3B29A

Human leukotriene c4 synthase in complex with dodecyl-beta-d-selenomaltoside
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
142
structure length
142
Chain Sequence
KDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Leukotriene C4 synthase
publication title Seleno-detergent MAD phasing of leukotriene C4 synthase in complex with dodecyl-beta-D-selenomaltoside
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 55
structure length 142
sequence length 142
ec nomenclature ec 4.4.1.20: Leukotriene-C(4) synthase.
pdb deposition date 2011-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 3b29A00
4YL1A 2UUIA 2UUHA 3LEOA 4NTAA 4AL1A 5BQIA 3B29A 4JC7A 5BQGA 4AL0A 2PNOA 5K0IA 4JCZA 4J7YA 4NTBA 3DWWA 5HV9A 4NTFA 4JRZA 4YK5A 4BPMA 5BQHA 3PCVA 2H8AA 4YL3A 2Q7RA 4WABA 4YL0A 4J7TA 3HKKA
chains in the Genus database with same CATH superfamily
4GQHA 1AVOB 2AVKA 4EUKB 4ZLCA 2H7VC 3NYMA 3DZAA 2Q9BA 1LE2A 3N24A 4P9FA 4G0HA 4MVOA 4MVZA 4BJ1A 2A0UA 3SNHA 4ONSA 4DJ9A 2IYLD 2GWWA 2LIGA 3JRMO 3ZQVA 2XLOA 4KC9A 5JS5A 1C03A 4PACA 4BJ5A 1WATA 1VMAA 3C8GA 1EA8A 1NFNA 2Y3DA 4OIPF 5CIVA 2IBFA 2R7UA 4LDKA 3JTLO 1Z3IX 2G3VA 3IQ6A 1J8MF 1NU7D 3S27A 3GODA 5BQHA 1Q0KA 2QLAA 2XXAA 4N6HA 1O5HA 2ETSA 1WTYA 4KBLA 5KYYB 3UMIA 3NRHA 1LVKA 1M6TA 3HLZA 3SEOA 2NUTB 2HSQA 2A1DD 3SXKA 2NSFA 4K1OA 3B0PA 5A6BD 4RDAA 4CIPA 1A7EA 3EZIA 4E18A 1HY5A 3KMIA 2PP4A 2WVOA 3FAJA 3TOMA 3M1CB 1E85A 1YYXA 1PCXA 4J32B 2QY9A 4MTFA 5D91A 5K0IA 1FFHA 4F4BA 1Z5ZA 1A7DA 2H7BA 1HE1A 1B68A 1K40A 1LIHA 2KSFA 3NKEA 4NTBA 3AG2C 3ASNC 2B0HA 4MW3A 4CS8C 5HV9A 1ZZPA 4JKVA 2P1AA 4E17A 3NDBB 3ZTZA 3ECSA 1TQGA 3FXHA 4DVZA 4FAPB 4LERA 4I1MA 3LESA 4DOZA 4QI2A 4LACB 3RVZA 2YL1A 2A6EF 1YZAA 5KYUA 4UDVA 2NSGA 4Q5SF 2Q4FA 3LS0A 3M4BA 5CI8A 2XL8A 2J9WA 1C02A 5F5HA 2R03A 3U9JA 1L7CA 4EBJA 1F1MA 2IOQA 3JZ0A 2YL0A 1VOMA 2DB4A 4JTAB 2YHSA 3GM1A 1W2WA 4XLNF 2O9XA 1BR2A 3LEVA 1K05A 1QVXA 2J0XA 3B29A 3QW0A 4L6RA 5FZTA 3T6BA 3JYYA 3B0UX 1TKNA 1L3PA 1V54C 2M4EA 4A4AA 3HNKA 5A6AA 1VK5A 3GANA 3KPHA 2H7OA 4K7BA 4LLCA 1J8YF 2XLMA 3DKAA 3G4ZA 4E7ZA 1ZHXA 2CCYA 4OIOF 3K66A 4ANJA 2DI3A 4CBEA 3BRJA 2Y69C 3NMKA 5F28E 2LFDA 4W8PA 2WVNA 4U5FE 4IWBA 4O79A 5AC4A 2LP4A 2V3CC 3JSEO 1QKRA 2F22A 4JE9A 4JCHA 1UG7A 1YARO 2R7VA 1KTMA 3S84A 4NCQA 1OKKA 3U5SA 4D4XA 3RF3A 1YLMA 2EPLX 4EBBA 1OW6A 4KI2A 1M2VB 3S29A 2LQGA 4G7HF 2XM4A 4PJLA 5D92A 4CS8A 2HJ3A 3NMJA 4FWVA 4PFPA 4BJTA 1H9TA 1OCCC 3DI5A 3FAPB 1I4YA 3EG9A 3F46A 3ZWIA 5JUAA 