4E17A

Alpha-e-catenin is an autoinhibited molecule that co-activates vinculin
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
256
structure length
246
Chain Sequence
IQMPVFHTRTIESILEPVAQQISHLVIMHEEGEIPDLTAPVSAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVRAAQMLQADPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKGIEEALKNRNFTVEKMSAEINEIIRVLQLTSWD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Vinculin
publication title Conformational plasticity of alpha-catenin revealed by binding interactions with vinculin
rcsb
source organism Gallus gallus
total genus 105
structure length 246
sequence length 256
ec nomenclature
pdb deposition date 2012-03-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 4e17A02
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 4e17A01
2L7AA 1ST6A 1XWJA 5L0DA 1H6GA 1RKCA 1U6HA 1RKEB 4K1OA 4E17A 3TJ6A 3H2VA 5L0JA 2GWWA 4EHPA 5L0IA 1SYQA 2IBFA 2HSQA 4ONSA 3H2UA 3TJ5A 1ZW3A 1QKRA 5L0FA 4E18A 3ZDLA 3RF3A 1YDIA 4DJ9A 1U89A 1DOWA 4IGGA 3S90A 4PR9A 3T6GB 5L0GA 2B0HA 1L7CA 1ZVZA 1T01A 2GDCA 1TR2A 2X0CA 4W8PA 4P9TA 2LQGA 1RKEA 5FZTA 5L0HA 3VF0A 3MYIA 5L0CA 1ZW2A 1DOVA
chains in the Genus database with same CATH superfamily
1E85A 1JOGA 2EPLX 1QQ3A 2EPKX 3C8GD 4YT5A 3RIPA 4A2NB 4K1OA 3V5YA 2W4BA 2WVNA 4LDKA 4JW1A 3EGDB 4J7TA 4O6MA 1TWAA 5GPGB 4BJTA 1ZW3A 3PCVA 3OEOA 4XPXA 5COFA 4B6IA 1H9TA 3IQCA 4MVRA 5D92A 3OA1A 3SZRA 3HNJA 1EA8A 1FNTc 2ZXWC 3K7DA 5BQHA 5E2QA 3JYHA 4MTOA 3TK0A 4HEAJ 2DI3A 3C8ZA 4IWBA 3FVYA 2R7VA 2Q3TA 2WVQA 3LUTB 4PR9A 3ZC4A 2HJ3A 1ZVZA 1G4WR 3W8HA 3V5XA 1QVXA 1H7IA 1G5ZA 1TR2A 2OEVA 2WZFA 3U9JA 4CS9C 2R05A 4O79A 2GFHA 1MNEA 4J32B 2IOQA 3S28A 1YA7O 3EGDA 4P6IC 1VTMP 256BA 4BEMJ 4MTFA 4J30B 2JPUA 1OCOC 2O9XA 2RSEB 1CPQA 4HE8D 4C3DA 3FOPA 4U9DA 1T5OA 4XPWA 3GWNA 3Q7LA 3RW0A 3ZTZA 2P1AA 3HNLA 2XL4A 3G4XA 2MYSA 2PNOA 4MVZA 2J9UA 3I4UA 3GEIA 4XEFA 4KBLA 4IJJA 1L3PA 1NG1A 2A1DD 2F22A 3SXKA 4EBJA 1Q0MA 2XLDA 3UMKA 3W8IA 4LACB 2R7TA 1FFTC 3U2MA 2XLWA 1L7CA 3MLGA 1S7ZA 4EWCA 4W8PA 5HV9A 2IXNA 5A6KA 3U5SA 5FZTA 4OIOF 5HSWA 2QNLA 3G50A 1YYJA 4MVQA 5KYXB 2EIJC 5L0DA 3NMIA 2ZXOA 3U8PA 1VLTA 3W2VA 1Y4CA 4F4BA 2HV7A 3C7JA 1CGOA 2CNWA 3AGTA 1SYQA 4W8KA 5JS5A 1ORYA 2YKZA 4AK9A 4Q5SF 1PD1A 5COGA 1LKXA 5DS5A 1YLMA 2R7RA 2PX0A 3DE9A 3GODA 4MVUA 2B0JA 4JTCB 3ZG1A 2XLVA 4ULVA 2HFIA 2WB7A 3AG1C 3MBGA 4KNWA 2GAQA 3CEXA 4CS8A 5KYXA 1TQGA 1RXQA 2HMZA 2LQGA 2V26A 3RQEA 3IQTA 2VCCA 2J46A 1OQCA 3MYIA 3JT1A 3LS0A 2L7AA 5AGFA 2HMQA 2R02A 3EG9B 3NKDA 3GWLA 2CYDA 3H2VA 3U3BA 2Y3DA 1OXKA 3NMKA 3M4CA 3SXYA 5AC5A 1ZYRF 3N2ZB 3I5PA 3ZDLA 4IAOA 4CS8C 4IAQA 2IM8A 1OCCC 3F47A 4MQ9F 1I4YA 1FMWA 2AWYA 2G3KA 2EILC 1IW7F 2V3CC 3ZQYA 3ZWIA 2EPNA 1Z6AA 3AQBA 5F5FA 1QZXA 1NBBA 3FAJA 2CNWD 3KPHA 4XQ1A 3EG9A 3SYNA 4DBRA 2CCYA 2R7QA 3QZCA 3ATPA 1MMDA 4O6NA 1TWHA 2YL0A 1A7DA 2Y3BA 3LEOA 2PFDA 1EKYA 1WTYA 4I44A 4BJ6A 1M2VB 2YHSA 4CX9A 3K1IA 4O6YA 2OOCA 1M6TA 4E7SA 1NZEA 4N6HA 1O3UA 2H7VC 3IHUA 4XWJA 5E3AA 2J45A 3U3FA 1QSPA 3H2UA 1D0ZA 3RH3A 4CBEA 2J0WA 2YL1A 3DXJF 3NYJA 5D91A 4CDYA 3MFNA 2AWCA 4X0RA 3UR3C 5B3IA 1FR0A 3TOMA 1R4TA 1YVIA 2NSFA 3O39A 4MW3A 2VH3A 4NC3A 3L8JA 2DB4A 3LEVA 3VM6A 5DS4A 4MTGA 3PHF2 1F1MA 2P0NA 3M15A 2LFDA 4MS2A 4I3MA 5IY5C 4BJ6C 1E86A 5KYYA 3GM3A 2YLGA 1M2VA 2QE9A 3K1IC 3LESA 3VAYA 3ZIBA 1WASA 3EZHA 3PMRA 3JSEO 3L34A 2J7PD 3SXMA 5L0CA 3N0TA 3T4RA 2XS8A 4JRZA 3RQFA 4XEVA 4PJJA 2M4EA 3B29A 2TMVP 3ZSUA 4E17A 2EINC 1T9KA 3B0VC 3L8IA 3O6XA 4GYTA 1BZ4A 2Z15A 2LP4A 4U5EE 4CIPA 2IYLD 3ZQVA 2ASRA 2CW0F 1Q0FA 1YAUO 4AX2A 4WABA 3AQCA 4C3EA 3EFOA 4U5GA 2L6FA 3HTKC 2H7BA 3QW1A 4BJ5C 1CGNA 2OCCC 1SZIA 1VK5A 1JAFA 1T6UA 4JTDB 4U5FE 1BR1A 3EQLF 3IEEA 4OIRF 3UGPA 1XZPA 2QUPA 1ZHXA 3HLZA 2XM0A 2XRHA 1Y6DA 1ZHTA 2L9JA 4G78A 3RKOF 5TJ5E 3R2PA 3K6BA 3QW0A 4JURI 1Z5ZA 3JSZA 2XLHA 1UFBA 4FX5A 3GM1A 4PJLA 2PBEA 4R32A 2ZPAA 1XZQA 2OJQA 3IQ5A 5CI8A 4EHPA 3U0CA 3E70C 4A4AA 1J8MF 1QKRA 1VB5A 4XTKA 4Z9HA 5L0FA 1JMWA 1MMAA 1YARO 5JP7A 2UUHA 2KGOA 4WGZA 1I4ZA 4C3BA 2E87A 1EQ1A 3S90A 1JRAA 3EGXB 4XLNF 2XLMA 3M79A 3NMJA 4JEAA 4YJWA 4U5CE 5JLIA 2W45A 2A6HF 1VYIA 2G3VA 4NTFA 3WODF 1Z3IX 2FGYA 1K04A 1NSGB 4KNVA 3ABMC 1V55C 3IQ6A 3SP1A 2Q00A 2I15A 2PP4A 5DVWA 4JJGA 3HNKA 1SR2A 1M2OA 1ZHYA 1WOLA 2AP3A 3LS1A 2DYSC 1OCZC 1D1BA 4MVOA 3EZIA 5T3WA 1VYKA 3CAXA 3FMSA 1YZAA 3RYLA 1HMOA 2JX0A 3LNMB 1O5HA 3EGXA 4FWVA 1GQAA 4JIOA 3ZVRA 3O55A 4MNDA 4C7OA 3NDBB 3DJNB 3U8VA 2HV6A 2GA0A 4KI2A 2H7OA 2A0BA 2EPMX 3US6A 4JVSA 3T6GB 3X1OA 4LDQA 2CGEA 4N06A 2BC5A 3JCUQ 3ABKC 5BQIA 4PFOA 4XPYA 1PV3A 2D5RB 2GDCA 1JR8A 3J06A 1GS9A 3RFYA 1NFNA 4AL1A 3DI5A 1HE1A 2WVOA 4U9EA 1D1AA 2R03A 3CZ6A 2YWAA 4YL0A 2PF4E 4AL0A 2R7UA 1UG7A 5JUAA 2YL3A 2X51A 1HMDA 4K7BA 1LM3B 1G4US 2LCHA 2WZGA 4RDAA 4CDAA 2YLIA 4GQHA 3CQZA 2BL2A 3EHMA 1OCRC 1OW6A 2JD3A 2YL7A 2YRFA 4J7YA 4N4WA 4U5HA 3TJ5A 2P7VA 4JZAA 5B3SC 1YDIA 3NYMA 1D0YA 1DOWA 1T6IA 1ZHWA 1BR4A 2Q9BA 2FFHA 3MYFA 2QY9A 4I1OB 2OG2A 4U5BE 5L0GA 3JYYA 3ZTMA 4G0HA 1NU9C 4IB4A 3CSKA 3FXHA 2DGJA 2NUTB 4RD9A 4PACA 4DRHB 1VLSA 2OKUA 4LERA 1J8YF 4P9TA 3POVA 4H54A 3VF0A 3MX3A 4QDLA 3FOOA 4NY3A 2KYHA 1WWPA 1TWCA 2HZ8A 3Q7GA 4U5DE 1TKNA 5L3QA 1TFKB 3SNHA 2KJGA 5KYYB 4Z9IA 1BR2A 4PK4A 3T9OA 1K05A 