2XL8A

Reduced structure of r124f mutant of cytochrome c' from alcaligenes xylosoxidans
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
126
structure length
126
Chain Sequence
EFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYFKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords CYTOCHROME C'
publication title Distal-to-Proximal No Conversion in Hemoproteins: The Role of the Proximal Pocket.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
total genus 50
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2010-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 2xl8A00
2XM0A 3HNLA 4N6HA 1YYXA 3HNIA 3FOPA 3M15A 5B3IA 4CJGA 4D4NA 3L1MA 4JKVA 4ULVA 4D4XA 2YLDA 1YYJA 5JS5A 5JP7A 3VRCA 4CDVA 5JLIA 3QVYA 2YKZA 2BC5A 3FOOA 3ZTZA 3IQ6A 1M6TA 2XLDA 5JT4A 1RCPA 3U8PA 2YLGA 2YLIA 5JRAA 1QQ3A 4L6RA 1YZCA 4IAQA 3QW1A 2YL1A 3ZQYA 4IB4A 1EKYA 1BBHA 1JAFA 3M4BA 1APCA 1CPRA 1E86A 2J9BA 1MQVA 2XLVA 3NMIA 3M79A 3HNJA 2XLOA 3ZQVA 4WGYA 1CGNA 4JE9A 2XM4A 3TOMA 2XLEA 4N4WA 2CCYA 4CDAA 2XLHA 4JEBA 3NMKA 4EIYA 5JSLA 4CIPA 4CJOA 1NBBA 3DE8A 4IARA 2YL7A 5JVEA 3ZWIA 3M4CA 3QW0A 2YL3A 2YL0A 3C63A 3NMJA 4ER9A 3C62A 2XLMA 2QLAA 2XL6A 5JUAA 1A7VA 1LM3B 1E83A 3HNKA 2XL8A 256BA 1CPQA 4JEAA 1YZAA 4U9EA 3QVZA 1QPUA 1CGOA 5AGFA 3TOLA 1S05A 2J8WA 3DE9A 3IQ5A 4NC3A 4CDYA 3ZTMA 1E84A 1E85A 4U9DA 1GQAA 4CX9A 4WGZA 2XLWA
chains in the Genus database with same CATH superfamily
2DB4A 1FAPB 3WODF 5BQIA 4Q5SF 1ZHTA 1LI5A 4IWBA 4XEVA 2XL4A 4OIQF 2EPKX 3HNIA 1LKXA 1VK5A 3FOPA 4CJGA 3JZ0A 4I3MA 3X2QC 3EGDA 3S29A 4FESA 5L0CA 1G4WR 3LLKA 4CS7A 3PHF2 3S0XA 4E7SA 1FFHA 1RKEB 4CIHA 3JSZA 3LEOA 3EZIA 2PF4E 4MS2A 5KYWB 1D0ZA 3U0CA 2LIGA 2PNOA 1IW7F 5JS5A 4KC9A 1EQ1A 1SF8A 3VRCA 4X0RA 4CDVA 3Q6MA 2EINC 2UUIA 4ZLCA 1OW7A 2HV7A 1T01A 2BC5A 1VTMP 4AL0A 3ZTZA 3V5YA 2H7VC 2HZ8A 1M6TA 4W8PA 4O7GA 5F28E 4BPMA 2YQYA 2A69F 1RCPA 3AQCA 5CI8A 2W4MA 2YLIA 1QQ3A 1H9GA 1OXKA 1QKRA 5KYNA 1A41A 2VCBA 3RYLA 4AE4B 3DJNB 1K40A 2HJMA 1YZCA 4MVOA 4Q7CA 3QW1A 2YL1A 2IXOA 4ZLDA 3C18A 4WABA 1PCXA 4IB4A 2KNHA 2EPNA 3TJ6A 1EI7A 2A0BA 1A7DA 5E3AA 2H7BA 3GWNA 3T6GB 1EA8A 2J9WA 3L8IA 2LSEA 4Z9JA 3GM2A 3IHUA 3PMRA 1YA9A 4PFPA 5DVWA 3FDQA 3DJUB 3H65A 2BL2A 4LDRA 2ASRA 2J7PA 1MMAA 2QNLA 3EZHA 4HE8D 1ZHYA 1VYKA 2XLVA 1ZW3A 2QUPA 3E9VA 4WGYA 1AVOB 1CGNA 3B0VC 3SZRA 1R4TA 4XEFA 4C3DA 3TD7A 5D91A 3N24A 2AP3A 4N4WA 3EFOA 5KYYB 2M64A 2XS8A 3KPHA 2X0CA 4BJ5C 4EUKB 1TWAA 3R2PA 4QDLA 2YHSA 2OEXA 1K04A 2CCYA 3EG9B 1D1BA 1Y4CA 2HMZA 2XLHA 2H7OA 2EILC 2P1AA 3ABLC 4CS9A 4DOZA 1G8XA 1OKKD 4LDKA 1GM5A 1FTSA 2EPOA 4E18A 4NTFA 2P61A 4I1MA 4EWCA 1MNDA 2YL7A 1T6UA 2PP4A 5JVEA 3RVYA 3M4CA 3QW0A 1LIHA 2EPLX 1LE2A 2PX0A 3RH3A 2YL3A 2CNWD 2VCCA 1HMOA 2WVQA 2YL0A 3DZAA 1D1CA 3C63A 3LS1A 3C62A 3NYLA 1DOVA 2LFFA 2MYSA 4JW1A 2IYLD 3AQBA 1MMNA 2NPUA 3O10A 