2P1AA

Crystal structure of a putative metal-binding protein (bce_2162) from bacillus cereus atcc 10987 at 2.10 a resolution
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
143
structure length
143
Chain Sequence
b'GMFVQSALHQLKVAVDTSIQMLDQYTEIDLKIAPIQSKRSLFEMYAHLSLICHADLLILNGSTEKELHTFYKEQTPETIAQMQKTMIQGYDLLSKTFLSYSNEQLAEMKTAYWGISYSRFEWLLEIVAHFYHHRGQIHILLCE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein
publication title Crystal structure of hypothetical protein (NP_978475.1) from Bacillus cereus ATCC 10987 at 2.10 A resolution
rcsb
source organism Bacillus cereus
molecule tags Unknown function
total genus 48
structure length 143
sequence length 143
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12867 DinB_2 DinB superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.450 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) dinb family like domain 2p1aA00
3CEXA 1RXQA 2QNLA 2OQMA 5COFA 2NSFA 2YQYA 2P1AA 2F22A 2HKVA 4N6CA 2RD9A 2NSGA 2OU6A 5CIVA 3DI5A 2QE9A 3DKAA 5COGA 5COMA 3GORA 3QTHA
chains in the Genus database with same CATH superfamily
5E2QA 4JTCB 2OCCC 2DYRC 4XLPF 1J8YF 1TWHA 1TQGA 2M4EA 4O79A 3GEEA 4O6MA 2OJED 1TWGA 2P61A 3L1MA 3M4CA 1BR1A 5B3IA 3ATPA 3E70C 3U2LA 2XL4A 4BJ6A 2F22A 1SMYF 4U5HA 1U89A 2MWQA 2HKVA 1DOVA 1K40A 4DXWA 2QY9A 5D92A 2J45A 1QZXA 1BR4A 5L0JA 3C8GB 2FAPB 2ICWG 4FAPB 2R7XA 3LLIA 4YL3A 2NUTB 3FHDA 3FAPB 1T9KA 2PFDA 2ZD9A 4AL1A 2EINC 2WZGA 4OINF 3O6XA 3KMIA 3W4YA 1A7DA 1C02A 5DQTA 2EIJC 1JRAA 2AU5A 3LNRA 4ONSA 1VYKA 4C3EA 4K1OA 4WGYA 4HE8D 3SP1A 3T4RA 1HW1A 1YA9A 2QTVA 1YZAA 2MHRA 4BJ1A 4PACA 4CDAA 2J9BA 2L6HA 4DVZA 2AVKA 3F46A 2WL8A 4NTAA 2XLWA 4CIPA 4J30B 3V5YA 3AG1C 1A0BA 1G4US 3I5QA 3L34A 5JSLA 2ZPAA 3HNIA 4L6RA 1F1MA 1JPNA 1NG1A 3EHNA 4JZAA 1JR8A 1WWPA 2A0UA 1EA8A 2IYLD 2VASA 4PJJA 4PFPA 3PDMP 1I4YA 3EH1A 1MNDA 3AQCA 2R7WA 1ZHWA 4OIQF 1OR3A 1Q0DA 2LP4A 3GM2A 2H7VC 1Z23A 4IGGA 2XM4A 3AJMA 3B9QA 3RQEA 4Z9IA 3V5ZA 4YK5A 4DVYP 4XLNF 1ZW2A 3TJ6A 1K05A 1PD0A 2YKZA 1N1CA 1RXQA 2YLIA 4EKWA 2Q00A 3TOLA 2NUPA 4NTBA 4NY3A 1FTSA 4W8KA 4YT4A 1GS9A 4YL1A 2J7PA 3DM5A 2D5RB 4F4BA 1S7ZA 2JX0A 3K6BA 4XPYA 4MVMA 1OCCC 1RKCA 3WG7C 3U3BA 3OEOA 3RIPA 1BBHA 2ZXPA 1Q0MA 1M6TA 1WATA 1YJGA 2DB4A 2J8WA 2WVNA 3NDBB 3ECSA 4AE4A 4JRZA 1TKNA 2A0BA 3W8IA 4Z9JA 3DI5A 4MVRA 4GEHA 1V55C 1OCZC 2H7BA 2Y3HA 3ABMC 3VF0A 1CGME 4PFOA 4RD9A 1LIHA 3WHNA 4CS9A 2W4BA 1U0BB 1YARO 4K0DA 1H6GA 1HE9A 4Q7CA 4ZLDA 5COMA 2LK4A 4WGZA 