2XL8A

Reduced structure of r124f mutant of cytochrome c' from alcaligenes xylosoxidans
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
126
structure length
126
Chain Sequence
EFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYFKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C'
publication title Distal-to-Proximal No Conversion in Hemoproteins: The Role of the Proximal Pocket.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Electron transport
total genus 50
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2010-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 2xl8A00
4IARA 1APCA 4U9DA 3VRCA 3DE9A 5AGFA 1YZCA 2J9BA 2XLMA 2YLIA 4CDAA 3ZQYA 1GQAA 4CDYA 1CPQA 3C62A 5JP7A 4N6HA 4NC3A 4ER9A 1E86A 5JLIA 4CJOA 4WGZA 3ZTMA 1S05A 4JKVA 1E85A 2YL7A 1CPRA 3M79A 5JS5A 3HNLA 1YYJA 1YYXA 2YL0A 1MQVA 4JEBA 2XM0A 3NMJA 3M15A 2XLDA 3IQ5A 2XL6A 3ZTZA 1BBHA 3M4BA 2YL3A 3QVYA 4JEAA 3HNJA 3ZQVA 1NBBA 4U9EA 3L1MA 5JRAA 1RCPA 1EKYA 5JSLA 3DE8A 4D4XA 3FOOA 4N4WA 3TOLA 3HNIA 3TOMA 2CCYA 4IAQA 4JE9A 2YLDA 5JUAA 1A7VA 1LM3B 4L6RA 3NMIA 2YL1A 5B3IA 256BA 1YZAA 4WGYA 1E83A 2XM4A 4EIYA 3IQ6A 4ULVA 2XLWA 4IB4A 5JVEA 1E84A 3QVZA 3HNKA 3C63A 4CIPA 2YKZA 2XLVA 1M6TA 1CGOA 2QLAA 3ZWIA 2BC5A 3NMKA 3U8PA 1CGNA 2XLHA 3QW1A 4CDVA 2XL8A 1QPUA 3FOPA 3M4CA 3QW0A 2XLEA 2J8WA 1JAFA 1QQ3A 2YLGA 5JT4A 2XLOA 4CJGA 4CX9A 4D4NA
chains in the Genus database with same CATH superfamily
2WVNA 2Z15A 3DZAA 4U5HA 3Q6NA 4I1OB 4KI2A 2L81A 3EHNA 3L8IA 4U9DA 3RIPA 2Q3TA 3VRCA 1T9KA 3E70C 3RVZA 2PX0A 2Y39A 4AL1A 1V74B 1J8MF 2XLMA 1V55C 2YLIA 4P9TA 5B3SC 2R7RA 1HE1A 3ZQYA 5DS5A 1GQAA 1EA8A 3VM6A 1L3PA 2XXAB 2VC9A 2X51A 2AWYA 5D91A 2PX3A 2NUTB 3ABKC 4Z9JA 2ETSA 4H4KC 4N6HA 3SXYA 3O6XA 3EFOB 5DQZA 3ZTZA 2B0HA 4K0DA 4E7ZA 1MMAA 1SZIA 3DXJF 5JLIA 4N06A 3B9QA 3G4XA 4E18A 4O79A 1EI7A 3V5XA 2A0BA 4WABA 1Q0FA 3RQFA 4XPWA 3F47A 5L0GA 3AG2C 1HW2A 4YK5A 2HJ3A 2YL7A 3C8GB 4MVOA 4RBNA 3U2LA 4BPMA 1NSGB 2TMVP 3UNGC 1BZ4A 1ZW2A 1BR1A 3EZIA 3FXHA 4A4AA 1Y6DA 3CZ6A 1Z6AA 3EH1A 3M79A 1Q0GA 2R05A 3QZCA 1YYJA 5DQTA 1YYXA 2V26A 2YL0A 1MQVA 4ULWA 5B1AC 4G0HA 4MTFA 3KMIA 4CS8A 2KW3C 3M15A 3FDQA 4IGGA 4BJ6C 4YWQA 4HEAJ 1YVIA 2A6EF 3AGTA 2KYHA 2KGOA 2L6GA 5A69A 2EIKC 4EHPA 2Q00A 4JTDB 1OKKA 3L8JA 4OIOF 3A11A 3EG9A 4O6YA 1VK5A 4JEAA 2VB6A 5KYXA 3W2VA 4MTOA 3HNJA 1WGWA 5DS4A 4C7OB 5F5FA 2BL2A 4YT2A 3CAXA 3DAGA 3GEHA 2XS8A 2CW0F 4P6IC 4XEFA 4BJTA 4FAPB 4O6NA 3NYLA 3T6JA 4J30B 2G3KA 2OCCC 1LI5A 3DE8A 4PJLA 1R5ID 2P6VA 3FOOA 1WASA 3I5PA 2FFHA 4MNDA 2HFIA 2R02A 2VCAA 4PJMA 1F1MA 4MVRA 3GANA 4KNWA 1TFOB 1NZEA 1YA7O 3EGDA 3JYYA 3B0UX 4WJ0A 3KH2A 3DJNB 3UR3C 2L6FA 2Y3HA 1T01A 4OIQF 3VYWA 3U2MA 4E0HA 2QNLA 1HY5A 2L7AA 4ZLCA 2ZXPA 4LERA 2D4UA 5AC4A 4EIYA 2AVKA 2R7QA 3Q6MA 3U8VA 4K1OA 4CSAC 3GM2A 3GWNA 4GYTA 2XLWA 2WVQA 4DVZA 4EBBA 3PDMP 