2XL8A

Reduced structure of r124f mutant of cytochrome c' from alcaligenes xylosoxidans
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
126
structure length
126
Chain Sequence
EFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYFKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C'
publication title Distal-to-Proximal No Conversion in Hemoproteins: The Role of the Proximal Pocket.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Electron transport
total genus 50
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2010-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 2xl8A00
4JEBA 3QVYA 2XLEA 3FOOA 3HNIA 1CGOA 1QPUA 3HNKA 2XLVA 1RCPA 3DE8A 4NC3A 4N6HA 2YKZA 4IB4A 4CDYA 1YYJA 2YL7A 3VRCA 2XLWA 4U9DA 3ZQYA 4CJOA 4WGYA 1QQ3A 1E86A 3QVZA 3TOMA 2QLAA 4JE9A 3IQ6A 4D4NA 1E85A 1MQVA 2J9BA 3QW0A 2YLDA 3ZTMA 1YZCA 1GQAA 4JKVA 1JAFA 4EIYA 3NMKA 2XM4A 4L6RA 4IARA 2YL1A 3ZQVA 5JRAA 2XLDA 2XLHA 1S05A 3U8PA 4WGZA 5JT4A 5JP7A 5JSLA 5JLIA 2YLGA 3HNJA 3M4BA 4U9EA 3QW1A 256BA 2J8WA 4N4WA 5B3IA 4CJGA 3NMIA 1CPQA 3ZWIA 3IQ5A 2XLMA 1CGNA 2YLIA 4IAQA 5AGFA 2BC5A 1M6TA 3M4CA 2XLOA 3DE9A 1A7VA 3M15A 3L1MA 1BBHA 1YZAA 5JS5A 3C63A 1NBBA 3FOPA 4CIPA 2XM0A 2YL3A 1E83A 4D4XA 3C62A 1APCA 5JUAA 5JVEA 4CX9A 1LM3B 4ULVA 3NMJA 2YL0A 4ER9A 1YYXA 2XL6A 2XL8A 3TOLA 3HNLA 4JEAA 2CCYA 4CDVA 1CPRA 4CDAA 3M79A 1E84A 3ZTZA 1EKYA
chains in the Genus database with same CATH superfamily
3ECSA 2J7PA 3DM9B 5E2QA 4Q4ZF 2EIMC 2R02A 3M1CB 4LDKA 2J45A 3GEIA 1H9GA 1CGOA 1UG7A 1ZHZA 2YHSA 2XS1A 2RSEB 5CI9A 3RF3A 5AC4A 5BUOA 2ZXWC 5EGYA 2XLVA 3DE8A 2IXOA 2YKZA 3EGXA 1MMDA 4U5GA 4CDYA 1YYJA 1AUEA 1NLXA 4JTDB 1G5ZA 3MFNA 3FAPB 2Q9AA 1ZVZA 3G50A 4CS9C 1NFOA 3GWNA 3IPMO 2KK1A 1C02A 2H7VC 4E7ZA 4A2NB 4NCQA 4FAPB 4BJ5A 5KYWB 2D5RB 4P9TA 1JPJA 2AWYA 1VMAA 1ZYRF 4YT2A 5L0IA 2A1DD 3NDBB 1K40A 3E9VA 4BJTA 3RKOF 2QLAA 3CZ6A 3UR3C 5KYUB 2L6GA 3IQ6A 3U3FA 1NG1A 1MQVA 4XPWA 2KJGA 5T1DB 2LIGA 1RKEA 2WB7A 3QW0A 4MW3A 1RMVA 4IRUA 4CSAA 2ICWG 1VYKA 5EK0A 1Q0FA 2J9UA 3EQLF 4JKVA 2D4UA 1RKCA 3AGTA 4MVQA 4AE4A 1GS9A 2EPOA 2XM4A 1LVKA 4H54A 1ST6A 5TJ5E 3U0CA 2OCCC 4KI2A 3C8GA 2G3KA 3IHUA 2HSQA 3JZ0A 3ZIBA 3K33A 3N2ZB 3RYLA 3MBGA 5JRAA 1BDJB 5DVWA 2IXPA 1V4AA 3I5PA 4JTCB 1VTMP 3DJNB 4CSAC 3EH2A 1QZXA 2HFIA 4GQHA 4YT8A 2P1AA 3MYIA 4OIQF 1WN0A 3C18A 2H7OA 4LLCA 4X0RA 1LKXA 4ANJA 3U3BA 3KMIA 1M56C 2QUPA 2QTVA 3EG9B 1PD0A 1HMDA 2M4EA 2NG1A 3DZAA 4MVRA 3U2LA 2Y3HA 5F5HA 4NTFA 1XZQA 4MS2A 2DB4A 1I4ZA 3ZVRA 2FAPB 5KYYB 3KL4A 3UGOA 2XXAB 3K6BA 4MTFA 2XS8A 3SXYA 2HZ8A 3LNMB 4F4BA 4JVSA 4YK5A 4U5CE 4J32B 3ZDLA 2XLMA 1IW7F 3KKBA 3RVZA 2R7VA 2LSEA 2BC5A 2W4BA 1M6TA 1OW8A 4QDLA 2X0CA 3C8ZA 2UUIA 2WZFA 5A6BD 1QVXA 4A4AA 1BBHA 2NUPA 1Z5ZA 2KQ9A 2Q4FA 3EZIA 4JCZA 2IYLD 1YARO 2GAQA 3US6A 5JS5A 4EHPA 2WL8A 3AG1C 1SR2A 1YA9A 3C63A 4CS9A 3O39A 