4ZLCA 4XPWA 5A69A 5F28E 3U8VA 1MMAA 3LUTB 4CS8C 2IM8A 3EZIA 3NMJA 4RDAA 4XEVA 2KC3A 1R5ID 1FFTC 4YJWA 2G3KA 4IB4A 5AGFA 4JKVA 1HW2A 3MFNA 1M56C 2V3CC 5BQGA 1BZ4A 2YL1A 3H2VA 5HSWA 3EG9B 3CQZA 3NKEA 5L0FA 2PBEA 4J7TA 1U6HA 1MMGA 1YA7O 4P9TA 1ORSC 3IQ5A 4O6NA 4CBEA 2A6EF 1E2XA 4DRIB 2YWAA 4JEBA 4NC3A 5CIVA 1CPRA 3HLZA 3LS0A 2P6VA 3ZTMA 2IBFA 3PMRA 4DRHB 1K04A 4CDVA 3EHMA 2A6HF 4X0RA 5FZTA 4G7ZF 1XWJA 1O3UA 4LLCA 1NBBA 5A6BD 2JD3A 2AWYA 1QKRA 5E3CA 1M2VA 1O5HA 1OCRC 4I1MA 3Q6MA 3EGDB 3ITFA 3RH3A 2I15A 1LS1A 4JW1A 2Q4FA 2H7OA 4HFKB 3U0CA 1EKYA 3EPVA 1D1CA 4WJ0A 2IXOA 4P6IC 2Y3GA 2Q7RA 4FX5A 1RCPA 3EGXA 2LSEA 4Q4ZF 1SF8A 2HS5A 1WN0A 1YAUO 5CI9A 2KGOA 3F47A 5FCLA 5E3AA 1OKKA 1KTMA 5KYXA 5KYYB 2BL2A 3A11A 2HMZA 2AWCA 4U9DA 3RFYA 4CJGA 1VK5A 2LIGA 4U5GA 1CGNA 3K1IA 2BE5F 2EILC 5EHHA 4C7OA 1OW8A 3DM9B 1FAPB 3DD7A 4PR9A 3U9MA 5TJ5E 1ZHYA 3QTHA 1VLSA 3SYNA 2ZXRA 2OG2A 1Z5ZA 2W45A 3CAXA 4MS2A 1SZIA 2P0NA 1QLEC 2OQMA 1ZHZA 4U9EA 1QQ3A 3TD7A 1L3PA 3K7DA 1T6IA 1YYXA 4RBNA 4J32B 3PHF2 3UR3C 2G62A 5A6JA 1MQVA 2CYDA 3N0TA 4DOZA 5K0IA 2KJGA 4E7SA 1JOGA 1TFKB 4ULWA 2CCYA 4O7GA 2HZ8A 3NMKA 4LDKA 3T6BA 2ETSA 4XPXA 1ST6A 3U3FA 3GODA 4YWQA 5DS6A 2KSFA 3JZ0A 3H65A 5A6AA 4MVSA 4I44A 1PV3A 3EZHA 3B0PA 3JCUQ 5BQHA 5BUOA 5L3QA 2KK1A 3M1CB 1EI7A 3FOPA 2HMQA 2WVOA 2Z15A 3DJUB 2XL8A 2FFHA 3GEIA 1TWAA 4G78A 2G3VA 1ZU5A 2J9UA 3QZCA 3RKOF 3SXYA 3C8ZA 3SXMA 2M64A 3X1OA 5JS5A 1WGWA 3ABLC 1J8MF 4MNDA 3GM3A 1FMWA 2R9RB 2W9YA 5B1AC 3US6A 4IRUA 3W2WA 2WZLA 3LAYA 5DLJA 3LJBA 4MVUA 3L8IA 2QE9A 1VB5A 2NUPB 1HE1A 2YZSA 4JCZA 4JURI 3DKAA 1XZQA 4BJTA 2R7RA 3KYJA 1D0ZA 5JLIA 5KYWB 2VCBA 2X51A 3DE8A 2GWWA 5DVWA 1Y6DA 2XRHA 2ZXWC 3RVYA 3RW0A 1RJ9B 3JYYA 1ZW3A 3C8GD 1ZYRF 3Q6NA 4LACB 1IW7F 3K1HA 3RYLA 4LDQA 2XXAA 1R4TA 4AE4B 2XLVA 1FR0A 3RQFA 3MX3A 1JAFA 3M15A 1ORJA 4G7OF 5AC4A 2IXNA 2NSFA 1VTMP 3E9VA 3C7JA 1HMOA 2XLMA 3R2PA 1E86A 3L0IA 2R7OA 1I5NA 2QLAA 4JTDB 3HNJA 2OJQA 3SXZA 2O9XA 2LFFA 3NKDA 1C03A 4DJ9A 4MTOA 2L6GA 4JC7A 2OKUA 1RKEA 4YN0B 5JVEA 2L7AA 3IQTA 3O55A 2PF4E 2R7QA 1ZU4A 2XSEA 4NCQA 4XQ1A 5COGA 3U8PA 1B68A 3M4BA 1MMDA 3DXJF 2PNOA 4DRJB 1D1BA 3LS1A 3B29A 3MBGA 1SR2A 4YT5A 4BJ5C 2B0HA 2XLHA 4E7ZA 5DS4A 5HV9A 4JE9A 1H9TA 2QNLA 1A7EA 4HEAJ 2I8BA 2HV7A 2EPMX 2VB6A 1BDJB 3LEVA 3ZTZA 1GGQA 4E17A 2R03A 1G4WR 3SEOA 2XLOA 1Q0KA 2OOCA 3DAFA 2GA0A 1T6UA 4UDVA 4NQFA 3KKBA 3ZSUA 1A41A 4DBRA 1RMVA 3I5PA 1MMNA 1NU7D 2EPNA 2IXMA 2YVKA 3GWNA 4OD5A 4EWCA 1TR2A 1VYIA 1Z6AA 2KW3C 2RD9A 3FVYA 3EFOB 