2P1AA

Crystal structure of a putative metal-binding protein (bce_2162) from bacillus cereus atcc 10987 at 2.10 a resolution
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
143
structure length
143
Chain Sequence
GMFVQSALHQLKVAVDTSIQMLDQYTEIDLKIAPIQSKRSLFEMYAHLSLICHADLLILNGSTEKELHTFYKEQTPETIAQMQKTMIQGYDLLSKTFLSYSNEQLAEMKTAYWGISYSRFEWLLEIVAHFYHHRGQIHILLCE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Hypothetical protein
publication title Crystal structure of hypothetical protein (NP_978475.1) from Bacillus cereus ATCC 10987 at 2.10 A resolution
rcsb
source organism Bacillus cereus
total genus 48
structure length 143
sequence length 143
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12867 DinB_2 DinB superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.450 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) dinb family like domain 2p1aA00
3DKAA 5COMA 2OU6A 2OQMA 2YQYA 2F22A 5COGA 3DI5A 3QTHA 2HKVA 3GORA 2NSFA 2RD9A 4N6CA 2QNLA 2NSGA 5CIVA 1RXQA 2P1AA 3CEXA 5COFA 2QE9A
chains in the Genus database with same CATH superfamily
2H7BA 1RKCA 2O9XA 2KQ9A 1EQ1A 1CPRA 2CW0F 5A69A 2P6VA 2PBEA 2VH3A 4O7GA 1D1AA 2QTVA 1FR0A 2HS5A 2LCHA 4O6MA 2P7VA 1TR2A 3I5PA 1FNTc 3E70C 5COGA 3OA1A 4ER9A 2P61A 5JT4A 2C04A 2G3KA 1FFHA 1VMAA 2R7RA 2R7WA 2W4MA 3T6GB 2RD9A 3DXJF 3C7JA 3EGXB 4JIOA 2AWCA 5GPGB 1D1BA 2C03A 2LD6A 3JYYA 3RKOF 4PK4A 2NSGA 1FTSA 1D0ZA 4JTAB 1FMWA 3IQ6A 3RQEA 5F5HA 3QZCA 4MVMA 1Z23A 4PFOA 2H7OA 3GEEA 4E0IA 2HMQA 1LE4A 5D91A 3RVYA 1WTYA 4FX5A 1NFOA 1T6UA 4XPYA 4BPMA 3KYIA 4C3EA 4CJOA 3NMJA 4MS2A 3X1OA 2IYLD 3NMIA 2IXOA 3OEOA 1NG1A 3U2LA 1G4US 2OKUA 1XZPA 1I4ZA 4RBNA 2UUHA 2NUPB 3M79A 3NRHA 2AP3A 1I5NA 2WVQA 3BRJA 3EHMA 2HJMA 3K1IA 3V5ZA 4CS8A 4OIPF 4C7OA 2XL4A 1V54C 3LEOA 2R9RB 2VCCA 4O79A 2GDCA 4EHPA 2FGYA 2MHRA 2XL6A 3JSZA 3WHNA 3ABLC 3M15A 2YLGA 3WG7C 1XZQA 4KI2A 2R05A 2BE5F 2DGJA 1BZ4A 5FZTA 1LS4A 5KYXB 1ZW2A 2OU6A 3UGPA 3TJ5A 5B1AC 2GAQA 1E86A 3HKKA 2WZLA 2PNOA 4EBKA 4AL1A 3EGXA 3FOPA 3HJCA 3LLIA 5EGYA 4IRUA 4G7OF 2LIGA 3U9MA 3ATPA 4NY3A 3CZ6A 4DBQA 1CGME 3LEVA 1ORSC 2OCCC 5CI8A 5L3QA 4DBRA 3N24A 1OW8A 2WL8A 4W8PA 3NG1A 1A7EA 4FWVA 5KYYB 1IW7F 4CSAC 4YL1A 1SR2A 3HNLA 3Q7GA 2HMZA 5T1DB 1ZU5A 5CI9A 4DVZA 1TFKB 3KKBA 4CS9A 3LESA 3SEOA 3ZSUA 2YKZA 3NDBB 2IXPA 2ZXOA 4DRJB 3JT1A 1K05A 4GQHA 4XEVA 4HE8D 4HFFB 1AUEA 3HNJA 4JKVA 2Q3TA 4W8KA 4MNDA 4FESA 1ZU4A 2J8WA 3T6JA 2PX3A 1FAPB 4EWCA 2F22A 4K0DA 4U9DA 3W8HA 2FAPB 2YVKA 