4CJGA 3CZ6A 1BR1A 3DJUB 4XPWA 4U5CE 3RYLA 4E0IA 1XZPA 3WAQA 1HMDA 3ABLC 5COGA 3H2VA 2ZXPA 1LS4A 2J9BA 3M15A 1ZU4A 1Z23A 2KGOA 2Q3TA 4LLEA 4BPMA 1FMWA 4JVSA 2BL2A 3FOPA 1RXQA 5E3CA 1S05A 4U9EA 4G7ZF 4XWJA 1TWHA 4IAQA 1TWGA 2XLWA 4CIHA 3MLGA 3I4UA 2YVKA 4C7OA 2C04A 4PFOA 3R2PA 5T1DB 2OEXA 5L0FA 1CGME 1LKXA 2YZSA 2DYRC 2KQ9A 5HSWA 2R7QA 2EPOA 3IHUA 2HUJA 2W45A 2ZXWC 2R05A 1RKEB 2FFHA 3TK0A 5JP7A 1KNYA 1LE4A 2GFHA 2HS5A 3AG4C 3HTKC 2NUPB 3U8VA 2KK1A 1KU2A 3GM3A 1VLSA 4HE8D 3T6JA 4NTFA 5E33A 3CAXA 4H54A 3UMKA 3W4YA 5T3WA 1FFTC 2BE5F 2C03A 2X51A 3RQFA 4FX5A 2E87A 3SP1A 4FESA 4AE4A 2CGEA 4E7SA 2LK4A 1AEPA 2OKUA 3IQ5A 3HNLA 4GYTA 1FTSA 1MMAA 1WOLA 3ITFA 1OXBA 1FMVA 3UNGC 1SF8A 1OW8A 3K7DA 4D4NA 4DXWA 3L34A 3QMKA 3T6GB 3UR3C 3E70C 1TR2A 1OXKA 1YA9A 3QZCA 4DBQA 1K04A 1G4WR 4PK4A 3FMSA 2YEVA 2XSEA 3A11A 3FOOA 3U2MA 4IJJA 4BJ6C 1H6GA 4M63A 2IXPA 5BQGA 2EIKC 1EKYA 4OIRF 1CGOA 2EPNA 3NYJA 3EGXB 3V5XA 1JR8A 2KJGA 1JMWA 1T6IA 3U8PA 2J7PA 3ASOC 1R4TA 2GA0A 2QNLA 3L8JA 3B71A 3BEHA 2NPUA 1FAPB 2PX0A 2ZPAA 3IPMO 1WASA 4XPXA 2XRHA 3LNMB 1E86A 4I3MA 3U2LA 3TULA 3S90A 1OQCA 4O6NA 1ST6A 1QLEC 1ZHYA 2VCAA 1SR2A 1BBHA 1Z6AA 4BG0A 5B3IA 2XLHA 2AU5A 4JJGA 1IW7F 2LSEA 3AQBA 4XQ1A 1G4US 2IM8A 5JRAA 1FR0A 3LUTB 3DE8A 3US6A 4C3BA 4CDVA 2L6GA 1V4AA 3IQTA 4WJ0A 3HJCA 3A9CA 1JPNA 2P6VA 3GWNA 3JYHA 3VYWA 3K6BA 2Y39A 2YL3A 2Y3GA 5EK0A 3J06A 2KYHA 4XEVA 3L1MA 4DVYP 2I15A 3F47A 4QDLA 1OW7A 3G50A 1NZEA 1RCPA 2P61A 3EJNA 4OD5A 5T3TA 4EHPA 3NG1A 5KYYA 1APCA 2WVQA 2NUTA 1D0XA 1ZYRF 3EQLF 5B1BC 2KW3C 4BJ6A 1NU9C 4NQFA 4ULWA 3B9QA 4CDYA 2IXMA 3NKDA 4NC3A 1DOVA 4G7OF 1G8XA 1T5OA 3K1IC 4U5BE 1ZW3A 4BEJA 2DGJA 3Q6MA 3EHMA 2HMQA 4AL0A 4EWCA 1NBBA 3PDMP 1IZMA 1XZQA 4U5HA 3C63A 4CS9C 5EHHA 2R7TA 3VM6A 3AG1C 3WODF 3ZC4A 3DM5A 2J8WA 3KYIA 1LPEA 1MMDA 3DM9B 4HFKB 5DVWA 4DRIB 5A6KA 1CGNA 3ABKC 3GWLA 3JCUQ 2H8AA 3RIPA 3B0VC 1OR2A 3SYNA 3HKKA 2JX0A 2AP3A 1JOGA 1HMOA 2XS1A 4PJMA 1HW2A 1OCZC 2EILC 1YAUO 5L0HA 4YN0B 1H7IA 5E3AA 2XLDA 3JRTA 2XS8A 4NTAA 4WGYA 3H65A 1RJ9B 2WZFA 3EGDB 3SXZA 1T01A 5DS4A 4Q4ZF 4JTCB 3EG9B 4U5EE 1CPQA 5A6JA 2FAPB 4JCZA 1NFOA 2XLEA 1TWAA 3W8HA 3DJNB 1M2OA 1UFBA 2W4BA 1JRAA 1ZHZA 2PF4E 4OINF 4C3EA 3KKBA 5KYXB 1E83A 1MMNA 4ZLDA 1ORJA 4C3DA 1ORSC 4I1OB 4WGZA 3AOUA 3FHDA 4U9DA 5AGFA 3C8GD 4ULVA 2EPKX 2J7PD 2YKZA 3X2QC 1EI7A 1YJGA 2A0BA 3K1IA 5AC5A 4WABA 5A69A 5L0IA 2AWYA 5L0JA 3PHF2 3M4CA 4C7OB 4CS9A 3DMDA 3GM2A 2HKVA 3DXJF 5IY5C 3AGUA 4CDAA 5BQIA 4Z9JA 1NG1A 3UMHA 1QQ3A 