3B29A

Human leukotriene c4 synthase in complex with dodecyl-beta-d-selenomaltoside
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
142
structure length
142
Chain Sequence
KDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Leukotriene C4 synthase
publication title Seleno-detergent MAD phasing of leukotriene C4 synthase in complex with dodecyl-beta-D-selenomaltoside
pubmed doi rcsb
source organism Homo sapiens
total genus 55
structure length 142
sequence length 142
ec nomenclature ec 4.4.1.20: Leukotriene-C(4) synthase.
pdb deposition date 2011-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 3b29A00
4JC7A 3PCVA 4JRZA 5K0IA 4YL1A 5BQGA 5HV9A 4AL0A 3DWWA 4J7YA 3LEOA 4AL1A 5BQHA 4J7TA 2PNOA 4NTFA 2UUHA 2H8AA 4NTBA 4NTAA 5BQIA 3HKKA 4JCZA 4BPMA 3B29A 4YL3A 4YL0A 4YK5A 4WABA 2UUIA 2Q7RA
chains in the Genus database with same CATH superfamily
2LSEA 3C7JA 1RCPA 3VAYA 1RKEA 4JE9A 3GWNA 3K6BA 4H54A 1D1BA 2NUTA 1KU2A 1RJ9B 2EILC 5JT4A 4YL1A 1G8XA 3RQFA 2WZFA 2R7TA 1TWAA 1Z23A 5CI9A 4EIYA 5KYUA 4BEJA 5A6AA 4E7ZA 1OW7A 4GQHA 1SMYF 2CW0F 3DZAA 2PF4E 4FX5A 1XZQA 2OOCA 2XSEA 3EQLF 1T5OA 3E70C 3JCUQ 4MW8A 4RD9A 4CS8A 1RKCA 4EKWA 2P1AA 5KYXB 3ZTMA 2W45A 4PJJA 3SEOA 3TD7A 3JT1A 3B0UX 2FGYA 1OXKA 2M4EA 1R4TA 2CYDA 3LLKA 5A6KA 2Y3DA 3HNKA 3KYJA 1M2VB 3DMDA 5A6JA 1JMWA 1IZMA 1VYIA 1Q0KA 1MMNA 4EBJA 2IXMA 2AVKA 4LDQA 5L3QA 1MNEA 4W8PA 2A6HF 3IQCA 5JSLA 1FFTC 4E17A 1WWPA 3PCVA 3C18A 1M57C 5KYWA 4CS9C 4WGYA 1S05A 2TMVP 4ANJA 3ATPA 2D5RB 3X2QC 1W2WA 1OR3A 1PCXA 3Q7LA 1GS9A 3J06A 1WOLA 4QI2A 1C17M 1YA7O 2JD3A 5EK0A 2L6HA 1YZAA 2WL8A 3Q7GA 4JURI 4Q7CA 2CDQA 4JJFA 3RH3A 2R7WA 5IY5C 2R25A 1ZHZA 4P9FA 2Y69C 3TOMA 1YAUO 2R05A 1TFKB 2GA0A 3Q6MA 3VM6A 5KYWB 3B29A 2DYRC 3JRMO 1LI7A 2I8BA 1MMDA 1I4YA 4YK5A 2IXNA 1LM3B 5KYXA 2VCAA 2UUIA 5L0JA 2NUPA 3DAGA 3RFYA 3QVYA 1OCZC 2GWWA 1M2VA 2LK4A 5FZTA 1G5ZA 2EPNA 3ZC4A 1NZEA 2L7AA 4IAOA 1K04A 1YLMA 2L6GA 3T9OA 3O39A 2NPUA 5T1DB 5B3IA 3Q6NA 1NU7D 2IBFA 3EG9B 1PD0A 3MYIA 4XQ1A 1C02A 1Y6DA 2J7PA 3AG4C 3SZRA 4XEFA 5AC5A 5KYYB 2DB4A 3NG1A 2XXAB 1O5HA 2A0UA 1EA8A 3ZDLA 4FAPB 3CSKA 3TJ6A 4IARA 3M15A 3NDBB 3HNJA 3TULA 2YL0A 2ICWG 2KW3C 2H7VC 3C62A 2NSGA 4J32B 4MVQA 1GGQA 4WABA 1E85A 1DOWA 3GORA 4MW3A 4YWQA 2QY9A 4NQFA 3UGOA 5F5HA 3M79A 2GFHA 3EPVA 4E0IA 3LNMB 4LLEA 4WGZA 3IPMO 3NKDA 4EHPA 1UG7A 1V4AA 4HFFB 4AE4B 3TJ5A 1OR2A 2Q9BA 3W2WA 3CQZA 1TR2A 3CAXA 3UR3C 3S9OA 2MYSA 3U2LA 3KKBA 1OCRC 1QVXA 3LS0A 2YLIA 3MBGA 5GPGB 