4E17A

Alpha-e-catenin is an autoinhibited molecule that co-activates vinculin
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
256
structure length
246
Chain Sequence
b'IQMPVFHTRTIESILEPVAQQISHLVIMHEEGEIPDLTAPVSAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVRAAQMLQADPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKGIEEALKNRNFTVEKMSAEINEIIRVLQLTSWD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vinculin
publication title Conformational plasticity of alpha-catenin revealed by binding interactions with vinculin
rcsb
source organism Gallus gallus
molecule tags Cell adhesion
total genus 105
structure length 246
sequence length 256
ec nomenclature
pdb deposition date 2012-03-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 4e17A02
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 4e17A01
3VF0A 1DOVA 2L7AA 2GWWA 4W8PA 1H6GA 5L0JA 3S90A 1T01A 5L0GA 2LQGA 3H2VA 1ZW3A 4EHPA 4E18A 1ZW2A 1SYQA 3TJ5A 4IGGA 4P9TA 4ONSA 1L7CA 3RF3A 5L0FA 1U6HA 2X0CA 5L0DA 1DOWA 1ZVZA 4E17A 2IBFA 3MYIA 3H2UA 3T6GB 3ZDLA 2HSQA 4DJ9A 1XWJA 1RKEA 2GDCA 3TJ6A 5L0HA 5FZTA 4PR9A 1RKCA 4K1OA 1ST6A 1RKEB 1TR2A 1QKRA 5L0IA 1YDIA 5L0CA 2B0HA 1U89A
chains in the Genus database with same CATH superfamily
2ZXWC 2A68F 2X51A 3A9CA 4C3BA 2KW3C 5GPGB 2CDQA 2IXOA 3BRJA 3I4UA 1LE4A 1VMAA 1T01A 5COFA 2QE9A 3U9JA 3KL4A 2CNWD 2BC5A 2XLVA 4WGYA 4EHPA 1YA7O 3EGDB 4P9TA 3W2WA 3IQ5A 4BPMA 1R5ID 1ZHXA 5B3SC 3MYIA 4H54A 1EI7A 3Q6NA 1HW2A 1A41A 3K7DA 2I15A 2R25A 3IQ6A 4CS9A 3WODF 2WZGA 3W8HA 3G50A 3O10A 3U2MA 4G7OF 4K1OA 2J9UA 3KYJA 3M1CB 4U9EA 1HW1A 4FX5A 4O7GA 4KI2A 3GEEA 3QTHA 1FFHA 3DAGA 4N4WA 4BEJA 4MVZA 2YQYA 4LACB 3EH1A 3HNLA 4GYTA 4DBRA 4JURI 4ER9A 1TWCA 1SF8A 5DQTA 1E85A 1AUEA 4YL3A 1OCCC 2ASRA 2LQGA 1OCOC 2R9RB 1WWPA 3RKOF 4NTBA 4XTKA 3ATPA 2NUPA 3AG2C 3L34A 3EHMA 5DLJA 3UGPA 4Z9JA 4NCQA 1VLTA 4XQ1A 1O87A 2EILC 2WZLA 3VRCA 3DD7A 2IXMA 3IHUA 3JZ0A 4OD5A 4CX9A 4KNWA 5E33A 2WL8A 4DRJB 5A6KA 4JKVA 4MTOA 4XPWA 3HJCA 2R7SA 2VCAA 1QKRA 2ZXRA 3OA1A 3B0PA 3PCVA 4XEFA 1BZ4A 5D91A 2PF4E 3V5ZA 4ANJA 1EQ1A 5T1DB 2XXAA 3E70C 4BG0A 4C7OB 4HFFB 4J32B 4PJMA 1MMDA 5JS5A 2YLDA 5KYWA 3KYIA 4NY3A 1SYQA 1LE2A 2DB4A 2HMZA 2J0WA 1SZIA 2LD6A 3G4XA 3N2ZB 2R03A 1APCA 1NFNA 2VCCA 1Q0KA 1VYIA 3DKAA 3ZQYA 2PNOA 2KK1A 5K0IA 2A0UA 3EFOB 3VYWA 3GANA 2E87A 3RQFA 2EIMC 2EPLX 3LNMB 1IW7F 2HV7A 4XEKA 5BQGA 3I5QA 3LUTB 3TULA 4I1MA 4ULWA 1BR1A 1D1CA 2YRFA 4I3MA 4O6YA 3MX3A 2QY9A 3RH3A 1FMVA 1K40A 4Q4ZF 3U2LA 3ASNC 1NZEA 4MVUA 2IM8A 3L1MA 2J7PA 3V5YA 2QUPA 3Q7GA 1CPQA 2L6GA 2HSBA 2QTVA 1I5NA 1A0BA 