3B29A

Human leukotriene c4 synthase in complex with dodecyl-beta-d-selenomaltoside
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
142
structure length
142
Chain Sequence
KDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Seleno-detergent MAD phasing of leukotriene C4 synthase in complex with dodecyl-beta-D-selenomaltoside
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
molecule keywords Leukotriene C4 synthase
total genus 55
structure length 142
sequence length 142
ec nomenclature ec 4.4.1.20: Leukotriene-C(4) synthase.
pdb deposition date 2011-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 3b29A00
4J7TA 4JCZA 4WABA 3PCVA 4NTFA 2Q7RA 3HKKA 2H8AA 4J7YA 3DWWA 4YK5A 5BQHA 4JRZA 5BQGA 5HV9A 4BPMA 4AL1A 4YL1A 4YL3A 5BQIA 4NTBA 3B29A 5K0IA 2PNOA 4NTAA 2UUHA 2UUIA 4JC7A 4AL0A 4YL0A 3LEOA
chains in the Genus database with same CATH superfamily
1HY5A 3PMRA 4WJ0A 2AVKA 1RKEA 4JCZA 1LM3B 2PBEA 1V4AA 2XSEA 1WOLA 4MVMA 1GS9A 1L3PA 4IWBA 3U5SA 1U0BB 4P6IC 3EG9A 3V5XA 5DQTA 3AG1C 1OW7A 1TQGA 4CS8A 2Y69C 3SZRA 2YLIA 3V5YA 2HMZA 2J45A 5F5HA 3EZIA 1Z5ZA 2KGOA 3VAYA 1LPEA 2ETSA 4DRIB 3ZWIA 4U5FE 1RXQA 2BE5F 2WL8A 3SXMA 4CJOA 5L3VA 2JX0A 3RVYA 2HJ3A 2OJQA 2Y39A 1NFOA 2PP4A 3FDQA 3EFOA 3HNIA 2PX0A 3O6XA 2YKZA 4MVSA 3AG3C 4XTKA 5A69A 1E86A 1FNTc 1JOGA 4O6MA 4EBBA 4NTAA 3J06A 1Z6AA 2G3KA 2UUHA 4JEAA 4CBEA 4CS8C 4PJJA 2AP3A 3DZAA 4U9EA 3HLZA 2ZD9A 3LS0A 2KJGA 3EGXB 4JTAB 4MW8A 1EKYA 2DYSC 4MVUA 3EPVA 3RQGA 1LKXA 2B0HA 2XLWA 3U2MA 3U3FA 3L34A 1YAUO 4W8KA 1H7IA 2R05A 4CDYA 2AWYA 4JEBA 1CGNA 3TJ5A 2R7OA 5A6AA 1LIHA 3EFOB 4JE9A 3JCUQ 4IAQA 4DXWA 5B1AC 2XLVA 1QLEC 3C18A 1TKNA 2VH3A 4O79A 5IY5C 5KYWA 2YZSA 5TJ5E 2W4BA 3HNKA 4PR9A 5L0DA 4O6YA 3JTLO 1DOWA 2DGJA 2DI3A 3V7OA 3AG2C 4AE4B 1D0YA 4RBNA 3MBGA 1K40A 3IQCA 1FFHA 3O39A 5D91A 3RFYA 2D4UA 4OD5A 4LLEA 5L0FA 2LP4A 4PJNA 4L6RA 1YVIA 3G4XA 3Q6MA 4CSAA 2BC5A 2EPLX 1Z63A 3NMKA 1ZU4A 3T6BA 3HJCA 2VCAA 3ITFA 2OKUA 2AU5A 2MHRA 4N4WA 4CX9A 3MX3A 1LI5A 2CNWD 2LFFA 3FMSA 3M15A 4FWVA 4IAOA 3TOMA 4O7GA 3VF0A 4P9FA 3AGTA 4EWCA 3M79A 1SF8A 4H4KC 1YZAA 3ABKC 3DXJF 4CS9A 4E0HA 1NU9C 3H2VA 1GM5A 2NSGA 1CPRA 4AK9A 3B0UX 3WHNA 1HW2A 2R7UA 4G7OF 3T9OA 4E0IA 4AL1A 4DVYP 1ZW3A 3MYIA 5E3AA 3H65A 2L6GA 3S90A 1D1CA 1RJ9B 3DM9B 3N0TA 4MTFA 4QI0A 3CQZA 3B29A 1JAFA 2J9WA 4MVZA 4A4AA 1OKKA 5KYXA 5KYNA 2FGYA 1Z3IX 4MVOA 3ABMC 2NUPB 4YL0A 1ZHXA 3S29A 1BDJB 2OU6A 5JRAA 2R7XA 3DE9A 1J8MF 2YEVA 1E2XA 3C8ZA 4U5BE 2CDQA 5A6KA 