4Z9HA 1E83A 3DAGA 3JRTA 4WJ0A 1HW2A 2WZGA 5JVEA 1DOVA 1I5NA 3S28A 4EWCA 1RJ9A 3GODA 2B0JA 4MVOA 3G4ZA 4FWVA 2Y39A 4DRJB 4BEJA 2AU5A 3PHF2 2DYRC 3RQFA 2FGYA 2JX0A 3ASOC 4N06A 5DQZA 2YL0A 4G78A 4OIOF 5L0GA 1FFTC 3AG2C 1EQ1A 3G4XA 1FMWA 1BZ4A 2OJED 4KBLA 3TJ5A 3VYWA 1D1CA 3FDQA 4BEMJ 2J7PD 1OW6A 1WATA 3EFOB 4AL0A 2A0BA 4XWJA 1ORYA 1YYXA 2C03A 4O6YA 2XL8A 3SNHA 2R7SA 1TWAA 3LJBA 4OD4A 2LD6A 3RQEA 3WODF 4R32A 4IJJA 3RIPA 2Q3TA 1L7CA 4GYTA 4K0DA 3K1HA 5E3CA 5KYUA 4C7OB 1OCRC 3BRJA 2KGOA 5D91A 4MVZA 4BJ6A 2WVNA 1Z3IX 4LERA 2AWCA 2XLEA 3FHDA 3FOOA 2NSFA 3T6BA 2R7UA 1KNYA 1PD1A 3EZHA 1QPUA 1XZPA 2Y3GA 3LS0A 1Q0KA 3IEEA 4N6HA 5FCLA 4ZLCA 1MNDA 1ORSC 5EHHA 5A69A 3FXHA 3CAXA 3NYJA 2XLWA 3TJ6A 1JR8A 1M57C 4BJ6C 2VB6A 3DWWA 4CJOA 1HE9A 2CW0F 1QSPA 2HMQA 2YQYA 3JYYA 4K1OA 3OEOA 4O6MA 3TOMA 1LIHA 1HY5A 4PFPA 1VB5A 2YWAA 3C7JA 3GANA 3GORA 4P6IC 3C8GD 5L3QA 2W4MA 4JW1A 1VLSA 4E17A 1Q0DA 4MVSA 4W8KA 2I8BA 1DOWA 1MNEA 3L34A 4JJFA 3LS1A 3N24A 1YZCA 4JURI 1U6HA 1F1MA 4U5DE 1H9TA 4HFFB 1GQAA 3V5ZA 1JPNA 4EIYA 3HKKA 1HE1A 3NMKA 2HJ3A 2UUHA 2VH3A 1GGQA 3CQZA 3I4UA 2YVKA 4DVZA 4YWQA 3RH3A 3W2WA 3F47A 5T3WA 1IZMA 3SXKA 3QTHA 2XLDA 5CI8A 4G0HA 3AG3C 3W2VA 4NTAA 5IY5C 3TD7A 1ZZPA 2EPLX 4E0IA 2X51A 4HFKB 4E7SA 4PFOA 5E33A 2W45A 3RW0A 3Q7GA 4P9FA 4FX5A 5JP7A 3NG1A 1OCCC 5JSLA 5DS6A 3NKEA 4IAOA 3RQGA 4E18A 3NKDA 2PX3A 3LLIA 2YLGA 1D1AA 3M4BA 1D1BA 1MMNA 3VF0A 3DAFA 1U89A 2KYHA 4XEKA 4N4WA 3EGDB 3GM3A 1TFKB 4EBKA 4CJGA 4CS7A 3NMIA 1D0ZA 1LPEA 2HSBA 5HV9A 4MTOA 1CPQA 1MMGA 3ZWIA 3S90A 1G4US 3UMHA 1J8YF 1TWGA 2YZSA 2ZXPA 3MYFA 1JOGA 2E87A 4RBNA 3QZCA 5AGFA 2A0UA 3M4CA 1LS4A 1TQGA 2XLOA 1FFHA 1A7VA 2Q9CA 2PBEA 2HUJA 1ZU5A 2IOQA 3EG9A 3L1MA 4ULWA 1YZAA 3UNGC 3B0UX 1A41A 3ASNC 3QMKA 1OQCA 2ZXOA 3E70C 3U9JA 5KYYA 1NBBA 4G7ZF 1N1CA 3U5SA 4CIPA 2L6HA 2XM0A 4D4XA 2OU6A 3C62A 5FZTA 1YVIA 1A7DA 2VCCA 3U8VA 2NUTB 3ZG1A 1W2WA 5COMA 1ZU4A 3H65A 4I3MA 4CS8A 3OWTA 4CX9A 4I44A 4PJNA 3WHNA 1FNTc 3W4YA 4XEVA 4PJJA 2NSGA 4LACB 3EJNA 1G8XA 3TK0A 3WAQA 2KC3A 1OKKA 4OINF 1Z63A 1VLTA 1KTMA 2JD3A 4I1MA 1WASA 2EINC 4QI2A 2IXNA 1T01A 2C04A 4NTBA 4CS8C 3S0XA 4G7OF 2R25A 4O6NA 5T3TA 4QI0A 2I15A 1YJGA 2OQMA 4ER9A 3B0PA 5B3SC 2OKUA 3ATPA 3T6JA 2IM8A 3TOLA 1G4WR 1SYQA 2W9YA 1M2VB 1Y4CA 1H6GA 3LESA 1TWCA 5CIVA 3PDMP 4G7HF 3SZRA 4MVUA 2IXMA 4JIOA 2YEVA 4CDAA 2GFHA 2PF4E 3M79A 4MTGA 4EKWA 1EKYA 2P7VA 4JCHA 4HE8D 1BR1A 5AC5A 3QVYA 2MWQA 3FVYA 3L8IA 2CDQA 2OEVA 3CSKA 3EFOA 1ZW2A 3HNKA 1RCPA 3CEXA 4JTAB 4LDQA 4DBRA 3HTKC 4KNVA 1V74B 2WZLA 3JT1A 2NPUA 2YL7A 3HLZA 3VRCA 4Z9IA 2FFHA 3ZQYA 1SZIA 1A0BA 2QE9A 4WGYA 1EI7A 3FAJA 2MYSA 3H2VA 5GPGB 2Q9BA 2HV7A 3SXZA 1Z7Qc 4CIHA 3BEHA 4Q7CA 3B0VC 2R7QA 3I5QA 2VASA 2OJQA 3JYHA 4JE9A 4DBQA 2ETSA 4D4NA 5K0IA 2CNWD 1RXQA 3GM2A 1E85A 4MW8A 3KYIA 2EILC 1HW1A 4U5EE 5L0JA 1TWHA 3B9QA 2LQGA 3FMSA 4PJMA 