4XWJA 1OCOC 3U0CA 3R2PA 3ZTZA 4NY3A 2ETSA 3ABKC 3N0TA 3EG9A 2KNHA 4MNDA 4Z9IA 2ZD9A 1FR0A 4U5EE 2HSQA 3U3FA 3KPHA 4BJ6C 4DVYP 1F1MA 2XXAA 1BR1A 3MX3A 3ZVRA 4YL3A 2LFDA 2R7VA 4IWBA 2R02A 3U9JA 4CJGA 4A4AA 1ZW2A 3L8IA 2PFDA 2WVQA 3NMIA 3NYMA 4U5CE 3V7OA 3ZQYA 1Q0DA 1APCA 4QI0A 2HMQA 5K0IA 3S0XA 3ASOC 3SXMA 5HV9A 3POVA 1YYXA 3F47A 1ORYA 2HJMA 3IQTA 2HSBA 2RSEB 1EI7A 4XLNF 3T6GB 4QDLA 4AL1A 2G3VA 4J7TA 1C03A 5B1BC 4MQ9F 1LE4A 2OEVA 3SXYA 4MTFA 3QZCA 2G3KA 4X0RA 1Z6AA 3K1HA 4FWVA 4JZAA 4AE4A 3K7DA 2XS8A 3KYIA 1ZZPA 1YVIA 2AWYA 2OU6A 3JZ0A 3B0PA 2DI3A 2XL6A 2YWAA 3HTKC 4BEMJ 3DI5A 1Y4CA 3C8GA 1MNDA 4I3MA 5E3CA 5A6BA 2BE5F 2OCCC 3AQBA 3G4XA 3GODA 5JVEA 5E33A 4U5DE 3FHDA 3S29A 3W2VA 1D0XA 2V3CC 4B6IA 3RKOF 1TFOB 4JW1A 4CSAA 4J30B 3ZG1A 1RXQA 2YHSA 2YQYA 4JRZA 1D1AA 3DAFA 4C3EA 1VK5A 4DRHB 3V5ZA 1BZ4A 4ER9A 3S90A 3DE8A 3US6A 2BL2A 2JPUA 3FOPA 3LEOA 4C3BA 5FCLA 3LJBA 5BQHA 3GM3A 2ZXRA 4E18A 2Q9CA 4NTFA 2YEVA 3VRCA 4ZLCA 3IQ5A 2R7RA 4OD4A 2KJGA 2EPMX 1V74B 1K40A 2XLEA 4YJWA 3G4ZA 4DOZA 3JRTA 1U89A 4P6IC 1FAPB 2YL7A 4N4WA 3UMKA 5DS5A 2Y3BA 5KYNA 4G0HA 3FXHA 2E87A 4IB4A 2EPKX 2ZXWC 4DBQA 3B9QA 4YT5A 4MVSA 4EUKB 1HMDA 2Q4FA 5B3SC 2PBEA 1PV3A 1SR2A 4CIHA 1TKNA 1E83A 4N6HA 4BJ5C 1YYJA 2W4MA 2G62A 2Y3GA 5CIVA 1OKKD 3UGPA 3L1MA 2VASA 3AJMA 3SXKA 2QUPA 1FTSA 1WN0A 5DVWA 1BDJB 2PNOA 4O6MA 1RJ9A 2GAQA 3JYYA 4LLCA 3DKAA 4O7GA 2J0XA 2XM0A 4OIQF 4KC9A 2YZSA 3FDQA 3AOUA 1HE9A 3EJNA 3KMIA 5COFA 2CCYA 3R7CA 1G4WR 3M1CB 5D92A 1VMAA 2J0WA 5L0DA 1OCCC 1I4ZA 1LKXA 3GEHA 1D0YA 3L34A 4MVRA 4R32A 4XEVA 3ZIBA 3DM9B 4KI2A 3I5QA 4EWCA 3JSEO 1N1CA 3AG1C 4KNVA 2P61A 1J8YF 2DGJA 2B0HA 1K05A 3TQOA 1TWHA 2MHRA 3EGDB 3GEIA 3W8HA 1H7IA 1QLEC 5AC4A 1B68A 2MWQA 3DM5A 3ZWIA 2WVOA 3V5XA 5DS4A 1A41A 4MVZA 2HFIA 2Z15A 4XTKA 4CDYA 4D4NA 3RQEA 2Y3HA 3GEEA 1GQAA 1NLXA 3FAJA 4XPWA 5JRAA 4IJJA 3DJUB 3MLGA 3WAQA 1OKKA 3OEOA 3NRHA 3K1IC 5D91A 2J9VA 5CI8A 3I4UA 4G78A 2YRFA 1HW2A 4DBRA 3VYWA 1SZIA 3L0IA 3TK0A 1CPRA 2KQ9A 2J8WA 3MFNA 2IOQA 4YL0A 1E2XA 1MMGA 1YARO 2W9YA 3RIPA 1TQGA 2J9UA 4BJTA 3NKEA 2B0JA 4XEKA 1VOMA 1KTMA 3BEHA 3MYFA 3OWTA 4G7OF 2D4UA 2QTVA 4LACB 4U5GA 4RBNA 3C63A 1KNYA 1WASA 3IQ6A 4ULWA 3G50A 2ZPAA 2ZXPA 2XL4A 1ZHXA 4AL0A 3QVZA 1TWCA 1HE1A 2LIGA 2Y39A 2WB7A 3U8VA 1A7EA 1I5NA 1QQ3A 2WVNA 2AU5A 2R9RB 3EZIA 3TOLA 3N2ZB 1J8MF 3EGDA 2YL3A 3JTLO 1NG1A 3ZQVA 4O6NA 3WODF 5JP7A 5TJ5E 2HZ8A 3A9CA 4PJNA 1FMVA 3H65A 2A6EF 2XS1A 1LE2A 4N6CA 2HV6A 1LS4A 1ORJA 2ZXOA 4U5BE 5KYYA 1VLTA 2DYSC 4HFKB 