3NDBB 5JVEA 3PCVA 3IPMO 3ZG1A 2HZ8A 3AQCA 3SP1A 1IZMA 3C63A 4U5BE 2YKZA 4C3EA 1RKEA 4JW1A 4PR9A 1M6TA 1FAPB 2R7UA 2L9JA 2QLAA 3R7CA 3G50A 1I5NA 1W2WA 3IHUA 1M57C 2WZFA 4PJNA 2EINC 4U5GA 1OQCA 1VLTA 2XL8A 1QPUA 2EIMC 3UMIA 3FAPB 3J06A 1XZPA 3K1IC 2RSEB 4ZLDA 5KYWA 1OXKA 1WTYA 3ABMC 4H54A 1YJGA 1XWJA 2R7OA 3IEEA 5EHHA 2IXNA 3UMKA 4MQ9F 2LD6A 2HKVA 4U5FE 2YQYA 3IQTA 1T6IA 3RW0A 1CGME 1N1CA 2WVOA 2GWWA 2J9WA 5A6KA 2DYSC 4W8PA 3K1HA 3SXMA 3BEHA 3EPVA 4MS2A 1E2XA 1ZU4A 3U3BA 5KYUB 1T6UA 4YL1A 4YL0A 3LNMB 2V3CC 4AE4B 4JTCB 2F22A 1ORYA 2HV6A 3KYIA 3O10A 3DJUB 2H7BA 2JD3A 1CPQA 4XTKA 2CGEA 3B29A 2FGYA 2Q9BA 4NC3A 3KL4A 1FR0A 2R7VA 2GDCA 1V4AA 2VCCA 1J8YF 1NU9C 1LPEA 1OXBA 1RJ9B 3POVA 4OINF 3PMRA 3S9OA 3T4RA 4CJOA 2HJMA 3RQEA 2LFFA 2P61A 5L0FA 1NLXA 3DMDA 2KSFA 1LS1A 3EJNA 1CPRA 2J7PD 1YLMA 1VLSA 3JTLO 2ICWG 4FESA 3EH2A 4JJGA 2R7XA 2R7TA 2OG2A 2KC3A 2OEXA 4G78A 5F5HA 2A0UA 3LAYA 4NTAA 2ASRA 2IBFA 5EK0A 4E7SA 4NTFA 3U0CA 1JOGA 4QI0A 2XM0A 3NMJA 4U5EE 1HMDA 2HSQA 4PFPA 2EIJC 5AC5A 1SF8A 4NY3A 5L3VA 4XLPF 2XLDA 4JCZA 4JC7A 1Z7Qc 2J45A 2OOCA 4YN0B 4OIRF 1UFBA 4XQ1A 2J0WA 1BBHA 1VMAA 2IXPA 3VF0A 1VYIA 4CS8C 3M4BA 2EPMX 1FMWA 2HUJA 2YL3A 3DM5A 3MBGA 4J32B 4LACB 4YT8A 1Z5ZA 2YRFA 4DRJB 3US6A 1AUEA 2D5RB 2KNHA 2ZXWC 3EQLF 3JRMO 2NSGA 5JRAA 2DB4A 1EKYA 2H8AA 2H7OA 4CBEA 3M1CB 4YT4A 5L0IA 2PBEA 5TJ5E 1ZYRF 4KBLA 3RH3A 5FZTA 2Q7RA 1G8XA 2EPNA 4JIOA 3WAQA 4AK9A 4N4WA 4D4XA 4E17A 3DAFA 2HSBA 1A0BA 3TOLA 3ZDLA 1JR8A 3HNIA 4A2NB 5A6JA 3ZSUA 5KYYB 4JURI 4IAQA 3C8GD 5KYNA 2YLDA 4KC9A 3AOUA 2IOQA 1A7VA 2M4EA 3ITFA 1LM3B 3NYMA 3U9JA 4J7YA 4XWJA 3NMIA 1JPJA 2DYRC 5E2QA 1ZHTA 3S90A 1K05A 3AG4C 1YAUO 4P9FA 1HMOA 3HKKA 3EZHA 4DRIB 3MYFA 3W8HA 1K40A 3TULA 4IRUA 2ZXOA 3HTKC 2LFDA 5GPGB 1A7DA 1KTMA 1VB5A 2QE9A 2OQMA 4IB4A 3F46A 1BDJB 1I4YA 1TWGA 1AVOB 2HMQA 3OWTA 3VAYA 3ECSA 1ZU5A 5DLJA 2OJQA 2J46A 1FFHA 2UUIA 3HNKA 2CYDA 4MW8A 3W8IA 4G7ZF 3T6GB 1C03A 4PACA 3NYJA 1CGOA 3BRJA 3ZWIA 2BC5A 3DWWA 5EGYA 1R4TA 1NU7D 1LE4A 3ASOC 4EBKA 1OCRC 1MMDA 3H2UA 3EGXB 3QW1A 3X2QC 4CDVA 5FCLA 3EGDB 2A68F 3TK0A 3M4CA 1WWPA 3C18A 4GQHA 3H65A 5T1DB 5HV9A 3MFNA 1EQ1A 2XLEA 2Q4FA 2GAQA 2OEVA 4O7GA 1JAFA 1QQ3A 1S7ZA 2NSFA 3JT1A 2YLGA 4NTBA 5A6BD 2AP3A 1L7CA 1TQGA 2XLOA 2VH3A 1WATA 4CJGA 4JVSA 3GEEA 4XEVA 3WG7C 1UG7A 4CX9A 2YEVA 1OW8A 4AL0A 3LUTB 4EWCA 3HJCA 2AWCA 2KJGA 1U89A 2FAPB 2IM8A 1APCA 4EUKB 3DE9A 2Y3BA 2PNOA 4Z9IA 3V5YA 5DVWA 3LEVA 1D1CA 1HW1A 1SYQA 2WZGA 1YZCA 2G62A 5E3CA 2XL4A 1H6GA 4CDAA 2LIGA 1RKEB 1WOLA 2M64A 4KNVA 4XPXA 4CDYA 2EPLX 3C62A 3TQOA 5JP7A 1FTSA 3LNRA 1D0YA 2NUPA 4LDQA 4BJ5A 4ANJA 3SYNA 4ER9A 1A7EA 1VOMA 2I15A 4DBRA 1VYKA 1C17M 5E33A 2JPUA 2NPUA 4CS7A 5K0IA 4AX2A 3DD7A 3G4ZA 5L0DA 1MNEA 4WGZA 3ZTMA 5KYYA 1OCZC 1S05A 4JKVA 1YARO 1E85A 1C02A 1GGQA 4RDAA 5CI9A 1WN0A 3SZRA 1M56C 2J9UA 2XRHA 4MVUA 3S29A 