4JRZA 4JURI 2NUPB 4A4AA 1NU7D 1OCOC 1JR8A 1YDIA 2D4UA 1YJGA 2O9XA 2RSEB 3K1IC 4XLNF 3RVZA 3AG3C 3BEHA 4U9EA 4IJJA 2V3CC 3KKBA 3B71A 3S90A 3CAXA 2VH3A 2PFDA 3WAQA 4XPWA 3TOLA 3U9JA 3QMKA 2FGYA 3K66A 5B1BC 4EHPA 5KYUB 3DE9A 2R9RB 2R02A 4JC7A 4YK5A 5COMA 2LP4A 2R7UA 3N0TA 2Y39A 3R7CA 1PD1A 3E70C 4P9TA 2R7RA 2EIKC 2OKUA 4YL1A 2KK1A 3C7JA 3AOUA 3F46A 1M2VA 1S7ZA 1OW6A 3EH1A 4CS8C 2XM0A 3AGTA 3N2ZB 1G4US 4JVSA 4YT2A 4J7YA 1CGME 1NU9C 1YYXA 2AVKA 2VB6A 3VM6A 4C7OB 1WGWA 4CBEA 4RBNA 3T4RA 4D4NA 3L34A 3JYHA 1ZHWA 1A7EA 2KQ9A 4HFKB 2JPUA 2GDCA 4XEKA 4PJMA 3KYIA 3GEIA 3DD7A 1E2XA 2B0HA 3BRJA 4PJLA 3ZC4A 4D4XA 1FR0A 2OCCC 3EGDB 2HSQA 1FFTC 2A0UA 2DI3A 4J32B 1SR2A 4IAOA 1Q0FA 3AG4C 5GPGB 3FAJA 4FAPB 3AGUA 4MVUA 1ZZPA 3EHNA 3LUTB 5JP7A 2A1DD 2NSFA 5TJ5E 1NFNA 4EKWA 3SXZA 3QVYA 1YARO 4I44A 1TFKB 4ANJA 3VAYA 5L3VA 2OU6A 3ECSA 2XLDA 4CS9C 2JX0A 3B0PA 1K05A 2YWAA 3K1HA 4GYTA 5FZTA 4BJ6C 1LVKA 1I4ZA 4E0IA 4KNVA 1TFOB 5DLJA 3A11A 2D5RB 3AG1C 5F5HA 1GS9A 1Z23A 1Z6AA 2V26A 4KNWA 3V5ZA 5A6BD 4M63A 5DS4A 3JRTA 5A69A 1J8MF 5L0IA 2ZD9A 2IM8A 4DRIB 3NDBB 1EKYA 3C8GB 2VC9A 1UFBA 5EK0A 2Y3BA 1BBHA 1JAFA 3UGOA 2LCHA 3SYNA 1GGQA 5DS5A 3ZG1A 3ZSUA 1M57C 2L6HA 3DXJF 5A6JA 5KYXA 5L0DA 1CPRA 2Q7RA 3ABMC 2ICWG 1E86A 1XWJA 3LLIA 4G0HA 5EGYA 3C8ZA 3M79A 4YJWA 5IY5C 5B1AC 1JMWA 4YWQA 3T6BA 2P6VA 3K6BA 2R03A 2FAPB 4JE9A 4BEJA 2XXAB 2G3KA 3OA1A 3TOMA 4G7HF 3B29A 3U2MA 2DYSC 4OINF 3KMIA 1H6GA 1M2OA 4CSAC 5B3SC 1W2WA 4JEBA 4JCZA 4LLCA 5DQTA 4MVZA 5JSLA 1VMAA 1RJ9A 4C3BA 1NBBA 3EH2A 3NKDA 1RKCA 4O6YA 2A6EF 3UR3C 5A6AA 3I5QA 4NQFA 1ZU5A 5BQHA 2OG2A 2GFHA 3GANA 2QTVA 1ORJA 2J9UA 4PJNA 5A6KA 5L0GA 2DGJA 3H2UA 1V54C 4H4KC 4DRHB 2OEVA 1Z7Qc 3AJMA 1Z63A 1FMWA 1SZIA 4DBQA 3ASOC 4K7BA 4EBKA 1E83A 5F5FA 5COGA 1ZYRF 4H54A 1RKEA 256BA 3EHMA 3RQGA 4XTKA 4B6IA 2J46A 2I15A 1YZAA 3UMKA 3S84A 1WWPA 1CGOA 4OD4A 3X1OA 1NG1A 4U5GA 4OIRF 5DQZA 2WZGA 4JTAB 5HSWA 2R7XA 2B0JA 3J06A 1S05A 1OR2A 4JIOA 2R7OA 4BJTA 1YVIA 1ORSC 2OJQA 2Y3GA 2JD3A 3IPMO 4U5DE 3U8VA 2NUTB 3SXYA 3PCVA 2C03A 1VLTA 2R7TA 4XLPF 4MW8A 4GQHA 2L6GA 3ZTMA 1YA7O 1Z5ZA 1ORYA 5JT4A 2QY9A 2X51A 3EPVA 3NRHA 1WASA 1FNTc 1TWCA 1L3PA 3CSKA 2Q3TA 4LACB 3W4YA 5K0IA 2L81A 4JTDB 3EGXB 2IBFA 1Q0GA 3U5SA 4DRJB 3ASNC 4F4BA 3B0UX 2PBEA 2R7VA 2MHRA 2LK4A 1QVXA 3M15A 5B3IA 2CYDA 3I5PA 1V74B 1HY5A 3L1MA 3FMSA 2KSFA 3RF3A 1D0XA 3MLGA 1LS1A 1M56C 1VLSA 1Z3IX 4ULWA 1YLMA 1JPJA 4I1OB 1BR2A 3GM3A 4IRUA 3U3BA 1I4YA 1NLXA 3DMDA 4XQ1A 3GODA 2EPMX 3B9QA 4YT5A 3DWWA 3SXKA 3V7OA 1BR1A 4BG0A 3DI5A 4OIPF 4OD5A 1YYJA 1VOMA 4EBBA 3KL4A 4MVSA 2R05A 4DJ9A 2AWYA 3QZCA 1F1MA 5JLIA 3SNHA 4LDQA 3VYWA 3WHNA 5EHHA 3FOOA 4U5CE 5KYYA 3O39A 3IQ6A 4MTOA 3EJNA 2EIJC 3C8GD 1KNYA 4OIOF 3HTKC 3CEXA 1Y6DA 2NSGA 3U8PA 3EG9A 2FFHA 2QE9A 3TULA 4J30B 2ZXWC 2MWQA 5DS6A 2A68F 2H8AA 5L0JA 4XPXA 1RMVA 1XZQA 2YZSA 3EQLF 