3KMIA 3ABLC 1ORSC 3V5ZA 4DVZA 5L0JA 1Z63A 5L0IA 1RMVA 2R25A 5A69A 1HY5A 1QPUA 1PD0A 2Y3GA 4IARA 3DM5A 5EHHA 4ZLDA 2ZXRA 1I5NA 1VOMA 2NUTA 1YA9A 1U89A 4DVYP 4I1MA 3KYJA 2UUIA 3T6BA 1OKKA 3DAGA 3E9VA 3B0UX 5JT4A 3AG4C 1G8XA 1A0BA 4LDRA 4JCHA 1TWGA 2A69F 1YJGA 2X0CA 1ZU5A 2RD9A 2ICWG 4DOZA 3SXZA 1LE2A 1EI7A 1PCXA 3HJCA 3U2LA 2XL6A 3EFOB 3DJUB 3NYLA 1AUEA 3DMDA 4JTAB 1K40A 3AGUA 2XS1A 1Q0KA 2C04A 3DWWA 2KNHA 1LVKA 2VB6A 3EJNA 3V7OA 4LLEA 5BUOA 5A6BA 1A7EA 3G4ZA 2NPUA 5L3VA 1O87A 1TFOB 1D0XA 1S05A 4YL1A 2FAPB 3LJBA 3I5QA 1MMNA 4XLPF 3S29A 1M57C 2HSQA 2KK1A 4EKWA 4NTBA 2J9BA 3DM9B 3EH1A 3JRMO 2NUPA 3N24A 1NLXA 4MVMA 3RF3A 5DLJA 1M56C 4QI2A 2P6VA 3S84A 3AG3C 4YT8A 3DZAA 1KNYA 1SF8A 3L1MA 2IXPA 3QMKA 2XM4A 1BBHA 2HS5A 4HFKB 3AG2C 3FDQA 5T1DB 4M63A 4EIYA 2YQYA 2Q9AA 3O10A 3KKBA 3K33A 2LFFA 4E7ZA 2LSEA 1H9GA 1HW2A 3AOUA 2G62A 1LI7A 4CS9A 4IRUA 1RKEB 1OKKD 1HW1A 4P9FA 3SEOA 3U9MA 2DYRC 3IPMO 1NU7D 3QTHA 3DAFA 4CIHA 4G7HF 2MWQA 3TOLA 1IZMA 4ANJA 1GM5A 1C17M 1U0BB 2OQMA 2ZXPA 3M4BA 3S0XA 1ZU4A 4N6CA 5CIVA 3WG7C 4EBKA 4IGGA 2W4MA 1CPRA 3LLIA 2EIKC 4HFFB 5A6JA 1HE9A 5A6BD 4C7OB 3DE8A 3UMIA 2YEVA 4AE4B 3UNGC 3NG1A 2VCAA 2XLEA 5K0IA 4D4NA 1RKEA 3TD7A 3X2QC 4YN0B 4OIQF 4OINF 2LD6A 1SMYF 1LS4A 3DD7A 1LE4A 1V4AA 1ST6A 2R7OA 3GM2A 3KL4A 1U6HA 1NFOA 1V74B 3Q6NA 4G7ZF 4LLCA 4MW8A 4PFPA 2GWWA 3TJ6A 5DQTA 2J9WA 4DXWA 1ZZPA 1QLEC 2IBFA 4JEBA 1C03A 2AU5A 2J9VA 2L6HA 2XLOA 1V54C 3KYIA 3R7CA 4CSAA 4JC7A 1N1CA 3C18A 4E18A 5KYWB 1E84A 1MQVA 4AE4A 4DJ9A 1A7VA 1YZCA 5CI9A 2VCBA 2C03A 4DBQA 4E0IA 3LAYA 4YT4A 1C02A 4ULWA 2YLDA 4K0DA 4DRIB 3ITFA 4EUKB 2R7XA 2I8BA 1D1CA 3TULA 3PDMP 3BEHA 4JE9A 1E2XA 3RVZA 1E83A 2VASA 4JKVA 2D4UA 1FMVA 4YWQA 3A9CA 2Q9CA 2YZSA 1YYXA 4KC9A 5F5HA 5DQZA 5EGYA 3HNIA 3H65A 1ZW2A 1APCA 4CSAC 3DKAA 3UGOA 1Q0DA 2Q7RA 1GGQA 3OWTA 1RKCA 1R5ID 1WGWA 2EPOA 5KYWA 4MVSA 1OR2A 2R9RB 4BJ1A 3K1HA 2ZD9A 4CJGA 2NSGA 2QTVA 4EBBA 3GANA 2W9YA 2L6GA 5E3CA 2KC3A 3GEEA 5F28E 5B1AC 4GEHA 1Z7Qc 3VYWA 5JVEA 4L6RA 3S27A 5AC4A 2OU6A 4NQFA 5EK0A 1A41A 1OW8A 2KW3C 2HSBA 4JJFA 4XEKA 3T6JA 1ORJA 1RCPA 2VC9A 5COMA 3A11A 4O7GA 5KYNA 1FFHA 2B0HA 4JCZA 3S9OA 4CJOA 3M1CB 5T3TA 1MMGA 1JPJA 1WATA 3B71A 3K66A 5E33A 3RVYA 1RJ9B 3C62A 4OD4A 2KQ9A 4WJ0A 3ECSA 1OW7A 3B0PA 3C8GB 1FTSA 2J8WA 2LK4A 3UMHA 5B1BC 2OEXA 1CGME 2R7WA 2A68F 3HKKA 3WAQA 1XWJA 2LIGA 5DS6A 1Q0GA 3ASNC 3NKEA 4QI0A 4PJNA 3GEHA 4NTAA 1LS1A 4Q7CA 1OR3A 2KSFA 4OD5A 3QVYA 4BPMA 1LPEA 3JTLO 3W2WA 4YT2A 1FAPB 1Z23A 2J7PA 4UDVA 2Y39A 1MNDA 5BQGA 2WL8A 3AJMA 1VMAA 3WHNA 3GORA 4BG0A 2R7SA 3F46A 1RJ9A 3NRHA 2IXOA 3EH2A 4BEJA 4WGYA 3C8GA 