3NG1A 4DJ9A 1FNTc 4CIHA 2Y69C 3KPHA 3HNLA 3T6BA 3UMHA 1LE2A 4MTGA 3LS0A 4XPYA 3U9MA 2PFDA 1M2VA 1A41A 2OKUA 3JSEO 1QVXA 2IYLD 1FMVA 1H7IA 1QZXA 2DI3A 4CS9A 1GM5A 4JCHA 4OD4A 3QMKA 1OR3A 3AJMA 1ZHWA 4EBJA 4IJJA 4GEHA 1PD0A 3GM1A 2X0CA 1O3UA 3SXZA 4EKWA 4DBQA 5IY5C 4LDKA 1Z23A 4J7TA 3B71A 2CNWD 3N24A 3B0PA 3RQGA 2R9RB 2IXOA 1NBBA 1PCXA 1TWAA 2GA0A 2Y3DA 1GS9A 1RCPA 2ZXRA 3DKAA 1T6QA 5T3WA 1G5ZA 3SXKA 3WODF 1LI7A 4JZAA 3E9VA 2CDQA 3K7DA 3ZC4A 1MMNA 4OIPF 2BE5F 3I5QA 3TOMA 2CCYA 2Q9AA 2WB7A 3O39A 3OEOA 4JE9A 1BR4A 4G7OF 3NRHA 2YL1A 2J7PA 3PHF2 1ZHYA 256BA 4FWVA 2QUPA 4C3DA 5T3TA 1G4WR 1OR2A 1ZZPA 3DM9B 2O9XA 3CEXA 4JJFA 4WGYA 1E83A 5L0HA 2EILC 1PV3A 1QKRA 2C04A 4W8KA 4ULVA 4HFKB 1YA9A 5A6AA 3U3FA 2A1DD 1TR2A 3LLIA 1ZHXA 3NKEA 4E0IA 5COMA 2LQGA 4C3BA 3K6BA 1Q0MA 2LCHA 1V54C 1LVKA 3C8ZA 2YHSA 3QVZA 2EPKX 1ZW3A 2HV7A 4F4BA 2G3VA 1Z3IX 3FMSA 5COFA 3NMKA 2L6HA 2XXAA 4DVYP 1LKXA 1OCOC 1T5OA 2RD9A 2KK1A 2XLHA 3JRTA 4FX5A 1H9GA 4YT5A 2NUTA 3V7OA 4U5DE 3EFOA 3FOPA 1Z63A 1RMVA 2A6HF 2E87A 5B1BC 2J8WA 3JZ0A 1ZVZA 3IQCA 4G7HF 2P7VA 3MX3A 1MNDA 3B0VC 4IWBA 4MVZA 3AG3C 3TD7A 1U0BB 1OCCC 1K04A 1HE9A 1TWHA 2HMZA 2I8BA 1TWCA 2PF4E 3C8GA 1U6HA 3H2VA 3MYIA 3SEOA 4D4NA 3EG9B 4YL3A 5JS5A 2P0NA 2MWQA 4JRZA 2W9YA 4IARA 3RVYA 5KYXB 3TJ5A 4Q5SF 4IAOA 3AG1C 1NFOA 2IXMA 3ASNC 4PJJA 3L0IA 5AGFA 3DI5A 4Z9HA 1OKKD 3KYJA 4LDRA 2J9BA 1B68A 2J0XA 3R2PA 3LEOA 3OA1A 3KKBA 4XLNF 1Y4CA 4NQFA 2UUHA 3RF3A 1M2OA 2ZD9A 4MW3A 4I44A 3FHDA 2R25A 3S0XA 1E86A 1O87A 2LK4A 1IW7F 2R03A 2EPOA 5L3QA 3O55A 4C7OA 4RD9A 4DRHB 4PFOA 1KU2A 3ZVRA 1XZQA 1QLEC 2OU6A 3EHMA 3MLGA 3GORA 4LLCA 4BJ5C 2MYSA 2W45A 3LJBA 1D1AA 3LS1A 5COGA 4U5CE 3Q7GA 5D92A 3ZIBA 1RXQA 1JRAA 4NCQA 4B6IA 4MVMA 1ORSC 3GODA 2LSEA 3S27A 2WZLA 5A6BA 1SMYF 1LIHA 2KQ9A 3JYHA 3W2WA 2PP4A 3L34A 1D0ZA 2GFHA 1O5HA 3LLKA 3EGXA 4OD5A 4BJ6A 4Q7CA 4HFFB 3JSZA 1DOWA 3N2ZB 5BQGA 3Q7LA 1Q0DA 4JEBA 2JX0A 1AEPA 4R32A 4QI2A 1Q0KA 3ABLC 3IQ5A 3QTHA 4X0RA 4LLEA 4M63A 2WL8A 2ZPAA 3S28A 2OJED 3N0TA 5CIVA 1JMWA 3NKDA 2C03A 2NUPB 2XL6A 3K33A 2J9VA 3A9CA 5F28E 1NFNA 3CSKA 3TJ6A 3SNHA 3QVYA 4CS9C 5L0CA 5KYWB 4O6MA 3U5SA 3ZQVA 1ST6A 4U9EA 1SR2A 2YVKA 2YZSA 3L1MA 3S84A 2YWAA 1DOVA 3V5ZA 2R7WA 4Q4ZF 1TFKB 4ONSA 5JSLA 2QTVA 1TKNA 2W4MA 2XS1A 3JCUQ 4PK4A 4I1MA 3I4UA 4BEJA 1MMGA 5CI8A 5BQIA 2MHRA 1D1BA 1NG1A 4MVSA 1FFTC 1OW6A 4MVQA 3RKOF 5JUAA 1OW7A 5L0JA 1M2VB 4L6RA 5DS6A 3AGUA 3WHNA 5B3IA 1ORJA 4YJWA 4CSAA 1PD1A 1YZAA 4K7BA 2XM4A 1VTMP 5HSWA 2VCBA 4HE8D 3K66A 3IQ6A 5BQHA 3FAJA 1KNYA 1BR2A 3W4YA 3X1OA 2Y3GA 1QSPA 3FVYA 3RYLA 1JPNA 1D0XA 5E3AA 2DGJA 4BEMJ 4BG0A 1E84A 1H9TA 3UGPA 3C7JA 4I3MA 2NG1A 1YDIA 5KYUA 2P1AA 1LS4A 2A69F 2HS5A 3RFYA 4XEKA 2AU5A 2XLVA 4AE4A 2CNWA 5BUOA 4CIPA 3HLZA 3ATPA 2B0JA 3K1IA 1ZHZA 2Q9CA 3UGOA 3U8PA 1CGNA 4BJ1A 3GM3A 1G4US 2W4BA 3QW0A 2H7VC 3LESA 2QY9A 1RJ9A 1RKCA 4N6CA 2VASA 4JTAB 4DXWA 2XSEA 3GEIA 2R7SA 5JT4A 4DOZA 4QDLA 3T9OA 1I4ZA 3GWLA 2LP4A 3AQBA 4UDVA 3CQZA