3KL4A 1Q0DA 1TWCA 3EFOB 3R7CA 4B6IA 5EGYA 4IAOA 4KNWA 3OEOA 1BR4A 1D1BA 2A69F 2L81A 1ZU5A 3RKOF 1I5NA 1GS9A 3AJMA 1HE9A 4GEHA 3V5ZA 1YZCA 3ABMC 4CJOA 1OCRC 1O87A 5L3QA 5F5FA 2CNWA 256BA 2OEVA 2PX3A 1U6HA 1U89A 2OG2A 5COFA 5DLJA 2MWQA 3DAGA 4YT2A 4W8KA 4YL3A 2WZLA 2XM0A 4YL0A 3U9MA 1GM5A 3G4XA 2R7OA 1LI7A 4YL1A 1D1AA 3EPVA 2MHRA 3ATPA 1ZW2A 3W2WA 5JVEA 3O10A 4HEAJ 1QZXA 1D0ZA 1OCOC 3QW1A 4IRUA 4KNVA 4RBNA 2IXNA 4N06A 5TJ5E 4H4KC 3LNRA 4PJJA 4XEKA 3TOLA 4AL1A 5B3SC 4U5GA 2HV7A 3QTHA 2A68F 5DS5A 4G78A 3TD7A 4MTOA 1Q0MA 1RKEA 5DS6A 1RMVA 3RQEA 3TQOA 2NUPA 1A0BA 1T6UA 2V26A 2J0WA 2VB6A 3C62A 2B0JA 3TJ6A 2QTVA 3C8GB 3LLKA 4N4WA 3S28A 5GPGB 2R02A 2AWCA 1TFOB 4YK5A 1GQAA 3GORA 3U3BA 4O7GA 5KYWA 2QUPA 2VCCA 2A6HF 2EPMX 2XXAB 2P7VA 2OCCC 4E0HA 1NLXA 2WB7A 1V74B 2ZD9A 3ZSUA 5L3VA 3EH2A 4J7TA 1U0BB 3RH3A 2Y3HA 3OWTA 2L6FA 4MTGA 5L0GA 1Y4CA 3EZHA 2R7RA 3ZVRA 3T4RA 1WN0A 1JAFA 4MQ9F 3LAYA 2RD9A 2ICWG 3NYLA 4MS2A 4Z9HA 4ER9A 4JZAA 1VB5A 5JLIA 4AK9A 2CW0F 3OA1A 1OKKD 2ASRA 4P6IC 3H2UA 2W9YA 5BUOA 5KYXA 5L0DA 4BEMJ 1YA7O 1T6QA 2LCHA 3EGXA 2CDQA 2OU6A 3IEEA 3RVYA 3WG7C 2KNHA 3ZQYA 3TJ5A 4J7YA 2ZXOA 1LM3B 1YYJA 2LD6A 3JT1A 3RQGA 4EBKA 3UGOA 3MX3A 1VTMP 3C8ZA 3V7OA 3V5YA 2M64A 2XL4A 2J45A 2HMZA 3K33A 3GEIA 4JTDB 2HSBA 3U3FA 1D0YA 4OD4A 5KYUB 1YVIA 4EIYA 5KYNA 2DYSC 3I5QA 4O6MA 1HW1A 1JPJA 3WHNA 4MW8A 2UUIA 4YT5A 1PD1A 2PBEA 4K0DA 3L8IA 3N2ZB 4DBRA 2YL7A 5JT4A 2D5RB 1T9KA 2OJQA 5DQZA 2WL8A 5FCLA 2TMVP 4JEAA 2PNOA 2J9UA 5E2QA 2JD3A 3VRCA 4IGGA 1O3UA 4MVRA 3KH2A 1MNEA 2YLDA 4MVSA 1LS1A 2R25A 4R32A 3GEHA 2W4MA 2WZGA 4CSAC 4OIQF 4JRZA 3SXYA 3MBGA 4JJFA 5COMA 4X0RA 1Z7Qc 3W8IA 3RW0A 2JPUA 3K1HA 2CNWD 4LDRA 3ZDLA 3AQCA 3EH1A 2LFFA 1SYQA 1ZHTA 3ZG1A 2J9VA 2Q9AA 4XTKA 5CI9A 3HNIA 2YQYA 2FGYA 3KYJA 1Y6DA 3AGTA 4YJWA 4A2NB 2QE9A 3CQZA 3LEOA 1M56C 3DAFA 3O6XA 4Q7CA 1H9GA 1QPUA 2P0NA 4J30B 2R7WA 3POVA 1WGWA 3AG3C 3GEEA 1VYIA 3LLIA 3CEXA 4YT4A 1C17M 4XLPF 1DOWA 1MNDA 3FVYA 2D4UA 1BDJB 1S7ZA 3O55A 4XPYA 3MYFA 2HV6A 1M57C 2MYSA 3T9OA 2YLIA 3DE9A 3FDQA 2KC3A 3I5PA 2OQMA 2GDCA 4MVMA 1A41A 3M79A 4CS7A 4RD9A 5A6BA 1D1CA 4JIOA 4NY3A 3JSZA 4QI0A 3S9OA 4YT8A 2Q7RA 2IXOA 3UGPA 1Q0GA 1ZHWA 2R9RB 2OJED 4CX9A 2YWAA 4N6CA 3X1OA 3EHNA 4HFFB 1M2VA 2I8BA 4MNDA 4EKWA 3Q6NA 1RJ9A 3HNJA 1N1CA 4DRHB 2Y3BA 3EGDA 1GGQA 2EIMC 2GAQA 3CSKA 4CSAA 2HFIA 2VASA 2R7SA 2ZXRA 1YDIA 1LI5A 3RFYA 2XLVA 3C7JA 4JEBA 5L0CA 3ZTMA 2Q00A 2J46A 2L7AA 3IQCA 4DRJB 4YWQA 1R5ID 2L9JA 4MVQA 3SZRA 4PJNA 4PR9A 2Q9CA 3E9VA 