3FHDA 1OXBA 2Y69C 3Q6MA 4ZLCA 3VRCA 4H4KC 1WN0A 5KYUB 4G7OF 2NUPB 2EIMC 2HUJA 4RBNA 2L81A 3L0IA 3LNRA 1AEPA 1KTMA 2H8AA 1T6QA 4CS7A 4ER9A 2J0XA 2CDQA 1DOVA 1LI5A 4FESA 2HKVA 3EPVA 1B68A 1KU2A 1H6GA 3TQOA 2XSEA 2A6EF 2IXMA 4CDVA 4FAPB 2ETSA 3RQGA 4PJMA 2WZLA 3ASOC 4YK5A 2P61A 4D4XA 2XXAB 2QLAA 3C63A 4ONSA 2YVKA 2Q4FA 2NG1A 1LIHA 3JZ0A 1ZHZA 2OJED 5KYUA 2Y3HA 4DRJB 1W2WA 2XL8A 2AVKA 2PX3A 1AVOB 3W4YA 5JRAA 2A0UA 1T01A 4YL3A 4E0HA 5JSLA 2HJMA 3QVZA 2BE5F 3B9QA 3KH2A 3FAPB 4NCQA 5FCLA 2MHRA 5A6AA 4Q4ZF 1BDJB 3JRTA 4Z9JA 3LLKA 3BRJA 3EHNA 4BJ5A 2M64A 1JPNA 2XXAA 4OIPF 5L0HA
chains in the Genus database with same CATH topology
2L7AA 1ST6A 1XWJA 5L0DA 1H6GA 1RKCA 1U6HA 1RKEB 4K1OA 4E17A 3TJ6A 3H2VA 5L0JA 2GWWA 4EHPA 5L0IA 1SYQA 2IBFA 2HSQA 4ONSA 3H2UA 3TJ5A 1ZW3A 1QKRA 5L0FA 4E18A 3ZDLA 3RF3A 1YDIA 4DJ9A 1U89A 1DOWA 4IGGA 3S90A 4PR9A 3T6GB 5L0GA 2B0HA 1L7CA 1ZVZA 1T01A 2GDCA 1TR2A 2X0CA 4W8PA 4P9TA 2LQGA 1RKEA 5FZTA 5L0HA 3VF0A 3MYIA 5L0CA 1ZW2A 1DOVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L7A A;  1ST6 A;  1XWJ A;  5L0D A;  1H6G A;  1RKC A;  1U6H A;  1RKE B;  4K1O A;  4E17 A;  3TJ6 A;  3H2V A;  5L0J A;  2GWW A;  4EHP A;  5L0I A;  1SYQ A;  2IBF A;  2HSQ A;  4ONS A;  3H2U A;  3TJ5 A;  1ZW3 A;  1QKR A;  5L0F A;  4E18 A;  3ZDL A;  3RF3 A;  1YDI A;  4DJ9 A;  1U89 A;  1DOW A;  4IGG A;  3S90 A;  4PR9 A;  3T6G B;  5L0G A;  2B0H A;  1L7C A;  1ZVZ A;  1T01 A;  2GDC A;  1TR2 A;  2X0C A;  4W8P A;  4P9T A;  2LQG A;  1RKE A;  5FZT A;  5L0H A;  3VF0 A;  3MYI A;  5L0C A;  1ZW2 A;  1DOV A; 
#chains in the Genus database with same CATH topology
 1E85 A;  1JOG A;  2EPL X;  1QQ3 A;  2EPK X;  3C8G D;  4YT5 A;  3RIP A;  4A2N B;  4K1O A;  3V5Y A;  2W4B A;  2WVN A;  4LDK A;  4JW1 A;  3EGD B;  4J7T A;  4O6M A;  1TWA A;  5GPG B;  4BJT A;  1ZW3 A;  3PCV A;  3OEO A;  4XPX A;  5COF A;  4B6I A;  1H9T A;  3IQC A;  4MVR A;  5D92 A;  3OA1 A;  3SZR A;  3HNJ A;  1EA8 A;  1FNT c;  2ZXW C;  3K7D A;  5BQH A;  5E2Q A;  3JYH A;  4MTO A;  3TK0 A;  4HEA J;  2DI3 A;  3C8Z A;  4IWB A;  3FVY A;  2R7V A;  2Q3T A;  2WVQ A;  3LUT B;  4PR9 A;  3ZC4 A;  2HJ3 A;  1ZVZ A;  1G4W R;  3W8H A;  3V5X A;  1QVX A;  1H7I A;  1G5Z A;  1TR2 A;  2OEV A;  2WZF A;  3U9J A;  4CS9 C;  2R05 A;  4O79 A;  2GFH A;  1MNE A;  4J32 B;  2IOQ A;  3S28 A;  1YA7 O;  3EGD A;  4P6I C;  1VTM P;  256B A;  4BEM J;  4MTF A;  4J30 B;  2JPU A;  1OCO C;  2O9X A;  2RSE B;  1CPQ A;  4HE8 D;  4C3D A;  3FOP A;  4U9D A;  1T5O A;  4XPW A;  3GWN A;  3Q7L A;  3RW0 A;  3ZTZ A;  2P1A A;  3HNL A;  2XL4 A;  3G4X A;  2MYS A;  2PNO A;  4MVZ A;  2J9U A;  3I4U A;  3GEI A;  4XEF A;  4KBL A;  4IJJ A;  1L3P A;  1NG1 A;  2A1D D;  2F22 A;  3SXK A;  4EBJ A;  1Q0M A;  2XLD A;  3UMK A;  3W8I A;  4LAC B;  2R7T A;  1FFT C;  3U2M A;  2XLW A;  1L7C A;  3MLG A;  1S7Z A;  4EWC A;  4W8P A;  5HV9 A;  2IXN A;  5A6K A;  3U5S A;  5FZT A;  4OIO F;  5HSW A;  2QNL A;  3G50 A;  1YYJ A;  4MVQ A;  5KYX B;  2EIJ C;  5L0D A;  3NMI A;  2ZXO A;  3U8P A;  1VLT A;  3W2V A;  1Y4C A;  4F4B A;  2HV7 A;  3C7J A;  1CGO A;  2CNW A;  3AGT A;  1SYQ A;  4W8K A;  5JS5 A;  1ORY A;  2YKZ A;  4AK9 A;  4Q5S F;  1PD1 A;  5COG A;  1LKX A;  5DS5 A;  1YLM A;  2R7R A;  2PX0 A;  3DE9 A;  3GOD A;  4MVU A;  2B0J A;  4JTC B;  3ZG1 A;  2XLV A;  4ULV A;  2HFI A;  2WB7 A;  3AG1 C;  3MBG A;  4KNW A;  2GAQ A;  3CEX A;  4CS8 A;  5KYX A;  1TQG A;  1RXQ A;  2HMZ A;  2LQG A;  2V26 A;  3RQE A;  3IQT A;  2VCC A;  2J46 A;  1OQC A;  3MYI A;  3JT1 A;  3LS0 A;  2L7A A;  5AGF A;  2HMQ A;  2R02 A;  3EG9 B;  3NKD A;  3GWL A;  2CYD A;  3H2V A;  3U3B A;  2Y3D A;  1OXK A;  3NMK A;  3M4C A;  3SXY A;  5AC5 A;  1ZYR F;  3N2Z B;  3I5P A;  3ZDL A;  4IAO A;  4CS8 C;  4IAQ A;  2IM8 A;  1OCC C;  3F47 A;  4MQ9 F;  1I4Y A;  1FMW A;  2AWY A;  2G3K A;  2EIL C;  1IW7 F;  2V3C C;  3ZQY A;  3ZWI A;  2EPN A;  1Z6A A;  3AQB A;  5F5F A;  1QZX A;  1NBB A;  3FAJ A;  2CNW D;  3KPH A;  4XQ1 A;  3EG9 A;  3SYN A;  4DBR A;  2CCY A;  2R7Q A;  3QZC A;  3ATP A;  1MMD A;  4O6N A;  1TWH A;  2YL0 A;  1A7D A;  2Y3B A;  3LEO A;  2PFD A;  1EKY A;  1WTY A;  4I44 A;  4BJ6 A;  1M2V B;  2YHS A;  4CX9 A;  3K1I A;  4O6Y A;  2OOC A;  1M6T A;  4E7S A;  1NZE A;  4N6H A;  1O3U A;  2H7V C;  3IHU A;  4XWJ A;  5E3A A;  2J45 A;  3U3F A;  1QSP A;  3H2U A;  1D0Z A;  3RH3 A;  4CBE A;  2J0W A;  2YL1 A;  3DXJ F;  3NYJ A;  5D91 A;  4CDY A;  3MFN A;  2AWC A;  4X0R A;  3UR3 C;  5B3I A;  1FR0 A;  3TOM A;  1R4T A;  1YVI A;  2NSF A;  3O39 A;  4MW3 A;  2VH3 A;  4NC3 A;  3L8J A;  2DB4 A;  3LEV A;  3VM6 A;  5DS4 A;  4MTG A;  3PHF 2;  1F1M A;  2P0N A;  3M15 A;  2LFD A;  4MS2 A;  4I3M A;  5IY5 C;  4BJ6 C;  1E86 A;  5KYY A;  3GM3 A;  2YLG A;  1M2V A;  2QE9 A;  3K1I C;  3LES A;  3VAY A;  3ZIB A;  1WAS A;  3EZH A;  3PMR A;  3JSE O;  3L34 A;  2J7P D;  3SXM A;  5L0C A;  3N0T A;  3T4R A;  2XS8 A;  4JRZ A;  3RQF A;  4XEV A;  4PJJ A;  2M4E A;  3B29 A;  2TMV P;  3ZSU A;  4E17 A;  2EIN C;  1T9K A;  3B0V C;  3L8I A;  3O6X A;  4GYT A;  1BZ4 A;  2Z15 A;  2LP4 A;  4U5E E;  4CIP A;  2IYL D;  3ZQV A;  2ASR A;  2CW0 F;  1Q0F A;  1YAU O;  4AX2 A;  4WAB A;  3AQC A;  4C3E A;  3EFO A;  4U5G A;  2L6F A;  3HTK C;  2H7B A;  3QW1 A;  4BJ5 C;  1CGN