3F47A 1MQVA 4JJFA 1V74B 4XPWA 2VB6A 1Q0MA 3RH3A 1D1BA 4IGGA 1YYXA 1QZXA 2IXOA 2VCCA 4CJGA 2B0JA 3NKEA 3SP1A 4OIPF 2ZXWC 2CNWA 3CSKA 1MNDA 1T6IA 1ORJA 2L9JA 3GANA 3NMJA 3EZHA 4ZLCA 3W2WA 1BR2A 1NFNA 4C3BA 2E87A 4GQHA 2GFHA 1D0XA 3I4UA 2EPKX 2YVKA 5DVWA 5AC4A 4CS7A 3KYIA 3EHMA 3B71A 4B6IA 1VLSA 2F22A 2MYSA 2X51A 3LUTB 4K0DA 3TD7A 3LAYA 3DM5A 1U89A 1ZHYA 3Q7LA 4AL0A 3JZ0A 3UGOA 1FFTC 1LI7A 1ZZPA 3RVZA 5D92A 4MQ9F 2J9BA 4N6HA 3L8JA 5CI9A 2QTVA 4FESA 3K6BA 3JRMO 3NKDA 3L8IA 3S0XA 1WGWA 1R4TA 2WZGA 3H2UA 3IEEA 1TFKB 3DJUB 3LEVA 2R7RA 4JURI 1RKEB 2HZ8A 3LS1A 4IJJA 2P1AA 1I4YA 4LDKA 4PK4A 4YT4A 1NBBA 3LLIA 2LCHA 1BBHA 1C02A 3ZQVA 1YA9A 3IQ6A 1OW8A 5CI8A 3C8GD 2R7WA 2LD6A 3EHNA 1HMOA 3TJ6A 1OCCC 1E85A 1YYJA 3RIPA 2WVNA 3UGPA 3R2PA 3HNJA 1TR2A 1YA7O 2G62A 3GWLA 2R7VA 2C03A 3I5QA 4XPXA 1CGOA 2H7OA 3T4RA 1A7VA 2OJED 2XLDA 2BL2A 3SNHA 4HEAJ 1XWJA 2H7VC 3ZG1A 3PHF2 1QPUA 4F4BA 3FHDA 1Q0KA 2AWCA 4JTCB 2WVQA 3K66A 5COGA 4PACA 4QDLA 2Q7RA 3ZVRA 5JUAA 4I3MA 4LDQA 3IQTA 4Q4ZF 2YL0A 4JRZA 4LDRA 2A1DD 2VC9A 1TWCA 4MVRA 1FAPB 1OCOC 4RD9A 1CGME 2VASA 2NUTB 3C7JA 1RCPA 2DB4A 3MYFA 3K1HA 1WN0A 1OW6A 2KW3C 3KPHA 5EGYA 4JIOA 1C03A 4BJ5C 1Z7Qc 1B68A 5L3QA 3LESA 4BJ1A 2PNOA 2LIGA 3KKBA 2J7PA 1FMVA 2EIMC 2IXNA 3O55A 3I5PA 2NUTA 3LNMB 3TK0A 3LLKA 2YL3A 4C3DA 2QUPA 1WTYA 4QI2A 2IXMA 3G4ZA 5FZTA 2M64A 3ECSA 1MNEA 1E83A 3SXYA 3JYYA 3RKOF 4XLNF 3CEXA 2Q3TA 5DS4A 1N1CA 4HFFB 1VYKA 2QLAA 4GYTA 1I4ZA 1WWPA 1T6QA 2CGEA 3BEHA 4NC3A 2VCBA 1EI7A 3AQBA 4U9DA 1HMDA 2LFDA 4K7BA 4A2NB 1LVKA 1Y4CA 4EKWA 2R9RB 2RSEB 2HV7A 3W4YA 3NDBB 3DMDA 4RDAA 3ABLC 1DOVA 3US6A 2A68F 3X2QC 4IRUA 2L6HA 1TWHA 1OR2A 2L81A 4G0HA 2XL8A 4YT2A 1QQ3A 3GWNA 2XLEA 3T6GB 1KTMA 1FR0A 1QKRA 3EJNA 3TQOA 1M2VA 2HJMA 2XLMA 2ZPAA 3ZC4A 1FTSA 3M4CA 1D0ZA 4XPYA 1VTMP 3KL4A 2Y3BA 3QW1A 4NTFA 3U0CA 3EG9B 2KK1A 1R5ID 1OXKA 2PFDA 3W8HA 4AE4A 3RYLA 2V26A 2YHSA 1O3UA 1VMAA 3GORA 4U5CE 1NLXA 3S27A 2NPUA 4D4XA 1WATA 4XQ1A 2XLOA 5JP7A 1YLMA 1V55C 3TOLA 2W9YA 2YLGA 4FAPB 1LS1A 2LQGA 3NYJA 4NTBA 1ZYRF 1ZHWA 4EHPA 5JS5A 1NZEA 2Q9CA 3U9MA 1YDIA 1ZVZA 1Q0DA 2A0BA 4IB4A 2TMVP 1TWGA 2MWQA 1LE2A 4XEFA 1ORYA 1MMNA 4U5DE 4Z9HA 2P61A 5KYYA 4YN0B 2JPUA 4EIYA 2W4MA 4J7TA 1QVXA 4N6CA 5B3IA 3PCVA 4BJ6A 1ZU5A 4IARA 2GDCA 1A7EA 4XLPF 4GEHA 3DWWA 1RKCA 5E2QA 1SZIA 1SYQA 2R03A 3C62A 5L0HA 4DRHB 3KH2A 3Q6NA 4FX5A 3B0PA 3N24A 5KYWB 1G4US 3SYNA 3R7CA 4JKVA 1K04A 2G3VA 5JLIA 4G7HF 1AVOB 2R7SA 2YQYA 2J46A 1M56C 2A6EF 3MFNA 2J9UA 2XS8A 2XRHA 3OEOA 4EUKB 