3OEOA 3IEEA 2CNWA 2P7VA 5HSWA 1I4ZA 3FHDA 3EG9A 5F28E 4BJ6C 5L0DA 1ZVZA 2JPUA 4U5BE 4X0RA 4DOZA 1RXQA 4JE9A 1K04A 3CSKA 4OIPF 1RJ9A 2V3CC 4QI2A 1OW8A 3GWNA 4AL1A 5COGA 3TJ6A 4CS8A 3POVA 3ZG1A 2C03A 1HMDA 2H8AA 2YLIA 2ZD9A 3E9VA 5FZTA 4AE4A 4DVZA 2YL1A 2QNLA 4BJ5A 3C62A 2H7OA 4E0HA 1FAPB 2J46A 3KPHA 3RFYA 1PD0A 1NLXA 3EQLF 4LDQA 3RVZA 3NMKA 1WGWA 3AGTA 2CW0F 4OIOF 2GWWA 2W4BA 2XL8A 3HNJA 1LVKA 3MBGA 3SXMA 5L0JA 1B68A 1D1BA 3C7JA 3K6BA 5KYXB 1JAFA 5E3AA 2WVOA 1Q0GA 4NC3A 2J9VA 2G3VA 2IYLD 3X1OA 5TJ5E 3FOOA 4MVMA 1Q0MA 3B0UX 3KMIA 3K1IA 1AVOB 2P6VA 5BQIA 2RSEB 1ORYA 3H2UA 2XLWA 2AP3A 3GORA 3I5PA 2KYHA 1TFKB 3TD7A 2YWAA 1RKEA 2KGOA 1JRAA 1TWGA 1KU2A 3M4BA 3NYLA 2CGEA 4ZLCA 2BL2A 2H7BA 2NG1A 4FWVA 1TQGA 1Y6DA 3JYYA 1OCZC 2R7OA 5L0IA 2R7XA 2MYSA 3AG1C 3C8ZA 3TOLA 1LIHA 3DXJF 4PJJA 5B1BC 2Y3BA 3IPMO 4CDVA 2J7PD 4CSAA 1T6QA 3EHNA 4EWCA 2A0BA 2HJMA 3DAFA 2VH3A 2LIGA 1ZW2A 2XLDA 3UMIA 4A2NB 5KYUA 2HZ8A 3RF3A 5L0FA 3UGOA 1RCPA 3TK0A 4U5GA 4U5HA 1U0BB 1LI5A 1K05A 1VTMP 2IBFA 1PD1A 2XLMA 1CGME 1JOGA 1NU7D 1ZU4A 3ASOC 4IARA 5T3WA 3S9OA 3T9OA 1MMAA 2GDCA 2EPMX 1I4YA 4MVOA 1VB5A 4O79A 5JUAA 2A6EF 3AGUA 3NRHA 1G4WR 2XL6A 4BEMJ 1WTYA 3ZC4A 1D1AA 1GGQA 2OCCC 2YLGA 1Z7Qc 2Q00A 3RW0A 4K7BA 2MWQA 1DOVA 1C02A 1OW7A 2J8WA 1A7DA 1OXKA 1H6GA 5AGFA 1LPEA 3RQEA 3BEHA 4H4KC 1ZYRF 1YYXA 3DM5A 4IAOA 3F47A 3AOUA 4I44A 1H9TA 3EGXA 3G4ZA 1LKXA 4IB4A 1D0ZA 1M2OA 4FESA 4QI0A 4XEVA 4CS9C 3NYJA 1CGNA 3S29A 5EHHA 2KQ9A 2NUTA 3T6JA 1J8MF 1WOLA 1Z5ZA 2R05A 3SP1A 3FDQA 1V54C 1BR2A 1TWAA 2EPKX 2A69F 3DZAA 3GODA 3LLKA 3ZDLA 3GWLA 4AK9A 1HE1A 5JRAA 1TKNA 4XLNF 2CCYA 4CBEA 4FAPB 1SMYF 3QZCA 3T4RA 1R4TA 5IY5C 5CI8A 4CJGA 2HFIA 4WGZA 3N0TA 5D92A 5F5FA 3LS1A 1GQAA 1SR2A 4XPXA 4CDAA 4WJ0A 2WVNA 2Q7RA 4IWBA 1OCRC 5A6JA 1FR0A 4XLPF 3GEHA 2PX0A 1YA9A 2J9BA 4RDAA 2XM4A 1M56C 3EGDA 4DBQA 5L3VA 1LS4A 2HS5A 4NQFA 2Y3DA 2FFHA 3L8IA 3GM2A 4JTDB 2J0XA 4EBBA 5L0GA 1EKYA 4E18A 1CGOA 3LJBA 4ONSA 2L81A 2VC9A 2XLOA 4I1OB 4J30B 5JLIA 1OR2A 1U6HA 2ZPAA 3FVYA 4YT2A 2OEXA 4YJWA 5A6BD 4JCHA 4O6NA 3LEOA 4O6MA 2QLAA 1M2VB 2A6HF 2GFHA 1JPJA 3LNRA 4JCZA 4RD9A 4U5DE 4RBNA 2UUHA 4GEHA 2DGJA 4W8KA 4E7ZA 3ZWIA 2WVQA 2XL4A 3H65A 4JJFA 1ST6A 1VOMA 2MHRA 4PK4A 4CDYA 1J8YF 2EIKC 3QVYA 3DM9B 1HY5A 3UMKA 4YT5A 1JMWA 1S7ZA 5DS4A 1ZZPA 1KNYA 3HKKA 3V5XA 4PJNA 3M79A 2H7VC 4EUKB 1PCXA 3C8GB 2HMQA 3GM1A 4MVRA 1HMOA 4Z9HA 3ABMC 2Q9AA 3U5SA 3CAXA 2XM0A 1KTMA 2KJGA 3HNKA 3JSZA 4YL0A 2W9YA 3PMRA 5KYYB 4G0HA 4LLCA 2R7TA 3EJNA 4YK5A 1VYKA 2VB6A 3ECSA 1ZU5A 3R7CA 1V4AA 5DVWA 4C7OA 2OJQA 1YDIA 1ZHYA 3HLZA 4L6RA 1RKCA 3VF0A 2ETSA 3VAYA 4AX2A 