1I4ZA 2YLGA 3S0XA 3PCVA 1SZIA 2EIJC 4BJ5C 2VH3A 2VCBA 2OOCA 1E84A 1V55C 2HZ8A 3Q7GA 3MFNA 1Z63A 1QSPA 1OR3A 2EINC 3PMRA 3SXMA 1EQ1A 1TFKB 4AE4B 2UUHA 2R7XA 2YRFA 4MVUA 3QVZA 1A7VA 1VLTA 4Z9IA 4JW1A 2L6HA 4XEFA 2XL6A 3VF0A 1PV3A 3EFOA 5JSLA 2X0CA 2VC9A 2G3KA 2G62A 1CPRA 2CYDA 3DD7A 4JC7A 1RKCA 3LS1A 1ORYA 1E2XA 3W2VA 3MYIA 4AX2A 3O39A 3U0CA 2NG1A 1NSGB 3ZIBA 3N0TA 3Q7LA 5DQTA 3C18A 2BC5A 1XWJA 1G5ZA 1MQVA 2Z15A 3DWWA 3QVYA 4IARA 3VAYA 3NMIA 1MMGA 2HJMA 3LJBA 5B1AC 4LDQA 1AUEA 4JURI 2PFDA 1PD0A 5KYWB 4U5DE 1Q0FA 3L0IA 4I44A 1ZVZA 4O6YA 1WWPA 2RSEB 1FNTc 1VYKA 1SMYF 1BZ4A 4IB4A 4P9TA
chains in the Genus database with same CATH topology
4YL1A 2UUIA 2UUHA 3LEOA 4NTAA 4AL1A 5BQIA 3B29A 4JC7A 5BQGA 4AL0A 2PNOA 5K0IA 4JCZA 4J7YA 4NTBA 3DWWA 5HV9A 4NTFA 4JRZA 4YK5A 4BPMA 5BQHA 3PCVA 2H8AA 4YL3A 2Q7RA 4WABA 4YL0A 4J7TA 3HKKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YL1 A;  2UUI A;  2UUH A;  3LEO A;  4NTA A;  4AL1 A;  5BQI A;  3B29 A;  4JC7 A;  5BQG A;  4AL0 A;  2PNO A;  5K0I A;  4JCZ A;  4J7Y A;  4NTB A;  3DWW A;  5HV9 A;  4NTF A;  4JRZ A;  4YK5 A;  4BPM A;  5BQH A;  3PCV A;  2H8A A;  4YL3 A;  2Q7R A;  4WAB A;  4YL0 A;  4J7T A;  3HKK A; 
#chains in the Genus database with same CATH topology
 4GQH A;  1AVO B;  2AVK A;  4EUK B;  4ZLC A;  2H7V C;  3NYM A;  3DZA A;  2Q9B A;  1LE2 A;  3N24 A;  4P9F A;  4G0H A;  4MVO A;  4MVZ A;  4BJ1 A;  2A0U A;  3SNH A;  4ONS A;  4DJ9 A;  2IYL D;  2GWW A;  2LIG A;  3JRM O;  3ZQV A;  2XLO A;  4KC9 A;  5JS5 A;  1C03 A;  4PAC A;  4BJ5 A;  1WAT A;  1VMA A;  3C8G A;  1EA8 A;  1NFN A;  2Y3D A;  4OIP F;  5CIV A;  2IBF A;  2R7U A;  4LDK A;  3JTL O;  1Z3I X;  2G3V A;  3IQ6 A;  1J8M F;  1NU7 D;  3S27 A;  3GOD A;  5BQH A;  1Q0K A;  2QLA A;  2XXA A;  4N6H A;  1O5H A;  2ETS A;  1WTY A;  4KBL A;  5KYY B;  3UMI A;  3NRH A;  1LVK A;  1M6T A;  3HLZ A;  3SEO A;  2NUT B;  2HSQ A;  2A1D D;  3SXK A;  2NSF A;  4K1O A;  3B0P A;  5A6B D;  4RDA A;  4CIP A;  1A7E A;  3EZI A;  4E18 A;  1HY5 A;  3KMI A;  2PP4 A;  2WVO A;  3FAJ A;  3TOM A;  3M1C B;  1E85 A;  1YYX A;  1PCX A;  4J32 B;  2QY9 A;  4MTF A;  5D91 A;  5K0I A;  1FFH A;  4F4B A;  1Z5Z A;  1A7D A;  2H7B A;  1HE1 A;  1B68 A;  1K40 A;  1LIH A;  2KSF A;  3NKE A;  4NTB A;  3AG2 C;  3ASN C;  2B0H A;  4MW3 A;  4CS8 C;  5HV9 A;  1ZZP A;  4JKV A;  2P1A A;  4E17 A;  3NDB B;  3ZTZ A;  3ECS A;  1TQG A;  3FXH A;  4DVZ A;  4FAP B;  4LER A;  4I1M A;  3LES A;  4DOZ A;  4QI2 A;  4LAC B;  3RVZ A;  2YL1 A;  2A6E F;  1YZA A;  5KYU A;  4UDV A;  2NSG A;  4Q5S F;  2Q4F A;  3LS0 A;  3M4B A;  5CI8 A;  2XL8 A;  2J9W A;  1C02 A;  5F5H A;  2R03 A;  3U9J A;  1L7C A;  4EBJ A;  1F1M A;  2IOQ A;  3JZ0 A;  2YL0 A;  1VOM A;  2DB4 A;  4JTA B;  2YHS A;  3GM1 A;  1W2W A;  4XLN F;  2O9X A;  1BR2 A;  3LEV A;  1K05 A;  1QVX A;  2J0X A;  3B29 A;  3QW0 A;  4L6R A;  5FZT A;  3T6B A;  3JYY A;  3B0U X;  1TKN A;  1L3P A;  1V54 C;  2M4E A;  4A4A A;  3HNK A;  5A6A A;  1VK5 A;  3GAN A;  3KPH A;  2H7O A;  4K7B A;  4LLC A;  1J8Y F;  2XLM A;  3DKA A;  3G4Z A;  4E7Z A;  1ZHX A;  2CCY A;  4OIO F;  3K66 A;  4ANJ A;  2DI3 A;  4CBE A;  3BRJ A;  2Y69 C;  3NMK A;  5F28 E;  2LFD A;  4W8P A;  2WVN A;  4U5F E;  4IWB A;  4O79 A;  5AC4 A;  2LP4 A;  2V3C C;  3JSE O;  1QKR A;  2F22 A;  4JE9 A;  4JCH A;  1UG7 A;  1YAR O;  2R7V A;  1KTM A;  3S84 A;  4NCQ A;  1OKK A;  3U5S A;  4D4X A;  3RF3 A;  1YLM A;  2EPL X;  4EBB A;  1OW6 A;  4KI2 A;  1M2V B;  3S29 A;  2LQG A;  4G7H F;  2XM4 A;  4PJL A;  5D92 A;  4CS8 A;  2HJ3 A;  3NMJ A;  4FWV A;  4PFP A;  4BJT A;  1H9T A;  1OCC C;  3DI5 A;  3FAP B;  1I4Y A;  3EG9 A;  3F46 A;  3ZWI A;  5JUA A;  4CJG A;  3CZ6 A;  1BR1 A;  3DJU B;  4XPW A;  4U5C E;  3RYL A;  4E0I A;  1XZP A;  3WAQ A;  1HMD A;  3ABL C;  5COG A;  3H2V A;  2ZXP A;  1LS4 A;  2J9B A;  3M15 A;  1ZU4 A;  1Z23 A;  2KGO A;  2Q3T A;  4LLE A;  4BPM A;  1FMW A;  4JVS A;  2BL2 A;  3FOP A;  1RXQ A;  5E3C A;  1S05 A;  4U9E A;  4G7Z F;  4XWJ A;  1TWH A;  4IAQ A;  1TWG A;  2XLW A;  4CIH A;  3MLG A;  3I4U A;  2YVK A;  4C7O A;  2C04 A;  4PFO A;  3R2P A;  5T1D B;  2OEX A;  5L0F A;  1CGM E;  1LKX A;  2YZS A;  2DYR C;  2KQ9 A;  5HSW A;  2R7Q A;  2EPO A;  3IHU A;  2HUJ A;  2W45 A;  2ZXW C;  2R05 A;  1RKE B;  2FFH A;  3TK0 A;  5JP7 A;  1KNY A;  1LE4 A;  2GFH A;  2HS5 A;  3AG4 C;  3HTK C;  2NUP B;  3U8V A;  2KK1 A;  1KU2 A;  3GM3 A;  1VLS A;  4HE8 D;  3T6J A;  4NTF A;  5E33 A;  3CAX A;  4H54 A;  3UMK A;  3W4Y A;  5T3W A;  1FFT C;  2BE5 F;  2C03 A;  2X51 A;  3RQF A;  4FX5 A;  2E87 A;  3SP1 A;  4FES A;  4AE4 A;  2CGE A;  4E7S A;  2LK4 A;  1AEP A;  2OKU A;  3IQ5 A;  3HNL A;  4GYT A;  1FTS A;  1MMA A;  1WOL A;  3ITF A;  1OXB A;  1FMV A;  3UNG C;  1SF8 A;  1OW8 A;  3K7D A;  4D4N A;  4DXW A;  3L34 A;  3QMK A;  3T6G B;  3UR3 C;  3E70 C;  1TR2 A;  1OXK A;  1YA9 A;  3QZC A;  4DBQ A;  1K04 A;  1G4W R;  4PK4 A;  3FMS A;  2YEV A;  2XSE A;  3A11 A;  3FOO A;  3U2M A;  4IJJ A;  4BJ6 C;  1H6G A;  4M63 A;  2IXP A;  