3ZQYA 4EBBA 3OA1A 3H2UA 5F5FA 1PD1A 1HMDA 1T5OA 3QW0A 5IY5C 1FFHA 3LESA 4ULVA 5JUAA 4CSAC 3A9CA 3QMKA 1LE4A 3B71A 4MW8A 3VYWA 1ZHXA 3U5SA 2EPLX 1VOMA 3CZ6A 5A6BA 3GEHA 2NPUA 3B0UX 1YVIA 3RVZA 2OEXA 2VCCA 4N06A 1ZHTA 3IEEA 4QI0A 3KH2A 4KNWA 5COFA 5T3WA 1JPJA 3RF3A 1G5ZA 1KU2A 3T6JA 5L0HA 3O10A 5L0CA 3UGPA 2VC9A 3LLKA 3JSZA 3GWLA 4WABA 4B6IA 4YT2A 2CNWD 4CS8A 2OU6A 1XZPA 3L8JA 1OQCA 4XWJA 3ASOC 4QDLA 3S29A 3UNGC 2GFHA 4MTFA 4BJ6C 5T1DB 2R25A 4Z9HA 3EH2A 1WASA 3HJCA 3JT1A 2PP4A 2YLGA 4MW3A 4H4KC 1JMWA 1OCOC 3LEOA 4U5EE 2HSBA 3AQBA 2WB7A 4M63A 4LLEA 2R7VA 4XEKA 2YL7A 3AGTA 2EIKC 3T6GB 4GYTA 1G8XA 2YLDA 3NYLA 3V5XA 2FGYA 1OW7A 3T9OA 4ER9A 3UGOA 4EUKB 3AG4C 3X2QC 2Q9CA 5KYUA 2YQYA 2P1AA 3JTLO 1OR2A 1Q0GA 4LDRA 4LERA 1IZMA 4JTAB 1I4ZA 3C62A 3TJ5A 4U5CE 3VM6A 1V4AA 5JP7A 4AL0A 2R7SA 2KQ9A 4N6CA 3QVYA 2MYSA 5D91A 1GQAA 1ZVZA 1V74B 1OXBA 2PX3A 1H7IA 1BR2A 1O87A 3JSEO 3WAQA 3AOUA 4FWVA 4QI2A 1LVKA 2LCHA 5B1BC 3MYIA 4I3MA 3M79A 4W8PA 5L0GA 3AG2C 1QSPA 1YDIA 2Q9AA 1APCA 1AUEA 4PJNA 3HNKA 4OIRF 4HFFB 2R7UA 1WOLA 5KYYA 4A4AA 1M57C 2C04A 2GAQA 3MLGA 4U5DE 4KNVA 3NG1A 1YZCA 4JCHA 4BG0A 1KNYA 3CSKA 2L6FA 2LFDA 3DAGA 4CS7A 3S27A 3Q7LA 2L9JA 3TK0A 3NRHA 4CX9A 3RQGA 4CDYA 3KYIA 2XXAB 2HUJA 3ASNC 2R02A 4IAOA 3NYMA 4A2NB 4EHPA 4E0IA 3FXHA 1OW6A 5L0IA 4U5FE 5B3SC 4N6HA 2DI3A 1LKXA 3FDQA 1LS4A 1Z3IX 2IXPA 5F5HA 1NZEA 1NU9C 1TWCA 3VAYA 3S84A 4YT8A 2HJ3A 4E18A 3C8GA 1UG7A 4R32A 2AP3A 1SYQA 4MVZA 3GM1A 3TQOA 3EJNA 4PJMA 2NUTA 5JRAA 4C3BA 3S90A 3POVA 4CS9C 3AG3C 1H9GA 4AX2A 5AC5A 5L3VA 1RKEB 4H54A 3EQLF 3TOMA 4EBKA 2J9VA 3SZRA 4MTGA 2WVQA 4PJLA 3WODF 2H8AA 4D4NA 1AVOB 2DGJA 1W2WA 3KPHA 1DOWA 1D0XA 2JPUA 2XLDA 3HTKC 3ABKC 3I4UA 3N24A 3QVZA 2X0CA 2YHSA 2Q9BA 5GPGB 2VH3A 5L0DA 2CGEA 3G4ZA 3PCVA 4KBLA 3DZAA 2C03A 3J06A 2HSQA 1HY5A 5DS5A 2TMVP 2YRFA 2QUPA 4IAQA 3ZVRA 4C3DA 5EGYA 3IQCA 4Q5SF 1PCXA 3NMIA 2HV6A 2Y3BA 4PK4A 3AGUA 3ZWIA 5JT4A 2CDQA 4E0HA 2J7PD 5KYWA 2W4MA 4OIOF 1E85A 4EBJA 2J0WA 1RJ9A 2ASRA 4IJJA 4CIHA 1E83A 256BA 1NFOA 2XS1A 1NFNA 2YL3A 2KYHA 3DE9A 3UMHA 2Y3DA 1V54C 2OEVA 3O39A 4MVOA 4JJGA 4KC9A 1E84A 4OIPF 4K7BA 3GANA 5E33A 1FMVA 2NSGA 1ZZPA 2XL6A 3UMKA 3UMIA 1AEPA 3G50A 1M2VB 4JJFA 1CPQA 1Z63A 5DQZA 2WZFA 3W2VA 2D4UA 1GM5A 4J7YA 3GORA 2A69F 1UFBA 4XTKA 3ZG1A 1D1AA 3K33A 2NG1A 5KYNA 2R7TA 3SXKA 3ZIBA 2EIMC 3S28A 2Q3TA 2UUHA 2XS8A 1CGOA 1LM3B 3CEXA 3EGXB 3G4XA 4G0HA 2A1DD 4JEAA 4MQ9F 5EK0A 1S05A 1ORYA 2V26A 5KYXB 2E87A 1NSGB 3K1IC 1A7VA 2A68F 2GDCA 3BEHA 