5JT4A 1A7EA 3U9MA 1T6IA 1GS9A 3EPVA 3FMSA 3US6A 2HUJA 1YZCA 2YL3A 3N24A 5EK0A 5DQZA 2R7VA 1C17M 1G4US 3S0XA 4KC9A 2Z15A 3EFOA 1TFOB 2LFFA 5HV9A 3B0VC 1ZHWA 2X0CA 4YT4A 1YAUO 2F22A 3JSEO 1YYJA 2D5RB 3SYNA 4E17A 3LESA 4YT8A 3S84A 1FMWA 3NDBB 4ZLDA 4BJ5C 1ZHTA 2YVKA 2Y3HA 3ABKC 4YN0B 3K33A 4Q7CA 4HEAJ 4JVSA 1LI7A 3RQGA 3QVZA 4LDRA 3MYFA 1OKKD 2PBEA 3HNIA 3AG4C 1LM3B 2CYDA 1YJGA 3RYLA 4CS7A 1YARO 2PP4A 2XLEA 4EKWA 5BUOA 2PFDA 4YL1A 2OKUA 2XSEA 3B9QA 1G5ZA 1U89A 3C8GA 3GM3A 5JSLA 3HTKC 3X2QC 1ZHZA 2LSEA 1QPUA 3W4YA 4BJTA 4LLEA 4G78A 3ITFA 1BR4A 3AG3C 3K1IC 1QZXA 2FAPB 1E83A 2Q4FA 1QVXA 1L7CA 1NG1A 1T6UA 2OU6A 4Z9IA 4N06A 3U3FA 3V7OA 4M63A 4MW3A 2Y69C 4PFOA 2OEVA 4CIPA 2R7RA 3NG1A 5A6BA 4JEAA 4XPYA 5JP7A 1Z3IX 3WAQA 1V55C 5AC5A 1PV3A 1QSPA 3AQCA 3R2PA 2NUPB 3RVYA 3CEXA 3OWTA 4IJJA 2TMVP 3DMDA 1W2WA 4MW8A 1XZPA 5FCLA 1FNTc 1O3UA 4CSAC 2P61A 2EPOA 4R32A 2YL7A 3JTLO 4N6CA 5KYXA 2P1AA 2R7QA 2M64A 1NU9C 3DJNB 3O55A 4WABA 2R7UA 1E2XA 4UDVA 4EIYA 3C63A 2R7WA 1H9GA 4MQ9F 5T3TA 1G8XA 2IXNA 3JT1A 4JTCB 4N6HA 3ZTMA 2YHSA 4JZAA 3O39A 4DRHB 3FXHA 4C3EA 2P0NA 2DI3A 1T9KA 4J7YA 1YVIA 2XS8A 1Y4CA 3ZQVA 2XXAB 2L9JA 4OD4A 3AJMA 3QW1A 4XWJA 5KYWB 3K66A 2G3KA 2XS1A 2B0JA 2EINC 2DYSC 2UUIA 1AEPA 1ORJA 3U0CA 2HJ3A 5L3QA 3B29A 3LS0A 2VASA 1VK5A 4PR9A 3M15A 4LERA 2LCHA 1BBHA 1D0YA 4JJGA 2D4UA 2DYRC 1C03A 3C8GD 3SEOA 4KNVA 3EZIA 3SZRA 1IZMA 1OR3A 1MNDA 2IOQA 3L0IA 2G62A 2BE5F 4K0DA 3PDMP 4U5EE 4DXWA 3UR3C 1XZQA 4LDKA 2JD3A 3LLIA 5E2QA 4P6IC 3L8JA 3FAPB 3EZHA 2KC3A 3SXYA 1OQCA 1MQVA 2EIJC 4U5FE 1Q0DA 1TWHA 4ULVA 3UNGC 5AC4A 3QMKA 5EGYA 4OINF 2O9XA 1E84A 3SXZA 3J06A 4JRZA 3DE9A 3T6GB 3WHNA 2NPUA 2J45A 2VCBA 4MS2A 3EG9B 2KSFA 2L6FA 2OOCA 2J9WA 1M6TA 3KKBA 3ABLC 2A1DD 4MTFA 4IAQA 1RJ9B 3Q6MA 4DRIB 1H7IA 3SNHA 1Z6AA 1OKKA 2WB7A 3NMIA 1NBBA 5E3CA 4P9FA 3JRTA 4BJ1A 5L0CA 3W8IA 2B0HA 2GAQA 2NSGA 4AE4B 3EH2A 4DVYP 3F46A 1EA8A 3O6XA 5A6AA 2ZXPA 4JEBA 1F1MA 3JRMO 3K1HA 2WZFA 2EPNA 1YZAA 2ICWG 3NMJA 3KH2A 1FTSA 3TOMA 1A7VA 5B1AC 3VM6A 1OXBA 4JTAB 4D4NA 1HE9A 4PFPA 2M4EA 1L3PA 1DOWA 3ZIBA 2OG2A 1E86A 1Z23A 1VLSA 1O5HA 1QQ3A 256BA 4NTFA 3JCUQ 1S05A 2HSQA 3NKEA 4DJ9A 5COMA 3NKDA 1NSGB 3IQCA 3M4CA 3CZ6A 3CQZA 3S28A 4BJ6A 5B3IA 5KYNA 4G7HF 1MMGA 2R02A 1WATA 3U3BA 4HFKB 1RMVA 2NSFA 2LP4A 3ZTZA 4F4BA 4G7ZF 2Q3TA 1RKEB 1TR2A 4U5CE 4CJOA 3Q7LA 2YZSA 3S27A 1MMNA 2OJED 3LAYA 4MVSA 4OIRF 3T6BA 3U8VA 1D0XA 2L7AA 2OQMA 2Y39A 1WASA 3DE8A 3JYHA 4PACA 4CIHA 3S90A 2Q9BA 2KNHA 1Q0FA 2AWYA 1ZW3A 3ZSUA 1LS1A 3TJ5A 4JW1A 1M2VA 1NFOA 2V26A 2XLHA 3ZVRA 4NTAA 5CI9A 5DS5A 4EBJA 2AVKA 2L6HA 2AWCA 2HKVA 1Z63A 4Q5SF 