5BQG A;  2EIK C;  1EKY A;  4OIR F;  1CGO A;  2EPN A;  3NYJ A;  3EGX B;  3V5X A;  1JR8 A;  2KJG A;  1JMW A;  1T6I A;  3U8P A;  2J7P A;  3ASO C;  1R4T A;  2GA0 A;  2QNL A;  3L8J A;  3B71 A;  3BEH A;  2NPU A;  1FAP B;  2PX0 A;  2ZPA A;  3IPM O;  1WAS A;  4XPX A;  2XRH A;  3LNM B;  1E86 A;  4I3M A;  3U2L A;  3TUL A;  3S90 A;  1OQC A;  4O6N A;  1ST6 A;  1QLE C;  1ZHY A;  2VCA A;  1SR2 A;  1BBH A;  1Z6A A;  4BG0 A;  5B3I A;  2XLH A;  2AU5 A;  4JJG A;  1IW7 F;  2LSE A;  3AQB A;  4XQ1 A;  1G4U S;  2IM8 A;  5JRA A;  1FR0 A;  3LUT B;  3DE8 A;  3US6 A;  4C3B A;  4CDV A;  2L6G A;  1V4A A;  3IQT A;  4WJ0 A;  3HJC A;  3A9C A;  1JPN A;  2P6V A;  3GWN A;  3JYH A;  3VYW A;  3K6B A;  2Y39 A;  2YL3 A;  2Y3G A;  5EK0 A;  3J06 A;  2KYH A;  4XEV A;  3L1M A;  4DVY P;  2I15 A;  3F47 A;  4QDL A;  1OW7 A;  3G50 A;  1NZE A;  1RCP A;  2P61 A;  3EJN A;  4OD5 A;  5T3T A;  4EHP A;  3NG1 A;  5KYY A;  1APC A;  2WVQ A;  2NUT A;  1D0X A;  1ZYR F;  3EQL F;  5B1B C;  2KW3 C;  4BJ6 A;  1NU9 C;  4NQF A;  4ULW A;  3B9Q A;  4CDY A;  2IXM A;  3NKD A;  4NC3 A;  1DOV A;  4G7O F;  1G8X A;  1T5O A;  3K1I C;  4U5B E;  1ZW3 A;  4BEJ A;  2DGJ A;  3Q6M A;  3EHM A;  2HMQ A;  4AL0 A;  4EWC A;  1NBB A;  3PDM P;  1IZM A;  1XZQ A;  4U5H A;  3C63 A;  4CS9 C;  5EHH A;  2R7T A;  3VM6 A;  3AG1 C;  3WOD F;  3ZC4 A;  3DM5 A;  2J8W A;  3KYI A;  1LPE A;  1MMD A;  3DM9 B;  4HFK B;  5DVW A;  4DRI B;  5A6K A;  1CGN A;  3ABK C;  3GWL A;  3JCU Q;  2H8A A;  3RIP A;  3B0V C;  1OR2 A;  3SYN A;  3HKK A;  2JX0 A;  2AP3 A;  1JOG A;  1HMO A;  2XS1 A;  4PJM A;  1HW2 A;  1OCZ C;  2EIL C;  1YAU O;  5L0H A;  4YN0 B;  1H7I A;  5E3A A;  2XLD A;  3JRT A;  2XS8 A;  4NTA A;  4WGY A;  3H65 A;  1RJ9 B;  2WZF A;  3EGD B;  3SXZ A;  1T01 A;  5DS4 A;  4Q4Z F;  4JTC B;  3EG9 B;  4U5E E;  1CPQ A;  5A6J A;  2FAP B;  4JCZ A;  1NFO A;  2XLE A;  1TWA A;  3W8H A;  3DJN B;  1M2O A;  1UFB A;  2W4B A;  1JRA A;  1ZHZ A;  2PF4 E;  4OIN F;  4C3E A;  3KKB A;  5KYX B;  1E83 A;  1MMN A;  4ZLD A;  1ORJ A;  4C3D A;  1ORS C;  4I1O B;  4WGZ A;  3AOU A;  3FHD A;  4U9D A;  5AGF A;  3C8G D;  4ULV A;  2EPK X;  2J7P D;  2YKZ A;  3X2Q C;  1EI7 A;  1YJG A;  2A0B A;  3K1I A;  5AC5 A;  4WAB A;  5A69 A;  5L0I A;  2AWY A;  5L0J A;  3PHF 2;  3M4C A;  4C7O B;  4CS9 A;  3DMD A;  3GM2 A;  2HKV A;  3DXJ F;  5IY5 C;  3AGU A;  4CDA A;  5BQI A;  4Z9J A;  1NG1 A;  3UMH A;  1QQ3 A;  3KL4 A;  1Q0D A;  1TWC A;  3EFO B;  3R7C A;  4B6I A;  5EGY A;  4IAO A;  4KNW A;  