3LNMB 2J9WA 4GQHA 2ZXOA 4I1OB 4MVQA 3IQ6A 3JRTA 4IWBA 2EPOA 3DMDA 4CJOA 1QVXA 3TULA 4U5BE 5T3TA 4C7OB 2IOQA 1Z7Qc 4AK9A 1OXKA 4JIOA 3U9JA 4EIYA 2BC5A 2RSEB 4NTFA 4BJ5A 2CNWA 5A6KA 3S0XA 2CW0F 1VMAA 2L81A 2PX0A 3C63A 3EG9A 3SNHA 3W8HA 5KYUB 2KNHA 2XM0A 1VLTA 3NYJA 2Y39A 3N2ZB 3DJNB 4P9FA 3KL4A 3Q7GA 3EFOA 3HKKA 5CI8A 2P7VA 3DWWA 4JVSA 2EPKX 4XEFA 1C17M 4BEMJ 1T6QA 3MYFA 2YL0A 3OWTA 3JYHA 4OD4A 1LPEA 3HNLA 1FNTc 4YL0A 1YLMA 3U2MA 4G7HF 3B0VC 2J46A 3R7CA 1YYJA 2UUIA 4FESA 1LE2A 2VCAA 1M2OA 3QW1A 4N4WA 3IHUA 1NLXA 1TFOB 4CSAA 4ANJA 3IPMO 2Y69C 4DBQA 5BQIA 3FOOA 4BEJA 2DYSC 2J0XA 1L7CA 1OKKD 4KI2A 1D0YA 1T01A 1Q0FA 2YEVA 3EGDA 3VRCA 3ZC4A 3JRMO 2HFIA 3BRJA 1Y4CA 4IARA 2R05A 2XLEA 3ZQVA 1QPUA 2LQGA 1MNEA 2LD6A 1LI5A 3ZDLA 3FAJA 2HJMA 3V7OA 4BPMA 1EQ1A 3S9OA 3FMSA 4O6YA 4D4XA 3C18A 1WTYA 2B0JA 1LI7A 3K66A
chains in the Genus database with same CATH topology
3CEXA 1RXQA 2QNLA 2OQMA 5COFA 2NSFA 2YQYA 2P1AA 2F22A 2HKVA 4N6CA 2RD9A 2NSGA 2OU6A 5CIVA 3DI5A 2QE9A 3DKAA 5COGA 5COMA 3GORA 3QTHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CEX A;  1RXQ A;  2QNL A;  2OQM A;  5COF A;  2NSF A;  2YQY A;  2P1A A;  2F22 A;  2HKV A;  4N6C A;  2RD9 A;  2NSG A;  2OU6 A;  5CIV A;  3DI5 A;  2QE9 A;  3DKA A;  5COG A;  5COM A;  3GOR A;  3QTH A; 
#chains in the Genus database with same CATH topology
 5E2Q A;  4JTC B;  2OCC C;  2DYR C;  4XLP F;  1J8Y F;  1TWH A;  1TQG A;  2M4E A;  4O79 A;  3GEE A;  4O6M A;  2OJE D;  1TWG A;  2P61 A;  3L1M A;  3M4C A;  1BR1 A;  5B3I A;  3ATP A;  3E70 C;  3U2L A;  2XL4 A;  4BJ6 A;  2F22 A;  1SMY F;  4U5H A;  1U89 A;  2MWQ A;  2HKV A;  1DOV A;  1K40 A;  4DXW A;  2QY9 A;  5D92 A;  2J45 A;  1QZX A;  1BR4 A;  5L0J A;  3C8G B;  2FAP B;  2ICW G;  4FAP B;  2R7X A;  3LLI A;  4YL3 A;  2NUT B;  3FHD A;  3FAP B;  1T9K A;  2PFD A;  2ZD9 A;  4AL1 A;  2EIN C;  2WZG A;  4OIN F;  3O6X A;  3KMI A;  3W4Y A;  1A7D A;  1C02 A;  5DQT A;  2EIJ C;  1JRA A;  2AU5 A;  3LNR A;  4ONS A;  1VYK A;  4C3E A;  4K1O A;  4WGY A;  4HE8 D;  3SP1 A;  3T4R A;  1HW1 A;  1YA9 A;  2QTV A;  1YZA A;  2MHR A;  4BJ1 A;  4PAC A;  4CDA A;  2J9B A;  2L6H A;  4DVZ A;  2AVK A;  3F46 A;  2WL8 A;  4NTA A;  2XLW A;  4CIP A;  4J30 B;  3V5Y A;  3AG1 C;  1A0B A;  1G4U S;  3I5Q A;  3L34 A;  5JSL A;  2ZPA A;  3HNI A;  4L6R A;  1F1M A;  1JPN A;  1NG1 A;  3EHN A;  4JZA A;  1JR8 A;  1WWP A;  2A0U A;  1EA8 A;  2IYL D;  2VAS A;  4PJJ A;  4PFP A;  3PDM P;  1I4Y A;  3EH1 A;  1MND A;  3AQC A;  2R7W