1JR8A 4CS8C 2Y3GA 4KBLA 4JC7A 4JIOA 1MNEA 5JVEA 3QW0A 5KYUB 1CPRA 4C3DA 1UG7A 2YL0A 2AU5A 1XWJA 2YKZA 1WN0A 2XRHA 3NYMA 4IRUA 5L0HA 3SXKA 4E7SA 4OIQF 1FFTC 1BDJB 1N1CA 3RIPA 3DWWA 2PX3A 3FAJA 3FOPA 2JX0A 4PJLA 1YLMA 3UMHA 3MFNA 3TQOA 3IQTA 2RD9A 2HV6A 4AL0A 5DS6A 2FGYA 4W8PA 2YEVA 1GM5A 2Q9CA 3C18A 3H2VA 3DJUB 3PHF2 5BQHA 1T5OA 4IGGA 3AQBA 4A4AA 5KYYA 1OW6A 2IXPA 3A11A 4QDLA 3LEVA 4GQHA 1UFBA 1ORSC 2C04A 2LFDA 4MVQA 1M57C 4MTGA 4E0IA 3EGXB 4EBKA 2W4MA 4B6IA 1JPNA 3B71A 3GEIA 4J7TA 3WG7C 4D4XA 2NUTB 3DI5A 3W2VA 1QLEC 4MNDA 2GA0A 2I8BA 3U8PA 3MLGA 5A69A 4HE8D 2LK4A 1V74B 2ZXOA 4YWQA 5CIVA 4U9DA 2W45A 5F5HA
chains in the Genus database with same CATH topology
3VF0A 1DOVA 2L7AA 2GWWA 4W8PA 1H6GA 5L0JA 3S90A 1T01A 5L0GA 2LQGA 3H2VA 1ZW3A 4EHPA 4E18A 1ZW2A 1SYQA 3TJ5A 4IGGA 4P9TA 4ONSA 1L7CA 3RF3A 5L0FA 1U6HA 2X0CA 5L0DA 1DOWA 1ZVZA 4E17A 2IBFA 3MYIA 3H2UA 3T6GB 3ZDLA 2HSQA 4DJ9A 1XWJA 1RKEA 2GDCA 3TJ6A 5L0HA 5FZTA 4PR9A 1RKCA 4K1OA 1ST6A 1RKEB 1TR2A 1QKRA 5L0IA 1YDIA 5L0CA 2B0HA 1U89A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VF0 A;  1DOV A;  2L7A A;  2GWW A;  4W8P A;  1H6G A;  5L0J A;  3S90 A;  1T01 A;  5L0G A;  2LQG A;  3H2V A;  1ZW3 A;  4EHP A;  4E18 A;  1ZW2 A;  1SYQ A;  3TJ5 A;  4IGG A;  4P9T A;  4ONS A;  1L7C A;  3RF3 A;  5L0F A;  1U6H A;  2X0C A;  5L0D A;  1DOW A;  1ZVZ A;  4E17 A;  2IBF A;  3MYI A;  3H2U A;  3T6G B;  3ZDL A;  2HSQ A;  4DJ9 A;  1XWJ A;  1RKE A;  2GDC A;  3TJ6 A;  5L0H A;  5FZT A;  4PR9 A;  1RKC A;  4K1O A;  1ST6 A;  1RKE B;  1TR2 A;  1QKR A;  5L0I A;  1YDI A;  5L0C A;  2B0H A;  1U89 A; 
#chains in the Genus database with same CATH topology
 2ZXW C;  2A68 F;  2X51 A;  3A9C A;  4C3B A;  2KW3 C;  5GPG B;  2CDQ A;  2IXO A;  3BRJ A;  3I4U A;  1LE4 A;  1VMA A;  1T01 A;  5COF A;  2QE9 A;  3U9J A;  3KL4 A;  2CNW D;  2BC5 A;  2XLV A;  4WGY A;  4EHP A;  1YA7 O;  3EGD B;  4P9T A;  3W2W A;  3IQ5 A;  4BPM A;  1R5I D;  1ZHX A;  5B3S C;  3MYI A;  4H54 A;  1EI7 A;  3Q6N A;  1HW2 A;  1A41 A;  3K7D A;  2I15 A;  2R25 A;  3IQ6 A;  4CS9 A;  3WOD F;  2WZG A;  3W8H A;  3G50 A;  3O10 A;  3U2M A;  4G7O F;  4K1O A;  2J9U A;  3KYJ A;  3M1C B;  4U9E A;  1HW1 A;  4FX5 A;  4O7G A;  4KI2 A;  3GEE A;  3QTH A;  1FFH A;  3DAG A;  4N4W A;  4BEJ A;  4MVZ A;  2YQY A;  4LAC B;  3EH1 A;  3HNL A;  4GYT A;  4DBR A;  4JUR I;  4ER9 A;  1TWC A;  1SF8 A;  5DQT A;  1E85 A;  1AUE A;  4YL3 A;  1OCC C;  2ASR A;  2LQG A;  1OCO C;  2R9R B;  1WWP A;  3RKO F;  4NTB A;  4XTK A;  3ATP A;  2NUP A;  3AG2 C;  3L34 A;  3EHM A;  5DLJ A;  3UGP A;  4Z9J A;  4NCQ A;  1VLT A;  