4LACB 2J0XA 4MTOA 3QW0A 5DQZA 4E18A 4U5HA 4ONSA 2P0NA 2LSEA 2WZLA 3U9JA 2L7AA 1BR4A 4D4NA 1EQ1A 1YZCA 3FVYA 4BJ5A 4XWJA 4Z9JA 4BJ6C 4KI2A 5DS6A 3HTKC 2FAPB 5DLJA 1E84A 2EPMX 3FAJA 4DVZA 3S28A 2PX3A 3U8PA 2R02A 4YK5A 5BUOA 3E70C 1MMAA 3RQEA 4LERA 5BQGA 2A6HF 4C7OB 2XL4A 1S05A 3GEEA 2NUPA 2WZFA 5JT4A 5L0IA 1AEPA 4ER9A 5KYUB 3GM2A 4CDVA 5T3WA 3K1IA 2IXPA 1TWAA 1I5NA 2YLDA 4G78A 1XZQA 5B3SC 2ZXRA 3NYMA 1OR3A 4I1OB 1G8XA 1PD0A 5E33A 2UUIA 4X0RA 4OIRF 4KBLA 1HE9A 2EPNA 2XM0A 5B1BC 2OEXA 4CDAA 5AC5A 3U8VA 1Y6DA 5E3CA 5CIVA 2HSBA 3C8GB 2L6FA 1ZHTA 1PCXA 4JZAA 2CW0F 2JD3A 1G4WR 2QY9A 1RMVA 2YWAA 3GEHA 1JMWA 3FAPB 4BEMJ 1LS4A 2QNLA 2YL7A 2XXAB 1OCZC 3TULA 3QVZA 3DI5A 2HV6A 5T3TA 1ZW2A 2OCCC 1VB5A 5HV9A 3EGXA 1S7ZA 2DYRC 1SR2A 2KYHA 3AQCA 3FOOA 4U5EE 3JSZA 1MMDA 4JTDB 2J7PD 4U5GA 1T01A 2OEVA 1GQAA 3L0IA 3QVYA 1XZPA 2IOQA 2Q9AA 3NYLA 3A9CA 2ZXPA 4YWQA 4CIHA 3UMKA 1O5HA 4MW3A 4OIQF 1W2WA 4DOZA 1M57C 1PD1A 5EK0A 4CIPA 3C63A 4YJWA 2GA0A 3EGDA 5A6BD 2C04A 3EQLF 1JRAA 5AGFA 4PJMA 3VYWA 1VOMA 4MTGA 2R7QA 1HW1A 1U6HA 3SEOA 3K1IC 4PJLA 4I1MA 4BG0A 3JRTA 3QMKA 3AOUA 3DAGA 3EH1A 1BZ4A 2I8BA 3NG1A 2LK4A 2HFIA 3RQFA 2A69F 1ORSC 4JCHA 3UMHA 2P7VA 1VLTA 3LNRA 3ATPA 3ASNC 4MS2A 1L7CA 2J0WA 5COMA 4YL1A 4DBQA 2R25A 4OD4A 2YRFA 3UNGC 3ZDLA 4G7ZF 4Q5SF 3IQ5A 1JR8A 5HSWA 4XEKA 2W45A 4WGZA 1M6TA 2M4EA 1K05A 2XM4A 2Y3DA 3RF3A 3LEOA 3SXKA 2J8WA 3V5ZA 1F1MA 3S84A 1H9TA 3CAXA 3VM6A 1FMWA 1WASA 2Q9BA 3DE8A 4W8PA 3KYJA 1HE1A 4DBRA 5DS5A 4OIOF 1Q0FA 4JJGA 1OCRC 4Z9IA 4HFKB 4N06A 3W8IA 2YL1A 1EA8A 4BEJA 5BQHA 2IBFA 3W2VA 1QSPA 2HS5A 3GEIA 2ICWG 3JSEO 3WODF 3SXZA 2OQMA 5KYUA 3ZIBA 5KYYB 3PDMP 3DKAA 4NCQA 1JPNA 4Q7CA 3FOPA 4H54A 256BA 1NU7D 2WB7A 3ZQYA 1NG1A 5BQIA 1AUEA 3S9OA 4M63A 3DAFA 3QTHA 5K0IA 1IW7F 3LJBA 3QZCA 1T9KA 2RD9A 4K1OA 3OWTA 3MLGA 3U3BA 4LLCA 4HE8D 1A7DA 4ANJA 3AG4C 2Z15A 2FFHA 4J32B 4E7ZA 3ASOC 4P9TA 2KQ9A 2J9VA 2NG1A 2XL6A 1D1AA 3X1OA 2H8AA 5L0CA 4ULVA 2H7BA 5JSLA 3B9QA 3DD7A 4J30B 4EBKA 3M4BA 4NQFA 4PFPA 2OOCA 1J8YF 5T1DB 2IM8A 1T5OA 5A6JA 1ZHZA 3NRHA 5KYXB 2A0UA 1H6GA 1A0BA 1MMGA 3A11A 5L0GA 2EIKC 1OKKD 2PF4E 3BRJA 3JYHA 1UG7A 1O87A 2EINC 1VK5A 1BR1A 1LE4A 1OQCA 4E17A 2P6VA 2CCYA 3EGDB 3M1CB 2GWWA 1M2VB 3GM1A 4C7OA 2Q00A 3G50A 2I15A 3FXHA 1CPQA 4JVSA 2NSFA 3NMIA 4WABA 4E7SA 4OINF 1H9GA 2EILC 3HKKA 2D5RB 2HMQA 4J7YA 5F28E 3AGUA 2KNHA 2V3CC 2WVOA 1Z23A 3T6JA 1A41A 1Q0GA 4EBJA 4KNVA 5GPGB 3VRCA 3OA1A 4BPMA 5JVEA 1G5ZA 4YT8A 4WGYA 1APCA 1GGQA 3CZ6A 3Q7GA 3WG7C 4C3EA 