chains in the Genus database with same CATH topology
4IARA 1APCA 4U9DA 3VRCA 3DE9A 5AGFA 1YZCA 2J9BA 2XLMA 2YLIA 4CDAA 3ZQYA 1GQAA 4CDYA 1CPQA 3C62A 5JP7A 4N6HA 4NC3A 4ER9A 1E86A 5JLIA 4CJOA 4WGZA 3ZTMA 1S05A 4JKVA 1E85A 2YL7A 1CPRA 3M79A 5JS5A 3HNLA 1YYJA 1YYXA 2YL0A 1MQVA 4JEBA 2XM0A 3NMJA 3M15A 2XLDA 3IQ5A 2XL6A 3ZTZA 1BBHA 3M4BA 2YL3A 3QVYA 4JEAA 3HNJA 3ZQVA 1NBBA 4U9EA 3L1MA 5JRAA 1RCPA 1EKYA 5JSLA 3DE8A 4D4XA 3FOOA 4N4WA 3TOLA 3HNIA 3TOMA 2CCYA 4IAQA 4JE9A 2YLDA 5JUAA 1A7VA 1LM3B 4L6RA 3NMIA 2YL1A 5B3IA 256BA 1YZAA 4WGYA 1E83A 2XM4A 4EIYA 3IQ6A 4ULVA 2XLWA 4IB4A 5JVEA 1E84A 3QVZA 3HNKA 3C63A 4CIPA 2YKZA 2XLVA 1M6TA 1CGOA 2QLAA 3ZWIA 2BC5A 3NMKA 3U8PA 1CGNA 2XLHA 3QW1A 4CDVA 2XL8A 1QPUA 3FOPA 3M4CA 3QW0A 2XLEA 2J8WA 1JAFA 1QQ3A 2YLGA 5JT4A 2XLOA 4CJGA 4CX9A 4D4NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IAR A;  1APC A;  4U9D A;  3VRC A;  3DE9 A;  5AGF A;  1YZC A;  2J9B A;  2XLM A;  2YLI A;  4CDA A;  3ZQY A;  1GQA A;  4CDY A;  1CPQ A;  3C62 A;  5JP7 A;  4N6H A;  4NC3 A;  4ER9 A;  1E86 A;  5JLI A;  4CJO A;  4WGZ A;  3ZTM A;  1S05 A;  4JKV A;  1E85 A;  2YL7 A;  1CPR A;  3M79 A;  5JS5 A;  3HNL A;  1YYJ A;  1YYX A;  2YL0 A;  1MQV A;  4JEB A;  2XM0 A;  3NMJ A;  3M15 A;  2XLD A;  3IQ5 A;  2XL6 A;  3ZTZ A;  1BBH A;  3M4B A;  2YL3 A;  3QVY A;  4JEA A;  3HNJ A;  3ZQV A;  1NBB A;  4U9E A;  3L1M A;  5JRA A;  1RCP A;  1EKY A;  5JSL A;  3DE8 A;  4D4X A;  3FOO A;  4N4W A;  3TOL A;  3HNI A;  3TOM A;  2CCY A;  4IAQ A;  4JE9 A;  2YLD A;  5JUA A;  1A7V A;  1LM3 B;  4L6R A;  3NMI A;  2YL1 A;  5B3I A;  256B A;  1YZA A;  4WGY A;  1E83 A;  2XM4 A;  4EIY A;  3IQ6 A;  4ULV A;  2XLW A;  4IB4 A;  5JVE A;  1E84 A;  3QVZ A;  3HNK A;  3C63 A;  4CIP A;  2YKZ A;  2XLV A;  1M6T A;  1CGO A;  2QLA A;  3ZWI A;  2BC5 A;  3NMK A;  3U8P A;  1CGN A;  2XLH A;  3QW1 A;  4CDV A;  2XL8 A;  1QPU A;  3FOP A;  3M4C A;  3QW0 A;  2XLE A;  2J8W A;  1JAF A;  1QQ3 A;  2YLG A;  5JT4 A;  2XLO A;  4CJG A;  4CX9 A;  4D4N A; 
#chains in the Genus database with same CATH topology
 2WVN A;  2Z15 A;  3DZA A;  4U5H A;  3Q6N A;  4I1O B;  4KI2 A;  2L81 A;  3EHN A;  3L8I A;  4U9D A;  3RIP A;  2Q3T A;  3VRC A;  1T9K A;  3E70 C;  3RVZ A;  2PX0 A;  2Y39 A;  4AL1 A;  1V74 B;  1J8M F;  2XLM A;  1V55 C;  2YLI A;  4P9T A;  5B3S C;  2R7R A;  1HE1 A;  3ZQY A;  5DS5 A;  1GQA A;  1EA8 A;  3VM6 A;  1L3P A;  2XXA B;  2VC9 A;  2X51 A;  2AWY A;  5D91 A;  2PX3 A;  2NUT B;  3ABK C;  4Z9J A;  2ETS A;  4H4K C;  4N6H A;  3SXY A;  3O6X A;  3EFO B;  5DQZ A;  3ZTZ A;  2B0H A;  4K0D A;  4E7Z A;  1MMA A;  1SZI A;  3DXJ F;  5JLI A;  4N06 A;  3B9Q A;  3G4X A;  4E18 A;  4O79 A;  1EI7 A;  3V5X A;  2A0B A;  4WAB A;  1Q0F A;  3RQF A;  4XPW