A;  2OCC C;  1SZI A;  1VK5 A;  1JAF A;  1T6U A;  4JTD B;  4U5F E;  1BR1 A;  3EQL F;  3IEE A;  4OIR F;  3UGP A;  1XZP A;  2QUP A;  1ZHX A;  3HLZ A;  2XM0 A;  2XRH A;  1Y6D A;  1ZHT A;  2L9J A;  4G78 A;  3RKO F;  5TJ5 E;  3R2P A;  3K6B A;  3QW0 A;  4JUR I;  1Z5Z A;  3JSZ A;  2XLH A;  1UFB A;  4FX5 A;  3GM1 A;  4PJL A;  2PBE A;  4R32 A;  2ZPA A;  1XZQ A;  2OJQ A;  3IQ5 A;  5CI8 A;  4EHP A;  3U0C A;  3E70 C;  4A4A A;  1J8M F;  1QKR A;  1VB5 A;  4XTK A;  4Z9H A;  5L0F A;  1JMW A;  1MMA A;  1YAR O;  5JP7 A;  2UUH A;  2KGO A;  4WGZ A;  1I4Z A;  4C3B A;  2E87 A;  1EQ1 A;  3S90 A;  1JRA A;  3EGX B;  4XLN F;  2XLM A;  3M79 A;  3NMJ A;  4JEA A;  4YJW A;  4U5C E;  5JLI A;  2W45 A;  2A6H F;  1VYI A;  2G3V A;  4NTF A;  3WOD F;  1Z3I X;  2FGY A;  1K04 A;  1NSG B;  4KNV A;  3ABM C;  1V55 C;  3IQ6 A;  3SP1 A;  2Q00 A;  2I15 A;  2PP4 A;  5DVW A;  4JJG A;  3HNK A;  1SR2 A;  1M2O A;  1ZHY A;  1WOL A;  2AP3 A;  3LS1 A;  2DYS C;  1OCZ C;  1D1B A;  4MVO A;  3EZI A;  5T3W A;  1VYK A;  3CAX A;  3FMS A;  1YZA A;  3RYL A;  1HMO A;  2JX0 A;  3LNM B;  1O5H A;  3EGX A;  4FWV A;  1GQA A;  4JIO A;  3ZVR A;  3O55 A;  4MND A;  4C7O A;  3NDB B;  3DJN B;  3U8V A;  2HV6 A;  2GA0 A;  4KI2 A;  2H7O A;  2A0B A;  2EPM X;  3US6 A;  4JVS A;  3T6G B;  3X1O A;  4LDQ A;  2CGE A;  4N06 A;  2BC5 A;  3JCU Q;  3ABK C;  5BQI A;  4PFO A;  4XPY A;  1PV3 A;  2D5R B;  2GDC A;  1JR8 A;  3J06 A;  1GS9 A;  3RFY A;  1NFN A;  4AL1 A;  3DI5 A;  1HE1 A;  2WVO A;  4U9E A;  1D1A A;  2R03 A;  3CZ6 A;  2YWA A;  4YL0 A;  2PF4 E;  4AL0 A;  2R7U A;  1UG7 A;  5JUA A;  2YL3 A;  2X51 A;  1HMD A;  4K7B A;  1LM3 B;  1G4U S;  2LCH A;  2WZG A;  4RDA A;  4CDA A;  2YLI A;  4GQH A;  3CQZ A;  2BL2 A;  3EHM A;  1OCR C;  1OW6 A;  2JD3 A;  2YL7 A;  2YRF A;  4J7Y A;  4N4W A;  4U5H A;  3TJ5 A;  2P7V A;  4JZA A;  5B3S C;  1YDI A;  3NYM A;  1D0Y A;  1DOW A;  1T6I A;  1ZHW A;  1BR4 A;  2Q9B A;  2FFH A;  3MYF A;  2QY9 A;  4I1O B;  2OG2 A;  4U5B E;  5L0G A;  3JYY A;  3ZTM A;  4G0H A;  1NU9 C;  4IB4 A;  3CSK A;  3FXH A;  2DGJ A;  2NUT B;  4RD9 A;  4PAC A;  4DRH B;  1VLS A;  2OKU A;  4LER A;  1J8Y F;  4P9T A;  3POV A;  4H54 A;  3VF0 A;  3MX3 A;  4QDL A;  3FOO A;  4NY3 A;  2KYH A;  1WWP A;  1TWC A;  2HZ8 A;  3Q7G A;  4U5D E;  1TKN A;  5L3Q A;  1TFK B;  3SNH A;  2KJG A;  5KYY B;  4Z9I A;  1BR2 A;  4PK4 A;  3T9O A;  1K05 A;  3KMI A;  3ABL C;  1ORS C;  3V5Z A;  4DVZ A;  5L0J A;  1Z63 A;  5L0I A;  1RMV A;  2R25 A;  5A69 A;  1HY5 A;  1QPU A;  1PD0 A;  2Y3G A;  4IAR A;  3DM5 A;  5EHH A;  4ZLD A;  2ZXR A;  1I5N A;  1VOM A;  2NUT A;  1YA9 A;  