1ST6A 1OXBA 5FCLA 4NY3A 1M2OA 2XXAA 3O10A 3U2LA 1YJGA 3JT1A 3KMIA 3B0VC 3POVA 2XLHA 5COFA 2ASRA 1V54C 2CYDA 4JC7A 4CS9C 2Y3GA 2Q4FA 2HSQA 1TFOB 2GAQA 2QE9A 3IPMO 3K7DA 4DJ9A 2XS1A 3F46A 4MVQA 1IZMA 3EH2A 4XEVA 4AX2A 3WAQA 2HUJA 3IHUA 1YARO 5F5FA 3ZTZA 5EHHA 3E9VA 5L0JA 2R7TA 3K33A 4I44A 3RW0A 3N2ZB 1SMYF 1PV3A 4ZLDA 1RJ9A 1C17M 1UFBA 3GODA 4KNWA 4R32A 3AJMA 3DJNB 1VYIA 3ZSUA 4UDVA 1JPJA 1KU2A 1KNYA 2KC3A 2ZXOA 3UR3C 4KC9A 3GM3A 3HNLA 4YL3A 3L1MA 4YT5A 2X0CA 4JW1A 4PFOA 4CSAC 2EPOA 2IYLD 4O6NA 4BJTA 2KSFA 4ULWA 4DRJB 4MNDA 1NSGB 1T6UA 2Y3HA 2O9XA 2OG2A 3C8GA 2EIJC 5A6BA 3UMIA 2HKVA 3ZTMA
chains in the Genus database with same CATH topology
4J7TA 4JCZA 4WABA 3PCVA 4NTFA 2Q7RA 3HKKA 2H8AA 4J7YA 3DWWA 4YK5A 5BQHA 4JRZA 5BQGA 5HV9A 4BPMA 4AL1A 4YL1A 4YL3A 5BQIA 4NTBA 3B29A 5K0IA 2PNOA 4NTAA 2UUHA 2UUIA 4JC7A 4AL0A 4YL0A 3LEOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J7T A;  4JCZ A;  4WAB A;  3PCV A;  4NTF A;  2Q7R A;  3HKK A;  2H8A A;  4J7Y A;  3DWW A;  4YK5 A;  5BQH A;  4JRZ A;  5BQG A;  5HV9 A;  4BPM A;  4AL1 A;  4YL1 A;  4YL3 A;  5BQI A;  4NTB A;  3B29 A;  5K0I A;  2PNO A;  4NTA A;  2UUH A;  2UUI A;  4JC7 A;  4AL0 A;  4YL0 A;  3LEO A; 
#chains in the Genus database with same CATH topology
 1HY5 A;  3PMR A;  4WJ0 A;  2AVK A;  1RKE A;  4JCZ A;  1LM3 B;  2PBE A;  1V4A A;  2XSE A;  1WOL A;  4MVM A;  1GS9 A;  1L3P A;  4IWB A;  3U5S A;  1U0B B;  4P6I C;  3EG9 A;  3V5X A;  5DQT A;  3AG1 C;  1OW7 A;  1TQG A;  4CS8 A;  2Y69 C;  3SZR A;  2YLI A;  3V5Y A;  2HMZ A;  2J45 A;  5F5H A;  3EZI A;  1Z5Z A;  2KGO A;  3VAY A;  1LPE A;  2ETS A;  4DRI B;  3ZWI A;  4U5F E;  1RXQ A;  2BE5 F;  2WL8 A;  3SXM A;  4CJO A;  5L3V A;  2JX0 A;  3RVY A;  2HJ3 A;  2OJQ A;  2Y39 A;  1NFO A;  2PP4 A;  3FDQ A;  3EFO A;  3HNI A;  2PX0 A;  3O6X A;  2YKZ A;  4MVS A;  3AG3 C;  4XTK A;  5A69 A;  1E86 A;  1FNT c;  1JOG A;  4O6M A;  4EBB A;  4NTA A;  3J06 A;  1Z6A A;  2G3K A;  2UUH A;  4JEA A;  4CBE A;  4CS8 C;  4PJJ A;  2AP3 A;  3DZA A;  4U9E A;  3HLZ A;  2ZD9 A;  3LS0 A;  2KJG A;  3EGX B;  4JTA B;  4MW8 A;  1EKY A;  2DYS C;  4MVU A;  3EPV A;  3RQG A;  1LKX A;  2B0H A;  2XLW A;  3U2M A;  3U3F A;  3L34 A;  1YAU O;  4W8K A;  1H7I A;  2R05 A;  4CDY A;  2AWY A;  4JEB A;  1CGN A;  3TJ5 A;  2R7O A;  5A6A A;  1LIH A;  3EFO B;  4JE9 A;  3JCU Q;  4IAQ A;  4DXW A;  5B1A C;  2XLV A;  1QLE C;  3C18 A;  1TKN A;  2VH3 A;  4O79 A;  5IY5 C;  5KYW A;  2YZS A;  5TJ5 E;  2W4B A;  3HNK A;  