2R7WA 2V26A 3IQCA 2H7BA 2P61A 2G62A 1LE2A 3T9OA 1OR3A 4YN0B 4L6RA 4UDVA 1R5ID 2YL1A 3F46A 3ZQVA 2AVKA 2L9JA 4YT5A 4CBEA 4WABA 1WTYA 1BR2A 2OG2A 3DD7A 4O7GA 4DJ9A 3KYJA 2QNLA 1TKNA 1Z23A 5KYXB 3S84A 4RD9A 5L0FA 1GM5A 2HJMA 5COFA 3JSEO 2XLHA 1S05A 2Y3BA 5KYNA 4WGZA 1FMVA 1Z6AA 1YLMA 3ABKC 5JT4A 1MMAA 1OR2A 1B68A 4EBJA 1UFBA 2LK4A 2IBFA 1D0XA 4KC9A 1SF8A 1YDIA 5JLIA 3PCVA 4W8PA 1AEPA 3VAYA 4DRIB 3MLGA 4O79A 4U9EA 2EIJC 3QW1A 5F28E 3Q7LA 1A7EA 1FR0A 4EUKB 5B1AC 1ZHTA 2J8WA 5B3IA 2M64A 4KNWA 1WGWA 3AG4C 2GDCA 3UGPA 1NU9C 3Q6NA 1NFNA 2L7AA 5L0CA 3EHMA 5D92A 4IAQA 2PX0A 3NYMA 4N6CA 2WVQA 2J0XA 3K7DA 1T5OA 3N0TA 2R9RB 1M2OA 1PCXA 2CNWA 2Q00A 3UMKA 3ABLC 1LS1A 4NY3A 1R4TA 4AK9A 1HMOA 3IQTA 3L8JA 2DI3A 4BPMA 1ZHXA 2P0NA 3EGDA 3S9OA 3POVA 1YAUO 4JZAA 1OKKD 2YL3A 3AQBA 1JRAA 5JUAA 2Q7RA 3ZSUA 3AOUA 1ZHWA 4J7TA 4U5FE 4JJGA 4DXWA 1ZHYA 2HKVA 2O9XA 4PJLA 2GWWA 4ZLDA 1T9KA 1T6UA 2EPKX 3O10A 3LLKA 3JCUQ 4I1OB 5F5FA 1L3PA 4XTKA 4FESA 3HJCA 1OW7A 1K04A 3NMJA 2J9WA 4JC7A 2EPNA 3L0IA 2R7OA 2CGEA 1VOMA 3K1IA 4M63A 2NUTA 3SYNA 3GEHA 2EPMX 2L81A 3EGXB 1S7ZA 4PR9A 2XXAA 2LCHA 3GM1A 2CCYA 4CDVA 2GA0A 2R03A 4YT4A 1LI7A 3V5YA 3GWLA 3W8HA 1O5HA 1XWJA 1AVOB 4YL3A 5BQGA 1EA8A 1OXBA 4DOZA 5L0HA 4Z9JA 2DYSC 3K1IC 3OA1A 3ZTZA 4JEBA 4MVMA 4XQ1A 4BJ5C 5BQHA 2OEXA 5A6JA 3A11A 1WOLA 3HNIA 1V55C 2H8AA 1Q0GA 4NC3A 4GEHA 4IB4A 2BL2A 1RKEB 1M2VA 4U9DA 4LLEA 3SXMA 3T6GB 3JTLO 1O3UA 3AGUA 4U5HA 4XEFA 1TR2A 2A6EF 1QQ3A 4AE4B 3S29A 3DJUB 1E86A 3O55A 4DVYP 1K05A 2PP4A 3C8GB 3QVZA 4BJ1A 2VC9A 5A6AA 1LE4A 1QLEC 3EPVA 2LP4A 4PK4A 1Y6DA 2PFDA 3MX3A 2J9BA 1T6IA 2ZPAA 3GEEA 4YJWA 2YLDA 3ZTMA 3T4RA 4E0HA 1PV3A 1NSGB 1JAFA 2HMZA 5BQIA 3Q6MA 3DI5A 1NU7D 3DXJF 1VK5A 4IARA 2LFFA 3X1OA 2CYDA 2R7TA 3LAYA 3ABMC 2QY9A 2JPUA 1TFOB 3LEVA 1YA7O 2KNHA 4OD5A 4H4KC 3V7OA 2TMVP 2OOCA 3A9CA 1OCZC 4C7OA 2VCAA 1LI5A 3U8PA 2VCBA 1KU2A 3PMRA 4EBBA 2KSFA 3JRMO 4B6IA 4NQFA 3LUTB 3LEOA 3LNRA 3X2QC 1WWPA 5COGA 2HV6A 5HSWA 2ASRA 4YL1A 4IGGA 2A69F 3HNJA 2NUPB 3JSZA 3RFYA 256BA 3K66A 1VYIA 1FAPB 4U5BE 1H7IA 4DRHB 2Y69C 3B71A 1NZEA 5B1BC 5KYXA 3H2UA 1I4YA 3IQ5A 1OXKA 2A6HF 5E3AA 1OCOC 4AX2A 3TULA 1CGNA 1RJ9B 2YLIA 3ITFA 3AQCA 1FTSA 4RDAA 4C3DA 3RVYA 1U0BB 4MQ9F 4XPYA 3WG7C 5DQTA 3DE9A 3M15A 3KH2A 1BR4A 2YRFA 2Z15A 3SP1A 1J8MF 2ZXRA 2RD9A 1O87A 1ORJA 4OIRF 3UMIA 2AP3A 1C03A 5KYWA 2R05A 4C3BA 2J0WA 2J46A 4J7YA 3FOPA 1QKRA 2F22A 3AJMA 4XLNF 2LFDA 3B29A 1APCA 1V54C 2HS5A 3DKAA 3EHNA 4MNDA 4K7BA 1E2XA 2R7RA 5A6KA 5DS4A 5A6BA 3SEOA 3W8IA 2PNOA 2P6VA 4J30B 3ZC4A 1LM3B 4ULVA 3VM6A 2Y3DA 4IWBA 4PACA 4BG0A 4Q5SF 4LDRA 4ONSA 1E84A 3NRHA 4XPXA 1Q0MA 1ZW3A 2BE5F 2MHRA 1C17M 1JMWA 3DMDA 3R2PA 3EH1A 5DLJA 3V5XA 5L0DA 4XLPF 3J06A 2R7XA 3O6XA 1D0YA 3KPHA 4HEAJ 3TQOA 4JRZA 2XSEA 2A68F 2B0HA 2KW3C 3DM5A 4C3EA 3U9MA 4YL0A 3U2MA 2J9VA 2L6FA 1T6QA 2EIKC 2WVOA 2ZD9A 3HNLA 3R7CA 1CGME 1SMYF 4JEAA 4OIPF 3NYLA 2G3VA 2XL4A 3S27A 2DGJA 4AL1A 1CPRA 5DS5A 2V3CC 2XL6A 2XRHA 5L3VA