4G7ZF 3DKAA 3Q7LA 1HW2A 1JPNA 3H2VA 4YT4A 5HV9A 4HEAJ 1G5ZA 1BR4A 3GORA 3FXHA 4MTGA 3G50A 4UDVA 5L3QA 3O55A 1OR3A 1QZXA 2L9JA 2P0NA 3NKEA 4KI2A 1C03A 1APCA 2IXNA 2LD6A 2NUPA 1R5ID 1WN0A 4PFOA 3NMIA 2ZXOA 2XLOA 3ZQVA 5BUOA 5CI9A 1VB5A 4DBRA 3UGPA 3DAFA 3ABKC 3KYJA 3SP1A 2P7VA 5AC5A 3UNGC 1LPEA 4MNDA 3DM5A 3L0IA 1H7IA 1KU2A 2YRFA 4XWJA 4BJ5A 4MVQA 1TWHA 2LFDA 2R25A 3NMKA 2XSEA 2J45A 3OEOA 4MQ9F 3Q7GA 5T3WA 2G3VA 4EBJA 3POVA 1O87A 2OJED 1C17M 1AUEA 3ATPA 1V55C 3G4ZA 2WB7A 4IARA 1B68A 2YVKA 3ZDLA 3KH2A 3ZWIA 1WATA 2WL8A 5T3TA 1TKNA 1RJ9B 2F22A 3L8JA 3LJBA 1C02A 3RFYA 1OKKA 5D92A 2J0WA 1OQCA 4MVRA 1MMGA 4BEMJ 3W8HA 5FCLA 1SMYF 2IXPA 5AC4A 1T6IA 1LS4A 3LESA 2KC3A 2ETSA 1T5OA 2DYRC 4IGGA 1OW8A 3NYJA 2Y3HA 4MTFA 2CNWA 4JZAA 4R32A 1LM3B 4FWVA 3UMIA 3V5XA 3W8IA 1OXBA 2GWWA 1HMDA 1HW1A 2IXMA 3CQZA 3ITFA 3Q6NA 3U3FA 3K1IA 3LS0A 1KTMA 2IOQA 1PD0A 2WZFA 1O3UA 3MBGA 4MW3A 4Z9HA 4AL1A 4YT8A 5AGFA 5L0HA 1Q0MA 3EFOB 4DXWA 3LNRA 2WVNA 5CIVA 3G4XA 1HE9A 2CDQA 4WJ0A 3NYMA 2J8WA 3IQ5A 4NC3A 4RDAA 5E2QA 3S9OA 1J8YF 5E33A 4YL3A 1QSPA 2ZXRA 1ZHXA 4PR9A 1E84A 4QI2A 3F47A 3U2LA 4DVZA 1GQAA 1T6QA 2E87A 3HJCA 1TQGA 4WGZA 4O79A 4CX9A 2KW3C 2HFIA 3RIPA 3T9OA 1SYQA 2C04A 4NTBA 4CS8A 1UG7A 1IZMA 1Q0DA 3U9MA 1ZW2A 2UUHA 3HNLA 2KJGA 3GEHA 3JRMO 1XZPA 4N6HA 3W2WA 4G7OF 3I4UA 3SEOA 4YN0B 3C8GA 3FAPB 4JKVA 4AK9A 2YEVA 2HKVA 1ZU4A 2RD9A 2OQMA 1QLEC 3S27A 3US6A 5KYWA 3DAGA 4U5HA 2WVOA 3M1CB 3NG1A 3IQCA 4Z9IA 4ULVA 2HMQA 3WG7C 3RKOF 2Y3DA 2YLDA 1D1AA 4O6NA 3GEEA 4YL0A 1FMVA 1T9KA 2HJ3A 4DVYP 2XXAA 2YKZA 2BE5F 3LNMB 4U5EE 1OCCC 2J0XA 1PV3A 4J7TA 3K33A 2LQGA 3FHDA 4XPYA 2L6FA 1TR2A 4O6MA 1WOLA 1NSGB 2OOCA 4LERA 3ZIBA 2YLGA 4AE4A 4BJ6A 2PX3A 3MYIA 4HFFB 5JRAA 5L0FA 3RQFA 1OCRC 4L6RA 3JT1A 4G78A 1NFOA 1TWGA 3HKKA 3DM9B 1M2VB 4N6CA 1ST6A 4IAQA 1ZVZA 4C3EA 2R7SA 2I8BA 3ZQYA 2AU5A 4A2NB 4AX2A 1JRAA 2L7AA 4GEHA 4BJ1A 1JOGA 1V4AA 5A6BA 2NG1A 5T1DB 2HUJA 1H9TA 3MX3A 1OCZC 3UMHA 2Q9AA 1L7CA 1BZ4A 2AWCA 3M4BA 4NCQA 3T6JA 1VYIA 3A9CA 1ZHZA 2Q00A 1MMDA 2Z15A 3QTHA 4U5BE 1LE4A 2J9BA 4JJGA 1MQVA 4ONSA 2GA0A 3GM1A 3HNJA 2R7QA 1D0YA 3FVYA 1WTYA 4W8KA 1I5NA 2HS5A 4JTCB 2XM4A 2W45A 2GAQA 3JSEO 2Y69C 2XLEA 2ZPAA 2W4BA 2J9VA 4P6IC 4K1OA 2EIMC 3VF0A 2KGOA 1MNEA 3MFNA 4MVMA 4CDAA 2NUTA 2HV6A 4CSAA 1BDJB 3SXMA 3K7DA 2G62A 4EIYA 4PJJA 4CIPA 4CJOA 2M4EA 2W9YA 3DE8A 5BQGA 2J7PD 1N1CA 4PACA 4Q4ZF 4NY3A 4PK4A 4NTAA 2WZLA 2Q9BA 3AG2C 3EGXA 2XRHA 2VCAA 4P9FA 3IEEA 3NMJA 3JTLO 3O6XA 4JCHA 4ER9A 3JCUQ 2XLMA 3LEVA 2VASA 2QLAA 4RD9A 2XL6A 5JUAA 1Q0KA 4FX5A 1LI7A 5KYXB 4N06A 1A7VA 3TJ5A 3GWLA 1NZEA 1U0BB 2R7WA 4E17A 3HNKA 3HLZA 2XL8A 3MYFA 1YAUO 4K0DA 4E0HA 1RXQA 3OWTA 1AEPA 2Q9CA 4KBLA 4QI0A 3TK0A 1CPQA 2TMVP 4LLEA 4JEAA 3QVZA 4U5FE 1QPUA 2XS1A 2CW0F 5KYUA 4JJFA 3S28A 4E7ZA 2CGEA 1HE1A 5COFA 3W2VA 2A6HF 3RQEA 1U89A 3LAYA 2KYHA 3JYYA 3IQTA 1DOWA 3RW0A 4CDYA 2HSBA 2ZXPA 1U6HA 5E3CA 1E85A 3ZVRA 4U9DA 3PDMP 4C7OA 3TQOA 3CZ6A 1A0BA 1O5HA 2Q4FA 2XLWA