4PR9 A;  5L0D A;  4O6Y A;  3JTL O;  1DOW A;  2DGJ A;  2DI3 A;  3V7O A;  3AG2 C;  4AE4 B;  1D0Y A;  4RBN A;  3MBG A;  1K40 A;  3IQC A;  1FFH A;  3O39 A;  5D91 A;  3RFY A;  2D4U A;  4OD5 A;  4LLE A;  5L0F A;  2LP4 A;  4PJN A;  4L6R A;  1YVI A;  3G4X A;  3Q6M A;  4CSA A;  2BC5 A;  2EPL X;  1Z63 A;  3NMK A;  1ZU4 A;  3T6B A;  3HJC A;  2VCA A;  3ITF A;  2OKU A;  2AU5 A;  2MHR A;  4N4W A;  4CX9 A;  3MX3 A;  1LI5 A;  2CNW D;  2LFF A;  3FMS A;  3M15 A;  4FWV A;  4IAO A;  3TOM A;  4O7G A;  3VF0 A;  4P9F A;  3AGT A;  4EWC A;  3M79 A;  1SF8 A;  4H4K C;  1YZA A;  3ABK C;  3DXJ F;  4CS9 A;  4E0H A;  1NU9 C;  3H2V A;  1GM5 A;  2NSG A;  1CPR A;  4AK9 A;  3B0U X;  3WHN A;  1HW2 A;  2R7U A;  4G7O F;  3T9O A;  4E0I A;  4AL1 A;  4DVY P;  1ZW3 A;  3MYI A;  5E3A A;  3H65 A;  2L6G A;  3S90 A;  1D1C A;  1RJ9 B;  3DM9 B;  3N0T A;  4MTF A;  4QI0 A;  3CQZ A;  3B29 A;  1JAF A;  2J9W A;  4MVZ A;  4A4A A;  1OKK A;  5KYX A;  5KYN A;  2FGY A;  1Z3I X;  4MVO A;  3ABM C;  2NUP B;  4YL0 A;  1ZHX A;  3S29 A;  1BDJ B;  2OU6 A;  5JRA A;  2R7X A;  3DE9 A;  1J8M F;  2YEV A;  1E2X A;  3C8Z A;  4U5B E;  2CDQ A;  5A6K A;  3F47 A;  1MQV A;  4JJF A;  1V74 B;  4XPW A;  2VB6 A;  1Q0M A;  3RH3 A;  1D1B A;  4IGG A;  1YYX A;  1QZX A;  2IXO A;  2VCC A;  4CJG A;  2B0J A;  3NKE A;  3SP1 A;  4OIP F;  2ZXW C;  2CNW A;  3CSK A;  1MND A;  1T6I A;  1ORJ A;  2L9J A;  3GAN A;  3NMJ A;  3EZH A;  4ZLC A;  3W2W A;  1BR2 A;  1NFN A;  4C3B A;  2E87 A;  4GQH A;  2GFH A;  1D0X A;  3I4U A;  2EPK X;  2YVK A;  5DVW A;  5AC4 A;  4CS7 A;  3KYI A;  3EHM A;  3B71 A;  4B6I A;  1VLS A;  2F22 A;  2MYS A;  2X51 A;  3LUT B;  4K0D A;  3TD7 A;  3LAY A;  3DM5 A;  1U89 A;  1ZHY A;  3Q7L A;  4AL0 A;  3JZ0 A;  3UGO A;  1FFT C;  1LI7 A;  1ZZP A;  3RVZ A;  5D92 A;  4MQ9 F;  2J9B A;  4N6H A;  3L8J A;  5CI9 A;  2QTV A;  4FES A;  3K6B A;  3JRM O;  3NKD A;  3L8I A;  3S0X A;  1WGW A;  1R4T A;  2WZG A;  3H2U A;  3IEE A;  1TFK B;  3DJU B;  3LEV A;  2R7R A;  4JUR I;  1RKE B;  2HZ8 A;  3LS1 A;  4IJJ A;  2P1A A;  1I4Y A;  4LDK A;  4PK4 A;  4YT4 A;  1NBB A;  3LLI A;  2LCH A;  1BBH A;  1C02 A;  3ZQV A;  1YA9 A;  3IQ6 A;  1OW8 A;  5CI8 A;  3C8G D;  2R7W A;  2LD6 A;  3EHN A;  1HMO A;  3TJ6 A;  1OCC C;  1E85 A;  1YYJ A;  3RIP A;  2WVN A;  3UGP A;  3R2P A;  3HNJ A;  1TR2 A;  1YA7 O;  2G62 A;  3GWL A;  2R7V A;  2C03 A;  3I5Q A;  4XPX A;  1CGO A;  2H7O A;  3T4R A;  1A7V A;  2OJE D;  2XLD A;  2BL2 A;  3SNH A;  4HEA J;  1XWJ A;  2H7V C;  3ZG1 