3FMSA 2XLWA 2NSFA 1H9GA 2JPUA 4U5GA 1CGNA 3O10A 4CBEA 4KC9A 3RF3A 5A6AA 4IAOA 2HSBA 3IPMO 4OD4A 2A68F 4EIYA 5CIVA 3A11A 2Y3HA 3L1MA 3LS0A 2LFDA 1Z63A 2XLHA 4AE4A 3IQCA 1NLXA 4JCHA 1JPJA 3DKAA 5DS6A 4LLCA 5JS5A 5L3VA 1M2VA 2YLIA 3W2VA 4CJGA 3VRCA 1OCCC 1SF8A 2LP4A 2ZPAA 4MVUA 2P0NA 4P9TA 3LNRA 4CIHA 2AVKA 1I4YA 2XM0A 4H54A 3S0XA 1YLMA 3U8PA 4ANJA 2PX0A 4D4NA 4BEJA 5KYYA 3EG9B 1RKEB 1FMVA 4IJJA 3AJMA 1N1CA 3C63A 1FFTC 2B0JA 2HZ8A 3NKDA 3NYMA 2UUIA 1V4AA 4EBJA 2I8BA 4G7HF 3VYWA 3G4ZA 1YZAA 3K1IC 5DQTA 4CS8C 1GGQA 3HNIA 1YVIA 2XM4A 3QW0A 1SZIA 4Z9JA 4E18A 3DMDA 3QMKA 4OIQF 4OINF 2OOCA 3DE8A 4K7BA 5E33A 2R25A 3TD7A 3U2MA 5EHHA 4BJ6A 4WGZA 1DOWA 5KYNA 2IOQA 1T01A 2R7UA 1A7VA 2QE9A 1E84A 2E87A 4IWBA 4YN0B 1OCRC 5B3SC 3US6A 1B68A 4LDKA 1VK5A 2A0BA 2R02A 3VF0A 4DRHB 1W2WA 3EQLF 3UR3C 1L3PA 2L6FA 4LERA 4MVZA 4OIRF 2VCBA 2Q7RA 5L0DA 5HSWA 1NBBA 1SYQA 4O6NA 1NZEA 3AQBA 3IQ5A 4U5FE 2ETSA 3CAXA 1LIHA 1WASA 1YARO 1VLSA 1ZHZA 2AWYA 2HFIA 3ASNC 3DJNB 4U5BE 1QQ3A 4YL3A 2VC9A 5JP7A 4EUKB 3K7DA 3HTKC 3SXMA 5KYWA 3DAFA 3F46A 4J7TA 1PD0A 2H7VC 2ZXRA 4JCZA 4PACA 4ULVA 5DS5A 2XLDA 3VM6A 4OD5A 1IZMA 1OXBA 2YHSA 1ZW3A 1E2XA 4U5DE 3ZDLA 3TOMA 1LS1A 1H6GA 4CS9C 5FCLA 1YA9A 2L6GA 2BC5A 4YL0A 4B6IA 1C03A 2EIMC 3EFOA 4UDVA 4E7SA 2PP4A 2YQYA 1LM3B 1Y6DA 3DAGA 1TWHA 2GFHA 5AC5A 5AGFA 4ZLDA 2QY9A 3NYJA 3RH3A 3HLZA 3KH2A 3KMIA 3LS1A 2NG1A 4NCQA 1M2OA 3DI5A 1GQAA 3B0VC 3QVZA 4X0RA 3B9QA 3C8GA 3MFNA 2JD3A 4H4KC 2DB4A 4JJGA 1ZHWA 4MTGA 4QDLA 4C3BA 1ZHTA 4ZLCA 2R7VA 1BR2A 3RQGA 3ZWIA 3GANA 4FAPB 1TWAA 4NTBA 4U9EA 1Q0DA 1SMYF 1VOMA 4N6CA 2YRFA 3JRMO 4QI2A 1RXQA 1TKNA 1UFBA 2P1AA 1AEPA 1O3UA 2PFDA 4JE9A 1YJGA 4BJTA 2Y3GA 5L0CA 1WOLA 4G7ZF 3C8GD 2LSEA 3G50A 4NTFA 1CPQA 3K66A 2Q9CA 3M4CA 3Q6NA 4J7YA 2NPUA 5COMA 5JVEA 1E85A 2YZSA 4F4BA 1U89A 2G62A 1ORYA 2ZXWC 1MNEA 5JSLA 3W2WA 1VB5A 2EILC 2A6EF 3DJUB 3AG2C 4P9FA 2YL7A 3Q6MA 3WAQA 1U0BB 2M64A 2YEVA 3ZQVA 3C62A 3B0UX 1C17M 2DYRC 1HY5A 1MMNA 2J9UA 1L7CA 2EPNA 1G8XA 5L0FA 2QLAA 2KNHA 3UGOA 2WB7A 2A6HF 4JRZA 1C02A 4N4WA 1TWGA 4JJFA 3LAYA 5L0HA 1LI7A 3C18A 3NMKA 5A6JA 2EPLX 5COFA 2YL1A 2XXAB 4OIOF 1ZZPA 4MVQA 2KK1A 4AK9A 5F28E 4BJ6C 1Z7Qc 3S27A 3TK0A 4AX2A 4JEAA 3UMKA 3U9JA 1LI5A 3EZHA 5L0GA 5E3AA 2NUPA 3DZAA 3W8IA 1APCA 1TQGA 4JEBA 5DVWA 3PHF2 3V7OA 3FHDA 1BR4A 2IXMA 3GM2A 2Q4FA 4JURI 3AOUA 4KNVA 3CSKA 4I1MA 2A69F 3DM9B 4E7ZA 1QSPA 2VCAA 3A9CA 2IBFA 4JW1A 1PCXA 1M57C 2GA0A 2A0UA 2J0XA 3N2ZB 5KYXA 2XLEA 4NC3A 4J30B 4YJWA 2D4UA 3EHNA 