2EIJC 2C03A 2P0NA 2L81A 2R7UA 4BJ5A 2YLDA 2YKZA 4P9TA 3IHUA 1S7ZA 1Z3IX 3LS1A 4U9DA 4DRIB 4E7SA 1XWJA 2OKUA 3LLIA 3AG3C 3CEXA 3UMIA 4YT8A 4MS2A 2EIKC 2A69F 3SXZA 1JOGA 1ZVZA 1NFNA 4RDAA 3KL4A 2XLMA 5L0HA 3DXJF 5T3TA 4JTAB 4BJ6A 3GWLA 2J9BA 2V26A 3PDMP 3AGTA 4JKVA 2BC5A 4HE8D 1M56C 4JEAA 4PJMA 4I1MA 4YN0B 5L0GA 4PFOA 4K1OA 1VB5A 2W4BA 4DRJB 3U3BA 2VB6A 1MMAA 4NTBA 2LFFA 3AQCA 2NG1A 1HMOA 3B71A 4IRUA 2J46A 3M4BA 1NBBA 5E3AA 4ZLDA 1ZU5A 4CDAA 2M64A 4NC3A 3HNLA 3NYJA 4WJ0A 4EBKA 2EPLX 4E0HA 5L3VA 3ZSUA 1ZHYA 4JC7A 1VLSA 2FFHA 2A0BA 4OIRF 5L0FA 1QZXA 2L6FA 1PD1A 5BQGA 2OEXA 1UFBA 1SF8A 1AUEA 1LPEA 1LVKA 3JSZA 4Z9JA 5L0IA 1Q0MA 1V55C 3EHNA 4XLPF 2QLAA 1VTMP 4CBEA 2XLVA 1A7VA 1CPQA 1ZHTA 4FESA 4PR9A 5HSWA 3LAYA 4O6YA 4IAQA 2H7OA 2EPOA 3HLZA 2QE9A 4PFPA 2A68F 4NCQA 2R03A 4U9EA 1TWGA 3EH2A 1ZYRF 4AX2A 3O10A 1YZCA 2EINC 2VCBA 2P6VA 3DE9A 1R5ID 3H2VA 4JCZA 4PJLA 1ORSC 3S28A 3SP1A 2VH3A 1AVOB 2I15A 1L7CA 3X1OA 4JIOA 4A2NB 4OINF 4Q4ZF 1YDIA 2OG2A 2PX3A 4CS8C 2OQMA 2OJED 1QKRA 1BR4A 3RVZA 3A11A 1MQVA 3LESA 1BBHA 3OA1A 3WHNA 1RMVA 3DWWA 3QW0A 4CS7A 1NFOA 2YVKA 1DOVA 2OJQA 4DJ9A 3GANA 3SNHA 1T6IA 5EGYA 4KNWA 2WZGA 3FMSA 3EH1A 4GYTA 4MTGA 1XZPA 1WATA 1M2OA 2ASRA 5E2QA 1Q0FA 4EBBA 2NUPB 5BUOA 4MTOA 1Z63A 4CS9A 2J45A 1CGOA 3KH2A 1NSGB 1ZU4A 3CZ6A 3HNIA 3N24A 1CGME 1YA9A 3EFOB 2JX0A 3JYHA 1FFHA 2VCCA 3M4CA 3I5PA 4AK9A 2P7VA 1H9GA 2J7PD 2LD6A 5JS5A 2LCHA 1O3UA 3W4YA 3O6XA 5A6BD 5JLIA 4JEBA 2J9WA 2L9JA 3T4RA 4DVZA 3RVYA 1JAFA 1E84A 3H2UA 2F22A 4U5HA 3QTHA 2A1DD 1OW8A 1U6HA 5T3WA 3W8IA 5JUAA 2XLHA 3GM2A 2KGOA 3NMKA 4LERA 1L3PA 1ZHWA 4LDKA 1A0BA 1FMWA 2KK1A 3FOOA 4NTAA 1IW7F 1VYKA 256BA 3S27A 3HKKA 2GDCA 1JPNA 2CNWD 4HEAJ 3U5SA 3E9VA 2R7OA 5DQZA 1M6TA 3AG2C 4BG0A 3LNRA 3O55A 2Q7RA 3LEVA 1T01A 3EGXB 2XLWA 3K1IA 3QMKA 1JPJA 4ULVA 4D4XA 1V54C 2XLDA 1H9TA 3EFOA 1H6GA 4C3DA 4F4BA 4Q5SF 4U5FE 4J7YA 4L6RA 5F28E 3T6BA 4LDRA 3NMJA 4IGGA 2HJ3A 3U9MA 4C7OB 3S84A 2YL1A 3U8PA 4MVOA 4N06A 4H4KC 1U0BB 4M63A 2H8AA 2RD9A 3V5YA 4OIPF 3U2MA 4CX9A 1OW6A 1AEPA 1Z5ZA 2O9XA 2FAPB 2VC9A 4ONSA 4K7BA 1D0ZA 3K33A 4CDVA 4CIPA 2Q3TA 4XPYA 1EQ1A 2CGEA 1JRAA 3LUTB 5AGFA 4UDVA 4YT2A 3IEEA 1O87A 3RQGA 1E86A 1T9KA 4JCHA 2CNWA 3HJCA 3ITFA 4G7HF 1WTYA 2KC3A 4W8KA 4I1OB 4PACA 2PX0A 3L8JA 2HUJA 2QNLA 4JTCB 1QSPA 1EKYA 2AP3A 3DJNB 4O79A 1D1CA 3EGXA 4K0DA 5A69A 3RW0A 1OXBA 3EHMA 1FNTc 2HMZA 3C8GB 3C8GD 2NSFA 1SYQA 2YLGA 3DD7A 3EZHA 3FAPB 2XM4A 4MVUA 1T6UA 4CJOA 1ZW3A 5COGA 3RYLA 3UMHA 5DS6A 2XL8A 