4XQ1 A;  1O87 A;  2EIL C;  2WZL A;  3VRC A;  3DD7 A;  2IXM A;  3IHU A;  3JZ0 A;  4OD5 A;  4CX9 A;  4KNW A;  5E33 A;  2WL8 A;  4DRJ B;  5A6K A;  4JKV A;  4MTO A;  4XPW A;  3HJC A;  2R7S A;  2VCA A;  1QKR A;  2ZXR A;  3OA1 A;  3B0P A;  3PCV A;  4XEF A;  1BZ4 A;  5D91 A;  2PF4 E;  3V5Z A;  4ANJ A;  1EQ1 A;  5T1D B;  2XXA A;  3E70 C;  4BG0 A;  4C7O B;  4HFF B;  4J32 B;  4PJM A;  1MMD A;  5JS5 A;  2YLD A;  5KYW A;  3KYI A;  4NY3 A;  1SYQ A;  1LE2 A;  2DB4 A;  2HMZ A;  2J0W A;  1SZI A;  2LD6 A;  3G4X A;  3N2Z B;  2R03 A;  1APC A;  1NFN A;  2VCC A;  1Q0K A;  1VYI A;  3DKA A;  3ZQY A;  2PNO A;  2KK1 A;  5K0I A;  2A0U A;  3EFO B;  3VYW A;  3GAN A;  2E87 A;  3RQF A;  2EIM C;  2EPL X;  3LNM B;  1IW7 F;  2HV7 A;  4XEK A;  5BQG A;  3I5Q A;  3LUT B;  3TUL A;  4I1M A;  4ULW A;  1BR1 A;  1D1C A;  2YRF A;  4I3M A;  4O6Y A;  3MX3 A;  2QY9 A;  3RH3 A;  1FMV A;  1K40 A;  4Q4Z F;  3U2L A;  3ASN C;  1NZE A;  4MVU A;  2IM8 A;  3L1M A;  2J7P A;  3V5Y A;  2QUP A;  3Q7G A;  1CPQ A;  2L6G A;  2HSB A;  2QTV A;  1I5N A;  1A0B A;  3OEO A;  3IEE A;  2CNW A;  2P7V A;  5HSW A;  1I4Z A;  3FHD A;  3EG9 A;  5F28 E;  4BJ6 C;  5L0D A;  1ZVZ A;  2JPU A;  4U5B E;  4X0R A;  4DOZ A;  1RXQ A;  4JE9 A;  1K04 A;  3CSK A;  4OIP F;  1RJ9 A;  2V3C C;  4QI2 A;  1OW8 A;  3GWN A;  4AL1 A;  5COG A;  3TJ6 A;  4CS8 A;  3POV A;  3ZG1 A;  2C03 A;  1HMD A;  2H8A A;  2YLI A;  2ZD9 A;  3E9V A;  5FZT A;  4AE4 A;  4DVZ A;  2YL1 A;  2QNL A;  4BJ5 A;  3C62 A;  2H7O A;  4E0H A;  1FAP B;  2J46 A;  3KPH A;  3RFY A;  1PD0 A;  1NLX A;  3EQL F;  4LDQ A;  3RVZ A;  3NMK A;  1WGW A;  3AGT A;  2CW0 F;  4OIO F;  2GWW A;  2W4B A;  2XL8 A;  3HNJ A;  1LVK A;  3MBG A;  3SXM A;  5L0J A;  1B68 A;  1D1B A;  3C7J A;  3K6B A;  5KYX B;  1JAF A;  5E3A A;  2WVO A;  1Q0G A;  4NC3 A;  2J9V A;  2G3V A;  2IYL D;  3X1O A;  5TJ5 E;  3FOO A;  4MVM A;  1Q0M A;  3B0U X;  3KMI A;  3K1I A;  1AVO B;  2P6V A;  5BQI A;  2RSE B;  1ORY A;  3H2U A;  2XLW A;  2AP3 A;  3GOR A;  3I5P A;  2KYH A;  1TFK B;  3TD7 A;  2YWA A;  1RKE A;  2KGO A;  1JRA A;  1TWG A;  1KU2 A;  3M4B A;  3NYL A;  2CGE A;  4ZLC A;  2BL2 A;  2H7B A;  2NG1 A;  4FWV A;  1TQG A;  1Y6D A;  3JYY A;  1OCZ C;  2R7O A;  5L0I A;  2R7X A;  2MYS A;  3AG1 C;  3C8Z A;  3TOL A;  1LIH A;  3DXJ F;  4PJJ A;  5B1B C;  2Y3B A;  3IPM O;  4CDV A;  2J7P D;  4CSA A;  1T6Q A;  3EHN A;  4EWC A;  2A0B A;  2HJM A;  3DAF A;  2VH3 A;  2LIG A;  1ZW2 A;  2XLD A;  3UMI A;  4A2N B;  5KYU A;  2HZ8 A;  3RF3 A;  5L0F A;  3UGO A;  1RCP A;  3TK0 A;  4U5G A;  4U5H A;  1U0B B;  1LI5 A;  1K05 A;  1VTM P;  2IBF A;  1PD1 