A;  1ZHW A;  4OIQ F;  1OR3 A;  1Q0D A;  2LP4 A;  3GM2 A;  2H7V C;  1Z23 A;  4IGG A;  2XM4 A;  3AJM A;  3B9Q A;  3RQE A;  4Z9I A;  3V5Z A;  4YK5 A;  4DVY P;  4XLN F;  1ZW2 A;  3TJ6 A;  1K05 A;  1PD0 A;  2YKZ A;  1N1C A;  1RXQ A;  2YLI A;  4EKW A;  2Q00 A;  3TOL A;  2NUP A;  4NTB A;  4NY3 A;  1FTS A;  4W8K A;  4YT4 A;  1GS9 A;  4YL1 A;  2J7P A;  3DM5 A;  2D5R B;  4F4B A;  1S7Z A;  2JX0 A;  3K6B A;  4XPY A;  4MVM A;  1OCC C;  1RKC A;  3WG7 C;  3U3B A;  3OEO A;  3RIP A;  1BBH A;  2ZXP A;  1Q0M A;  1M6T A;  1WAT A;  1YJG A;  2DB4 A;  2J8W A;  2WVN A;  3NDB B;  3ECS A;  4AE4 A;  4JRZ A;  1TKN A;  2A0B A;  3W8I A;  4Z9J A;  3DI5 A;  4MVR A;  4GEH A;  1V55 C;  1OCZ C;  2H7B A;  2Y3H A;  3ABM C;  3VF0 A;  1CGM E;  4PFO A;  4RD9 A;  1LIH A;  3WHN A;  4CS9 A;  2W4B A;  1U0B B;  1YAR O;  4K0D A;  1H6G A;  1HE9 A;  4Q7C A;  4ZLD A;  5COM A;  2LK4 A;  4WGZ A;  4ZLC A;  4XPW A;  5A69 A;  5F28 E;  3U8V A;  1MMA A;  3LUT B;  4CS8 C;  2IM8 A;  3EZI A;  3NMJ A;  4RDA A;  4XEV A;  2KC3 A;  1R5I D;  1FFT C;  4YJW A;  2G3K A;  4IB4 A;  5AGF A;  4JKV A;  1HW2 A;  3MFN A;  1M56 C;  2V3C C;  5BQG A;  1BZ4 A;  2YL1 A;  3H2V A;  5HSW A;  3EG9 B;  3CQZ A;  3NKE A;  5L0F A;  2PBE A;  4J7T A;  1U6H A;  1MMG A;  1YA7 O;  4P9T A;  1ORS C;  3IQ5 A;  4O6N A;  4CBE A;  2A6E F;  1E2X A;  4DRI B;  2YWA A;  4JEB A;  4NC3 A;  5CIV A;  1CPR A;  3HLZ A;  3LS0 A;  2P6V A;  3ZTM A;  2IBF A;  3PMR A;  4DRH B;  1K04 A;  4CDV A;  3EHM A;  2A6H F;  4X0R A;  5FZT A;  4G7Z F;  1XWJ A;  1O3U A;  4LLC A;  1NBB A;  5A6B D;  2JD3 A;  2AWY A;  1QKR A;  5E3C A;  1M2V A;  1O5H A;  1OCR C;  4I1M A;  3Q6M A;  3EGD B;  3ITF A;  3RH3 A;  2I15 A;  1LS1 A;  4JW1 A;  2Q4F A;  2H7O A;  4HFK B;  3U0C A;  1EKY A;  3EPV A;  1D1C A;  4WJ0 A;  2IXO A;  4P6I C;  2Y3G A;  2Q7R A;  4FX5 A;  1RCP A;  3EGX A;  2LSE A;  4Q4Z F;  1SF8 A;  2HS5 A;  1WN0 A;  1YAU O;  5CI9 A;  2KGO A;  3F47 A;  5FCL A;  5E3A A;  1OKK A;  1KTM A;  5KYX A;  5KYY B;  2BL2 A;  3A11 A;  2HMZ A;  2AWC A;  4U9D A;  3RFY A;  4CJG A;  1VK5 A;  2LIG A;  4U5G A;  1CGN A;  3K1I A;  2BE5 F;  2EIL C;  5EHH A;  4C7O A;  1OW8 A;  3DM9 B;  1FAP B;  3DD7 A;  4PR9 A;  3U9M A;  5TJ5 E;  1ZHY A;  3QTH A;  1VLS A;  3SYN A;  2ZXR A;  2OG2 A;  1Z5Z A;  2W45 A;  3CAX A;  4MS2 A;  1SZI A;  2P0N A;  1QLE C;  2OQM A;  1ZHZ A;  4U9E A;  1QQ3 A;  3TD7 A;  1L3P A;  3K7D A;  1T6I A;  1YYX A;  4RBN A;  4J32 B;  3PHF 2;  3UR3 C;  2G62 A;  5A6J A;  1MQV A;  2CYD