2LQGA 3F46A 1OQCA 2X0CA 4C7OA 5DQTA 2X51A 5BQIA 1LI5A 1YJGA 2IM8A 1RKEB 1ST6A 2IXPA 3K66A 1CGNA 2NUTB 4GEHA 4MVMA 3FVYA 1G4US 1LIHA 2IYLD 2WZLA 2XLOA 4G7ZF 5KYUB 4XPXA 2IXOA 4DXWA 3BRJA 4JTDB 1Q0GA 2HKVA 1NU9C 2Q00A 5B1AC 2HS5A 1Z7Qc 4BJ1A 3ABMC 4KBLA 1T6QA 3SYNA 2R7QA 2C04A 3NYLA 4JVSA 4Z9HA 1JR8A 3VF0A 2AWCA 2Q9AA 4OIOF 1QPUA 3WG7C 5COMA 2LP4A 3C8ZA 3PHF2 3UNGC 1GM5A 5DLJA 1HY5A 3AGUA 3ASNC 3RF3A 1A7DA 5EHHA 2UUHA 4CSAC 2R7SA 3T6JA 3GM1A 2HV7A 3ABLC 4I44A 1LS1A 4PK4A 1BR2A 3PMRA 3ECSA 5L0CA 3QW1A 2KSFA 4BPMA 2H7BA 4OD5A 4YT4A 2PP4A 2KYHA 1HW1A 1WGWA 2XRHA 5F5FA 2R7XA 3B0VC 4JJGA 2EIMC
chains in the Genus database with same CATH topology
4JC7A 3PCVA 4JRZA 5K0IA 4YL1A 5BQGA 5HV9A 4AL0A 3DWWA 4J7YA 3LEOA 4AL1A 5BQHA 4J7TA 2PNOA 4NTFA 2UUHA 2H8AA 4NTBA 4NTAA 5BQIA 3HKKA 4JCZA 4BPMA 3B29A 4YL3A 4YL0A 4YK5A 4WABA 2UUIA 2Q7RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JC7 A;  3PCV A;  4JRZ A;  5K0I A;  4YL1 A;  5BQG A;  5HV9 A;  4AL0 A;  3DWW A;  4J7Y A;  3LEO A;  4AL1 A;  5BQH A;  4J7T A;  2PNO A;  4NTF A;  2UUH A;  2H8A A;  4NTB A;  4NTA A;  5BQI A;  3HKK A;  4JCZ A;  4BPM A;  3B29 A;  4YL3 A;  4YL0 A;  4YK5 A;  4WAB A;  2UUI A;  2Q7R A; 
#chains in the Genus database with same CATH topology
 2LSE A;  3C7J A;  1RCP A;  3VAY A;  1RKE A;  4JE9 A;  3GWN A;  3K6B A;  4H54 A;  1D1B A;  2NUT A;  1KU2 A;  1RJ9 B;  2EIL C;  5JT4 A;  4YL1 A;  1G8X A;  3RQF A;  2WZF A;  2R7T A;  1TWA A;  1Z23 A;  5CI9 A;  4EIY A;  5KYU A;  4BEJ A;  5A6A A;  4E7Z A;  1OW7 A;  4GQH A;  1SMY F;  2CW0 F;  3DZA A;  2PF4 E;  4FX5 A;  1XZQ A;  2OOC A;  2XSE A;  3EQL F;  1T5O A;  3E70 C;  3JCU Q;  4MW8 A;  4RD9 A;  4CS8 A;  1RKC A;  4EKW A;  2P1A A;  5KYX B;  3ZTM A;  2W45 A;  4PJJ A;  3SEO A;  3TD7 A;  3JT1 A;  3B0U X;  2FGY A;  1OXK A;  2M4E A;  1R4T A;  2CYD A;  3LLK A;  5A6K A;  2Y3D A;  3HNK A;  3KYJ A;  1M2V B;  3DMD A;  5A6J A;  1JMW A;  1IZM A;  1VYI A;  1Q0K A;  1MMN A;  4EBJ A;  2IXM A;  2AVK A;  4LDQ A;  5L3Q A;  1MNE A;  4W8P A;  2A6H F;  3IQC A;  5JSL A;  1FFT C;  4E17 A;  1WWP A;  3PCV A;  3C18 A;  1M57 C;  5KYW A;  4CS9 C;  4WGY A;  1S05 A;  2TMV P;  4ANJ A;  3ATP A;  2D5R B;  3X2Q C;  1W2W A;  1OR3 A;  1PCX A;  3Q7L A;  1GS9 A;  3J06 A;  1WOL A;  4QI2 A;  1C17 M;  1YA7 O;  2JD3 A;  5EK0 A;  2L6H A;  1YZA A;  2WL8 A;  3Q7G A;  4JUR I;  4Q7C A;  2CDQ A;  4JJF A;  3RH3 A;  2R7W A;  5IY5 C;  2R25 A;  1ZHZ A;  4P9F A;  2Y69 C;  3TOM A;  1YAU O;  2R05 A;  1TFK