A;  2XLM A;  1CGM E;  1JOG A;  1NU7 D;  1ZU4 A;  3ASO C;  4IAR A;  5T3W A;  3S9O A;  3T9O A;  1MMA A;  2GDC A;  2EPM X;  1I4Y A;  4MVO A;  1VB5 A;  4O79 A;  5JUA A;  2A6E F;  3AGU A;  3NRH A;  1G4W R;  2XL6 A;  4BEM J;  1WTY A;  3ZC4 A;  1D1A A;  1GGQ A;  2OCC C;  2YLG A;  1Z7Q c;  2Q00 A;  3RW0 A;  4K7B A;  2MWQ A;  1DOV A;  1C02 A;  1OW7 A;  2J8W A;  1A7D A;  1OXK A;  1H6G A;  5AGF A;  1LPE A;  3RQE A;  3BEH A;  4H4K C;  1ZYR F;  1YYX A;  3DM5 A;  4IAO A;  3F47 A;  3AOU A;  4I44 A;  1H9T A;  3EGX A;  3G4Z A;  1LKX A;  4IB4 A;  1D0Z A;  1M2O A;  4FES A;  4QI0 A;  4XEV A;  4CS9 C;  3NYJ A;  1CGN A;  3S29 A;  5EHH A;  2KQ9 A;  2NUT A;  3T6J A;  1J8M F;  1WOL A;  1Z5Z A;  2R05 A;  3SP1 A;  3FDQ A;  1V54 C;  1BR2 A;  1TWA A;  2EPK X;  2A69 F;  3DZA A;  3GOD A;  3LLK A;  3ZDL A;  3GWL A;  4AK9 A;  1HE1 A;  5JRA A;  1TKN A;  4XLN F;  2CCY A;  4CBE A;  4FAP B;  1SMY F;  3QZC A;  3T4R A;  1R4T A;  5IY5 C;  5CI8 A;  4CJG A;  2HFI A;  4WGZ A;  3N0T A;  5D92 A;  5F5F A;  3LS1 A;  1GQA A;  1SR2 A;  4XPX A;  4CDA A;  4WJ0 A;  2WVN A;  2Q7R A;  4IWB A;  1OCR C;  5A6J A;  1FR0 A;  4XLP F;  3GEH A;  2PX0 A;  1YA9 A;  2J9B A;  4RDA A;  2XM4 A;  1M56 C;  3EGD A;  4DBQ A;  5L3V A;  1LS4 A;  2HS5 A;  4NQF A;  2Y3D A;  2FFH A;  3L8I A;  3GM2 A;  4JTD B;  2J0X A;  4EBB A;  5L0G A;  1EKY A;  4E18 A;  1CGO A;  3LJB A;  4ONS A;  2L81 A;  2VC9 A;  2XLO A;  4I1O B;  4J30 B;  5JLI A;  1OR2 A;  1U6H A;  2ZPA A;  3FVY A;  4YT2 A;  2OEX A;  4YJW A;  5A6B D;  4JCH A;  4O6N A;  3LEO A;  4O6M A;  2QLA A;  1M2V B;  2A6H F;  2GFH A;  1JPJ A;  3LNR A;  4JCZ A;  4RD9 A;  4U5D E;  4RBN A;  2UUH A;  4GEH A;  2DGJ A;  4W8K A;  4E7Z A;  3ZWI A;  2WVQ A;  2XL4 A;  3H65 A;  4JJF A;  1ST6 A;  1VOM A;  2MHR A;  4PK4 A;  4CDY A;  1J8Y F;  2EIK C;  3QVY A;  3DM9 B;  1HY5 A;  3UMK A;  4YT5 A;  1JMW A;  1S7Z A;  5DS4 A;  1ZZP A;  1KNY A;  3HKK A;  3V5X A;  4PJN A;  3M79 A;  2H7V C;  4EUK B;  1PCX A;  3C8G B;  2HMQ A;  3GM1 A;  4MVR A;  1HMO A;  4Z9H A;  3ABM C;  2Q9A A;  3U5S A;  3CAX A;  2XM0 A;  1KTM A;  2KJG A;  3HNK A;  3JSZ A;  4YL0 A;  2W9Y A;  3PMR A;  5KYY B;  4G0H A;  4LLC A;  2R7T A;  3EJN A;  4YK5 A;  1VYK A;  2VB6 A;  3ECS A;  1ZU5 A;  3R7C A;  1V4A A;  5DVW A;  4C7O A;  2OJQ A;  1YDI A;  1ZHY A;  3HLZ A;  4L6R A;  1RKC A;  3VF0 A;  2ETS A;  3VAY A;  4AX2 A;  5JT4 A;  1A7E A;  3U9M A;  1T6I A;  1GS9 A;  3EPV A;  3FMS A;  3US6 A;  2HUJ A;  1YZC A;  2YL3 A;  3N24 A;  5EK0 A;  5DQZ A;  2R7V A;  1C17 M;  1G4U S;  3S0X A;  4KC9 A;  2Z15 A;  3EFO A;  1TFO B;  2LFF A;  5HV9 A;  3B0V C;  