A;  3N0T A;  4DOZ A;  5K0I A;  2KJG A;  4E7S A;  1JOG A;  1TFK B;  4ULW A;  2CCY A;  4O7G A;  2HZ8 A;  3NMK A;  4LDK A;  3T6B A;  2ETS A;  4XPX A;  1ST6 A;  3U3F A;  3GOD A;  4YWQ A;  5DS6 A;  2KSF A;  3JZ0 A;  3H65 A;  5A6A A;  4MVS A;  4I44 A;  1PV3 A;  3EZH A;  3B0P A;  3JCU Q;  5BQH A;  5BUO A;  5L3Q A;  2KK1 A;  3M1C B;  1EI7 A;  3FOP A;  2HMQ A;  2WVO A;  2Z15 A;  3DJU B;  2XL8 A;  2FFH A;  3GEI A;  1TWA A;  4G78 A;  2G3V A;  1ZU5 A;  2J9U A;  3QZC A;  3RKO F;  3SXY A;  3C8Z A;  3SXM A;  2M64 A;  3X1O A;  5JS5 A;  1WGW A;  3ABL C;  1J8M F;  4MND A;  3GM3 A;  1FMW A;  2R9R B;  2W9Y A;  5B1A C;  3US6 A;  4IRU A;  3W2W A;  2WZL A;  3LAY A;  5DLJ A;  3LJB A;  4MVU A;  3L8I A;  2QE9 A;  1VB5 A;  2NUP B;  1HE1 A;  2YZS A;  4JCZ A;  4JUR I;  3DKA A;  1XZQ A;  4BJT A;  2R7R A;  3KYJ A;  1D0Z A;  5JLI A;  5KYW B;  2VCB A;  2X51 A;  3DE8 A;  2GWW A;  5DVW A;  1Y6D A;  2XRH A;  2ZXW C;  3RVY A;  3RW0 A;  1RJ9 B;  3JYY A;  1ZW3 A;  3C8G D;  1ZYR F;  3Q6N A;  4LAC B;  1IW7 F;  3K1H A;  3RYL A;  4LDQ A;  2XXA A;  1R4T A;  4AE4 B;  2XLV A;  1FR0 A;  3RQF A;  3MX3 A;  1JAF A;  3M15 A;  1ORJ A;  4G7O F;  5AC4 A;  2IXN A;  2NSF A;  1VTM P;  3E9V A;  3C7J A;  1HMO A;  2XLM A;  3R2P A;  1E86 A;  3L0I A;  2R7O A;  1I5N A;  2QLA A;  4JTD B;  3HNJ A;  2OJQ A;  3SXZ A;  2O9X A;  2LFF A;  3NKD A;  1C03 A;  4DJ9 A;  4MTO A;  2L6G A;  4JC7 A;  2OKU A;  1RKE A;  4YN0 B;  5JVE A;  2L7A A;  3IQT A;  3O55 A;  2PF4 E;  2R7Q A;  1ZU4 A;  2XSE A;  4NCQ A;  4XQ1 A;  5COG A;  3U8P A;  1B68 A;  3M4B A;  1MMD A;  3DXJ F;  2PNO A;  4DRJ B;  1D1B A;  3LS1 A;  3B29 A;  3MBG A;  1SR2 A;  4YT5 A;  4BJ5 C;  2B0H A;  2XLH A;  4E7Z A;  5DS4 A;  5HV9 A;  4JE9 A;  1H9T A;  2QNL A;  1A7E A;  4HEA J;  2I8B A;  2HV7 A;  2EPM X;  2VB6 A;  1BDJ B;  3LEV A;  3ZTZ A;  1GGQ A;  4E17 A;  2R03 A;  1G4W R;  3SEO A;  2XLO A;  1Q0K A;  2OOC A;  3DAF A;  2GA0 A;  1T6U A;  4UDV A;  4NQF A;  3KKB A;  3ZSU A;  1A41 A;  4DBR A;  1RMV A;  3I5P A;  1MMN A;  1NU7 D;  2EPN A;  2IXM A;  2YVK A;  3GWN A;  4OD5 A;  4EWC A;  1TR2 A;  1VYI A;  1Z6A A;  2KW3 C;  2RD9 A;  3FVY A;  3EFO B;  3ZQY A;  4EBB A;  3OA1 A;  3H2U A;  5F5F A;  1PD1 A;  1HMD A;  1T5O A;  3QW0 A;  5IY5 C;  1FFH A;  3LES A;  4ULV A;  5JUA A;  4CSA C;  3A9C A;  3QMK A;  1LE4 A;  3B71 A;  4MW8 A;  3VYW A;  1ZHX A;  3U5S A;  2EPL X;  1VOM A;  3CZ6 A;  5A6B A;  3GEH A;  2NPU A;  3B0U X;  1YVI A;  3RVZ A;  2OEX A;  2VCC A;  4N06 A;  1ZHT A;  