1QKRA 1OKKA 5DS4A 1O5HA 2L9JA 2YWAA 4ULWA 1Q0FA 3T9OA 4DOZA 4XQ1A 1OQCA 3NKEA 4MTFA 1D1CA 1R4TA 3AGUA 1D0XA 2XSEA 2CGEA 2W4BA 3EPVA 3NYLA 3O39A 4IAQA 1TWCA 4MVSA 4YK5A 4YT4A 1J8MF 1R5ID 5K0IA 4I1OB 1Z3IX 3L0IA 1HMDA 4CX9A 1VYIA 3I4UA 4CSAA 1KNYA 1Q0KA 1OKKD 2CCYA 4XLPF 2W45A 4U5CE 4BJ1A 2LK4A 2XXAA 2XRHA 3FVYA 3S84A 5A6KA 5TJ5E 1BDJB 1JRAA 2WZFA 3ITFA 2FFHA 3O55A 3ABKC 1J8YF 1TFOB 4QI0A 4XEKA 1D0YA 1NSGB 1ZVZA 4JTCB 1CGOA 2B0HA 3ASOC 4YT8A 2KJGA 3O6XA 4GEHA 5KYUB 3FAPB 1KTMA 3GM3A 4I44A 5BUOA 3H65A 2OQMA 1H9TA 1LE2A 4NTAA 3RIPA 2Y69C 4IB4A 4XPXA 1G4WR 3FOOA 3UMIA 1HW2A 2J9VA 2YL0A 5DQZA 1U6HA 2HJ3A 3MYIA 2EIKC 2Y39A 3RFYA 1WGWA 5AC4A 1PV3A 2L7AA 4JZAA 3ZIBA 3EGDB 3SYNA 3T6BA 1JAFA 1OCZC 4ONSA 4IARA 3M1CB 1QLEC 4DRIB 1YYJA 4Z9IA 2XLOA 1K40A 1QPUA 2CDQA 2KW3C 2CYDA 2XLVA 3AG3C 1A7DA 1JOGA 3IHUA 1GS9A 3H2VA 4U5HA 4RD9A 2R7QA 2CNWA 3AG4C 4GYTA 2Y3BA 3U5SA 4C3DA 1A41A 3FXHA 3LLKA 4YWQA 5L0IA 4MQ9F 5DLJA 3CEXA 3SNHA 3KL4A 4XPWA 4C7OB 1JPNA 1G5ZA 2EIJC 4R32A 3ZVRA 3JYHA 3KPHA 2M4EA 3L8IA 4KNWA 4HFKB 3QVYA 4U5EE 3EG9A 3K6BA 2AU5A 4HEAJ 1RKEA 5A6BA 3RQFA 3S9OA 3MLGA 4L6RA 4N6HA 3EZIA 3SZRA 3C8ZA 2CNWD 4YT5A 1NFNA 5T3TA 2YL3A 4DJ9A 3JSEO 5BQIA 4G0HA 1OXKA 2X51A 5D92A 1A0BA 3FAJA 3MYFA 1E83A 1BR1A 3I5QA 2LFFA 1EA8A 4WABA 4WGYA 2NUTB 3MBGA 3ZG1A 5F5FA 5A6BD 3LUTB 4JTDB 5KYUA 1T6IA 1MMDA 1M56C 3JTLO 1QZXA 1F1MA 3SXZA 4BEMJ 2QNLA 1MMAA 3V5XA 3B0PA 3GM1A 3OWTA 3POVA 1Q0MA 1RCPA 2BL2A 2ZXPA 3U3BA 3L34A 3JZ0A 4LDRA 1Z6AA 2OEXA 3EGDA 4P6IC 2HSQA 4O6YA 2OJQA 1MQVA 2Q9BA 2A1DD 3KYJA 1V74B 1Y4CA 3AGTA 3MX3A 4XEFA 3S28A 4CDVA 4BJ5A 3SXKA 3DWWA 2V26A 3EH1A 3GWNA 1OW6A 3QW1A 4MW8A 4D4XA 5IY5C 2R7TA 1YYXA 2D5RB 2YLDA 2L81A 3QTHA 4DXWA 5B1BC 3U0CA 1NU9C 1RJ9B 2J0WA 2PF4E 3H2UA 3VAYA 3E9VA 3T4RA 4MVOA 2J45A 5L0JA 1ZHYA 1MMGA 256BA 3HNKA 4DVYP 1Q0GA 5BQHA 3SXYA 5HV9A 3SP1A 2W9YA 2G3VA 3N0TA 2ICWG 3WODF 1BBHA 4XTKA 2J9BA 4XLNF 4A2NB 1EI7A 1YA7O 2DI3A 2OJED 5EK0A 3TQOA 5E3CA 3PMRA 2OG2A 3FDQA 1ZYRF 3L8JA 4EBBA 3GODA 4Q7CA 4I3MA 5JRAA 1MNDA 2L6HA 1OR3A 2NUTA 3UMHA 4LLEA 4AE4B 1S7ZA 1V55C 3ZC4A 1XWJA 4PJLA 3U3FA 1M2VB 3ZQYA 4MVRA 1HW1A 3M4BA 1T5OA 2J46A 2R7XA 2KGOA 3RW0A 2OEVA 2WVOA 1HE9A 3ECSA 2EINC 1M6TA 2ASRA 4N06A 4RDAA 3CQZA 2J7PA 4CIPA 3S90A 1VTMP 3U8VA 4A4AA 2XLMA 4Q5SF 1S05A 3PCVA 3R7CA 4CDYA 1OW7A 1ST6A 3JRTA 3Q7LA 3TJ6A 4BG0A 2XL8A 3GEHA 1DOVA 4MTOA 3V5YA 3LJBA 4E0HA 1HE1A 3ZTZA 1YDIA 2GWWA 3DE9A 5T3WA 3TOLA 4LACB 2Z15A 1RJ9A 2X0CA 1VLTA 4MW3A 1OCOC 2Q9AA 