chains in the Genus database with same CATH topology
2XM0A 3HNLA 4N6HA 1YYXA 3HNIA 3FOPA 3M15A 5B3IA 4CJGA 4D4NA 3L1MA 4JKVA 4ULVA 4D4XA 2YLDA 1YYJA 5JS5A 5JP7A 3VRCA 4CDVA 5JLIA 3QVYA 2YKZA 2BC5A 3FOOA 3ZTZA 3IQ6A 1M6TA 2XLDA 5JT4A 1RCPA 3U8PA 2YLGA 2YLIA 5JRAA 1QQ3A 4L6RA 1YZCA 4IAQA 3QW1A 2YL1A 3ZQYA 4IB4A 1EKYA 1BBHA 1JAFA 3M4BA 1APCA 1CPRA 1E86A 2J9BA 1MQVA 2XLVA 3NMIA 3M79A 3HNJA 2XLOA 3ZQVA 4WGYA 1CGNA 4JE9A 2XM4A 3TOMA 2XLEA 4N4WA 2CCYA 4CDAA 2XLHA 4JEBA 3NMKA 4EIYA 5JSLA 4CIPA 4CJOA 1NBBA 3DE8A 4IARA 2YL7A 5JVEA 3ZWIA 3M4CA 3QW0A 2YL3A 2YL0A 3C63A 3NMJA 4ER9A 3C62A 2XLMA 2QLAA 2XL6A 5JUAA 1A7VA 1LM3B 1E83A 3HNKA 2XL8A 256BA 1CPQA 4JEAA 1YZAA 4U9EA 3QVZA 1QPUA 1CGOA 5AGFA 3TOLA 1S05A 2J8WA 3DE9A 3IQ5A 4NC3A 4CDYA 3ZTMA 1E84A 1E85A 4U9DA 1GQAA 4CX9A 4WGZA 2XLWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XM0 A;  3HNL A;  4N6H A;  1YYX A;  3HNI A;  3FOP A;  3M15 A;  5B3I A;  4CJG A;  4D4N A;  3L1M A;  4JKV A;  4ULV A;  4D4X A;  2YLD A;  1YYJ A;  5JS5 A;  5JP7 A;  3VRC A;  4CDV A;  5JLI A;  3QVY A;  2YKZ A;  2BC5 A;  3FOO A;  3ZTZ A;  3IQ6 A;  1M6T A;  2XLD A;  5JT4 A;  1RCP A;  3U8P A;  2YLG A;  2YLI A;  5JRA A;  1QQ3 A;  4L6R A;  1YZC A;  4IAQ A;  3QW1 A;  2YL1 A;  3ZQY A;  4IB4 A;  1EKY A;  1BBH A;  1JAF A;  3M4B A;  1APC A;  1CPR A;  1E86 A;  2J9B A;  1MQV A;  2XLV A;  3NMI A;  3M79 A;  3HNJ A;  2XLO A;  3ZQV A;  4WGY A;  1CGN A;  4JE9 A;  2XM4 A;  3TOM A;  2XLE A;  4N4W A;  2CCY A;  4CDA A;  2XLH A;  4JEB A;  3NMK A;  4EIY A;  5JSL A;  4CIP A;  4CJO A;  1NBB A;  3DE8 A;  4IAR A;  2YL7 A;  5JVE A;  3ZWI A;  3M4C A;  3QW0 A;  2YL3 A;  2YL0 A;  3C63 A;  3NMJ A;  4ER9 A;  3C62 A;  2XLM A;  2QLA A;  2XL6 A;  5JUA A;  1A7V A;  1LM3 B;  1E83 A;  3HNK A;  2XL8 A;  256B A;  1CPQ A;  4JEA A;  1YZA A;  4U9E A;  3QVZ A;  1QPU A;  1CGO A;  5AGF A;  3TOL A;  1S05 A;  2J8W A;  3DE9 A;  3IQ5 A;  4NC3 A;  4CDY A;  3ZTM A;  1E84 A;  1E85 A;  4U9D A;  1GQA A;  4CX9 A;  4WGZ A;  2XLW A; 
#chains in the Genus database with same CATH topology
 2DB4 A;  1FAP B;  3WOD F;  5BQI A;  4Q5S F;  1ZHT A;  1LI5 A;  4IWB A;  4XEV A;  2XL4 A;  4OIQ F;  2EPK X;  3HNI A;  1LKX A;  1VK5 A;  3FOP A;  4CJG A;  3JZ0 A;  4I3M A;  3X2Q C;  3EGD A;  3S29 A;  4FES A;  5L0C A;  1G4W R;  3LLK A;  4CS7 A;  3PHF 2;  3S0X A;  4E7S A;  1FFH A;  1RKE B;  4CIH A;  3JSZ A;  3LEO A;  3EZI A;  2PF4 E;  4MS2 A;  5KYW B;  1D0Z A;  3U0C A;  2LIG A;  2PNO A;  1IW7 F;  5JS5 A;  4KC9 A;  1EQ1 A;  1SF8 A;  3VRC A;  4X0R A;  4CDV A;  3Q6M A;  2EIN C;  2UUI A;  4ZLC A;  1OW7 A;  2HV7 A;  1T01 A;  2BC5 A;  1VTM P;  4AL0 A;  3ZTZ A;  3V5Y A;  2H7V C;  2HZ8 A;  1M6T A;  4W8P A;  4O7G A;  5F28 E;  4BPM A;  2YQY