B;  2GA0 A;  3Q6M A;  3VM6 A;  5KYW B;  3B29 A;  2DYR C;  3JRM O;  1LI7 A;  2I8B A;  1MMD A;  1I4Y A;  4YK5 A;  2IXN A;  1LM3 B;  5KYX A;  2VCA A;  2UUI A;  5L0J A;  2NUP A;  3DAG A;  3RFY A;  3QVY A;  1OCZ C;  2GWW A;  1M2V A;  2LK4 A;  5FZT A;  1G5Z A;  2EPN A;  3ZC4 A;  1NZE A;  2L7A A;  4IAO A;  1K04 A;  1YLM A;  2L6G A;  3T9O A;  3O39 A;  2NPU A;  5T1D B;  5B3I A;  3Q6N A;  1NU7 D;  2IBF A;  3EG9 B;  1PD0 A;  3MYI A;  4XQ1 A;  1C02 A;  1Y6D A;  2J7P A;  3AG4 C;  3SZR A;  4XEF A;  5AC5 A;  5KYY B;  2DB4 A;  3NG1 A;  2XXA B;  1O5H A;  2A0U A;  1EA8 A;  3ZDL A;  4FAP B;  3CSK A;  3TJ6 A;  4IAR A;  3M15 A;  3NDB B;  3HNJ A;  3TUL A;  2YL0 A;  2ICW G;  2KW3 C;  2H7V C;  3C62 A;  2NSG A;  4J32 B;  4MVQ A;  1GGQ A;  4WAB A;  1E85 A;  1DOW A;  3GOR A;  4MW3 A;  4YWQ A;  2QY9 A;  4NQF A;  3UGO A;  5F5H A;  3M79 A;  2GFH A;  3EPV A;  4E0I A;  3LNM B;  4LLE A;  4WGZ A;  3IPM O;  3NKD A;  4EHP A;  1UG7 A;  1V4A A;  4HFF B;  4AE4 B;  3TJ5 A;  1OR2 A;  2Q9B A;  3W2W A;  3CQZ A;  1TR2 A;  3CAX A;  3UR3 C;  3S9O A;  2MYS A;  3U2L A;  3KKB A;  1OCR C;  1QVX A;  3LS0 A;  2YLI A;  3MBG A;  5GPG B;  4XWJ A;  1OCO C;  3U0C A;  3R2P A;  3ZTZ A;  4NY3 A;  2ETS A;  3ABK C;  3N0T A;  3EG9 A;  2KNH A;  4MND A;  4Z9I A;  2ZD9 A;  1FR0 A;  4U5E E;  2HSQ A;  3U3F A;  3KPH A;  4BJ6 C;  4DVY P;  1F1M A;  2XXA A;  1BR1 A;  3MX3 A;  3ZVR A;  4YL3 A;  2LFD A;  2R7V A;  4IWB A;  2R02 A;  3U9J A;  4CJG A;  4A4A A;  1ZW2 A;  3L8I A;  2PFD A;  2WVQ A;  3NMI A;  3NYM A;  4U5C E;  3V7O A;  3ZQY A;  1Q0D A;  1APC A;  4QI0 A;  2HMQ A;  5K0I A;  3S0X A;  3ASO C;  3SXM A;  5HV9 A;  3POV A;  1YYX A;  3F47 A;  1ORY A;  2HJM A;  3IQT A;  2HSB A;  2RSE B;  1EI7 A;  4XLN F;  3T6G B;  4QDL A;  4AL1 A;  2G3V A;  4J7T A;  1C03 A;  5B1B C;  4MQ9 F;  1LE4 A;  2OEV A;  3SXY A;  4MTF A;  3QZC A;  2G3K A;  4X0R A;  1Z6A A;  3K1H A;  4FWV A;  4JZA A;  4AE4 A;  3K7D A;  2XS8 A;  3KYI A;  1ZZP A;  1YVI A;  2AWY A;  2OU6 A;  3JZ0 A;  3B0P A;  2DI3 A;  2XL6 A;  2YWA A;  3HTK C;  4BEM J;  3DI5 A;  1Y4C A;  3C8G A;  1MND A;  4I3M A;  5E3C A;  5A6B A;  2BE5 F;  2OCC C;  3AQB A;  3G4X A;  3GOD A;  5JVE A;  5E33 A;  4U5D E;  3FHD A;  3S29 A;  3W2V A;  1D0X A;  2V3C C;  4B6I A;  3RKO F;  1TFO B;  4JW1 A;  4CSA A;  4J30 B;  3ZG1 A;  1RXQ A;  2YHS A;  2YQY A;  4JRZ A;  1D1A A;  3DAF A;  4C3E A;  1VK5 A;  4DRH B;  3V5Z A;  1BZ4 A;  4ER9 A;  3S90 A;  3DE8 A;  3US6 A;  2BL2 A;  2JPU A;  3FOP A;  3LEO