chains in the Genus database with same CATH topology
4JEBA 3QVYA 2XLEA 3FOOA 3HNIA 1CGOA 1QPUA 3HNKA 2XLVA 1RCPA 3DE8A 4NC3A 4N6HA 2YKZA 4IB4A 4CDYA 1YYJA 2YL7A 3VRCA 2XLWA 4U9DA 3ZQYA 4CJOA 4WGYA 1QQ3A 1E86A 3QVZA 3TOMA 2QLAA 4JE9A 3IQ6A 4D4NA 1E85A 1MQVA 2J9BA 3QW0A 2YLDA 3ZTMA 1YZCA 1GQAA 4JKVA 1JAFA 4EIYA 3NMKA 2XM4A 4L6RA 4IARA 2YL1A 3ZQVA 5JRAA 2XLDA 2XLHA 1S05A 3U8PA 4WGZA 5JT4A 5JP7A 5JSLA 5JLIA 2YLGA 3HNJA 3M4BA 4U9EA 3QW1A 256BA 2J8WA 4N4WA 5B3IA 4CJGA 3NMIA 1CPQA 3ZWIA 3IQ5A 2XLMA 1CGNA 2YLIA 4IAQA 5AGFA 2BC5A 1M6TA 3M4CA 2XLOA 3DE9A 1A7VA 3M15A 3L1MA 1BBHA 1YZAA 5JS5A 3C63A 1NBBA 3FOPA 4CIPA 2XM0A 2YL3A 1E83A 4D4XA 3C62A 1APCA 5JUAA 5JVEA 4CX9A 1LM3B 4ULVA 3NMJA 2YL0A 4ER9A 1YYXA 2XL6A 2XL8A 3TOLA 3HNLA 4JEAA 2CCYA 4CDVA 1CPRA 4CDAA 3M79A 1E84A 3ZTZA 1EKYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JEB A;  3QVY A;  2XLE A;  3FOO A;  3HNI A;  1CGO A;  1QPU A;  3HNK A;  2XLV A;  1RCP A;  3DE8 A;  4NC3 A;  4N6H A;  2YKZ A;  4IB4 A;  4CDY A;  1YYJ A;  2YL7 A;  3VRC A;  2XLW A;  4U9D A;  3ZQY A;  4CJO A;  4WGY A;  1QQ3 A;  1E86 A;  3QVZ A;  3TOM A;  2QLA A;  4JE9 A;  3IQ6 A;  4D4N A;  1E85 A;  1MQV A;  2J9B A;  3QW0 A;  2YLD A;  3ZTM A;  1YZC A;  1GQA A;  4JKV A;  1JAF A;  4EIY A;  3NMK A;  2XM4 A;  4L6R A;  4IAR A;  2YL1 A;  3ZQV A;  5JRA A;  2XLD A;  2XLH A;  1S05 A;  3U8P A;  4WGZ A;  5JT4 A;  5JP7 A;  5JSL A;  5JLI A;  2YLG A;  3HNJ A;  3M4B A;  4U9E A;  3QW1 A;  256B A;  2J8W A;  4N4W A;  5B3I A;  4CJG A;  3NMI A;  1CPQ A;  3ZWI A;  3IQ5 A;  2XLM A;  1CGN A;  2YLI A;  4IAQ A;  5AGF A;  2BC5 A;  1M6T A;  3M4C A;  2XLO A;  3DE9 A;  1A7V A;  3M15 A;  3L1M A;  1BBH A;  1YZA A;  5JS5 A;  3C63 A;  1NBB A;  3FOP A;  4CIP A;  2XM0 A;  2YL3 A;  1E83 A;  4D4X A;  3C62 A;  1APC A;  5JUA A;  5JVE A;  4CX9 A;  1LM3 B;  4ULV A;  3NMJ A;  2YL0 A;  4ER9 A;  1YYX A;  2XL6 A;  2XL8 A;  3TOL A;  3HNL A;  4JEA A;  2CCY A;  4CDV A;  1CPR A;  4CDA A;  3M79 A;  1E84 A;  3ZTZ A;  1EKY A; 
#chains in the Genus database with same CATH topology
 3ECS A;  2J7P A;  3DM9 B;  5E2Q A;  4Q4Z F;  2EIM C;  2R02 A;  3M1C B;  4LDK A;  2J45 A;  3GEI A;  1H9G A;  1CGO A;  1UG7 A;  1ZHZ A;  2YHS A;  2XS1 A;  2RSE B;  5CI9 A;  3RF3 A;  5AC4 A;  5BUO A;  2ZXW C;  5EGY A;  2XLV A;  3DE8 A;  2IXO A;  2YKZ A;  3EGX A;  1MMD A;  4U5G A;  4CDY A;  1YYJ A;  1AUE A;  1NLX A;  4JTD B;  1G5Z A;  3MFN A;  3FAP B;  2Q9A A;  1ZVZ A;  3G50 A;  4CS9 C;  1NFO A;  3GWN A;  3IPM O;  2KK1 A;  1C02 A;  2H7V C;  4E7Z A;  4A2N B;  4NCQ A;  4FAP B;  4BJ5 A;  5KYW B;  2D5R B;  4P9T A;  1JPJ A;  2AWY A;  1VMA A;  1ZYR F;  4YT2 A;  5L0I A;  2A1D D;  3NDB B;  1K40 A;  3E9V A;  4BJT A;  3RKO F;  2QLA A;  3CZ6 