1ZHW A;  2X0C A;  4YT4 A;  1YAU O;  2F22 A;  3JSE O;  1YYJ A;  2D5R B;  3SYN A;  4E17 A;  3LES A;  4YT8 A;  3S84 A;  1FMW A;  3NDB B;  4ZLD A;  4BJ5 C;  1ZHT A;  2YVK A;  2Y3H A;  3ABK C;  4YN0 B;  3K33 A;  4Q7C A;  4HEA J;  4JVS A;  1LI7 A;  3RQG A;  3QVZ A;  4LDR A;  3MYF A;  1OKK D;  2PBE A;  3HNI A;  3AG4 C;  1LM3 B;  2CYD A;  1YJG A;  3RYL A;  4CS7 A;  1YAR O;  2PP4 A;  2XLE A;  4EKW A;  5BUO A;  2PFD A;  4YL1 A;  2OKU A;  2XSE A;  3B9Q A;  1G5Z A;  1U89 A;  3C8G A;  3GM3 A;  5JSL A;  3HTK C;  3X2Q C;  1ZHZ A;  2LSE A;  1QPU A;  3W4Y A;  4BJT A;  4LLE A;  4G78 A;  3ITF A;  1BR4 A;  3AG3 C;  3K1I C;  1QZX A;  2FAP B;  1E83 A;  2Q4F A;  1QVX A;  1L7C A;  1NG1 A;  1T6U A;  2OU6 A;  4Z9I A;  4N06 A;  3U3F A;  3V7O A;  4M63 A;  4MW3 A;  2Y69 C;  4PFO A;  2OEV A;  4CIP A;  2R7R A;  3NG1 A;  5A6B A;  4JEA A;  4XPY A;  5JP7 A;  1Z3I X;  3WAQ A;  1V55 C;  5AC5 A;  1PV3 A;  1QSP A;  3AQC A;  3R2P A;  2NUP B;  3RVY A;  3CEX A;  3OWT A;  4IJJ A;  2TMV P;  3DMD A;  1W2W A;  4MW8 A;  1XZP A;  5FCL A;  1FNT c;  1O3U A;  4CSA C;  2P61 A;  2EPO A;  4R32 A;  2YL7 A;  3JTL O;  4N6C A;  5KYX A;  2P1A A;  2R7Q A;  2M64 A;  1NU9 C;  3DJN B;  3O55 A;  4WAB A;  2R7U A;  1E2X A;  4UDV A;  4EIY A;  3C63 A;  2R7W A;  1H9G A;  4MQ9 F;  5T3T A;  1G8X A;  2IXN A;  3JT1 A;  4JTC B;  4N6H A;  3ZTM A;  2YHS A;  4JZA A;  3O39 A;  4DRH B;  3FXH A;  4C3E A;  2P0N A;  2DI3 A;  1T9K A;  4J7Y A;  1YVI A;  2XS8 A;  1Y4C A;  3ZQV A;  2XXA B;  2L9J A;  4OD4 A;  3AJM A;  3QW1 A;  4XWJ A;  5KYW B;  3K66 A;  2G3K A;  2XS1 A;  2B0J A;  2EIN C;  2DYS C;  2UUI A;  1AEP A;  1ORJ A;  3U0C A;  2HJ3 A;  5L3Q A;  3B29 A;  3LS0 A;  2VAS A;  1VK5 A;  4PR9 A;  3M15 A;  4LER A;  2LCH A;  1BBH A;  1D0Y A;  4JJG A;  2D4U A;  2DYR C;  1C03 A;  3C8G D;  3SEO A;  4KNV A;  3EZI A;  3SZR A;  1IZM A;  1OR3 A;  1MND A;  2IOQ A;  3L0I A;  2G62 A;  2BE5 F;  4K0D A;  3PDM P;  4U5E E;  4DXW A;  3UR3 C;  1XZQ A;  4LDK A;  2JD3 A;  3LLI A;  5E2Q A;  4P6I C;  3L8J A;  3FAP B;  3EZH A;  2KC3 A;  3SXY A;  1OQC A;  1MQV A;  2EIJ C;  4U5F E;  1Q0D A;  1TWH A;  4ULV A;  3UNG C;  5AC4 A;  3QMK A;  5EGY A;  4OIN F;  2O9X A;  1E84 A;  3SXZ A;  3J06 A;  4JRZ A;  3DE9 A;  3T6G B;  3WHN A;  2NPU A;  2J45 A;  2VCB A;  4MS2 A;  3EG9 B;  2KSF A;  2L6F A;  2OOC A;  2J9W A;  1M6T A;  3KKB A;  3ABL C;  2A1D D;  4MTF A;  4IAQ A;  1RJ9 B;  3Q6M A;  4DRI B;  1H7I A;  3SNH A;  1Z6A A;  1OKK A;  2WB7 A;  3NMI A;  1NBB A;  5E3C A;  4P9F A;  3JRT A;  4BJ1 A;  5L0C A;  3W8I A;  2B0H A;  2GAQ A;  2NSG A;  4AE4 B;  3EH2 A;  4DVY P;  