3IEE A;  4QI0 A;  3KH2 A;  4KNW A;  5COF A;  5T3W A;  1JPJ A;  3RF3 A;  1G5Z A;  1KU2 A;  3T6J A;  5L0H A;  3O10 A;  5L0C A;  3UGP A;  2VC9 A;  3LLK A;  3JSZ A;  3GWL A;  4WAB A;  4B6I A;  4YT2 A;  2CNW D;  4CS8 A;  2OU6 A;  1XZP A;  3L8J A;  1OQC A;  4XWJ A;  3ASO C;  4QDL A;  3S29 A;  3UNG C;  2GFH A;  4MTF A;  4BJ6 C;  5T1D B;  2R25 A;  4Z9H A;  3EH2 A;  1WAS A;  3HJC A;  3JT1 A;  2PP4 A;  2YLG A;  4MW3 A;  4H4K C;  1JMW A;  1OCO C;  3LEO A;  4U5E E;  2HSB A;  3AQB A;  2WB7 A;  4M63 A;  4LLE A;  2R7V A;  4XEK A;  2YL7 A;  3AGT A;  2EIK C;  3T6G B;  4GYT A;  1G8X A;  2YLD A;  3NYL A;  3V5X A;  2FGY A;  1OW7 A;  3T9O A;  4ER9 A;  3UGO A;  4EUK B;  3AG4 C;  3X2Q C;  2Q9C A;  5KYU A;  2YQY A;  2P1A A;  3JTL O;  1OR2 A;  1Q0G A;  4LDR A;  4LER A;  1IZM A;  4JTA B;  1I4Z A;  3C62 A;  3TJ5 A;  4U5C E;  3VM6 A;  1V4A A;  5JP7 A;  4AL0 A;  2R7S A;  2KQ9 A;  4N6C A;  3QVY A;  2MYS A;  5D91 A;  1GQA A;  1ZVZ A;  1V74 B;  1OXB A;  2PX3 A;  1H7I A;  1BR2 A;  1O87 A;  3JSE O;  3WAQ A;  3AOU A;  4FWV A;  4QI2 A;  1LVK A;  2LCH A;  5B1B C;  3MYI A;  4I3M A;  3M79 A;  4W8P A;  5L0G A;  3AG2 C;  1QSP A;  1YDI A;  2Q9A A;  1APC A;  1AUE A;  4PJN A;  3HNK A;  4OIR F;  4HFF B;  2R7U A;  1WOL A;  5KYY A;  4A4A A;  1M57 C;  2C04 A;  2GAQ A;  3MLG A;  4U5D E;  4KNV A;  3NG1 A;  1YZC A;  4JCH A;  4BG0 A;  1KNY A;  3CSK A;  2L6F A;  2LFD A;  3DAG A;  4CS7 A;  3S27 A;  3Q7L A;  2L9J A;  3TK0 A;  3NRH A;  4CX9 A;  3RQG A;  4CDY A;  3KYI A;  2XXA B;  2HUJ A;  3ASN C;  2R02 A;  4IAO A;  3NYM A;  4A2N B;  4EHP A;  4E0I A;  3FXH A;  1OW6 A;  5L0I A;  4U5F E;  5B3S C;  4N6H A;  2DI3 A;  1LKX A;  3FDQ A;  1LS4 A;  1Z3I X;  2IXP A;  5F5H A;  1NZE A;  1NU9 C;  1TWC A;  3VAY A;  3S84 A;  4YT8 A;  2HJ3 A;  4E18 A;  3C8G A;  1UG7 A;  4R32 A;  2AP3 A;  1SYQ A;  4MVZ A;  3GM1 A;  3TQO A;  3EJN A;  4PJM A;  2NUT A;  5JRA A;  4C3B A;  3S90 A;  3POV A;  4CS9 C;  3AG3 C;  1H9G A;  4AX2 A;  5AC5 A;  5L3V A;  1RKE B;  4H54 A;  3EQL F;  3TOM A;  4EBK A;  2J9V A;  3SZR A;  4MTG A;  2WVQ A;  4PJL A;  3WOD F;  2H8A A;  4D4N A;  1AVO B;  2DGJ A;  1W2W A;  3KPH A;  1DOW A;  1D0X A;  2JPU A;  2XLD A;  3HTK C;  3ABK C;  3I4U A;  3N24 A;  3QVZ A;  2X0C A;  2YHS A;  2Q9B A;  5GPG B;  2VH3 A;  5L0D A;  2CGE A;  3G4Z A;  3PCV A;  4KBL A;  3DZA A;  2C03 A;  3J06 A;  2HSQ A;  1HY5 A;  5DS5 A;  2TMV P;  2YRF A;  2QUP A;  4IAQ A;  3ZVR A;  4C3D A;  5EGY A;  3IQC A;  4Q5S F;  1PCX A;  3NMI A;  2HV6 