A;  2A69 F;  1RCP A;  3AQC A;  5CI8 A;  2W4M A;  2YLI A;  1QQ3 A;  1H9G A;  1OXK A;  1QKR A;  5KYN A;  1A41 A;  2VCB A;  3RYL A;  4AE4 B;  3DJN B;  1K40 A;  2HJM A;  1YZC A;  4MVO A;  4Q7C A;  3QW1 A;  2YL1 A;  2IXO A;  4ZLD A;  3C18 A;  4WAB A;  1PCX A;  4IB4 A;  2KNH A;  2EPN A;  3TJ6 A;  1EI7 A;  2A0B A;  1A7D A;  5E3A A;  2H7B A;  3GWN A;  3T6G B;  1EA8 A;  2J9W A;  3L8I A;  2LSE A;  4Z9J A;  3GM2 A;  3IHU A;  3PMR A;  1YA9 A;  4PFP A;  5DVW A;  3FDQ A;  3DJU B;  3H65 A;  2BL2 A;  4LDR A;  2ASR A;  2J7P A;  1MMA A;  2QNL A;  3EZH A;  4HE8 D;  1ZHY A;  1VYK A;  2XLV A;  1ZW3 A;  2QUP A;  3E9V A;  4WGY A;  1AVO B;  1CGN A;  3B0V C;  3SZR A;  1R4T A;  4XEF A;  4C3D A;  3TD7 A;  5D91 A;  3N24 A;  2AP3 A;  4N4W A;  3EFO A;  5KYY B;  2M64 A;  2XS8 A;  3KPH A;  2X0C A;  4BJ5 C;  4EUK B;  1TWA A;  3R2P A;  4QDL A;  2YHS A;  2OEX A;  1K04 A;  2CCY A;  3EG9 B;  1D1B A;  1Y4C A;  2HMZ A;  2XLH A;  2H7O A;  2EIL C;  2P1A A;  3ABL C;  4CS9 A;  4DOZ A;  1G8X A;  1OKK D;  4LDK A;  1GM5 A;  1FTS A;  2EPO A;  4E18 A;  4NTF A;  2P61 A;  4I1M A;  4EWC A;  1MND A;  2YL7 A;  1T6U A;  2PP4 A;  5JVE A;  3RVY A;  3M4C A;  3QW0 A;  1LIH A;  2EPL X;  1LE2 A;  2PX0 A;  3RH3 A;  2YL3 A;  2CNW D;  2VCC A;  1HMO A;  2WVQ A;  2YL0 A;  3DZA A;  1D1C A;  3C63 A;  3LS1 A;  3C62 A;  3NYL A;  1DOV A;  2LFF A;  2MYS A;  4JW1 A;  2IYL D;  3AQB A;  1MMN A;  2NPU A;  3O10 A;  4JRZ A;  4JUR I;  2NUP B;  4A4A A;  1NU7 D;  1OCO C;  1JR8 A;  1YDI A;  2D4U A;  1YJG A;  2O9X A;  2RSE B;  3K1I C;  4XLN F;  3RVZ A;  3AG3 C;  3BEH A;  4U9E A;  4IJJ A;  2V3C C;  3KKB A;  3B71 A;  3S90 A;  3CAX A;  2VH3 A;  2PFD A;  3WAQ A;  4XPW A;  3TOL A;  3U9J A;  3QMK A;  2FGY A;  3K66 A;  5B1B C;  4EHP A;  5KYU B;  3DE9 A;  2R9R B;  2R02 A;  4JC7 A;  4YK5 A;  5COM A;  2LP4 A;  2R7U A;  3N0T A;  2Y39 A;  3R7C A;  1PD1 A;  3E70 C;  4P9T A;  2R7R A;  2EIK C;  2OKU A;  4YL1 A;  2KK1 A;  3C7J A;  3AOU A;  3F46 A;  1M2V A;  1S7Z A;  1OW6 A;  3EH1 A;  4CS8 C;  2XM0 A;  3AGT A;  3N2Z B;  1G4U S;  4JVS A;  4YT2 A;  4J7Y A;  1CGM E;  1NU9 C;  1YYX A;  2AVK A;  2VB6 A;  3VM6 A;  4C7O B;  1WGW A;  4CBE A;  4RBN A;  3T4R A;  4D4N A;  3L34 A;  3JYH A;  1ZHW A;  1A7E A;  2KQ9 A;  4HFK B;  2JPU A;  2GDC A;  4XEK A;  4PJM A;  3KYI A;  3GEI A;  3DD7 A;  1E2X A;  2B0H A;  3BRJ A;  4PJL A;  3ZC4 A;  4D4X A;  1FR0 A;  2OCC C;  3EGD B;  2HSQ A;  1FFT C;  2A0U A;  2DI3 A;  4J32 B;  1SR2 A;  4IAO A;  1Q0F A;  3AG4 C;  5GPG B;  3FAJ A;  4FAP B;  3AGU A;  4MVU A;  1ZZP A;  3EHN A;  3LUT B;  5JP7 A;  2A1D D;  2NSF A;  5TJ5 E;  1NFN A;  4EKW A;  3SXZ A;  3QVY A;  1YAR O;  4I44 A;  1TFK B;  4ANJ A;  3VAY A;  5L3V A;  2OU6 A;  3ECS A;  2XLD A;  4CS9 C;  2JX0 A;  3B0P A;  1K05 A;  2YWA A;  3K1H A;  4GYT A;  5FZT A;  4BJ6 C;  1LVK A;  1I4Z A;  4E0I A;  4KNV A;  1TFO B;  5DLJ A;  3A11 A;  2D5R B;  3AG1 C;  5F5H A;  1GS9 A;  1Z23 A;  1Z6A A;  2V26 A;  4KNW A;  3V5Z A;  5A6B D;  4M63 A;  5DS4 A;  3JRT A;  5A69 A;  1J8M F;  5L0I A;  2ZD9 A;  2IM8 A;  4DRI B;  3NDB B;  1EKY A;  3C8G B;  2VC9 A;  1UFB A;  5EK0 A;  2Y3B A;  1BBH A;  1JAF A;  3UGO A;  2LCH A;  3SYN A;  1GGQ A;  5DS5 A;  3ZG1 A;  3ZSU A;  1M57 C;  2L6H A;  3DXJ F;  5A6J A;  5KYX A;  5L0D A;  1CPR A;  2Q7R A;  3ABM C;  2ICW G;  1E86 A;  1XWJ A;  3LLI A;  4G0H A;  5EGY A;  3C8Z A;  3M79 A;  4YJW A;  5IY5 C;  5B1A C;  1JMW A;  4YWQ A;  3T6B A;  2P6V A;  3K6B A;  2R03 A;  2FAP B;  4JE9 A;  4BEJ A;  2XXA B;  2G3K A;  3OA1 A;  3TOM A;  4G7H F;  3B29 A;  3U2M A;  2DYS C;  4OIN F;  3KMI A;  1H6G A;  1M2O A;  4CSA C;  5B3S C;  1W2W A;  4JEB A;  4JCZ A;  4LLC A;  5DQT A;  4MVZ A;  5JSL A;  1VMA A;  1RJ9 A;  4C3B A;  1NBB A;  3EH2 A;  3NKD A;  1RKC A;  4O6Y A;  2A6E F;  3UR3 C;  5A6A A;  3I5Q A;  4NQF A;  1ZU5 A;  5BQH A;  2OG2 A;  2GFH A;  3GAN A;  2QTV A;  1ORJ A;  2J9U A;  4PJN A;  5A6K A;  5L0G A;  2DGJ A;  3H2U A;  1V54 C;  4H4K C;  4DRH B;  2OEV A;  1Z7Q c;  3AJM A;  1Z63 A;  1FMW A;  1SZI A;  4DBQ A;  3ASO C;  4K7B A;  4EBK A;  1E83 A;  5F5F A;  5COG A;  1ZYR F;  4H54 A;  1RKE A;  256B A;  3EHM A;  3RQG A;  4XTK A;  4B6I A;  2J46 A;  2I15 A;  1YZA A;  3UMK A;  3S84 A;  1WWP A;  1CGO A;  4OD4 A;  3X1O A;  1NG1 A;  4U5G A;  4OIR F;  5DQZ A;  2WZG A;  4JTA B;  5HSW A;  2R7X A;  2B0J A;  3J06 A;  1S05 A;  1OR2 A;  4JIO A;  2R7O A;  4BJT A;  1YVI A;  1ORS C;  2OJQ A;  2Y3G A;  2JD3 A;  3IPM O;  4U5D E;  3U8V A;  2NUT B;  3SXY A;  3PCV A;  2C03 A;  1VLT A;  2R7T A;  4XLP F;  4MW8 A;  4GQH A;  2L6G A;  3ZTM A;  1YA7 O;  1Z5Z A;  1ORY A;  5JT4 A;  2QY9 A;  2X51 A;  3EPV A;  3NRH A;  1WAS A;  1FNT c;  1TWC A;  1L3P A;  3CSK A;  2Q3T A;  4LAC B;  3W4Y A;  5K0I A;  2L81 A;  4JTD B;  3EGX B;  2IBF A;  1Q0G A;  3U5S A;  4DRJ B;  3ASN C;  4F4B A;  3B0U X;  2PBE A;  2R7V A;  2MHR A;  2LK4 A;  1QVX A;  3M15 A;  5B3I A;  2CYD A;  3I5P A;  1V74 B;  1HY5 A;  3L1M A;  3FMS A;  2KSF A;  3RF3 A;  1D0X A;  3MLG A;  1LS1 A;  1M56 C;  1VLS A;  1Z3I X;  4ULW A;  1YLM A;  1JPJ A;  4I1O B;  1BR2 A;  3GM3 A;  4IRU A;  3U3B A;  1I4Y A;  1NLX A;  3DMD A;  4XQ1 A;  3GOD A;  2EPM X;  3B9Q A;  4YT5 A;  3DWW A;  3SXK A;  3V7O A;  1BR1 A;  4BG0 A;  3DI5 A;  4OIP F;  4OD5 A;  1YYJ A;  1VOM A;  4EBB A;  3KL4 A;  4MVS A;  2R05 A;  4DJ9 A;  2AWY A;  3QZC A;  1F1M A;  5JLI A;  3SNH A;  4LDQ A;  3VYW A;  3WHN A;  5EHH A;  3FOO A;  4U5C E;  5KYY A;  3O39 A;  3IQ6 A;  4MTO A;  3EJN A;  2EIJ C;  3C8G D;  1KNY A;  4OIO F;  3HTK C;  3CEX A;  1Y6D A;  2NSG A;  3U8P A;  3EG9 A;  2FFH A;  2QE9 A;  3TUL A;  4J30 B;  2ZXW C;  2MWQ A;  5DS6 A;  2A68 F;  2H8A A;  5L0J A;  4XPX A;  1RMV A;  1XZQ A;  2YZS A;  3EQL