A;  3UR3 C;  5KYU B;  2L6G A;  3IQ6 A;  3U3F A;  1NG1 A;  1MQV A;  4XPW A;  2KJG A;  5T1D B;  2LIG A;  1RKE A;  2WB7 A;  3QW0 A;  4MW3 A;  1RMV A;  4IRU A;  4CSA A;  2ICW G;  1VYK A;  5EK0 A;  1Q0F A;  2J9U A;  3EQL F;  4JKV A;  2D4U A;  1RKC A;  3AGT A;  4MVQ A;  4AE4 A;  1GS9 A;  2EPO A;  2XM4 A;  1LVK A;  4H54 A;  1ST6 A;  5TJ5 E;  3U0C A;  2OCC C;  4KI2 A;  3C8G A;  2G3K A;  3IHU A;  2HSQ A;  3JZ0 A;  3ZIB A;  3K33 A;  3N2Z B;  3RYL A;  3MBG A;  5JRA A;  1BDJ B;  5DVW A;  2IXP A;  1V4A A;  3I5P A;  4JTC B;  1VTM P;  3DJN B;  4CSA C;  3EH2 A;  1QZX A;  2HFI A;  4GQH A;  4YT8 A;  2P1A A;  3MYI A;  4OIQ F;  1WN0 A;  3C18 A;  2H7O A;  4LLC A;  4X0R A;  1LKX A;  4ANJ A;  3U3B A;  3KMI A;  1M56 C;  2QUP A;  2QTV A;  3EG9 B;  1PD0 A;  1HMD A;  2M4E A;  2NG1 A;  3DZA A;  4MVR A;  3U2L A;  2Y3H A;  5F5H A;  4NTF A;  1XZQ A;  4MS2 A;  2DB4 A;  1I4Z A;  3ZVR A;  2FAP B;  5KYY B;  3KL4 A;  3UGO A;  2XXA B;  3K6B A;  4MTF A;  2XS8 A;  3SXY A;  2HZ8 A;  3LNM B;  4F4B A;  4JVS A;  4YK5 A;  4U5C E;  4J32 B;  3ZDL A;  2XLM A;  1IW7 F;  3KKB A;  3RVZ A;  2R7V A;  2LSE A;  2BC5 A;  2W4B A;  1M6T A;  1OW8 A;  4QDL A;  2X0C A;  3C8Z A;  2UUI A;  2WZF A;  5A6B D;  1QVX A;  4A4A A;  1BBH A;  2NUP A;  1Z5Z A;  2KQ9 A;  2Q4F A;  3EZI A;  4JCZ A;  2IYL D;  1YAR O;  2GAQ A;  3US6 A;  5JS5 A;  4EHP A;  2WL8 A;  3AG1 C;  1SR2 A;  1YA9 A;  3C63 A;  4CS9 A;  3O39 A;  4Z9H A;  1E83 A;  3DAG A;  3JRT A;  4WJ0 A;  1HW2 A;  2WZG A;  5JVE A;  1DOV A;  1I5N A;  3S28 A;  4EWC A;  1RJ9 A;  3GOD A;  2B0J A;  4MVO A;  3G4Z A;  4FWV A;  2Y39 A;  4DRJ B;  4BEJ A;  2AU5 A;  3PHF 2;  2DYR C;  3RQF A;  2FGY A;  2JX0 A;  3ASO C;  4N06 A;  5DQZ A;  2YL0 A;  4G78 A;  4OIO F;  5L0G A;  1FFT C;  3AG2 C;  1EQ1 A;  3G4X A;  1FMW A;  1BZ4 A;  2OJE D;  4KBL A;  3TJ5 A;  3VYW A;  1D1C A;  3FDQ A;  4BEM J;  2J7P D;  1OW6 A;  1WAT A;  3EFO B;  4AL0 A;  2A0B A;  4XWJ A;  1ORY A;  1YYX A;  2C03 A;  4O6Y A;  2XL8 A;  3SNH A;  2R7S A;  1TWA A;  3LJB A;  4OD4 A;  2LD6 A;  3RQE A;  3WOD F;  4R32 A;  4IJJ A;  3RIP A;  2Q3T A;  1L7C A;  4GYT A;  4K0D A;  3K1H A;  5E3C A;  5KYU A;  4C7O B;  1OCR C;  3BRJ A;  2KGO A;  5D91 A;  4MVZ A;  4BJ6 A;  2WVN A;  1Z3I X;  4LER A;  2AWC A;  2XLE A;  3FHD A;  3FOO A;  2NSF A;  3T6B A;  2R7U A;  1KNY A;  1PD1 A;  3EZH A;  1QPU A;  1XZP A;  2Y3G A;  3LS0 A;  1Q0K A;  3IEE A;  4N6H A;  5FCL A;  4ZLC A;  1MND A;  1ORS C;  5EHH A;  5A69 A;  3FXH A;  3CAX A;  3NYJ A;  2XLW A;  3TJ6 A;  1JR8 A;  1M57 C;  4BJ6 C;  2VB6 A;  3DWW A;  4CJO A;  1HE9 A;  2CW0 F;  1QSP A;  2HMQ A;  2YQY A;  3JYY A;  4K1O A;  3OEO A;  4O6M A;  3TOM A;  1LIH A;  1HY5 A;  4PFP A;  1VB5 A;  2YWA A;  3C7J A;  3GAN A;  3GOR A;  4P6I C;  3C8G D;  5L3Q A;  2W4M A;  4JW1 A;  1VLS A;  4E17 A;  1Q0D A;  4MVS A;  4W8K A;  2I8B A;  