3J06A 1LKXA 3RYLA 2J7PD 1RMVA 4Z9HA 4WJ0A 3W4YA 1WWPA 1ZHXA 2V3CC 2HKVA 1JR8A 3GORA 5JLIA 2DYSC 1JMWA 5E2QA 1H7IA 3AG1C 4NQFA 4PJNA 1PD1A 3B71A 1AVOB 4JC7A 4AL0A 2IM8A 3GWLA 4PR9A 1VYKA 3ZTMA 2R03A 3JCUQ 2XS8A 3EH2A 3IEEA 1HMOA 1LPEA 1K04A 2I15A 5KYWB 1WATA 2QUPA 2WZGA 3DM5A 3IQTA 4PJMA 2J9WA 1OR2A 4JVSA 2EPKX 5BQGA 3PDMP 2KYHA 1YZCA 2VASA 1ORJA 5JUAA 4E17A 1KU2A 3GEIA 4M63A 3UNGC 2H8AA 3B29A 4IGGA 2KSFA 1T9KA 4PFPA 4BJ5C 4LDQA 2EPOA 2IXNA 2HV6A 3EFOB 2R7SA 3TULA 2XS1A 3R2PA 3LNMB 1Z5ZA 2VB6A 1NU7D 2HUJA 3S29A 1LVKA 1EKYA 2ZD9A 2Y3DA 1O87A 3K33A 2HV7A 4KBLA 4PJJA 3RVZA 2Q00A 4EKWA 3AQCA 1YAUO 3BEHA 1QVXA 5B3IA 3K1HA 1GM5A 3C8GB 2WVNA 2MYSA 3EJNA 4XWJA 3F47A 3X2QC 2KC3A 4CS7A 1T6QA 3ABMC 4K1OA 2JX0A 3DD7A 2TMVP 4YT2A 1UG7A 2RSEB 3G4XA 2LQGA 4G78A 1WN0A 2MWQA 4J32B 4Q4ZF 2R7OA 2EPMX 4CDAA
chains in the Genus database with same CATH topology
3DKAA 5COMA 2OU6A 2OQMA 2YQYA 2F22A 5COGA 3DI5A 3QTHA 2HKVA 3GORA 2NSFA 2RD9A 4N6CA 2QNLA 2NSGA 5CIVA 1RXQA 2P1AA 3CEXA 5COFA 2QE9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DKA A;  5COM A;  2OU6 A;  2OQM A;  2YQY A;  2F22 A;  5COG A;  3DI5 A;  3QTH A;  2HKV A;  3GOR A;  2NSF A;  2RD9 A;  4N6C A;  2QNL A;  2NSG A;  5CIV A;  1RXQ A;  2P1A A;  3CEX A;  5COF A;  2QE9 A; 
#chains in the Genus database with same CATH topology
 2H7B A;  1RKC A;  2O9X A;  2KQ9 A;  1EQ1 A;  1CPR A;  2CW0 F;  5A69 A;  2P6V A;  2PBE A;  2VH3 A;  4O7G A;  1D1A A;  2QTV A;  1FR0 A;  2HS5 A;  2LCH A;  4O6M A;  2P7V A;  1TR2 A;  3I5P A;  1FNT c;  3E70 C;  5COG A;  3OA1 A;  4ER9 A;  2P61 A;  5JT4 A;  2C04 A;  2G3K A;  1FFH A;  1VMA A;  2R7R A;  2R7W A;  2W4M A;  3T6G B;  2RD9 A;  3DXJ F;  3C7J A;  3EGX B;  4JIO A;  2AWC A;  5GPG B;  1D1B A;  2C03 A;  2LD6 A;  3JYY A;  3RKO F;  4PK4 A;  2NSG A;  1FTS A;  1D0Z A;  4JTA B;  1FMW A;  3IQ6 A;  3RQE A;  5F5H A;  3QZC A;  4MVM A;  1Z23 A;  4PFO A;  2H7O A;  3GEE A;  4E0I A;  2HMQ A;  1LE4 A;  5D91 A;  3RVY A;  1WTY A;  4FX5 A;  1NFO A;  1T6U A;  4XPY A;  4BPM A;  3KYI A;  4C3E A;  4CJO A;  3NMJ A;  4MS2 A;  3X1O A;  2IYL D;  3NMI A;  2IXO A;  3OEO A;  1NG1 A;  3U2L A;  1G4U S;  2OKU A;  1XZP A;  1I4Z A;  4RBN A;  2UUH A;  2NUP B;  3M79 A;  3NRH A;  2AP3 A;  1I5N A;  2WVQ A;  3BRJ A;  3EHM A;  2HJM A;  3K1I A;  3V5Z A;  4CS8 A;  4OIP F;  4C7O A;  2XL4 A;  1V54 C;  3LEO A;  2R9R B;  2VCC A;  4O79 A;  2GDC A;  4EHP A;  2FGY A;  2MHR A;  2XL6 A;  3JSZ A;  3WHN A;  3ABL C;  3M15 A;  