F;  4G7Z F;  3DKA A;  3Q7L A;  1HW2 A;  1JPN A;  3H2V A;  4YT4 A;  5HV9 A;  4HEA J;  1G5Z A;  1BR4 A;  3GOR A;  3FXH A;  4MTG A;  3G50 A;  4UDV A;  5L3Q A;  3O55 A;  1OR3 A;  1QZX A;  2L9J A;  2P0N A;  3NKE A;  4KI2 A;  1C03 A;  1APC A;  2IXN A;  2LD6 A;  2NUP A;  1R5I D;  1WN0 A;  4PFO A;  3NMI A;  2ZXO A;  2XLO A;  3ZQV A;  5BUO A;  5CI9 A;  1VB5 A;  4DBR A;  3UGP A;  3DAF A;  3ABK C;  3KYJ A;  3SP1 A;  2P7V A;  5AC5 A;  3UNG C;  1LPE A;  4MND A;  3DM5 A;  3L0I A;  1H7I A;  1KU2 A;  2YRF A;  4XWJ A;  4BJ5 A;  4MVQ A;  1TWH A;  2LFD A;  2R25 A;  3NMK A;  2XSE A;  2J45 A;  3OEO A;  4MQ9 F;  3Q7G A;  5T3W A;  2G3V A;  4EBJ A;  3POV A;  1O87 A;  2OJE D;  1C17 M;  1AUE A;  3ATP A;  1V55 C;  3G4Z A;  2WB7 A;  4IAR A;  1B68 A;  2YVK A;  3ZDL A;  3KH2 A;  3ZWI A;  1WAT A;  2WL8 A;  5T3T A;  1TKN A;  1RJ9 B;  2F22 A;  3L8J A;  3LJB A;  1C02 A;  3RFY A;  1OKK A;  5D92 A;  2J0W A;  1OQC A;  4MVR A;  1MMG A;  4BEM J;  3W8H A;  5FCL A;  1SMY F;  2IXP A;  5AC4 A;  1T6I A;  1LS4 A;  3LES A;  2KC3 A;  2ETS A;  1T5O A;  2DYR C;  4IGG A;  1OW8 A;  3NYJ A;  2Y3H A;  4MTF A;  2CNW A;  4JZA A;  4R32 A;  1LM3 B;  4FWV A;  3UMI A;  3V5X A;  3W8I A;  1OXB A;  2GWW A;  1HMD A;  1HW1 A;  2IXM A;  3CQZ A;  3ITF A;  3Q6N A;  3U3F A;  3K1I A;  3LS0 A;  1KTM A;  2IOQ A;  1PD0 A;  2WZF A;  1O3U A;  3MBG A;  4MW3 A;  4Z9H A;  4AL1 A;  4YT8 A;  5AGF A;  5L0H A;  1Q0M A;  3EFO B;  4DXW A;  3LNR A;  2WVN A;  5CIV A;  3G4X A;  1HE9 A;  2CDQ A;  4WJ0 A;  3NYM A;  2J8W A;  3IQ5 A;  4NC3 A;  4RDA A;  5E2Q A;  3S9O A;  1J8Y F;  5E33 A;  4YL3 A;  1QSP A;  2ZXR A;  1ZHX A;  4PR9 A;  1E84 A;  4QI2 A;  3F47 A;  3U2L A;  4DVZ A;  1GQA A;  1T6Q A;  2E87 A;  3HJC A;  1TQG A;  4WGZ A;  4O79 A;  4CX9 A;  2KW3 C;  2HFI A;  3RIP A;  3T9O A;  1SYQ A;  2C04 A;  4NTB A;  4CS8 A;  1UG7 A;  1IZM A;  1Q0D A;  3U9M A;  1ZW2 A;  2UUH A;  3HNL A;  2KJG A;  3GEH A;  3JRM O;  1XZP A;  4N6H A;  3W2W A;  4G7O F;  3I4U A;  3SEO A;  4YN0 B;  3C8G A;  3FAP B;  4JKV A;  4AK9 A;  2YEV A;  2HKV A;  1ZU4 A;  2RD9 A;  2OQM A;  1QLE C;  3S27 A;  3US6 A;  5KYW A;  3DAG A;  4U5H A;  2WVO A;  3M1C B;  3NG1 A;  3IQC A;  4Z9I A;  4ULV A;  2HMQ A;  3WG7 C;  3RKO F;  2Y3D A;  2YLD A;  1D1A A;  4O6N A;  3GEE A;  4YL0 A;  1FMV A;  1T9K A;  2HJ3 A;  4DVY P;  2XXA A;  2YKZ A;  2BE5 F;  3LNM B;  4U5E E;  1OCC C;  2J0X A;  1PV3 A;  4J7T A;  3K33 A;  2LQG A;  3FHD A;  4XPY A;  2L6F A;  1TR2 A;  4O6M A;  1WOL A;  1NSG B;  2OOC A;  4LER A;  3ZIB A;  2YLG A;  4AE4 A;  4BJ6 A;  2PX3 A;  3MYI A;  4HFF B;  5JRA A;  5L0F A;  3RQF A;  1OCR C;  4L6R A;  3JT1 A;  4G78 A;  1NFO A;  1TWG A;  3HKK A;  3DM9 B;  1M2V B;  4N6C A;  1ST6 A;  4IAQ A;  1ZVZ A;  4C3E A;  2R7S A;  2I8B A;  3ZQY A;  2AU5 A;  4A2N B;  4AX2 A;  1JRA A;  2L7A A;  4GEH A;  4BJ1 A;  1JOG A;  