A;  4C3B A;  5FCL A;  3LJB A;  5BQH A;  3GM3 A;  2ZXR A;  4E18 A;  2Q9C A;  4NTF A;  2YEV A;  3VRC A;  4ZLC A;  3IQ5 A;  2R7R A;  4OD4 A;  2KJG A;  2EPM X;  1V74 B;  1K40 A;  2XLE A;  4YJW A;  3G4Z A;  4DOZ A;  3JRT A;  1U89 A;  4P6I C;  1FAP B;  2YL7 A;  4N4W A;  3UMK A;  5DS5 A;  2Y3B A;  5KYN A;  4G0H A;  3FXH A;  2E87 A;  4IB4 A;  2EPK X;  2ZXW C;  4DBQ A;  3B9Q A;  4YT5 A;  4MVS A;  4EUK B;  1HMD A;  2Q4F A;  5B3S C;  2PBE A;  1PV3 A;  1SR2 A;  4CIH A;  1TKN A;  1E83 A;  4N6H A;  4BJ5 C;  1YYJ A;  2W4M A;  2G62 A;  2Y3G A;  5CIV A;  1OKK D;  3UGP A;  3L1M A;  2VAS A;  3AJM A;  3SXK A;  2QUP A;  1FTS A;  1WN0 A;  5DVW A;  1BDJ B;  2PNO A;  4O6M A;  1RJ9 A;  2GAQ A;  3JYY A;  4LLC A;  3DKA A;  4O7G A;  2J0X A;  2XM0 A;  4OIQ F;  4KC9 A;  2YZS A;  3FDQ A;  3AOU A;  1HE9 A;  3EJN A;  3KMI A;  5COF A;  2CCY A;  3R7C A;  1G4W R;  3M1C B;  5D92 A;  1VMA A;  2J0W A;  5L0D A;  1OCC C;  1I4Z A;  1LKX A;  3GEH A;  1D0Y A;  3L34 A;  4MVR A;  4R32 A;  4XEV A;  3ZIB A;  3DM9 B;  4KI2 A;  3I5Q A;  4EWC A;  3JSE O;  1N1C A;  3AG1 C;  4KNV A;  2P61 A;  1J8Y F;  2DGJ A;  2B0H A;  1K05 A;  3TQO A;  1TWH A;  2MHR A;  3EGD B;  3GEI A;  3W8H A;  1H7I A;  1QLE C;  5AC4 A;  1B68 A;  2MWQ A;  3DM5 A;  3ZWI A;  2WVO A;  3V5X A;  5DS4 A;  1A41 A;  4MVZ A;  2HFI A;  2Z15 A;  4XTK A;  4CDY A;  4D4N A;  3RQE A;  2Y3H A;  3GEE A;  1GQA A;  1NLX A;  3FAJ A;  4XPW A;  5JRA A;  4IJJ A;  3DJU B;  3MLG A;  3WAQ A;  1OKK A;  3OEO A;  3NRH A;  3K1I C;  5D91 A;  2J9V A;  5CI8 A;  3I4U A;  4G78 A;  2YRF A;  1HW2 A;  4DBR A;  3VYW A;  1SZI A;  3L0I A;  3TK0 A;  1CPR A;  2KQ9 A;  2J8W A;  3MFN A;  2IOQ A;  4YL0 A;  1E2X A;  1MMG A;  1YAR O;  2W9Y A;  3RIP A;  1TQG A;  2J9U A;  4BJT A;  3NKE A;  2B0J A;  4XEK A;  1VOM A;  1KTM A;  3BEH A;  3MYF A;  3OWT A;  4G7O F;  2D4U A;  2QTV A;  4LAC B;  4U5G A;  4RBN A;  3C63 A;  1KNY A;  1WAS A;  3IQ6 A;  4ULW A;  3G50 A;  2ZPA A;  2ZXP A;  2XL4 A;  1ZHX A;  4AL0 A;  3QVZ A;  1TWC A;  1HE1 A;  2LIG A;  2Y39 A;  2WB7 A;  3U8V A;  1A7E A;  1I5N A;  1QQ3 A;  2WVN A;  2AU5 A;  2R9R B;  3EZI A;  3TOL A;  3N2Z B;  1J8M F;  3EGD A;  2YL3 A;  3JTL O;  1NG1 A;  3ZQV A;  4O6N A;  3WOD F;  5JP7 A;  5TJ5 E;  2HZ8 A;  3A9C A;  4PJN A;  1FMV A;  3H65 A;  2A6E F;  2XS1 A;  1LE2 A;  4N6C A;  2HV6 A;  1LS4 A;  1ORJ A;  2ZXO A;  4U5B E;  5KYY A;  1VLT A;  2DYS C;  4HFK B;  2EIJ C;  2C03 A;  2P0N A;  2L81 A;  2R7U A;  4BJ5 A;  2YLD A;  2YKZ A;  4P9T A;  