3OEO A;  1BR4 A;  1D1B A;  2A69 F;  2L81 A;  1ZU5 A;  3RKO F;  1I5N A;  1GS9 A;  3AJM A;  1HE9 A;  4GEH A;  3V5Z A;  1YZC A;  3ABM C;  4CJO A;  1OCR C;  1O87 A;  5L3Q A;  5F5F A;  2CNW A;  256B A;  2OEV A;  2PX3 A;  1U6H A;  1U89 A;  2OG2 A;  5COF A;  5DLJ A;  2MWQ A;  3DAG A;  4YT2 A;  4W8K A;  4YL3 A;  2WZL A;  2XM0 A;  4YL0 A;  3U9M A;  1GM5 A;  3G4X A;  2R7O A;  1LI7 A;  4YL1 A;  1D1A A;  3EPV A;  2MHR A;  3ATP A;  1ZW2 A;  3W2W A;  5JVE A;  3O10 A;  4HEA J;  1QZX A;  1D0Z A;  1OCO C;  3QW1 A;  4IRU A;  4KNV A;  4RBN A;  2IXN A;  4N06 A;  5TJ5 E;  4H4K C;  3LNR A;  4PJJ A;  4XEK A;  3TOL A;  4AL1 A;  5B3S C;  4U5G A;  2HV7 A;  3QTH A;  2A68 F;  5DS5 A;  4G78 A;  3TD7 A;  4MTO A;  1Q0M A;  1RKE A;  5DS6 A;  1RMV A;  3RQE A;  3TQO A;  2NUP A;  1A0B A;  1T6U A;  2V26 A;  2J0W A;  2VB6 A;  3C62 A;  2B0J A;  3TJ6 A;  2QTV A;  3C8G B;  3LLK A;  4N4W A;  3S28 A;  5GPG B;  2R02 A;  2AWC A;  1TFO B;  4YK5 A;  1GQA A;  3GOR A;  3U3B A;  4O7G A;  5KYW A;  2QUP A;  2VCC A;  2A6H F;  2EPM X;  2XXA B;  2P7V A;  2OCC C;  4E0H A;  1NLX A;  2WB7 A;  1V74 B;  2ZD9 A;  3ZSU A;  5L3V A;  3EH2 A;  4J7T A;  1U0B B;  3RH3 A;  2Y3H A;  3OWT A;  2L6F A;  4MTG A;  5L0G A;  1Y4C A;  3EZH A;  2R7R A;  3ZVR A;  3T4R A;  1WN0 A;  1JAF A;  4MQ9 F;  3LAY A;  2RD9 A;  2ICW G;  3NYL A;  4MS2 A;  4Z9H A;  4ER9 A;  4JZA A;  1VB5 A;  5JLI A;  4AK9 A;  2CW0 F;  3OA1 A;  1OKK D;  2ASR A;  4P6I C;  3H2U A;  2W9Y A;  5BUO A;  5KYX A;  5L0D A;  4BEM J;  1YA7 O;  1T6Q A;  2LCH A;  3EGX A;  2CDQ A;  2OU6 A;  3IEE A;  3RVY A;  3WG7 C;  2KNH A;  3ZQY A;  3TJ5 A;  4J7Y A;  2ZXO A;  1LM3 B;  1YYJ A;  2LD6 A;  3JT1 A;  3RQG A;  4EBK A;  3UGO A;  3MX3 A;  1VTM P;  3C8Z A;  3V7O A;  3V5Y A;  2M64 A;  2XL4 A;  2J45 A;  2HMZ A;  3K33 A;  3GEI A;  4JTD B;  2HSB A;  3U3F A;  1D0Y A;  4OD4 A;  5KYU B;  1YVI A;  4EIY A;  5KYN A;  2DYS C;  3I5Q A;  4O6M A;  1HW1 A;  1JPJ A;  3WHN A;  4MW8 A;  2UUI A;  4YT5 A;  1PD1 A;  2PBE A;  4K0D A;  3L8I A;  3N2Z B;  4DBR A;  2YL7 A;  5JT4 A;  2D5R B;  1T9K A;  2OJQ A;  5DQZ A;  2WL8 A;  5FCL A;  2TMV P;  4JEA A;  2PNO A;  2J9U A;  5E2Q A;  2JD3 A;  3VRC A;  4IGG A;  1O3U A;  4MVR A;  3KH2 A;  1MNE A;  2YLD A;  4MVS A;  1LS1 A;  2R25 A;  4R32 A;  3GEH A;  2W4M A;  2WZG A;  4CSA C;  4OIQ F;  4JRZ A;  3SXY A;  3MBG A;  4JJF A;  5COM A;  4X0R A;  1Z7Q c;  3W8I A;  3RW0 A;  2JPU A;  3K1H A;  2CNW D;  4LDR A;  3ZDL A;  3AQC A;  3EH1 A;  2LFF A;  1SYQ A;  1ZHT