1V4A A;  5A6B A;  2NG1 A;  5T1D B;  2HUJ A;  1H9T A;  3MX3 A;  1OCZ C;  3UMH A;  2Q9A A;  1L7C A;  1BZ4 A;  2AWC A;  3M4B A;  4NCQ A;  3T6J A;  1VYI A;  3A9C A;  1ZHZ A;  2Q00 A;  1MMD A;  2Z15 A;  3QTH A;  4U5B E;  1LE4 A;  2J9B A;  4JJG A;  1MQV A;  4ONS A;  2GA0 A;  3GM1 A;  3HNJ A;  2R7Q A;  1D0Y A;  3FVY A;  1WTY A;  4W8K A;  1I5N A;  2HS5 A;  4JTC B;  2XM4 A;  2W45 A;  2GAQ A;  3JSE O;  2Y69 C;  2XLE A;  2ZPA A;  2W4B A;  2J9V A;  4P6I C;  4K1O A;  2EIM C;  3VF0 A;  2KGO A;  1MNE A;  3MFN A;  4MVM A;  4CDA A;  2NUT A;  2HV6 A;  4CSA A;  1BDJ B;  3SXM A;  3K7D A;  2G62 A;  4EIY A;  4PJJ A;  4CIP A;  4CJO A;  2M4E A;  2W9Y A;  3DE8 A;  5BQG A;  2J7P D;  1N1C A;  4PAC A;  4Q4Z F;  4NY3 A;  4PK4 A;  4NTA A;  2WZL A;  2Q9B A;  3AG2 C;  3EGX A;  2XRH A;  2VCA A;  4P9F A;  3IEE A;  3NMJ A;  3JTL O;  3O6X A;  4JCH A;  4ER9 A;  3JCU Q;  2XLM A;  3LEV A;  2VAS A;  2QLA A;  4RD9 A;  2XL6 A;  5JUA A;  1Q0K A;  4FX5 A;  1LI7 A;  5KYX B;  4N06 A;  1A7V A;  3TJ5 A;  3GWL A;  1NZE A;  1U0B B;  2R7W A;  4E17 A;  3HNK A;  3HLZ A;  2XL8 A;  3MYF A;  1YAU O;  4K0D A;  4E0H A;  1RXQ A;  3OWT A;  1AEP A;  2Q9C A;  4KBL A;  4QI0 A;  3TK0 A;  1CPQ A;  2TMV P;  4LLE A;  4JEA A;  3QVZ A;  4U5F E;  1QPU A;  2XS1 A;  2CW0 F;  5KYU A;  4JJF A;  3S28 A;  4E7Z A;  2CGE A;  1HE1 A;  5COF A;  3W2V A;  2A6H F;  3RQE A;  1U89 A;  3LAY A;  2KYH A;  3JYY A;  3IQT A;  1DOW A;  3RW0 A;  4CDY A;  2HSB A;  2ZXP A;  1U6H A;  5E3C A;  1E85 A;  3ZVR A;  4U9D A;  3PDM P;  4C7O A;  3TQO A;  3CZ6 A;  1A0B A;  1O5H A;  2Q4F A;  2XLW A; 
#chains in the Genus database with same CATH homology
 2XM0 A;  3HNL A;  4N6H A;  1YYX A;  3HNI A;  3FOP A;  3M15 A;  5B3I A;  4CJG A;  4D4N A;  3L1M A;  4JKV A;  4ULV A;  4D4X A;  2YLD A;  1YYJ A;  5JS5 A;  5JP7 A;  3VRC A;  4CDV A;  5JLI A;  3QVY A;  2YKZ A;  2BC5 A;  3FOO A;  3ZTZ A;  3IQ6 A;  1M6T A;  2XLD A;  5JT4 A;  1RCP A;  3U8P A;  2YLG A;  2YLI A;  5JRA A;  1QQ3 A;  4L6R A;  1YZC A;  4IAQ A;  3QW1 A;  2YL1 A;  3ZQY A;  4IB4 A;  1EKY A;  1BBH A;  1JAF A;  3M4B A;  1APC A;  1CPR A;  1E86 A;  2J9B A;  1MQV A;  2XLV A;  3NMI A;  3M79 A;  3HNJ A;  2XLO A;  3ZQV A;  4WGY A;  1CGN A;  4JE9 A;  2XM4 A;  3TOM A;  2XLE A;  4N4W A;  2CCY A;  4CDA A;  2XLH A;  4JEB A;  3NMK A;  4EIY A;  5JSL A;  4CIP A;  4CJO A;  1NBB A;  3DE8 A;  4IAR A;  2YL7 A;  5JVE A;  3ZWI A;  3M4C A;  3QW0 A;  2YL3 A;  2YL0 A;  3C63 A;  3NMJ A;  4ER9 A;  3C62 A;  2XLM A;  2QLA A;  2XL6 A;  5JUA A;  1A7V A;  1LM3 B;  1E83 A;  3HNK A;  2XL8 A;  256B A;  1CPQ A;  4JEA A;  1YZA A;  4U9E A;  3QVZ A;  1QPU A;  1CGO A;  5AGF A;  3TOL A;  1S05 A;  2J8W A;  3DE9 A;  3IQ5 A;  4NC3 A;  4CDY A;  3ZTM A;  1E84 A;  1E85 A;  4U9D A;  1GQA A;  4CX9 A;  4WGZ A;  2XLW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...