2YLG A;  3WG7 C;  1XZQ A;  4KI2 A;  2R05 A;  2BE5 F;  2DGJ A;  1BZ4 A;  5FZT A;  1LS4 A;  5KYX B;  1ZW2 A;  2OU6 A;  3UGP A;  3TJ5 A;  5B1A C;  2GAQ A;  1E86 A;  3HKK A;  2WZL A;  2PNO A;  4EBK A;  4AL1 A;  3EGX A;  3FOP A;  3HJC A;  3LLI A;  5EGY A;  4IRU A;  4G7O F;  2LIG A;  3U9M A;  3ATP A;  4NY3 A;  3CZ6 A;  4DBQ A;  1CGM E;  3LEV A;  1ORS C;  2OCC C;  5CI8 A;  5L3Q A;  4DBR A;  3N24 A;  1OW8 A;  2WL8 A;  4W8P A;  3NG1 A;  1A7E A;  4FWV A;  5KYY B;  1IW7 F;  4CSA C;  4YL1 A;  1SR2 A;  3HNL A;  3Q7G A;  2HMZ A;  5T1D B;  1ZU5 A;  5CI9 A;  4DVZ A;  1TFK B;  3KKB A;  4CS9 A;  3LES A;  3SEO A;  3ZSU A;  2YKZ A;  3NDB B;  2IXP A;  2ZXO A;  4DRJ B;  3JT1 A;  1K05 A;  4GQH A;  4XEV A;  4HE8 D;  4HFF B;  1AUE A;  3HNJ A;  4JKV A;  2Q3T A;  4W8K A;  4MND A;  4FES A;  1ZU4 A;  2J8W A;  3T6J A;  2PX3 A;  1FAP B;  4EWC A;  2F22 A;  4K0D A;  4U9D A;  3W8H A;  2FAP B;  2YVK A;  3FMS A;  2XLW A;  2NSF A;  1H9G A;  2JPU A;  4U5G A;  1CGN A;  3O10 A;  4CBE A;  4KC9 A;  3RF3 A;  5A6A A;  4IAO A;  2HSB A;  3IPM O;  4OD4 A;  2A68 F;  4EIY A;  5CIV A;  3A11 A;  2Y3H A;  3L1M A;  3LS0 A;  2LFD A;  1Z63 A;  2XLH A;  4AE4 A;  3IQC A;  1NLX A;  4JCH A;  1JPJ A;  3DKA A;  5DS6 A;  4LLC A;  5JS5 A;  5L3V A;  1M2V A;  2YLI A;  3W2V A;  4CJG A;  3VRC A;  1OCC C;  1SF8 A;  2LP4 A;  2ZPA A;  4MVU A;  2P0N A;  4P9T A;  3LNR A;  4CIH A;  2AVK A;  1I4Y A;  2XM0 A;  4H54 A;  3S0X A;  1YLM A;  3U8P A;  4ANJ A;  2PX0 A;  4D4N A;  4BEJ A;  5KYY A;  3EG9 B;  1RKE B;  1FMV A;  4IJJ A;  3AJM A;  1N1C A;  3C63 A;  1FFT C;  2B0J A;  2HZ8 A;  3NKD A;  3NYM A;  2UUI A;  1V4A A;  4EBJ A;  2I8B A;  4G7H F;  3VYW A;  3G4Z A;  1YZA A;  3K1I C;  5DQT A;  4CS8 C;  1GGQ A;  3HNI A;  1YVI A;  2XM4 A;  3QW0 A;  1SZI A;  4Z9J A;  4E18 A;  3DMD A;  3QMK A;  4OIQ F;  4OIN F;  2OOC A;  3DE8 A;  4K7B A;  5E33 A;  2R25 A;  3TD7 A;  3U2M A;  5EHH A;  4BJ6 A;  4WGZ A;  1DOW A;  5KYN A;  2IOQ A;  1T01 A;  2R7U A;  1A7V A;  2QE9 A;  1E84 A;  2E87 A;  4IWB A;  4YN0 B;  1OCR C;  5B3S C;  3US6 A;  1B68 A;  4LDK A;  1VK5 A;  2A0B A;  2R02 A;  3VF0 A;  4DRH B;  1W2W A;  3EQL F;  3UR3 C;  1L3P A;  2L6F A;  4LER A;  4MVZ A;  4OIR F;  2VCB A;  2Q7R A;  5L0D A;  5HSW A;  1NBB A;  1SYQ A;  4O6N A;  1NZE A;  3AQB A;  3IQ5 A;  4U5F E;  2ETS A;  3CAX A;  1LIH A;  1WAS A;  1YAR O;  1VLS A;  1ZHZ A;  2AWY A;  2HFI A;  3ASN C;  3DJN B;  4U5B E;  1QQ3 A;  4YL3 A;  2VC9 A;  5JP7 A;  4EUK B;  3K7D A;  3HTK C;  3SXM