1U89 A;  4DVY P;  4I1M A;  3KYJ A;  2UUI A;  3T6B A;  1OKK A;  3DAG A;  3E9V A;  3B0U X;  5JT4 A;  3AG4 C;  1G8X A;  1A0B A;  4LDR A;  4JCH A;  1TWG A;  2A69 F;  1YJG A;  2X0C A;  1ZU5 A;  2RD9 A;  2ICW G;  4DOZ A;  3SXZ A;  1LE2 A;  1EI7 A;  1PCX A;  3HJC A;  3U2L A;  2XL6 A;  3EFO B;  3DJU B;  3NYL A;  1AUE A;  3DMD A;  4JTA B;  1K40 A;  3AGU A;  2XS1 A;  1Q0K A;  2C04 A;  3DWW A;  2KNH A;  1LVK A;  2VB6 A;  3EJN A;  3V7O A;  4LLE A;  5BUO A;  5A6B A;  1A7E A;  3G4Z A;  2NPU A;  5L3V A;  1O87 A;  1TFO B;  1D0X A;  1S05 A;  4YL1 A;  2FAP B;  3LJB A;  3I5Q A;  1MMN A;  4XLP F;  3S29 A;  1M57 C;  2HSQ A;  2KK1 A;  4EKW A;  4NTB A;  2J9B A;  3DM9 B;  3EH1 A;  3JRM O;  2NUP A;  3N24 A;  1NLX A;  4MVM A;  3RF3 A;  5DLJ A;  1M56 C;  4QI2 A;  2P6V A;  3S84 A;  3AG3 C;  4YT8 A;  3DZA A;  1KNY A;  1SF8 A;  3L1M A;  2IXP A;  3QMK A;  2XM4 A;  1BBH A;  2HS5 A;  4HFK B;  3AG2 C;  3FDQ A;  5T1D B;  4M63 A;  4EIY A;  2YQY A;  2Q9A A;  3O10 A;  3KKB A;  3K33 A;  2LFF A;  4E7Z A;  2LSE A;  1H9G A;  1HW2 A;  3AOU A;  2G62 A;  1LI7 A;  4CS9 A;  4IRU A;  1RKE B;  1OKK D;  1HW1 A;  4P9F A;  3SEO A;  3U9M A;  2DYR C;  3IPM O;  1NU7 D;  3QTH A;  3DAF A;  4CIH A;  4G7H F;  2MWQ A;  3TOL A;  1IZM A;  4ANJ A;  1GM5 A;  1C17 M;  1U0B B;  2OQM A;  2ZXP A;  3M4B A;  3S0X A;  1ZU4 A;  4N6C A;  5CIV A;  3WG7 C;  4EBK A;  4IGG A;  2W4M A;  1CPR A;  3LLI A;  2EIK C;  4HFF B;  5A6J A;  1HE9 A;  5A6B D;  4C7O B;  3DE8 A;  3UMI A;  2YEV A;  4AE4 B;  3UNG C;  3NG1 A;  2VCA A;  2XLE A;  5K0I A;  4D4N A;  1RKE A;  3TD7 A;  3X2Q C;  4YN0 B;  4OIQ F;  4OIN F;  2LD6 A;  1SMY F;  1LS4 A;  3DD7 A;  1LE4 A;  1V4A A;  1ST6 A;  2R7O A;  3GM2 A;  3KL4 A;  1U6H A;  1NFO A;  1V74 B;  3Q6N A;  4G7Z F;  4LLC A;  4MW8 A;  4PFP A;  2GWW A;  3TJ6 A;  5DQT A;  2J9W A;  4DXW A;  1ZZP A;  1QLE C;  2IBF A;  4JEB A;  1C03 A;  2AU5 A;  2J9V A;  2L6H A;  2XLO A;  1V54 C;  3KYI A;  3R7C A;  4CSA A;  4JC7 A;  1N1C A;  3C18 A;  4E18 A;  5KYW B;  1E84 A;  1MQV A;  4AE4 A;  4DJ9 A;  1A7V A;  1YZC A;  5CI9 A;  2VCB A;  2C03 A;  4DBQ A;  4E0I A;  3LAY A;  4YT4 A;  1C02 A;  4ULW A;  2YLD A;  4K0D A;  4DRI B;  3ITF A;  4EUK B;  2R7X A;  2I8B A;  1D1C A;  3TUL A;  3PDM P;  3BEH A;  4JE9 A;  1E2X A;  3RVZ A;  1E83 A;  2VAS A;  4JKV A;  2D4U A;  1FMV A;  4YWQ A;  3A9C A;  2Q9C A;  2YZS A;  1YYX A;  4KC9 A;  5F5H A;  5DQZ A;  5EGY A;  3HNI A;  3H65 A;  1ZW2 A;  1APC A;  4CSA C;  3DKA A;  3UGO A;  1Q0D A;  2Q7R A;  1GGQ A;  3OWT A;  1RKC A;  1R5I D;  1WGW A;  2EPO A;  5KYW A;  4MVS A;  1OR2 A;  2R9R B;  4BJ1 A;  3K1H A;  