1DOW A;  1MNE A;  3L34 A;  4JJF A;  3LS1 A;  3N24 A;  1YZC A;  4JUR I;  1U6H A;  1F1M A;  4U5D E;  1H9T A;  4HFF B;  1GQA A;  3V5Z A;  1JPN A;  4EIY A;  3HKK A;  1HE1 A;  3NMK A;  2HJ3 A;  2UUH A;  2VH3 A;  1GGQ A;  3CQZ A;  3I4U A;  2YVK A;  4DVZ A;  4YWQ A;  3RH3 A;  3W2W A;  3F47 A;  5T3W A;  1IZM A;  3SXK A;  3QTH A;  2XLD A;  5CI8 A;  4G0H A;  3AG3 C;  3W2V A;  4NTA A;  5IY5 C;  3TD7 A;  1ZZP A;  2EPL X;  4E0I A;  2X51 A;  4HFK B;  4E7S A;  4PFO A;  5E33 A;  2W45 A;  3RW0 A;  3Q7G A;  4P9F A;  4FX5 A;  5JP7 A;  3NG1 A;  1OCC C;  5JSL A;  5DS6 A;  3NKE A;  4IAO A;  3RQG A;  4E18 A;  3NKD A;  2PX3 A;  3LLI A;  2YLG A;  1D1A A;  3M4B A;  1D1B A;  1MMN A;  3VF0 A;  3DAF A;  1U89 A;  2KYH A;  4XEK A;  4N4W A;  3EGD B;  3GM3 A;  1TFK B;  4EBK A;  4CJG A;  4CS7 A;  3NMI A;  1D0Z A;  1LPE A;  2HSB A;  5HV9 A;  4MTO A;  1CPQ A;  1MMG A;  3ZWI A;  3S90 A;  1G4U S;  3UMH A;  1J8Y F;  1TWG A;  2YZS A;  2ZXP A;  3MYF A;  1JOG A;  2E87 A;  4RBN A;  3QZC A;  5AGF A;  2A0U A;  3M4C A;  1LS4 A;  1TQG A;  2XLO A;  1FFH A;  1A7V A;  2Q9C A;  2PBE A;  2HUJ A;  1ZU5 A;  2IOQ A;  3EG9 A;  3L1M A;  4ULW A;  1YZA A;  3UNG C;  3B0U X;  1A41 A;  3ASN C;  3QMK A;  1OQC A;  2ZXO A;  3E70 C;  3U9J A;  5KYY A;  1NBB A;  4G7Z F;  1N1C A;  3U5S A;  4CIP A;  2L6H A;  2XM0 A;  4D4X A;  2OU6 A;  3C62 A;  5FZT A;  1YVI A;  1A7D A;  2VCC A;  3U8V A;  2NUT B;  3ZG1 A;  1W2W A;  5COM A;  1ZU4 A;  3H65 A;  4I3M A;  4CS8 A;  3OWT A;  4CX9 A;  4I44 A;  4PJN A;  3WHN A;  1FNT c;  3W4Y A;  4XEV A;  4PJJ A;  2NSG A;  4LAC B;  3EJN A;  1G8X A;  3TK0 A;  3WAQ A;  2KC3 A;  1OKK A;  4OIN F;  1Z63 A;  1VLT A;  1KTM A;  2JD3 A;  4I1M A;  1WAS A;  2EIN C;  4QI2 A;  2IXN A;  1T01 A;  2C04 A;  4NTB A;  4CS8 C;  3S0X A;  4G7O F;  2R25 A;  4O6N A;  5T3T A;  4QI0 A;  2I15 A;  1YJG A;  2OQM A;  4ER9 A;  3B0P A;  5B3S C;  2OKU A;  3ATP A;  3T6J A;  2IM8 A;  3TOL A;  1G4W R;  1SYQ A;  2W9Y A;  1M2V B;  1Y4C A;  1H6G A;  3LES A;  1TWC A;  5CIV A;  3PDM P;  4G7H F;  3SZR A;  4MVU A;  2IXM A;  4JIO A;  2YEV A;  4CDA A;  2GFH A;  2PF4 E;  3M79 A;  4MTG A;  4EKW A;  1EKY A;  2P7V A;  4JCH A;  4HE8 D;  1BR1 A;  5AC5 A;  3QVY A;  2MWQ A;  3FVY A;  3L8I A;  2CDQ A;  2OEV A;  3CSK A;  3EFO A;  1ZW2 A;  3HNK A;  1RCP A;  3CEX A;  4JTA B;  4LDQ A;  4DBR A;  3HTK C;  4KNV A;  1V74 B;  2WZL A;  3JT1 A;  2NPU A;  2YL7 A;  3HLZ A;  3VRC A;  4Z9I A;  2FFH A;  3ZQY A;  1SZI A;  1A0B A;  2QE9 A;  4WGY A;  1EI7 A;  3FAJ A;  2MYS A;  3H2V A;  5GPG B;  2Q9B A;  2HV7 A;  3SXZ A;  1Z7Q c;  4CIH A;  3BEH A;  4Q7C A;  3B0V C;  2R7Q A;  3I5Q A;  2VAS A;  2OJQ A;  3JYH A;  4JE9 A;  4DBQ A;  2ETS A;  4D4N A;  5K0I A;  2CNW D;  1RXQ A;  3GM2 A;  1E85 A;  4MW8 A;  3KYI A;  2EIL C;  1HW1 A;  4U5E E;  5L0J A;  1TWH A;  3B9Q A;  2LQG A;  3FMS A;  4PJM