A;  5KYW A;  3DAF A;  3F46 A;  4J7T A;  1PD0 A;  2H7V C;  2ZXR A;  4JCZ A;  4PAC A;  4ULV A;  5DS5 A;  2XLD A;  3VM6 A;  4OD5 A;  1IZM A;  1OXB A;  2YHS A;  1ZW3 A;  1E2X A;  4U5D E;  3ZDL A;  3TOM A;  1LS1 A;  1H6G A;  4CS9 C;  5FCL A;  1YA9 A;  2L6G A;  2BC5 A;  4YL0 A;  4B6I A;  1C03 A;  2EIM C;  3EFO A;  4UDV A;  4E7S A;  2PP4 A;  2YQY A;  1LM3 B;  1Y6D A;  3DAG A;  1TWH A;  2GFH A;  5AC5 A;  5AGF A;  4ZLD A;  2QY9 A;  3NYJ A;  3RH3 A;  3HLZ A;  3KH2 A;  3KMI A;  3LS1 A;  2NG1 A;  4NCQ A;  1M2O A;  3DI5 A;  1GQA A;  3B0V C;  3QVZ A;  4X0R A;  3B9Q A;  3C8G A;  3MFN A;  2JD3 A;  4H4K C;  2DB4 A;  4JJG A;  1ZHW A;  4MTG A;  4QDL A;  4C3B A;  1ZHT A;  4ZLC A;  2R7V A;  1BR2 A;  3RQG A;  3ZWI A;  3GAN A;  4FAP B;  1TWA A;  4NTB A;  4U9E A;  1Q0D A;  1SMY F;  1VOM A;  4N6C A;  2YRF A;  3JRM O;  4QI2 A;  1RXQ A;  1TKN A;  1UFB A;  2P1A A;  1AEP A;  1O3U A;  2PFD A;  4JE9 A;  1YJG A;  4BJT A;  2Y3G A;  5L0C A;  1WOL A;  4G7Z F;  3C8G D;  2LSE A;  3G50 A;  4NTF A;  1CPQ A;  3K66 A;  2Q9C A;  3M4C A;  3Q6N A;  4J7Y A;  2NPU A;  5COM A;  5JVE A;  1E85 A;  2YZS A;  4F4B A;  1U89 A;  2G62 A;  1ORY A;  2ZXW C;  1MNE A;  5JSL A;  3W2W A;  1VB5 A;  2EIL C;  2A6E F;  3DJU B;  3AG2 C;  4P9F A;  2YL7 A;  3Q6M A;  3WAQ A;  1U0B B;  2M64 A;  2YEV A;  3ZQV A;  3C62 A;  3B0U X;  1C17 M;  2DYR C;  1HY5 A;  1MMN A;  2J9U A;  1L7C A;  2EPN A;  1G8X A;  5L0F A;  2QLA A;  2KNH A;  3UGO A;  2WB7 A;  2A6H F;  4JRZ A;  1C02 A;  4N4W A;  1TWG A;  4JJF A;  3LAY A;  5L0H A;  1LI7 A;  3C18 A;  3NMK A;  5A6J A;  2EPL X;  5COF A;  2YL1 A;  2XXA B;  4OIO F;  1ZZP A;  4MVQ A;  2KK1 A;  4AK9 A;  5F28 E;  4BJ6 C;  1Z7Q c;  3S27 A;  3TK0 A;  4AX2 A;  4JEA A;  3UMK A;  3U9J A;  1LI5 A;  3EZH A;  5L0G A;  5E3A A;  2NUP A;  3DZA A;  3W8I A;  1APC A;  1TQG A;  4JEB A;  5DVW A;  3PHF 2;  3V7O A;  3FHD A;  1BR4 A;  2IXM A;  3GM2 A;  2Q4F A;  4JUR I;  3AOU A;  4KNV A;  3CSK A;  4I1M A;  2A69 F;  3DM9 B;  4E7Z A;  1QSP A;  2VCA A;  3A9C A;  2IBF A;  4JW1 A;  1PCX A;  1M57 C;  2GA0 A;  2A0U A;  2J0X A;  3N2Z B;  5KYX A;  2XLE A;  4NC3 A;  4J30 B;  4YJW A;  2D4U A;  3EHN A;  1QKR A;  1OKK A;  5DS4 A;  1O5H A;  2L9J A;  2YWA A;  4ULW A;  1Q0F A;  3T9O A;  4DOZ A;  4XQ1 A;  1OQC A;  3NKE A;  4MTF A;  1D1C A;  1R4T A;  3AGU A;  1D0X A;  2XSE A;  2CGE A;  2W4B A;  3EPV A;  3NYL A;  3O39 A;  4IAQ A;  1TWC A;  4MVS A;  4YK5 A;  4YT4 A;  1J8M F;  1R5I D;  5K0I A;  4I1O B;  1Z3I X;  3L0I