A;  3PHF 2;  1QPU A;  4F4B A;  3FHD A;  1Q0K A;  2AWC A;  4JTC B;  2WVQ A;  3K66 A;  5COG A;  4PAC A;  4QDL A;  2Q7R A;  3ZVR A;  5JUA A;  4I3M A;  4LDQ A;  3IQT A;  4Q4Z F;  2YL0 A;  4JRZ A;  4LDR A;  2A1D D;  2VC9 A;  1TWC A;  4MVR A;  1FAP B;  1OCO C;  4RD9 A;  1CGM E;  2VAS A;  2NUT B;  3C7J A;  1RCP A;  2DB4 A;  3MYF A;  3K1H A;  1WN0 A;  1OW6 A;  2KW3 C;  3KPH A;  5EGY A;  4JIO A;  1C03 A;  4BJ5 C;  1Z7Q c;  1B68 A;  5L3Q A;  3LES A;  4BJ1 A;  2PNO A;  2LIG A;  3KKB A;  2J7P A;  1FMV A;  2EIM C;  2IXN A;  3O55 A;  3I5P A;  2NUT A;  3LNM B;  3TK0 A;  3LLK A;  2YL3 A;  4C3D A;  2QUP A;  1WTY A;  4QI2 A;  2IXM A;  3G4Z A;  5FZT A;  2M64 A;  3ECS A;  1MNE A;  1E83 A;  3SXY A;  3JYY A;  3RKO F;  4XLN F;  3CEX A;  2Q3T A;  5DS4 A;  1N1C A;  4HFF B;  1VYK A;  2QLA A;  4GYT A;  1I4Z A;  1WWP A;  1T6Q A;  2CGE A;  3BEH A;  4NC3 A;  2VCB A;  1EI7 A;  3AQB A;  4U9D A;  1HMD A;  2LFD A;  4K7B A;  4A2N B;  1LVK A;  1Y4C A;  4EKW A;  2R9R B;  2RSE B;  2HV7 A;  3W4Y A;  3NDB B;  3DMD A;  4RDA A;  3ABL C;  1DOV A;  3US6 A;  2A68 F;  3X2Q C;  4IRU A;  2L6H A;  1TWH A;  1OR2 A;  2L81 A;  4G0H A;  2XL8 A;  4YT2 A;  1QQ3 A;  3GWN A;  2XLE A;  3T6G B;  1KTM A;  1FR0 A;  1QKR A;  3EJN A;  3TQO A;  1M2V A;  2HJM A;  2XLM A;  2ZPA A;  3ZC4 A;  1FTS A;  3M4C A;  1D0Z A;  4XPY A;  1VTM P;  3KL4 A;  2Y3B A;  3QW1 A;  4NTF A;  3U0C A;  3EG9 B;  2KK1 A;  1R5I D;  1OXK A;  2PFD A;  3W8H A;  4AE4 A;  3RYL A;  2V26 A;  2YHS A;  1O3U A;  1VMA A;  3GOR A;  4U5C E;  1NLX A;  3S27 A;  2NPU A;  4D4X A;  1WAT A;  4XQ1 A;  2XLO A;  5JP7 A;  1YLM A;  1V55 C;  3TOL A;  2W9Y A;  2YLG A;  4FAP B;  1LS1 A;  2LQG A;  3NYJ A;  4NTB A;  1ZYR F;  1ZHW A;  4EHP A;  5JS5 A;  1NZE A;  2Q9C A;  3U9M A;  1YDI A;  1ZVZ A;  1Q0D A;  2A0B A;  4IB4 A;  2TMV P;  1TWG A;  2MWQ A;  1LE2 A;  4XEF A;  1ORY A;  1MMN A;  4U5D E;  4Z9H A;  2P61 A;  5KYY A;  4YN0 B;  2JPU A;  4EIY A;  2W4M A;  4J7T A;  1QVX A;  4N6C A;  5B3I A;  3PCV A;  4BJ6 A;  1ZU5 A;  4IAR A;  2GDC A;  1A7E A;  4XLP F;  4GEH A;  3DWW A;  1RKC A;  5E2Q A;  1SZI A;  1SYQ A;  2R03 A;  3C62 A;  5L0H A;  4DRH B;  3KH2 A;  3Q6N A;  4FX5 A;  3B0P A;  3N24 A;  5KYW B;  1G4U S;  3SYN A;  3R7C A;  4JKV A;  1K04 A;  2G3V A;  5JLI A;  4G7H F;  1AVO B;  2R7S A;  2YQY A;  2J46 A;  1M56 C;  2A6E F;  3MFN A;  2J9U A;  2XS8 A;  2XRH A;  3OEO A;  4EUK B;  4LAC B;  2J0X A;  4MTO A;  3QW0 A;  5DQZ A;  4E18 A;  4U5H A;  4ONS A;  2P0N A;  2LSE A;  