A;  2Y3B A;  4PK4 A;  3AGU A;  3ZWI A;  5JT4 A;  2CDQ A;  4E0H A;  2J7P D;  5KYW A;  2W4M A;  4OIO F;  1E85 A;  4EBJ A;  2J0W A;  1RJ9 A;  2ASR A;  4IJJ A;  4CIH A;  1E83 A;  256B A;  1NFO A;  2XS1 A;  1NFN A;  2YL3 A;  2KYH A;  3DE9 A;  3UMH A;  2Y3D A;  1V54 C;  2OEV A;  3O39 A;  4MVO A;  4JJG A;  4KC9 A;  1E84 A;  4OIP F;  4K7B A;  3GAN A;  5E33 A;  1FMV A;  2NSG A;  1ZZP A;  2XL6 A;  3UMK A;  3UMI A;  1AEP A;  3G50 A;  1M2V B;  4JJF A;  1CPQ A;  1Z63 A;  5DQZ A;  2WZF A;  3W2V A;  2D4U A;  1GM5 A;  4J7Y A;  3GOR A;  2A69 F;  1UFB A;  4XTK A;  3ZG1 A;  1D1A A;  3K33 A;  2NG1 A;  5KYN A;  2R7T A;  3SXK A;  3ZIB A;  2EIM C;  3S28 A;  2Q3T A;  2UUH A;  2XS8 A;  1CGO A;  1LM3 B;  3CEX A;  3EGX B;  3G4X A;  4G0H A;  2A1D D;  4JEA A;  4MQ9 F;  5EK0 A;  1S05 A;  1ORY A;  2V26 A;  5KYX B;  2E87 A;  1NSG B;  3K1I C;  1A7V A;  2A68 F;  2GDC A;  3BEH A;  3LNM B;  2J9W A;  4GQH A;  2ZXO A;  4I1O B;  4MVQ A;  3IQ6 A;  3JRT A;  4IWB A;  2EPO A;  3DMD A;  4CJO A;  1QVX A;  3TUL A;  4U5B E;  5T3T A;  4C7O B;  2IOQ A;  1Z7Q c;  4AK9 A;  1OXK A;  4JIO A;  3U9J A;  4EIY A;  2BC5 A;  2RSE B;  4NTF A;  4BJ5 A;  2CNW A;  5A6K A;  3S0X A;  2CW0 F;  1VMA A;  2L81 A;  2PX0 A;  3C63 A;  3EG9 A;  3SNH A;  3W8H A;  5KYU B;  2KNH A;  2XM0 A;  1VLT A;  3NYJ A;  2Y39 A;  3N2Z B;  3DJN B;  4P9F A;  3KL4 A;  3Q7G A;  3EFO A;  3HKK A;  5CI8 A;  2P7V A;  3DWW A;  4JVS A;  2EPK X;  4XEF A;  1C17 M;  4BEM J;  1T6Q A;  3MYF A;  2YL0 A;  3OWT A;  3JYH A;  4OD4 A;  1LPE A;  3HNL A;  1FNT c;  4YL0 A;  1YLM A;  3U2M A;  4G7H F;  3B0V C;  2J46 A;  3R7C A;  1YYJ A;  2UUI A;  4FES A;  1LE2 A;  2VCA A;  1M2O A;  3QW1 A;  4N4W A;  3IHU A;  1NLX A;  1TFO B;  4CSA A;  4ANJ A;  3IPM O;  2Y69 C;  4DBQ A;  5BQI A;  3FOO A;  4BEJ A;  2DYS C;  2J0X A;  1L7C A;  1OKK D;  4KI2 A;  1D0Y A;  1T01 A;  1Q0F A;  2YEV A;  3EGD A;  3VRC A;  3ZC4 A;  3JRM O;  2HFI A;  3BRJ A;  1Y4C A;  4IAR A;  2R05 A;  2XLE A;  3ZQV A;  1QPU A;  2LQG A;  1MNE A;  2LD6 A;  1LI5 A;  3ZDL A;  3FAJ A;  2HJM A;  3V7O A;  4BPM A;  1EQ1 A;  3S9O A;  3FMS A;  4O6Y A;  4D4X A;  3C18 A;  1WTY A;  2B0J A;  1LI7 A;  3K66 A; 
#chains in the Genus database with same CATH homology
 3CEX A;  1RXQ A;  2QNL A;  2OQM A;  5COF A;  2NSF A;  2YQY A;  2P1A A;  2F22 A;  2HKV A;  4N6C A;  2RD9 A;  2NSG A;  2OU6 A;  5CIV A;  3DI5 A;  2QE9 A;  3DKA A;  5COG A;  5COM A;  3GOR A;  3QTH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...