A;  1HMD A;  4CX9 A;  1VYI A;  3I4U A;  4CSA A;  1KNY A;  1Q0K A;  1OKK D;  2CCY A;  4XLP F;  2W45 A;  4U5C E;  4BJ1 A;  2LK4 A;  2XXA A;  2XRH A;  3FVY A;  3S84 A;  5A6K A;  5TJ5 E;  1BDJ B;  1JRA A;  2WZF A;  3ITF A;  2FFH A;  3O55 A;  3ABK C;  1J8Y F;  1TFO B;  4QI0 A;  4XEK A;  1D0Y A;  1NSG B;  1ZVZ A;  4JTC B;  1CGO A;  2B0H A;  3ASO C;  4YT8 A;  2KJG A;  3O6X A;  4GEH A;  5KYU B;  3FAP B;  1KTM A;  3GM3 A;  4I44 A;  5BUO A;  3H65 A;  2OQM A;  1H9T A;  1LE2 A;  4NTA A;  3RIP A;  2Y69 C;  4IB4 A;  4XPX A;  1G4W R;  3FOO A;  3UMI A;  1HW2 A;  2J9V A;  2YL0 A;  5DQZ A;  1U6H A;  2HJ3 A;  3MYI A;  2EIK C;  2Y39 A;  3RFY A;  1WGW A;  5AC4 A;  1PV3 A;  2L7A A;  4JZA A;  3ZIB A;  3EGD B;  3SYN A;  3T6B A;  1JAF A;  1OCZ C;  4ONS A;  4IAR A;  3M1C B;  1QLE C;  4DRI B;  1YYJ A;  4Z9I A;  2XLO A;  1K40 A;  1QPU A;  2CDQ A;  2KW3 C;  2CYD A;  2XLV A;  3AG3 C;  1A7D A;  1JOG A;  3IHU A;  1GS9 A;  3H2V A;  4U5H A;  4RD9 A;  2R7Q A;  2CNW A;  3AG4 C;  4GYT A;  2Y3B A;  3U5S A;  4C3D A;  1A41 A;  3FXH A;  3LLK A;  4YWQ A;  5L0I A;  4MQ9 F;  5DLJ A;  3CEX A;  3SNH A;  3KL4 A;  4XPW A;  4C7O B;  1JPN A;  1G5Z A;  2EIJ C;  4R32 A;  3ZVR A;  3JYH A;  3KPH A;  2M4E A;  3L8I A;  4KNW A;  4HFK B;  3QVY A;  4U5E E;  3EG9 A;  3K6B A;  2AU5 A;  4HEA J;  1RKE A;  5A6B A;  3RQF A;  3S9O A;  3MLG A;  4L6R A;  4N6H A;  3EZI A;  3SZR A;  3C8Z A;  2CNW D;  4YT5 A;  1NFN A;  5T3T A;  2YL3 A;  4DJ9 A;  3JSE O;  5BQI A;  4G0H A;  1OXK A;  2X51 A;  5D92 A;  1A0B A;  3FAJ A;  3MYF A;  1E83 A;  1BR1 A;  3I5Q A;  2LFF A;  1EA8 A;  4WAB A;  4WGY A;  2NUT B;  3MBG A;  3ZG1 A;  5F5F A;  5A6B D;  3LUT B;  4JTD B;  5KYU A;  1T6I A;  1MMD A;  1M56 C;  3JTL O;  1QZX A;  1F1M A;  3SXZ A;  4BEM J;  2QNL A;  1MMA A;  3V5X A;  3B0P A;  3GM1 A;  3OWT A;  3POV A;  1Q0M A;  1RCP A;  2BL2 A;  2ZXP A;  3U3B A;  3L34 A;  3JZ0 A;  4LDR A;  1Z6A A;  2OEX A;  3EGD A;  4P6I C;  2HSQ A;  4O6Y A;  2OJQ A;  1MQV A;  2Q9B A;  2A1D D;  3KYJ A;  1V74 B;  1Y4C A;  3AGT A;  3MX3 A;  4XEF A;  3S28 A;  4CDV A;  4BJ5 A;  3SXK A;  3DWW A;  2V26 A;  3EH1 A;  3GWN A;  1OW6 A;  3QW1 A;  4MW8 A;  4D4X A;  5IY5 C;  2R7T A;  1YYX A;  2D5R B;  2YLD A;  2L81 A;  3QTH A;  4DXW A;  5B1B C;  3U0C A;  1NU9 C;  1RJ9 B;  2J0W A;  2PF4 E;  3H2U A;  3VAY A;  3E9V A;  3T4R A;  4MVO A;  2J45 A;  5L0J A;  1ZHY A;  1MMG A;  256B A;  3HNK A;  4DVY P;  1Q0G A;  5BQH A;  3SXY A;  5HV9 A;  3SP1 A;  2W9Y A;  2G3V A;  3N0T