2ZD9 A;  4CJG A;  2NSG A;  2QTV A;  4EBB A;  3GAN A;  2W9Y A;  2L6G A;  5E3C A;  2KC3 A;  3GEE A;  5F28 E;  5B1A C;  4GEH A;  1Z7Q c;  3VYW A;  5JVE A;  4L6R A;  3S27 A;  5AC4 A;  2OU6 A;  4NQF A;  5EK0 A;  1A41 A;  1OW8 A;  2KW3 C;  2HSB A;  4JJF A;  4XEK A;  3T6J A;  1ORJ A;  1RCP A;  2VC9 A;  5COM A;  3A11 A;  4O7G A;  5KYN A;  1FFH A;  2B0H A;  4JCZ A;  3S9O A;  4CJO A;  3M1C B;  5T3T A;  1MMG A;  1JPJ A;  1WAT A;  3B71 A;  3K66 A;  5E33 A;  3RVY A;  1RJ9 B;  3C62 A;  4OD4 A;  2KQ9 A;  4WJ0 A;  3ECS A;  1OW7 A;  3B0P A;  3C8G B;  1FTS A;  2J8W A;  2LK4 A;  3UMH A;  5B1B C;  2OEX A;  1CGM E;  2R7W A;  2A68 F;  3HKK A;  3WAQ A;  1XWJ A;  2LIG A;  5DS6 A;  1Q0G A;  3ASN C;  3NKE A;  4QI0 A;  4PJN A;  3GEH A;  4NTA A;  1LS1 A;  4Q7C A;  1OR3 A;  2KSF A;  4OD5 A;  3QVY A;  4BPM A;  1LPE A;  3JTL O;  3W2W A;  4YT2 A;  1FAP B;  1Z23 A;  2J7P A;  4UDV A;  2Y39 A;  1MND A;  5BQG A;  2WL8 A;  3AJM A;  1VMA A;  3WHN A;  3GOR A;  4BG0 A;  2R7S A;  3F46 A;  1RJ9 A;  3NRH A;  2IXO A;  3EH2 A;  4BEJ A;  4WGY A;  3C8G A;  3FHD A;  1OXB A;  2Y69 C;  3Q6M A;  4ZLC A;  3VRC A;  4H4K C;  1WN0 A;  5KYU B;  4G7O F;  2NUP B;  2EIM C;  2HUJ A;  4RBN A;  2L81 A;  3L0I A;  3LNR A;  1AEP A;  1KTM A;  2H8A A;  1T6Q A;  4CS7 A;  4ER9 A;  2J0X A;  2CDQ A;  1DOV A;  1LI5 A;  4FES A;  2HKV A;  3EPV A;  1B68 A;  1KU2 A;  1H6G A;  3TQO A;  2XSE A;  2A6E F;  2IXM A;  4CDV A;  4FAP B;  2ETS A;  3RQG A;  4PJM A;  2WZL A;  3ASO C;  4YK5 A;  2P61 A;  4D4X A;  2XXA B;  2QLA A;  3C63 A;  4ONS A;  2YVK A;  2Q4F A;  2NG1 A;  1LIH A;  3JZ0 A;  1ZHZ A;  2OJE D;  5KYU A;  2Y3H A;  4DRJ B;  1W2W A;  2XL8 A;  2AVK A;  2PX3 A;  1AVO B;  3W4Y A;  5JRA A;  2A0U A;  1T01 A;  4YL3 A;  4E0H A;  5JSL A;  2HJM A;  3QVZ A;  2BE5 F;  3B9Q A;  3KH2 A;  3FAP B;  4NCQ A;  5FCL A;  2MHR A;  5A6A A;  4Q4Z F;  1BDJ B;  3JRT A;  4Z9J A;  3LLK A;  3BRJ A;  3EHN A;  4BJ5 A;  2M64 A;  1JPN A;  2XXA A;  4OIP F;  5L0H A; 
#chains in the Genus database with same CATH homology
 2L7A A;  1ST6 A;  1XWJ A;  5L0D A;  1H6G A;  1RKC A;  1U6H A;  1RKE B;  4K1O A;  4E17 A;  3TJ6 A;  3H2V A;  5L0J A;  2GWW A;  4EHP A;  5L0I A;  1SYQ A;  2IBF A;  2HSQ A;  4ONS A;  3H2U A;  3TJ5 A;  1ZW3 A;  1QKR A;  5L0F A;  4E18 A;  3ZDL A;  3RF3 A;  1YDI A;  4DJ9 A;  1U89 A;  1DOW A;  4IGG A;  3S90 A;  4PR9 A;  3T6G B;  5L0G A;  2B0H A;  1L7C A;  1ZVZ A;  1T01 A;  2GDC A;  1TR2 A;  2X0C A;  4W8P A;  4P9T A;  2LQG A;  1RKE A;  5FZT A;  5L0H A;  3VF0 A;  3MYI A;  5L0C A;  1ZW2 A;  1DOV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...