A;  3F47 A;  5L0G A;  3AG2 C;  1HW2 A;  4YK5 A;  2HJ3 A;  2YL7 A;  3C8G B;  4MVO A;  4RBN A;  3U2L A;  4BPM A;  1NSG B;  2TMV P;  3UNG C;  1BZ4 A;  1ZW2 A;  1BR1 A;  3EZI A;  3FXH A;  4A4A A;  1Y6D A;  3CZ6 A;  1Z6A A;  3EH1 A;  3M79 A;  1Q0G A;  2R05 A;  3QZC A;  1YYJ A;  5DQT A;  1YYX A;  2V26 A;  2YL0 A;  1MQV A;  4ULW A;  5B1A C;  4G0H A;  4MTF A;  3KMI A;  4CS8 A;  2KW3 C;  3M15 A;  3FDQ A;  4IGG A;  4BJ6 C;  4YWQ A;  4HEA J;  1YVI A;  2A6E F;  3AGT A;  2KYH A;  2KGO A;  2L6G A;  5A69 A;  2EIK C;  4EHP A;  2Q00 A;  4JTD B;  1OKK A;  3L8J A;  4OIO F;  3A11 A;  3EG9 A;  4O6Y A;  1VK5 A;  4JEA A;  2VB6 A;  5KYX A;  3W2V A;  4MTO A;  3HNJ A;  1WGW A;  5DS4 A;  4C7O B;  5F5F A;  2BL2 A;  4YT2 A;  3CAX A;  3DAG A;  3GEH A;  2XS8 A;  2CW0 F;  4P6I C;  4XEF A;  4BJT A;  4FAP B;  4O6N A;  3NYL A;  3T6J A;  4J30 B;  2G3K A;  2OCC C;  1LI5 A;  3DE8 A;  4PJL A;  1R5I D;  2P6V A;  3FOO A;  1WAS A;  3I5P A;  2FFH A;  4MND A;  2HFI A;  2R02 A;  2VCA A;  4PJM A;  1F1M A;  4MVR A;  3GAN A;  4KNW A;  1TFO B;  1NZE A;  1YA7 O;  3EGD A;  3JYY A;  3B0U X;  4WJ0 A;  3KH2 A;  3DJN B;  3UR3 C;  2L6F A;  2Y3H A;  1T01 A;  4OIQ F;  3VYW A;  3U2M A;  4E0H A;  2QNL A;  1HY5 A;  2L7A A;  4ZLC A;  2ZXP A;  4LER A;  2D4U A;  5AC4 A;  4EIY A;  2AVK A;  2R7Q A;  3Q6M A;  3U8V A;  4K1O A;  4CSA C;  3GM2 A;  3GWN A;  4GYT A;  2XLW A;  2WVQ A;  4DVZ A;  4EBB A;  3PDM P;  3NDB B;  5JVE A;  3PCV A;  3IPM O;  3ZG1 A;  2HZ8 A;  3AQC A;  3SP1 A;  1IZM A;  3C63 A;  4U5B E;  2YKZ A;  4C3E A;  1RKE A;  4JW1 A;  4PR9 A;  1M6T A;  1FAP B;  2R7U A;  2L9J A;  2QLA A;  3R7C A;  3G50 A;  1I5N A;  1W2W A;  3IHU A;  1M57 C;  2WZF A;  4PJN A;  2EIN C;  4U5G A;  1OQC A;  1VLT A;  2XL8 A;  1QPU A;  2EIM C;  3UMI A;  3FAP B;  3J06 A;  1XZP A;  3K1I C;  2RSE B;  4ZLD A;  5KYW A;  1OXK A;  1WTY A;  3ABM C;  4H54 A;  1YJG A;  1XWJ A;  2R7O A;  3IEE A;  5EHH A;  2IXN A;  3UMK A;  4MQ9 F;  2LD6 A;  2HKV A;  4U5F E;  2YQY A;  3IQT A;  1T6I A;  3RW0 A;  1CGM E;  1N1C A;  2WVO A;  2GWW A;  2J9W A;  5A6K A;  2DYS C;  4W8P A;  3K1H A;  3SXM A;  3BEH A;  3EPV A;  4MS2 A;  1E2X A;  1ZU4 A;  3U3B A;  5KYU B;  1T6U A;  4YL1 A;  4YL0 A;  3LNM B;  2V3C C;  4AE4 B;  4JTC B;  2F22 A;  1ORY A;  2HV6 A;  3KYI A;  3O10 A;  3DJU B;  2H7B A;  2JD3 A;  1CPQ A;  4XTK A;  2CGE A;  3B29 A;  2FGY A;  2Q9B A;  4NC3 A;  3KL4 A;  1FR0 A;  2R7V A;  2GDC A;  1V4A A;  2VCC A;  1J8Y F;  1NU9 C;  1LPE A;  1OXB A;  1RJ9 B;  3POV A;  4OIN F;  3PMR A;  3S9O A;  3T4R A;  4CJO A;  2HJM A;  3RQE A;  2LFF A;  2P61 A;  5L0F A;  1NLX A;  3DMD A;  2KSF A;  1LS1 A;  3EJN A;  1CPR A;  2J7P D;  1YLM A;  1VLS A;  3JTL O;  2ICW G;  4FES A;  3EH2 A;  4JJG A;  2R7X A;  2R7T A;  2OG2 A;  2KC3 A;  2OEX A;  4G78 A;  5F5H A;  2A0U A;  3LAY A;  4NTA A;  2ASR A;  2IBF A;  