A;  2ICW G;  3WOD F;  1BBH A;  4XTK A;  2J9B A;  4XLN F;  4A2N B;  1EI7 A;  1YA7 O;  2DI3 A;  2OJE D;  5EK0 A;  3TQO A;  5E3C A;  3PMR A;  2OG2 A;  3FDQ A;  1ZYR F;  3L8J A;  4EBB A;  3GOD A;  4Q7C A;  4I3M A;  5JRA A;  1MND A;  2L6H A;  1OR3 A;  2NUT A;  3UMH A;  4LLE A;  4AE4 B;  1S7Z A;  1V55 C;  3ZC4 A;  1XWJ A;  4PJL A;  3U3F A;  1M2V B;  3ZQY A;  4MVR A;  1HW1 A;  3M4B A;  1T5O A;  2J46 A;  2R7X A;  2KGO A;  3RW0 A;  2OEV A;  2WVO A;  1HE9 A;  3ECS A;  2EIN C;  1M6T A;  2ASR A;  4N06 A;  4RDA A;  3CQZ A;  2J7P A;  4CIP A;  3S90 A;  1VTM P;  3U8V A;  4A4A A;  2XLM A;  4Q5S F;  1S05 A;  3PCV A;  3R7C A;  4CDY A;  1OW7 A;  1ST6 A;  3JRT A;  3Q7L A;  3TJ6 A;  4BG0 A;  2XL8 A;  3GEH A;  1DOV A;  4MTO A;  3V5Y A;  3LJB A;  4E0H A;  1HE1 A;  3ZTZ A;  1YDI A;  2GWW A;  3DE9 A;  5T3W A;  3TOL A;  4LAC B;  2Z15 A;  1RJ9 A;  2X0C A;  1VLT A;  4MW3 A;  1OCO C;  2Q9A A;  3J06 A;  1LKX A;  3RYL A;  2J7P D;  1RMV A;  4Z9H A;  4WJ0 A;  3W4Y A;  1WWP A;  1ZHX A;  2V3C C;  2HKV A;  1JR8 A;  3GOR A;  5JLI A;  2DYS C;  1JMW A;  5E2Q A;  1H7I A;  3AG1 C;  4NQF A;  4PJN A;  1PD1 A;  3B71 A;  1AVO B;  4JC7 A;  4AL0 A;  2IM8 A;  3GWL A;  4PR9 A;  1VYK A;  3ZTM A;  2R03 A;  3JCU Q;  2XS8 A;  3EH2 A;  3IEE A;  1HMO A;  1LPE A;  1K04 A;  2I15 A;  5KYW B;  1WAT A;  2QUP A;  2WZG A;  3DM5 A;  3IQT A;  4PJM A;  2J9W A;  1OR2 A;  4JVS A;  2EPK X;  5BQG A;  3PDM P;  2KYH A;  1YZC A;  2VAS A;  1ORJ A;  5JUA A;  4E17 A;  1KU2 A;  3GEI A;  4M63 A;  3UNG C;  2H8A A;  3B29 A;  4IGG A;  2KSF A;  1T9K A;  4PFP A;  4BJ5 C;  4LDQ A;  2EPO A;  2IXN A;  2HV6 A;  3EFO B;  2R7S A;  3TUL A;  2XS1 A;  3R2P A;  3LNM B;  1Z5Z A;  2VB6 A;  1NU7 D;  2HUJ A;  3S29 A;  1LVK A;  1EKY A;  2ZD9 A;  2Y3D A;  1O87 A;  3K33 A;  2HV7 A;  4KBL A;  4PJJ A;  3RVZ A;  2Q00 A;  4EKW A;  3AQC A;  1YAU O;  3BEH A;  1QVX A;  5B3I A;  3K1H A;  1GM5 A;  3C8G B;  2WVN A;  2MYS A;  3EJN A;  4XWJ A;  3F47 A;  3X2Q C;  2KC3 A;  4CS7 A;  1T6Q A;  3ABM C;  4K1O A;  2JX0 A;  3DD7 A;  2TMV P;  4YT2 A;  1UG7 A;  2RSE B;  3G4X A;  2LQG A;  4G78 A;  1WN0 A;  2MWQ A;  4J32 B;  4Q4Z F;  2R7O A;  2EPM X;  4CDA A; 
#chains in the Genus database with same CATH homology
 3DKA A;  5COM A;  2OU6 A;  2OQM A;  2YQY A;  2F22 A;  5COG A;  3DI5 A;  3QTH A;  2HKV A;  3GOR A;  2NSF A;  2RD9 A;  4N6C A;  2QNL A;  2NSG A;  5CIV A;  1RXQ A;  2P1A A;  3CEX A;  5COF A;  2QE9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...