2WZL A;  3U9J A;  2L7A A;  1BR4 A;  4D4N A;  1EQ1 A;  1YZC A;  3FVY A;  4BJ5 A;  4XWJ A;  4Z9J A;  4BJ6 C;  4KI2 A;  5DS6 A;  3HTK C;  2FAP B;  5DLJ A;  1E84 A;  2EPM X;  3FAJ A;  4DVZ A;  3S28 A;  2PX3 A;  3U8P A;  2R02 A;  4YK5 A;  5BUO A;  3E70 C;  1MMA A;  3RQE A;  4LER A;  5BQG A;  2A6H F;  4C7O B;  2XL4 A;  1S05 A;  3GEE A;  2NUP A;  2WZF A;  5JT4 A;  5L0I A;  1AEP A;  4ER9 A;  5KYU B;  3GM2 A;  4CDV A;  5T3W A;  3K1I A;  2IXP A;  1TWA A;  1I5N A;  2YLD A;  4G78 A;  1XZQ A;  5B3S C;  2ZXR A;  3NYM A;  1OR3 A;  4I1O B;  1G8X A;  1PD0 A;  5E33 A;  2UUI A;  4X0R A;  4OIR F;  4KBL A;  1HE9 A;  2EPN A;  2XM0 A;  5B1B C;  2OEX A;  4CDA A;  5AC5 A;  3U8V A;  1Y6D A;  5E3C A;  5CIV A;  2HSB A;  3C8G B;  2L6F A;  1ZHT A;  1PCX A;  4JZA A;  2CW0 F;  2JD3 A;  1G4W R;  2QY9 A;  1RMV A;  2YWA A;  3GEH A;  1JMW A;  3FAP B;  4BEM J;  1LS4 A;  2QNL A;  2YL7 A;  2XXA B;  1OCZ C;  3TUL A;  3QVZ A;  3DI5 A;  2HV6 A;  5T3T A;  1ZW2 A;  2OCC C;  1VB5 A;  5HV9 A;  3EGX A;  1S7Z A;  2DYR C;  1SR2 A;  2KYH A;  3AQC A;  3FOO A;  4U5E E;  3JSZ A;  1MMD A;  4JTD B;  2J7P D;  4U5G A;  1T01 A;  2OEV A;  1GQA A;  3L0I A;  3QVY A;  1XZP A;  2IOQ A;  2Q9A A;  3NYL A;  3A9C A;  2ZXP A;  4YWQ A;  4CIH A;  3UMK A;  1O5H A;  4MW3 A;  4OIQ F;  1W2W A;  4DOZ A;  1M57 C;  1PD1 A;  5EK0 A;  4CIP A;  3C63 A;  4YJW A;  2GA0 A;  3EGD A;  5A6B D;  2C04 A;  3EQL F;  1JRA A;  5AGF A;  4PJM A;  3VYW A;  1VOM A;  4MTG A;  2R7Q A;  1HW1 A;  1U6H A;  3SEO A;  3K1I C;  4PJL A;  4I1M A;  4BG0 A;  3JRT A;  3QMK A;  3AOU A;  3DAG A;  3EH1 A;  1BZ4 A;  2I8B A;  3NG1 A;  2LK4 A;  2HFI A;  3RQF A;  2A69 F;  1ORS C;  4JCH A;  3UMH A;  2P7V A;  1VLT A;  3LNR A;  3ATP A;  3ASN C;  4MS2 A;  1L7C A;  2J0W A;  5COM A;  4YL1 A;  4DBQ A;  2R25 A;  4OD4 A;  2YRF A;  3UNG C;  3ZDL A;  4G7Z F;  4Q5S F;  3IQ5 A;  1JR8 A;  5HSW A;  4XEK A;  2W45 A;  4WGZ A;  1M6T A;  2M4E A;  1K05 A;  2XM4 A;  2Y3D A;  3RF3 A;  3LEO A;  3SXK A;  2J8W A;  3V5Z A;  1F1M A;  3S84 A;  1H9T A;  3CAX A;  3VM6 A;  1FMW A;  1WAS A;  2Q9B A;  3DE8 A;  4W8P A;  3KYJ A;  1HE1 A;  4DBR A;  5DS5 A;  4OIO F;  1Q0F A;  4JJG A;  1OCR C;  4Z9I A;  4HFK B;  4N06 A;  3W8I A;  2YL1 A;  1EA8 A;  4BEJ A;  5BQH A;  2IBF A;  3W2V A;  1QSP A;  2HS5 A;  3GEI A;  2ICW G;  3JSE O;  3WOD F;  3SXZ A;  2OQM A;  5KYU A;  3ZIB A;  5KYY B;  3PDM P;  3DKA A;  4NCQ A;  1JPN A;  4Q7C A;  3FOP A;  4H54 A;  256B A;  1NU7 D;  2WB7 A;  3ZQY A;  1NG1 A;  5BQI