A;  2R7W A;  2V26 A;  3IQC A;  2H7B A;  2P61 A;  2G62 A;  1LE2 A;  3T9O A;  1OR3 A;  4YN0 B;  4L6R A;  4UDV A;  1R5I D;  2YL1 A;  3F46 A;  3ZQV A;  2AVK A;  2L9J A;  4YT5 A;  4CBE A;  4WAB A;  1WTY A;  1BR2 A;  2OG2 A;  3DD7 A;  4O7G A;  4DJ9 A;  3KYJ A;  2QNL A;  1TKN A;  1Z23 A;  5KYX B;  3S84 A;  4RD9 A;  5L0F A;  1GM5 A;  2HJM A;  5COF A;  3JSE O;  2XLH A;  1S05 A;  2Y3B A;  5KYN A;  4WGZ A;  1FMV A;  1Z6A A;  1YLM A;  3ABK C;  5JT4 A;  1MMA A;  1OR2 A;  1B68 A;  4EBJ A;  1UFB A;  2LK4 A;  2IBF A;  1D0X A;  4KC9 A;  1SF8 A;  1YDI A;  5JLI A;  3PCV A;  4W8P A;  1AEP A;  3VAY A;  4DRI B;  3MLG A;  4O79 A;  4U9E A;  2EIJ C;  3QW1 A;  5F28 E;  3Q7L A;  1A7E A;  1FR0 A;  4EUK B;  5B1A C;  1ZHT A;  2J8W A;  5B3I A;  2M64 A;  4KNW A;  1WGW A;  3AG4 C;  2GDC A;  3UGP A;  1NU9 C;  3Q6N A;  1NFN A;  2L7A A;  5L0C A;  3EHM A;  5D92 A;  4IAQ A;  2PX0 A;  3NYM A;  4N6C A;  2WVQ A;  2J0X A;  3K7D A;  1T5O A;  3N0T A;  2R9R B;  1M2O A;  1PCX A;  2CNW A;  2Q00 A;  3UMK A;  3ABL C;  1LS1 A;  4NY3 A;  1R4T A;  4AK9 A;  1HMO A;  3IQT A;  3L8J A;  2DI3 A;  4BPM A;  1ZHX A;  2P0N A;  3EGD A;  3S9O A;  3POV A;  1YAU O;  4JZA A;  1OKK D;  2YL3 A;  3AQB A;  1JRA A;  5JUA A;  2Q7R A;  3ZSU A;  3AOU A;  1ZHW A;  4J7T A;  4U5F E;  4JJG A;  4DXW A;  1ZHY A;  2HKV A;  2O9X A;  4PJL A;  2GWW A;  4ZLD A;  1T9K A;  1T6U A;  2EPK X;  3O10 A;  3LLK A;  3JCU Q;  4I1O B;  5F5F A;  1L3P A;  4XTK A;  4FES A;  3HJC A;  1OW7 A;  1K04 A;  3NMJ A;  2J9W A;  4JC7 A;  2EPN A;  3L0I A;  2R7O A;  2CGE A;  1VOM A;  3K1I A;  4M63 A;  2NUT A;  3SYN A;  3GEH A;  2EPM X;  2L81 A;  3EGX B;  1S7Z A;  4PR9 A;  2XXA A;  2LCH A;  3GM1 A;  2CCY A;  4CDV A;  2GA0 A;  2R03 A;  4YT4 A;  1LI7 A;  3V5Y A;  3GWL A;  3W8H A;  1O5H A;  1XWJ A;  1AVO B;  4YL3 A;  5BQG A;  1EA8 A;  1OXB A;  4DOZ A;  5L0H A;  4Z9J A;  2DYS C;  3K1I C;  3OA1 A;  3ZTZ A;  4JEB A;  4MVM A;  4XQ1 A;  4BJ5 C;  5BQH A;  2OEX A;  5A6J A;  3A11 A;  1WOL A;  3HNI A;  1V55 C;  2H8A A;  1Q0G A;  4NC3 A;  4GEH A;  4IB4 A;  2BL2 A;  1RKE B;  1M2V A;  4U9D A;  4LLE A;  3SXM A;  3T6G B;  3JTL O;  1O3U A;  3AGU A;  4U5H A;  4XEF A;  1TR2 A;  2A6E F;  1QQ3 A;  4AE4 B;  3S29 A;  3DJU B;  1E86 A;  3O55 A;  4DVY P;  1K05 A;  2PP4 A;  3C8G B;  3QVZ A;  4BJ1 A;  2VC9 A;  5A6A A;  1LE4 A;  1QLE C;  3EPV A;  2LP4 A;  4PK4 A;  1Y6D A;  2PFD A;  3MX3 A;  2J9B A;  1T6I A;  2ZPA A;  3GEE A;  4YJW A;  2YLD A;  3ZTM A;  3T4R A;  4E0H A;  1PV3 A;  1NSG B;  1JAF A;  2HMZ A;  5BQI A;  3Q6M A;  3DI5 A;  1NU7 D;  3DXJ F;  1VK5 A;  4IAR A;  2LFF A;  3X1O A;  2CYD A;  2R7T A;  3LAY A;  3ABM C;  2QY9 A;  2JPU A;  1TFO B;  3LEV A;  1YA7 O;  2KNH A;  4OD5 A;  4H4K C;  3V7O A;  2TMV P;  2OOC A;  3A9C A;  1OCZ C;  4C7O A;  2VCA A;  1LI5 A;  3U8P A;  2VCB A;  1KU2 A;  3PMR A;  4EBB A;  