1HMD A;  3T9O A;  3SXZ A;  1LE4 A;  2EPN A;  3DD7 A;  5D92 A;  3HKK A;  3CZ6 A;  3DAF A;  3FAP B;  3WAQ A;  4D4N A;  4YL3 A;  4P9F A;  4DBQ A;  5FCL A;  1EKY A;  4PJM A;  5KYW B;  3JYH A;  1T9K A;  3U3B A;  2B0J A;  5B3I A;  3EG9 B;  4LDR A;  1CPR A;  4ULW A;  3GWN A;  3NYJ A;  4L6R A;  3K66 A;  1G4U S;  2HSB A;  2J0X A;  1LI5 A;  3KKB A;  2KC3 A;  2J7P A;  3FXH A;  1ZW3 A;  5F28 E;  1MMD A;  2YL7 A;  2HUJ A;  2CW0 F;  4O6Y A;  1Q0K A;  3DZA A;  3F47 A;  5T1D B;  4Q4Z F;  3QW0 A;  1G5Z A;  4N06 A;  1YDI A;  1OW6 A;  2P7V A;  1U0B B;  4XLN F;  1NFO A;  2M4E A;  3K1H A;  4B6I A;  4ZLD A;  4JTD B;  1OXB A;  4XPX A;  1D0Y A;  3HNI A;  4K0D A;  2YLI A;  2YQY A;  1YJG A;  4ANJ A;  1S05 A;  3DJU B;  2A68 F;  2WVQ A;  2YWA A;  5B1A C;  4BJ5 A;  4DVY P;  3ATP A;  2A1D D;  4MVU A;  2H7B A;  1BR2 A;  2QY9 A;  4OD4 A;  2CCY A;  1Q0D A;  2Y3G A;  3B0U X;  2G3K A;  3U8P A;  4WGZ A;  3C8G A;  4YT5 A;  2OU6 A;  4BJ6 C;  2W45 A;  4U5D E;  3Q7G A;  5COF A;  3ZG1 A;  2B0H A;  4JJF A;  1KNY A;  3EFO A;  2A69 F;  3DM5 A;  4P6I C;  4U5C E;  1A7E A;  4CSA C;  4O6M A;  1JAF A;  2EIN C;  2KYH A;  2R25 A;  2ASR A;  3K7D A;  2J9B A;  1MQV A;  4DJ9 A;  3DKA A;  5IY5 C;  2LFD A;  2OJE D;  2OKU A;  1NZE A;  2EIJ C;  1LS4 A;  2ZXR A;  3GM1 A;  3L34 A;  3QZC A;  4W8K A;  1O5H A;  3RH3 A;  3US6 A;  3DXJ F;  3AQB A;  4XLP F;  3ABL C;  3NYM A;  2XSE A;  3RIP A;  2R7T A;  1A0B A;  5JP7 A;  4ZLC A;  5BUO A;  2XLW A;  4BJT A;  1ORJ A;  4J32 B;  1LKX A;  4F4B A;  1SR2 A;  3AJM A;  1E83 A;  2F22 A;  4IAQ A;  1LPE A;  2HJ3 A;  2Q9C A;  3O10 A;  2IXP A;  3U2M A;  2W9Y A;  2M64 A;  1ZYR F;  3DM9 B;  3ZTZ A;  2LSE A;  2V26 A;  3GWL A;  4XWJ A;  5DVW A;  5HV9 A;  4NTF A;  1QSP A;  2LD6 A;  3SZR A;  3C62 A;  4C7O B;  4N6H A;  2Y39 A;  4R32 A;  3RQF A;  4AE4 B;  2XL8 A;  3HTK C;  3S0X A;  3C8G B;  256B A;  1TQG A;  3IPM O;  3I4U A;  3UMH A;  1K05 A;  3SNH A;  1E86 A;  3U0C A;  4JE9 A;  3MBG A;  2NUP B;  4GQH A;  3RQG A;  3RKO F;  1HW2 A;  3AG3 C;  2P6V A;  1YAR O;  3O6X A;  3N0T A;  1YZC A;  4JVS A;  4YT2 A;  2NG1 A;  1Z5Z A;  4PJL A;  3S27 A;  4BJ5 C;  2Q9A A;  3B29 A;  4Q7C A;  4YN0 B;  1WAS A;  3LS1 A;  4CDY A;  2L6H A;  4CX9 A;  4E7Z A;  1EQ1 A;  3CQZ A;  2W4M A;  3E9V A;  3KL4 A;  3NMK A;  1AUE A;  4IJJ A;  4UDV A;  4I44 A;  3LEO A;  2G3V A;  3IQ5 A;  1HMO A;  1N1C A;  3TD7 A;  2OCC C;  4JZA