5EK0 A;  4E7S A;  4NTF A;  3U0C A;  1JOG A;  4QI0 A;  2XM0 A;  3NMJ A;  4U5E E;  1HMD A;  2HSQ A;  4PFP A;  2EIJ C;  5AC5 A;  1SF8 A;  4NY3 A;  5L3V A;  4XLP F;  2XLD A;  4JCZ A;  4JC7 A;  1Z7Q c;  2J45 A;  2OOC A;  4YN0 B;  4OIR F;  1UFB A;  4XQ1 A;  2J0W A;  1BBH A;  1VMA A;  2IXP A;  3VF0 A;  1VYI A;  4CS8 C;  3M4B A;  2EPM X;  1FMW A;  2HUJ A;  2YL3 A;  3DM5 A;  3MBG A;  4J32 B;  4LAC B;  4YT8 A;  1Z5Z A;  2YRF A;  4DRJ B;  3US6 A;  1AUE A;  2D5R B;  2KNH A;  2ZXW C;  3EQL F;  3JRM O;  2NSG A;  5JRA A;  2DB4 A;  1EKY A;  2H8A A;  2H7O A;  4CBE A;  3M1C B;  4YT4 A;  5L0I A;  2PBE A;  5TJ5 E;  1ZYR F;  4KBL A;  3RH3 A;  5FZT A;  2Q7R A;  1G8X A;  2EPN A;  4JIO A;  3WAQ A;  4AK9 A;  4N4W A;  4D4X A;  4E17 A;  3DAF A;  2HSB A;  1A0B A;  3TOL A;  3ZDL A;  1JR8 A;  3HNI A;  4A2N B;  5A6J A;  3ZSU A;  5KYY B;  4JUR I;  4IAQ A;  3C8G D;  5KYN A;  2YLD A;  4KC9 A;  3AOU A;  2IOQ A;  1A7V A;  2M4E A;  3ITF A;  1LM3 B;  3NYM A;  3U9J A;  4J7Y A;  4XWJ A;  3NMI A;  1JPJ A;  2DYR C;  5E2Q A;  1ZHT A;  3S90 A;  1K05 A;  3AG4 C;  1YAU O;  4P9F A;  1HMO A;  3HKK A;  3EZH A;  4DRI B;  3MYF A;  3W8H A;  1K40 A;  3TUL A;  4IRU A;  2ZXO A;  3HTK C;  2LFD A;  5GPG B;  1A7D A;  1KTM A;  1VB5 A;  2QE9 A;  2OQM A;  4IB4 A;  3F46 A;  1BDJ B;  1I4Y A;  1TWG A;  1AVO B;  2HMQ A;  3OWT A;  3VAY A;  3ECS A;  1ZU5 A;  5DLJ A;  2OJQ A;  2J46 A;  1FFH A;  2UUI A;  3HNK A;  2CYD A;  4MW8 A;  3W8I A;  4G7Z F;  3T6G B;  1C03 A;  4PAC A;  3NYJ A;  1CGO A;  3BRJ A;  3ZWI A;  2BC5 A;  3DWW A;  5EGY A;  1R4T A;  1NU7 D;  1LE4 A;  3ASO C;  4EBK A;  1OCR C;  1MMD A;  3H2U A;  3EGX B;  3QW1 A;  3X2Q C;  4CDV A;  5FCL A;  3EGD B;  2A68 F;  3TK0 A;  3M4C A;  1WWP A;  3C18 A;  4GQH A;  3H65 A;  5T1D B;  5HV9 A;  3MFN A;  1EQ1 A;  2XLE A;  2Q4F A;  2GAQ A;  2OEV A;  4O7G A;  1JAF A;  1QQ3 A;  1S7Z A;  2NSF A;  3JT1 A;  2YLG A;  4NTB A;  5A6B D;  2AP3 A;  1L7C A;  1TQG A;  2XLO A;  2VH3 A;  1WAT A;  4CJG A;  4JVS A;  3GEE A;  4XEV A;  3WG7 C;  1UG7 A;  4CX9 A;  2YEV A;  1OW8 A;  4AL0 A;  3LUT B;  4EWC A;  3HJC A;  2AWC A;  2KJG A;  1U89 A;  2FAP B;  2IM8 A;  1APC A;  4EUK B;  3DE9 A;  2Y3B A;  2PNO A;  4Z9I A;  3V5Y A;  5DVW A;  3LEV A;  1D1C A;  1HW1 A;  1SYQ A;  2WZG A;  1YZC A;  2G62 A;  5E3C A;  2XL4 A;  1H6G A;  4CDA A;  2LIG A;  1RKE B;  1WOL A;  2M64 A;  4KNV A;  4XPX A;  4CDY A;  2EPL X;  3C62 A;  3TQO A;  5JP7 A;  1FTS A;  3LNR A;  1D0Y A;  2NUP A;  4LDQ A;  4BJ5 A;  4ANJ A;  3SYN A;  4ER9 A;  1A7E A;  1VOM A;  2I15 A;  4DBR A;  1VYK A;  1C17 M;  5E33 A;  2JPU A;  2NPU A;  4CS7 A;  5K0I A;  4AX2 A;  3DD7 A;  3G4Z A;  5L0D A;  1MNE A;  4WGZ A;  3ZTM A;  5KYY A;  1OCZ C;  1S05 A;  4JKV A;  1YAR O;  1E85 A;  1C02 A;  1GGQ A;  4RDA A;  5CI9 A;  1WN0 A;  3SZR A;  1M56 C;  2J9U A;  2XRH A;  4MVU A;  3S29 