A;  3ZG1 A;  2J9V A;  2Q9A A;  4XTK A;  5CI9 A;  3HNI A;  2YQY A;  2FGY A;  3KYJ A;  1Y6D A;  3AGT A;  4YJW A;  4A2N B;  2QE9 A;  3CQZ A;  3LEO A;  1M56 C;  3DAF A;  3O6X A;  4Q7C A;  1H9G A;  1QPU A;  2P0N A;  4J30 B;  2R7W A;  3POV A;  1WGW A;  3AG3 C;  3GEE A;  1VYI A;  3LLI A;  3CEX A;  4YT4 A;  1C17 M;  4XLP F;  1DOW A;  1MND A;  3FVY A;  2D4U A;  1BDJ B;  1S7Z A;  3O55 A;  4XPY A;  3MYF A;  2HV6 A;  1M57 C;  2MYS A;  3T9O A;  2YLI A;  3DE9 A;  3FDQ A;  2KC3 A;  3I5P A;  2OQM A;  2GDC A;  4MVM A;  1A41 A;  3M79 A;  4CS7 A;  4RD9 A;  5A6B A;  1D1C A;  4JIO A;  4NY3 A;  3JSZ A;  4QI0 A;  3S9O A;  4YT8 A;  2Q7R A;  2IXO A;  3UGP A;  1Q0G A;  1ZHW A;  2R9R B;  2OJE D;  4CX9 A;  2YWA A;  4N6C A;  3X1O A;  3EHN A;  4HFF B;  1M2V A;  2I8B A;  4MND A;  4EKW A;  3Q6N A;  1RJ9 A;  3HNJ A;  1N1C A;  4DRH B;  2Y3B A;  3EGD A;  1GGQ A;  2EIM C;  2GAQ A;  3CSK A;  4CSA A;  2HFI A;  2VAS A;  2R7S A;  2ZXR A;  1YDI A;  1LI5 A;  3RFY A;  2XLV A;  3C7J A;  4JEB A;  5L0C A;  3ZTM A;  2Q00 A;  2J46 A;  2L7A A;  3IQC A;  4DRJ B;  4YWQ A;  1R5I D;  2L9J A;  4MVQ A;  3SZR A;  4PJN A;  4PR9 A;  2Q9C A;  3E9V A;  1I4Z A;  2YLG A;  3S0X A;  3PCV A;  1SZI A;  2EIJ C;  4BJ5 C;  2VH3 A;  2VCB A;  2OOC A;  1E84 A;  1V55 C;  2HZ8 A;  3Q7G A;  3MFN A;  1Z63 A;  1QSP A;  1OR3 A;  2EIN C;  3PMR A;  3SXM A;  1EQ1 A;  1TFK B;  4AE4 B;  2UUH A;  2R7X A;  2YRF A;  4MVU A;  3QVZ A;  1A7V A;  1VLT A;  4Z9I A;  4JW1 A;  2L6H A;  4XEF A;  2XL6 A;  3VF0 A;  1PV3 A;  3EFO A;  5JSL A;  2X0C A;  2VC9 A;  2G3K A;  2G62 A;  1CPR A;  2CYD A;  3DD7 A;  4JC7 A;  1RKC A;  3LS1 A;  1ORY A;  1E2X A;  3W2V A;  3MYI A;  4AX2 A;  3O39 A;  3U0C A;  2NG1 A;  1NSG B;  3ZIB A;  3N0T A;  3Q7L A;  5DQT A;  3C18 A;  2BC5 A;  1XWJ A;  1G5Z A;  1MQV A;  2Z15 A;  3DWW A;  3QVY A;  4IAR A;  3VAY A;  3NMI A;  1MMG A;  2HJM A;  3LJB A;  5B1A C;  4LDQ A;  1AUE A;  4JUR I;  2PFD A;  1PD0 A;  5KYW B;  4U5D E;  1Q0F A;  3L0I A;  4I44 A;  1ZVZ A;  4O6Y A;  1WWP A;  2RSE B;  1FNT c;  1VYK A;  1SMY F;  1BZ4 A;  4IB4 A;  4P9T A; 
#chains in the Genus database with same CATH homology
 4YL1 A;  2UUI A;  2UUH A;  3LEO A;  4NTA A;  4AL1 A;  5BQI A;  3B29 A;  4JC7 A;  5BQG A;  4AL0 A;  2PNO A;  5K0I A;  4JCZ A;  4J7Y A;  4NTB A;  3DWW A;  5HV9 A;  4NTF A;  4JRZ A;  4YK5 A;  4BPM A;  5BQH A;  3PCV A;  2H8A A;  4YL3 A;  2Q7R A;  4WAB A;  4YL0 A;  4J7T A;  3HKK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...