A;  4BEM J;  2YL3 A;  1DOV A;  1OR2 A;  1BR4 A;  1TFK B;  1VK5 A;  3R2P A;  4OD5 A;  2WB7 A;  4MW3 A;  5GPG B;  3L8I A;  1QPU A;  1NLX A;  2IBF A;  3KMI A;  4C3E A;  5AC4 A;  5DLJ A;  5A6B D;  3MFN A;  5KYN A;  5KYW A;  1WAT A;  2NUT A;  4C3D A;  4FAP B;  3EG9 A;  1I5N A;  2L81 A;  1G8X A;  3UGP A;  1T6U A;  3KH2 A;  1M56 C;  1YYX A;  1GQA A;  3B9Q A;  4XPY A;  5KYY B;  2GAQ A;  4DXW A;  1Z23 A;  1T6Q A;  1IW7 F;  3U5S A;  3DJN B;  4AL0 A;  5F5F A;  2FAP B;  3K1I A;  1BDJ B;  2J46 A;  2L9J A;  4HFK B;  3TOL A;  4C3B A;  1WOL A;  5DS5 A;  1LS1 A;  4DRI B;  3GAN A;  1EA8 A;  1LIH A;  1PD0 A;  2CGE A;  3AG4 C;  4NTA A;  1Q0F A;  4MVS A;  1JOG A;  4Z9H A;  4O6N A;  5A6J A;  1PD1 A;  1DOW A;  5JLI A;  2R7R A;  2CNW A;  4LER A;  3SXY A;  1SF8 A;  1T5O A;  1T6I A;  1C02 A;  1YAU O;  4PJN A;  1YA7 O;  3AGU A;  3Q7L A;  1ST6 A;  3MLG A;  2ETS A;  2C03 A;  3ZQV A;  2OEV A;  3BRJ A;  4U5B E;  4IAR A;  2C04 A;  1FAP B;  2FFH A;  3G50 A;  4JC7 A;  3WHN A;  2ICW G;  1VLT A;  2R7W A;  3M15 A;  3TUL A;  3A11 A;  3IHU A;  2WZG A;  2NUT B;  5AC5 A;  4G7Z F;  2XLD A;  1D1A A;  3SXM A;  3AQC A;  3L8J A;  4FWV A;  4U9D A;  1Z63 A;  4HEA J;  4D4X A;  3M1C B;  3H2V A;  1ZHY A;  1CGO A;  1O87 A;  4KC9 A;  4U5H A;  3PHF 2;  4DBR A;  4X0R A;  5KYX B;  2VAS A;  3NDB B;  3AOU A;  2XS1 A;  5L0F A;  4RBN A;  3FOO A;  1C03 A;  3JSZ A;  4G78 A;  4PR9 A;  5JVE A;  1VYI A;  1Q0M A;  1SMY F;  3M4B A;  3NRH A;  5HSW A;  3DI5 A;  4A4A A;  2IOQ A;  5BQI A;  3VM6 A;  4JIO A;  4ONS A;  2IM8 A;  1LM3 B;  2H7V C;  4OIQ F;  2MWQ A;  1E84 A;  1ZW2 A;  1JR8 A;  1TWC A;  1ORS C;  2GA0 A;  3MYF A;  4IRU A;  3O39 A;  2XS8 A;  3L0I A;  3O55 A;  2WZL A;  1R5I D;  2I15 A;  4MW8 A;  2XXA B;  1I4Z A;  2L7A A;  1K40 A;  4O7G A;  4YJW A;  4FES A;  3AG2 C;  4P9T A;  1FFH A;  2QTV A;  1ZHT A;  1CGM E;  2Y3H A;  2R03 A;  4C7O A;  3K1I C;  2W4B A;  2BC5 A;  4AE4 A;  4EUK B;  2EPO A;  1OCZ C;  2QLA A;  3HNL A;  4J7T A;  3JT1 A;  4U9E A;  3E70 C;  4YK5 A;  4GYT A;  5B1B C;  3UMI A;  2NUP A;  1Y6D A;  2NSF A;  4YL0 A;  4YL1 A;  1D1C A;  3ZC4 A;  3GM3 A;  2HV6 A;  3IQC A;  1NU7 D;  1IZM A;  1ZU5 A;  3FDQ A;  2PP4 A;  3TOM A;  2KK1 A;  4G7O F;  1L3P A;  1NFN A;  2XM0 A;  3CAX A;  4JEB A;  4N4W A;  1Q0G A;  3UGO A;  1PV3 A;  2Q3T A;  1Y4C A;  3J06 A;  1SYQ A;  1CGN A;  3GOR A;  1KU2 A;  4E18 A;  1OR3 A;  2PNO A;  