2KSF A;  3JRM O;  4B6I A;  4NQF A;  3LUT B;  3LEO A;  3LNR A;  3X2Q C;  1WWP A;  5COG A;  2HV6 A;  5HSW A;  2ASR A;  4YL1 A;  4IGG A;  2A69 F;  3HNJ A;  2NUP B;  3JSZ A;  3RFY A;  256B A;  3K66 A;  1VYI A;  1FAP B;  4U5B E;  1H7I A;  4DRH B;  2Y69 C;  3B71 A;  1NZE A;  5B1B C;  5KYX A;  3H2U A;  1I4Y A;  3IQ5 A;  1OXK A;  2A6H F;  5E3A A;  1OCO C;  4AX2 A;  3TUL A;  1CGN A;  1RJ9 B;  2YLI A;  3ITF A;  3AQC A;  1FTS A;  4RDA A;  4C3D A;  3RVY A;  1U0B B;  4MQ9 F;  4XPY A;  3WG7 C;  5DQT A;  3DE9 A;  3M15 A;  3KH2 A;  1BR4 A;  2YRF A;  2Z15 A;  3SP1 A;  1J8M F;  2ZXR A;  2RD9 A;  1O87 A;  1ORJ A;  4OIR F;  3UMI A;  2AP3 A;  1C03 A;  5KYW A;  2R05 A;  4C3B A;  2J0W A;  2J46 A;  4J7Y A;  3FOP A;  1QKR A;  2F22 A;  3AJM A;  4XLN F;  2LFD A;  3B29 A;  1APC A;  1V54 C;  2HS5 A;  3DKA A;  3EHN A;  4MND A;  4K7B A;  1E2X A;  2R7R A;  5A6K A;  5DS4 A;  5A6B A;  3SEO A;  3W8I A;  2PNO A;  2P6V A;  4J30 B;  3ZC4 A;  1LM3 B;  4ULV A;  3VM6 A;  2Y3D A;  4IWB A;  4PAC A;  4BG0 A;  4Q5S F;  4LDR A;  4ONS A;  1E84 A;  3NRH A;  4XPX A;  1Q0M A;  1ZW3 A;  2BE5 F;  2MHR A;  1C17 M;  1JMW A;  3DMD A;  3R2P A;  3EH1 A;  5DLJ A;  3V5X A;  5L0D A;  4XLP F;  3J06 A;  2R7X A;  3O6X A;  1D0Y A;  3KPH A;  4HEA J;  3TQO A;  4JRZ A;  2XSE A;  2A68 F;  2B0H A;  2KW3 C;  3DM5 A;  4C3E A;  3U9M A;  4YL0 A;  3U2M A;  2J9V A;  2L6F A;  1T6Q A;  2EIK C;  2WVO A;  2ZD9 A;  3HNL A;  3R7C A;  1CGM E;  1SMY F;  4JEA A;  4OIP F;  3NYL A;  2G3V A;  2XL4 A;  3S27 A;  2DGJ A;  4AL1 A;  1CPR A;  5DS5 A;  2V3C C;  2XL6 A;  2XRH A;  5L3V A; 
#chains in the Genus database with same CATH homology
 4JEB A;  3QVY A;  2XLE A;  3FOO A;  3HNI A;  1CGO A;  1QPU A;  3HNK A;  2XLV A;  1RCP A;  3DE8 A;  4NC3 A;  4N6H A;  2YKZ A;  4IB4 A;  4CDY A;  1YYJ A;  2YL7 A;  3VRC A;  2XLW A;  4U9D A;  3ZQY A;  4CJO A;  4WGY A;  1QQ3 A;  1E86 A;  3QVZ A;  3TOM A;  2QLA A;  4JE9 A;  3IQ6 A;  4D4N A;  1E85 A;  1MQV A;  2J9B A;  3QW0 A;  2YLD A;  3ZTM A;  1YZC A;  1GQA A;  4JKV A;  1JAF A;  4EIY A;  3NMK A;  2XM4 A;  4L6R A;  4IAR A;  2YL1 A;  3ZQV A;  5JRA A;  2XLD A;  2XLH A;  1S05 A;  3U8P A;  4WGZ A;  5JT4 A;  5JP7 A;  5JSL A;  5JLI A;  2YLG A;  3HNJ A;  3M4B A;  4U9E A;  3QW1 A;  256B A;  2J8W A;  4N4W A;  5B3I A;  4CJG A;  3NMI A;  1CPQ A;  3ZWI A;  3IQ5 A;  2XLM A;  1CGN A;  2YLI A;  4IAQ A;  5AGF A;  2BC5 A;  1M6T A;  3M4C A;  2XLO A;  3DE9 A;  1A7V A;  3M15 A;  3L1M A;  1BBH A;  1YZA A;  5JS5 A;  3C63 A;  1NBB A;  3FOP A;  4CIP A;  2XM0 A;  2YL3 A;  1E83 A;  4D4X A;  3C62 A;  1APC A;  5JUA A;  5JVE A;  4CX9 A;  1LM3 B;  4ULV A;  3NMJ A;  2YL0 A;  4ER9 A;  1YYX A;  2XL6 A;  2XL8 A;  3TOL A;  3HNL A;  4JEA A;  2CCY A;  4CDV A;  1CPR A;  4CDA A;  3M79 A;  1E84 A;  3ZTZ A;  1EKY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...