A;  3NG1 A;  4DJ9 A;  1FNT c;  4CIH A;  2Y69 C;  3KPH A;  3HNL A;  3T6B A;  3UMH A;  1LE2 A;  4MTG A;  3LS0 A;  4XPY A;  3U9M A;  2PFD A;  1M2V A;  1A41 A;  2OKU A;  3JSE O;  1QVX A;  2IYL D;  1FMV A;  1H7I A;  1QZX A;  2DI3 A;  4CS9 A;  1GM5 A;  4JCH A;  4OD4 A;  3QMK A;  1OR3 A;  3AJM A;  1ZHW A;  4EBJ A;  4IJJ A;  4GEH A;  1PD0 A;  3GM1 A;  2X0C A;  1O3U A;  3SXZ A;  4EKW A;  4DBQ A;  5IY5 C;  4LDK A;  1Z23 A;  4J7T A;  3B71 A;  2CNW D;  3N24 A;  3B0P A;  3RQG A;  2R9R B;  2IXO A;  1NBB A;  1PCX A;  1TWA A;  2GA0 A;  2Y3D A;  1GS9 A;  1RCP A;  2ZXR A;  3DKA A;  1T6Q A;  5T3W A;  1G5Z A;  3SXK A;  3WOD F;  1LI7 A;  4JZA A;  3E9V A;  2CDQ A;  3K7D A;  3ZC4 A;  1MMN A;  4OIP F;  2BE5 F;  3I5Q A;  3TOM A;  2CCY A;  2Q9A A;  2WB7 A;  3O39 A;  3OEO A;  4JE9 A;  1BR4 A;  4G7O F;  3NRH A;  2YL1 A;  2J7P A;  3PHF 2;  1ZHY A;  256B A;  4FWV A;  2QUP A;  4C3D A;  5T3T A;  1G4W R;  1OR2 A;  1ZZP A;  3DM9 B;  2O9X A;  3CEX A;  4JJF A;  4WGY A;  1E83 A;  5L0H A;  2EIL C;  1PV3 A;  1QKR A;  2C04 A;  4W8K A;  4ULV A;  4HFK B;  1YA9 A;  5A6A A;  3U3F A;  2A1D D;  1TR2 A;  3LLI A;  1ZHX A;  3NKE A;  4E0I A;  5COM A;  2LQG A;  4C3B A;  3K6B A;  1Q0M A;  2LCH A;  1V54 C;  1LVK A;  3C8Z A;  2YHS A;  3QVZ A;  2EPK X;  1ZW3 A;  2HV7 A;  4F4B A;  2G3V A;  1Z3I X;  3FMS A;  5COF A;  3NMK A;  2L6H A;  2XXA A;  4DVY P;  1LKX A;  1OCO C;  1T5O A;  2RD9 A;  2KK1 A;  2XLH A;  3JRT A;  4FX5 A;  1H9G A;  4YT5 A;  2NUT A;  3V7O A;  4U5D E;  3EFO A;  3FOP A;  1Z63 A;  1RMV A;  2A6H F;  2E87 A;  5B1B C;  2J8W A;  3JZ0 A;  1ZVZ A;  3IQC A;  4G7H F;  2P7V A;  3MX3 A;  1MND A;  3B0V C;  4IWB A;  4MVZ A;  3AG3 C;  3TD7 A;  1U0B B;  1OCC C;  1K04 A;  1HE9 A;  1TWH A;  2HMZ A;  2I8B A;  1TWC A;  2PF4 E;  3C8G A;  1U6H A;  3H2V A;  3MYI A;  3SEO A;  4D4N A;  3EG9 B;  4YL3 A;  5JS5 A;  2P0N A;  2MWQ A;  4JRZ A;  2W9Y A;  4IAR A;  3RVY A;  5KYX B;  3TJ5 A;  4Q5S F;  4IAO A;  3AG1 C;  1NFO A;  2IXM A;  3ASN C;  4PJJ A;  3L0I A;  5AGF A;  3DI5 A;  4Z9H A;  1OKK D;  3KYJ A;  4LDR A;  2J9B A;  1B68 A;  2J0X A;  3R2P A;  3LEO A;  3OA1 A;  3KKB A;  4XLN F;  1Y4C A;  4NQF A;  2UUH A;  3RF3 A;  1M2O A;  2ZD9 A;  4MW3 A;  4I44 A;  3FHD A;  2R25 A;  3S0X A;  1E86 A;  1O87 A;  2LK4 A;  1IW7 F;  2R03 A;  2EPO A;  5L3Q A;  3O55 A;  4C7O A;  4RD9 A;  4DRH B;  4PFO A;  1KU2 A;  3ZVR A;  1XZQ A;  1QLE C;  2OU6 A;  3EHM A;  3MLG A;  3GOR A;  4LLC A;  4BJ5 C;  2MYS A;  2W45 A;  3LJB A;  1D1A A;  3LS1 A;  5COG A;  4U5C E;  3Q7G A;  5D92 A;  3ZIB A;  1RXQ A;  1JRA A;  4NCQ A;  4B6I A;  4MVM A;  1ORS C;  3GOD A;  2LSE A;  3S27 A;  2WZL A;  5A6B A;  1SMY F;  1LIH A;  2KQ9 A;  3JYH A;  3W2W A;  2PP4 A;  3L34 A;  1D0Z A;  2GFH A;  1O5H A;  3LLK A;  3EGX A;  4OD5 A;  4BJ6 A;  4Q7C A;  4HFF B;  3JSZ A;  1DOW A;  3N2Z B;  5BQG A;  