3IHU A;  1S7Z A;  1Z3I X;  3LS1 A;  4U9D A;  4DRI B;  4E7S A;  1XWJ A;  2OKU A;  3LLI A;  3AG3 C;  3CEX A;  3UMI A;  4YT8 A;  4MS2 A;  2EIK C;  2A69 F;  3SXZ A;  1JOG A;  1ZVZ A;  1NFN A;  4RDA A;  3KL4 A;  2XLM A;  5L0H A;  3DXJ F;  5T3T A;  4JTA B;  4BJ6 A;  3GWL A;  2J9B A;  2V26 A;  3PDM P;  3AGT A;  4JKV A;  2BC5 A;  4HE8 D;  1M56 C;  4JEA A;  4PJM A;  4I1M A;  4YN0 B;  5L0G A;  4PFO A;  4K1O A;  1VB5 A;  2W4B A;  4DRJ B;  3U3B A;  2VB6 A;  1MMA A;  4NTB A;  2LFF A;  3AQC A;  2NG1 A;  1HMO A;  3B71 A;  4IRU A;  2J46 A;  3M4B A;  1NBB A;  5E3A A;  4ZLD A;  1ZU5 A;  4CDA A;  2M64 A;  4NC3 A;  3HNL A;  3NYJ A;  4WJ0 A;  4EBK A;  2EPL X;  4E0H A;  5L3V A;  3ZSU A;  1ZHY A;  4JC7 A;  1VLS A;  2FFH A;  2A0B A;  4OIR F;  5L0F A;  1QZX A;  2L6F A;  1PD1 A;  5BQG A;  2OEX A;  1UFB A;  1SF8 A;  1AUE A;  1LPE A;  1LVK A;  3JSZ A;  4Z9J A;  5L0I A;  1Q0M A;  1V55 C;  3EHN A;  4XLP F;  2QLA A;  1VTM P;  4CBE A;  2XLV A;  1A7V A;  1CPQ A;  1ZHT A;  4FES A;  4PR9 A;  5HSW A;  3LAY A;  4O6Y A;  4IAQ A;  2H7O A;  2EPO A;  3HLZ A;  2QE9 A;  4PFP A;  2A68 F;  4NCQ A;  2R03 A;  4U9E A;  1TWG A;  3EH2 A;  1ZYR F;  4AX2 A;  3O10 A;  1YZC A;  2EIN C;  2VCB A;  2P6V A;  3DE9 A;  1R5I D;  3H2V A;  4JCZ A;  4PJL A;  1ORS C;  3S28 A;  3SP1 A;  2VH3 A;  1AVO B;  2I15 A;  1L7C A;  3X1O A;  4JIO A;  4A2N B;  4OIN F;  4Q4Z F;  1YDI A;  2OG2 A;  2PX3 A;  4CS8 C;  2OQM A;  2OJE D;  1QKR A;  1BR4 A;  3RVZ A;  3A11 A;  1MQV A;  3LES A;  1BBH A;  3OA1 A;  3WHN A;  1RMV A;  3DWW A;  3QW0 A;  4CS7 A;  1NFO A;  2YVK A;  1DOV A;  2OJQ A;  4DJ9 A;  3GAN A;  3SNH A;  1T6I A;  5EGY A;  4KNW A;  2WZG A;  3FMS A;  3EH1 A;  4GYT A;  4MTG A;  1XZP A;  1WAT A;  1M2O A;  2ASR A;  5E2Q A;  1Q0F A;  4EBB A;  2NUP B;  5BUO A;  4MTO A;  1Z63 A;  4CS9 A;  2J45 A;  1CGO A;  3KH2 A;  1NSG B;  1ZU4 A;  3CZ6 A;  3HNI A;  3N24 A;  1CGM E;  1YA9 A;  3EFO B;  2JX0 A;  3JYH A;  1FFH A;  2VCC A;  3M4C A;  3I5P A;  4AK9 A;  2P7V A;  1H9G A;  2J7P D;  2LD6 A;  5JS5 A;  2LCH A;  1O3U A;  3W4Y A;  3O6X A;  5A6B D;  5JLI A;  4JEB A;  2J9W A;  2L9J A;  3T4R A;  4DVZ A;  3RVY A;  1JAF A;  1E84 A;  3H2U A;  2F22 A;  4U5H A;  3QTH A;  2A1D D;  1OW8 A;  1U6H A;  5T3W A;  3W8I A;  5JUA A;  2XLH A;  3GM2 A;  2KGO A;  3NMK A;  4LER A;  1L3P A;  1ZHW A;  4LDK A;  1A0B A;  1FMW A;  2KK1 A;  3FOO A;  4NTA A;  1IW7 F;  1VYK A;  256B A;  3S27 A;  3HKK A;  2GDC A;  1JPN A;  2CNW D;  4HEA J;  3U5S A;  3E9V A;  2R7O