A;  1AUE A;  3S9O A;  4M63 A;  3DAF A;  3QTH A;  5K0I A;  1IW7 F;  3LJB A;  3QZC A;  1T9K A;  2RD9 A;  4K1O A;  3OWT A;  3MLG A;  3U3B A;  4LLC A;  4HE8 D;  1A7D A;  4ANJ A;  3AG4 C;  2Z15 A;  2FFH A;  4J32 B;  4E7Z A;  3ASO C;  4P9T A;  2KQ9 A;  2J9V A;  2NG1 A;  2XL6 A;  1D1A A;  3X1O A;  2H8A A;  5L0C A;  4ULV A;  2H7B A;  5JSL A;  3B9Q A;  3DD7 A;  4J30 B;  4EBK A;  3M4B A;  4NQF A;  4PFP A;  2OOC A;  1J8Y F;  5T1D B;  2IM8 A;  1T5O A;  5A6J A;  1ZHZ A;  3NRH A;  5KYX B;  2A0U A;  1H6G A;  1A0B A;  1MMG A;  3A11 A;  5L0G A;  2EIK C;  1OKK D;  2PF4 E;  3BRJ A;  3JYH A;  1UG7 A;  1O87 A;  2EIN C;  1VK5 A;  1BR1 A;  1LE4 A;  1OQC A;  4E17 A;  2P6V A;  2CCY A;  3EGD B;  3M1C B;  2GWW A;  1M2V B;  3GM1 A;  4C7O A;  2Q00 A;  3G50 A;  2I15 A;  3FXH A;  1CPQ A;  4JVS A;  2NSF A;  3NMI A;  4WAB A;  4E7S A;  4OIN F;  1H9G A;  2EIL C;  3HKK A;  2D5R B;  2HMQ A;  4J7Y A;  5F28 E;  3AGU A;  2KNH A;  2V3C C;  2WVO A;  1Z23 A;  3T6J A;  1A41 A;  1Q0G A;  4EBJ A;  4KNV A;  5GPG B;  3VRC A;  3OA1 A;  4BPM A;  5JVE A;  1G5Z A;  4YT8 A;  4WGY A;  1APC A;  1GGQ A;  3CZ6 A;  3Q7G A;  3WG7 C;  4C3E A;  1ST6 A;  1OXB A;  5FCL A;  4NY3 A;  1M2O A;  2XXA A;  3O10 A;  3U2L A;  1YJG A;  3JT1 A;  3KMI A;  3B0V C;  3POV A;  2XLH A;  5COF A;  2ASR A;  1V54 C;  2CYD A;  4JC7 A;  4CS9 C;  2Y3G A;  2Q4F A;  2HSQ A;  1TFO B;  2GAQ A;  2QE9 A;  3IPM O;  3K7D A;  4DJ9 A;  2XS1 A;  3F46 A;  4MVQ A;  1IZM A;  3EH2 A;  4XEV A;  4AX2 A;  3WAQ A;  2HUJ A;  3IHU A;  1YAR O;  5F5F A;  3ZTZ A;  5EHH A;  3E9V A;  5L0J A;  2R7T A;  3K33 A;  4I44 A;  3RW0 A;  3N2Z B;  1SMY F;  1PV3 A;  4ZLD A;  1RJ9 A;  1C17 M;  1UFB A;  3GOD A;  4KNW A;  4R32 A;  3AJM A;  3DJN B;  1VYI A;  3ZSU A;  4UDV A;  1JPJ A;  1KU2 A;  1KNY A;  2KC3 A;  2ZXO A;  3UR3 C;  4KC9 A;  3GM3 A;  3HNL A;  4YL3 A;  3L1M A;  4YT5 A;  2X0C A;  4JW1 A;  4PFO A;  4CSA C;  2EPO A;  2IYL D;  4O6N A;  4BJT A;  2KSF A;  4ULW A;  4DRJ B;  4MND A;  1NSG B;  1T6U A;  2Y3H A;  2O9X A;  2OG2 A;  3C8G A;  2EIJ C;  5A6B A;  3UMI A;  2HKV A;  3ZTM A; 
#chains in the Genus database with same CATH homology
 4J7T A;  4JCZ A;  4WAB A;  3PCV A;  4NTF A;  2Q7R A;  3HKK A;  2H8A A;  4J7Y A;  3DWW A;  4YK5 A;  5BQH A;  4JRZ A;  5BQG A;  5HV9 A;  4BPM A;  4AL1 A;  4YL1 A;  4YL3 A;  5BQI A;  4NTB A;  3B29 A;  5K0I A;  2PNO A;  4NTA A;  2UUH A;  2UUI A;  4JC7 A;  4AL0 A;  4YL0 A;  3LEO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...