3Q7L A;  1Q0D A;  4JEB A;  2JX0 A;  1AEP A;  4R32 A;  4QI2 A;  1Q0K A;  3ABL C;  3IQ5 A;  3QTH A;  4X0R A;  4LLE A;  4M63 A;  2WL8 A;  2ZPA A;  3S28 A;  2OJE D;  3N0T A;  5CIV A;  1JMW A;  3NKD A;  2C03 A;  2NUP B;  2XL6 A;  3K33 A;  2J9V A;  3A9C A;  5F28 E;  1NFN A;  3CSK A;  3TJ6 A;  3SNH A;  3QVY A;  4CS9 C;  5L0C A;  5KYW B;  4O6M A;  3U5S A;  3ZQV A;  1ST6 A;  4U9E A;  1SR2 A;  2YVK A;  2YZS A;  3L1M A;  3S84 A;  2YWA A;  1DOV A;  3V5Z A;  2R7W A;  4Q4Z F;  1TFK B;  4ONS A;  5JSL A;  2QTV A;  1TKN A;  2W4M A;  2XS1 A;  3JCU Q;  4PK4 A;  4I1M A;  3I4U A;  4BEJ A;  1MMG A;  5CI8 A;  5BQI A;  2MHR A;  1D1B A;  1NG1 A;  4MVS A;  1FFT C;  1OW6 A;  4MVQ A;  3RKO F;  5JUA A;  1OW7 A;  5L0J A;  1M2V B;  4L6R A;  5DS6 A;  3AGU A;  3WHN A;  5B3I A;  1ORJ A;  4YJW A;  4CSA A;  1PD1 A;  1YZA A;  4K7B A;  2XM4 A;  1VTM P;  5HSW A;  2VCB A;  4HE8 D;  3K66 A;  3IQ6 A;  5BQH A;  3FAJ A;  1KNY A;  1BR2 A;  3W4Y A;  3X1O A;  2Y3G A;  1QSP A;  3FVY A;  3RYL A;  1JPN A;  1D0X A;  5E3A A;  2DGJ A;  4BEM J;  4BG0 A;  1E84 A;  1H9T A;  3UGP A;  3C7J A;  4I3M A;  2NG1 A;  1YDI A;  5KYU A;  2P1A A;  1LS4 A;  2A69 F;  2HS5 A;  3RFY A;  4XEK A;  2AU5 A;  2XLV A;  4AE4 A;  2CNW A;  5BUO A;  4CIP A;  3HLZ A;  3ATP A;  2B0J A;  3K1I A;  1ZHZ A;  2Q9C A;  3UGO A;  3U8P A;  1CGN A;  4BJ1 A;  3GM3 A;  1G4U S;  2W4B A;  3QW0 A;  2H7V C;  3LES A;  2QY9 A;  1RJ9 A;  1RKC A;  4N6C A;  2VAS A;  4JTA B;  4DXW A;  2XSE A;  3GEI A;  2R7S A;  5JT4 A;  4DOZ A;  4QDL A;  3T9O A;  1I4Z A;  3GWL A;  2LP4 A;  3AQB A;  4UDV A;  3CQZ A; 
#chains in the Genus database with same CATH homology
 4IAR A;  1APC A;  4U9D A;  3VRC A;  3DE9 A;  5AGF A;  1YZC A;  2J9B A;  2XLM A;  2YLI A;  4CDA A;  3ZQY A;  1GQA A;  4CDY A;  1CPQ A;  3C62 A;  5JP7 A;  4N6H A;  4NC3 A;  4ER9 A;  1E86 A;  5JLI A;  4CJO A;  4WGZ A;  3ZTM A;  1S05 A;  4JKV A;  1E85 A;  2YL7 A;  1CPR A;  3M79 A;  5JS5 A;  3HNL A;  1YYJ A;  1YYX A;  2YL0 A;  1MQV A;  4JEB A;  2XM0 A;  3NMJ A;  3M15 A;  2XLD A;  3IQ5 A;  2XL6 A;  3ZTZ A;  1BBH A;  3M4B A;  2YL3 A;  3QVY A;  4JEA A;  3HNJ A;  3ZQV A;  1NBB A;  4U9E A;  3L1M A;  5JRA A;  1RCP A;  1EKY A;  5JSL A;  3DE8 A;  4D4X A;  3FOO A;  4N4W A;  3TOL A;  3HNI A;  3TOM A;  2CCY A;  4IAQ A;  4JE9 A;  2YLD A;  5JUA A;  1A7V A;  1LM3 B;  4L6R A;  3NMI A;  2YL1 A;  5B3I A;  256B A;  1YZA A;  4WGY A;  1E83 A;  2XM4 A;  4EIY A;  3IQ6 A;  4ULV A;  2XLW A;  4IB4 A;  5JVE A;  1E84 A;  3QVZ A;  3HNK A;  3C63 A;  4CIP A;  2YKZ A;  2XLV A;  1M6T A;  1CGO A;  2QLA A;  3ZWI A;  2BC5 A;  3NMK A;  3U8P A;  1CGN A;  2XLH A;  3QW1 A;  4CDV A;  2XL8 A;  1QPU A;  3FOP A;  3M4C A;  3QW0 A;  2XLE A;  2J8W A;  1JAF A;  1QQ3 A;  2YLG A;  5JT4 A;  2XLO A;  4CJG A;  4CX9 A;  4D4N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...