A;  5DQZ A;  1M6T A;  3AG2 C;  4BG0 A;  3LNR A;  3O55 A;  2Q7R A;  3LEV A;  1T01 A;  3EGX B;  2XLW A;  3K1I A;  3QMK A;  1JPJ A;  4ULV A;  4D4X A;  1V54 C;  2XLD A;  1H9T A;  3EFO A;  1H6G A;  4C3D A;  4F4B A;  4Q5S F;  4U5F E;  4J7Y A;  4L6R A;  5F28 E;  3T6B A;  4LDR A;  3NMJ A;  4IGG A;  2HJ3 A;  3U9M A;  4C7O B;  3S84 A;  2YL1 A;  3U8P A;  4MVO A;  4N06 A;  4H4K C;  1U0B B;  4M63 A;  2H8A A;  2RD9 A;  3V5Y A;  4OIP F;  3U2M A;  4CX9 A;  1OW6 A;  1AEP A;  1Z5Z A;  2O9X A;  2FAP B;  2VC9 A;  4ONS A;  4K7B A;  1D0Z A;  3K33 A;  4CDV A;  4CIP A;  2Q3T A;  4XPY A;  1EQ1 A;  2CGE A;  1JRA A;  3LUT B;  5AGF A;  4UDV A;  4YT2 A;  3IEE A;  1O87 A;  3RQG A;  1E86 A;  1T9K A;  4JCH A;  2CNW A;  3HJC A;  3ITF A;  4G7H F;  1WTY A;  2KC3 A;  4W8K A;  4I1O B;  4PAC A;  2PX0 A;  3L8J A;  2HUJ A;  2QNL A;  4JTC B;  1QSP A;  1EKY A;  2AP3 A;  3DJN B;  4O79 A;  1D1C A;  3EGX A;  4K0D A;  5A69 A;  3RW0 A;  1OXB A;  3EHM A;  1FNT c;  2HMZ A;  3C8G B;  3C8G D;  2NSF A;  1SYQ A;  2YLG A;  3DD7 A;  3EZH A;  3FAP B;  2XM4 A;  4MVU A;  1T6U A;  4CJO A;  1ZW3 A;  5COG A;  3RYL A;  3UMH A;  5DS6 A;  2XL8 A;  2LQG A;  3F46 A;  1OQC A;  2X0C A;  4C7O A;  5DQT A;  2X51 A;  5BQI A;  1LI5 A;  1YJG A;  2IM8 A;  1RKE B;  1ST6 A;  2IXP A;  3K66 A;  1CGN A;  2NUT B;  4GEH A;  4MVM A;  3FVY A;  1G4U S;  1LIH A;  2IYL D;  2WZL A;  2XLO A;  4G7Z F;  5KYU B;  4XPX A;  2IXO A;  4DXW A;  3BRJ A;  4JTD B;  1Q0G A;  2HKV A;  1NU9 C;  2Q00 A;  5B1A C;  2HS5 A;  1Z7Q c;  4BJ1 A;  3ABM C;  4KBL A;  1T6Q A;  3SYN A;  2R7Q A;  2C04 A;  3NYL A;  4JVS A;  4Z9H A;  1JR8 A;  3VF0 A;  2AWC A;  2Q9A A;  4OIO F;  1QPU A;  3WG7 C;  5COM A;  2LP4 A;  3C8Z A;  3PHF 2;  3UNG C;  1GM5 A;  5DLJ A;  1HY5 A;  3AGU A;  3ASN C;  3RF3 A;  1A7D A;  5EHH A;  2UUH A;  4CSA C;  2R7S A;  3T6J A;  3GM1 A;  2HV7 A;  3ABL C;  4I44 A;  1LS1 A;  4PK4 A;  1BR2 A;  3PMR A;  3ECS A;  5L0C A;  3QW1 A;  2KSF A;  4BPM A;  2H7B A;  4OD5 A;  4YT4 A;  2PP4 A;  2KYH A;  1HW1 A;  1WGW A;  2XRH A;  5F5F A;  2R7X A;  3B0V C;  4JJG A;  2EIM C; 
#chains in the Genus database with same CATH homology
 4JC7 A;  3PCV A;  4JRZ A;  5K0I A;  4YL1 A;  5BQG A;  5HV9 A;  4AL0 A;  3DWW A;  4J7Y A;  3LEO A;  4AL1 A;  5BQH A;  4J7T A;  2PNO A;  4NTF A;  2UUH A;  2H8A A;  4NTB A;  4NTA A;  5BQI A;  3HKK A;  4JCZ A;  4BPM A;  3B29 A;  4YL3 A;  4YL0 A;  4YK5 A;  4WAB A;  2UUI A;  2Q7R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...