2YZS A;  1MMA A;  3EHM A;  1YA9 A;  4DRH B;  2KW3 C;  2MYS A;  4BPM A;  1T01 A;  2QNL A;  3EGD B;  3ZDL A;  4EBJ A;  1ORY A;  5CI8 A;  4EBK A;  2KGO A;  3HNJ A;  4H4K C;  2IXO A;  4Z9I A;  1D0X A;  4YWQ A;  3POV A;  2Q7R A;  2VCC A;  2Q00 A;  1JPJ A;  3B71 A;  2PX0 A;  4I1M A;  4QDL A;  5B3S C;  1GS9 A;  4JUR I;  5JRA A;  3ABM C;  3L1M A;  5DQT A;  3NMI A;  3T6G B;  2R02 A;  3FHD A;  3TK0 A;  4LAC B;  2YVK A;  3EH1 A;  5KYY A;  3S9O A;  2XLE A;  4OIR F;  1VMA A;  3K6B A;  3RVY A;  3K33 A;  1FMW A;  4A2N B;  4NQF A;  3WG7 C;  3HJC A;  1J8M F;  2WZF A;  3QW1 A;  4EHP A;  1TWG A;  1AEP A;  1UG7 A;  3Q6N A;  5L3Q A;  1FNT c;  1BZ4 A;  3LAY A;  3MX3 A;  1RJ9 A;  3T4R A;  4MND A;  5DS4 A;  1APC A;  4XPW A;  3GOD A;  3TJ6 A;  3C63 A;  2NPU A;  1YYJ A;  1ZHZ A;  1OKK D;  2H7O A;  3C8Z A;  3W8I A;  2NSG A;  2R9R B;  3AG1 C;  4CIH A;  2J8W A;  4G7H F;  1ZZP A;  4Q5S F;  1CPQ A;  2LCH A;  4XEF A;  3A9C A;  4IGG A;  1A7D A;  2DYS C;  2GFH A;  2Z15 A;  3NKD A;  4XTK A;  1QZX A;  3IQ6 A;  2X0C A;  2HS5 A;  3OWT A;  4DRJ B;  3GEE A;  4HFF B;  2XRH A;  2A0B A;  2HSQ A;  3DWW A;  3LJB A;  4CDV A;  4EIY A;  3JYY A;  2R7U A;  2EPM X;  3DE8 A;  4RD9 A;  2QUP A;  4MTO A;  2QE9 A;  3LES A;  2LP4 A;  4PFP A;  2VB6 A;  1A41 A;  4H54 A;  2Q4F A;  1QKR A;  2UUH A;  4MQ9 F;  1U89 A;  3EZH A;  1H7I A;  1D1B A;  2FGY A;  2WL8 A;  3IQT A;  4JTA B;  3ZSU A;  4WJ0 A;  1J8Y F;  4MVM A;  4N6C A;  4NCQ A;  4CS9 A;  1XZP A;  2YLD A;  3HLZ A;  1RXQ A;  4YT8 A;  1MNE A;  2XL4 A;  2YL1 A;  4E17 A;  2ZPA A;  5A6B A;  1JMW A;  1SZI A;  3U8V A;  4J7Y A;  5A6A A;  1OW7 A;  3SXK A;  4BEJ A;  1M6T A;  2CYD A;  2Y69 C;  2XLV A;  1OCC C;  1HE9 A;  1EI7 A;  1G4W R;  1ZVZ A;  3KYI A;  3QMK A;  4MVO A;  4ULV A;  3S84 A;  3FAJ A;  2XXA A;  3ZWI A;  3U2L A;  1RJ9 B;  2P1A A;  3H65 A;  1QVX A;  3ZTM A;  4LDK A;  1TKN A;  1RKC A;  4G0H A;  5D91 A;  3LEV A;  2XLH A;  3F46 A;  1OCO C;  2GWW A;  3DAG A;  3QTH A;  4JCZ A;  4NC3 A;  1M2V B;  3NKE A;  3ZIB A;  2G62 A;  2KJG A;  3U9M A;  3X1O A;  1NU9 C;  2CDQ A; 
#chains in the Genus database with same CATH homology
 1RXQ A;  2RD9 A;  5COG A;  2NSG A;  5COM A;  3CEX A;  2OU6 A;  2F22 A;  5COF A;  2NSF A;  2P1A A;  3DI5 A;  2QE9 A;  3DKA A;  5CIV A;  3QTH A;  2OQM A;  3GOR A;  2YQY A;  2HKV A;  2QNL A;  4N6C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...