3F46 A;  1EA8 A;  3O6X A;  5A6A A;  2ZXP A;  4JEB A;  1F1M A;  3JRM O;  3K1H A;  2WZF A;  2EPN A;  1YZA A;  2ICW G;  3NMJ A;  3KH2 A;  1FTS A;  3TOM A;  1A7V A;  5B1A C;  3VM6 A;  1OXB A;  4JTA B;  4D4N A;  1HE9 A;  4PFP A;  2M4E A;  1L3P A;  1DOW A;  3ZIB A;  2OG2 A;  1E86 A;  1Z23 A;  1VLS A;  1O5H A;  1QQ3 A;  256B A;  4NTF A;  3JCU Q;  1S05 A;  2HSQ A;  3NKE A;  4DJ9 A;  5COM A;  3NKD A;  1NSG B;  3IQC A;  3M4C A;  3CZ6 A;  3CQZ A;  3S28 A;  4BJ6 A;  5B3I A;  5KYN A;  4G7H F;  1MMG A;  2R02 A;  1WAT A;  3U3B A;  4HFK B;  1RMV A;  2NSF A;  2LP4 A;  3ZTZ A;  4F4B A;  4G7Z F;  2Q3T A;  1RKE B;  1TR2 A;  4U5C E;  4CJO A;  3Q7L A;  2YZS A;  3S27 A;  1MMN A;  2OJE D;  3LAY A;  4MVS A;  4OIR F;  3T6B A;  3U8V A;  1D0X A;  2L7A A;  2OQM A;  2Y39 A;  1WAS A;  3DE8 A;  3JYH A;  4PAC A;  4CIH A;  3S90 A;  2Q9B A;  2KNH A;  1Q0F A;  2AWY A;  1ZW3 A;  3ZSU A;  1LS1 A;  3TJ5 A;  4JW1 A;  1M2V A;  1NFO A;  2V26 A;  2XLH A;  3ZVR A;  4NTA A;  5CI9 A;  5DS5 A;  4EBJ A;  2AVK A;  2L6H A;  2AWC A;  2HKV A;  1Z63 A;  4Q5S F;  1JR8 A;  4CS8 C;  2Y3G A;  4KBL A;  4JC7 A;  4JIO A;  1MNE A;  5JVE A;  3QW0 A;  5KYU B;  1CPR A;  4C3D A;  1UG7 A;  2YL0 A;  2AU5 A;  1XWJ A;  2YKZ A;  1WN0 A;  2XRH A;  3NYM A;  4IRU A;  5L0H A;  3SXK A;  4E7S A;  4OIQ F;  1FFT C;  1BDJ B;  1N1C A;  3RIP A;  3DWW A;  2PX3 A;  3FAJ A;  3FOP A;  2JX0 A;  4PJL A;  1YLM A;  3UMH A;  3MFN A;  3TQO A;  3IQT A;  2RD9 A;  2HV6 A;  4AL0 A;  5DS6 A;  2FGY A;  4W8P A;  2YEV A;  1GM5 A;  2Q9C A;  3C18 A;  3H2V A;  3DJU B;  3PHF 2;  5BQH A;  1T5O A;  4IGG A;  3AQB A;  4A4A A;  5KYY A;  1OW6 A;  2IXP A;  3A11 A;  4QDL A;  3LEV A;  4GQH A;  1UFB A;  1ORS C;  2C04 A;  2LFD A;  4MVQ A;  1M57 C;  4MTG A;  4E0I A;  3EGX B;  4EBK A;  2W4M A;  4B6I A;  1JPN A;  3B71 A;  3GEI A;  4J7T A;  3WG7 C;  4D4X A;  2NUT B;  3DI5 A;  3W2V A;  1QLE C;  4MND A;  2GA0 A;  2I8B A;  3U8P A;  3MLG A;  5A69 A;  4HE8 D;  2LK4 A;  1V74 B;  2ZXO A;  4YWQ A;  5CIV A;  4U9D A;  2W45 A;  5F5H A; 
#chains in the Genus database with same CATH homology
 3VF0 A;  1DOV A;  2L7A A;  2GWW A;  4W8P A;  1H6G A;  5L0J A;  3S90 A;  1T01 A;  5L0G A;  2LQG A;  3H2V A;  1ZW3 A;  4EHP A;  4E18 A;  1ZW2 A;  1SYQ A;  3TJ5 A;  4IGG A;  4P9T A;  4ONS A;  1L7C A;  3RF3 A;  5L0F A;  1U6H A;  2X0C A;  5L0D A;  1DOW A;  1ZVZ A;  4E17 A;  2IBF A;  3MYI A;  3H2U A;  3T6G B;  3ZDL A;  2HSQ A;  4DJ9 A;  1XWJ A;  1RKE A;  2GDC A;  3TJ6 A;  5L0H A;  5FZT A;  4PR9 A;  1RKC A;  4K1O A;  1ST6 A;  1RKE B;  1TR2 A;  1QKR A;  5L0I A;  1YDI A;  5L0C A;  2B0H A;  1U89 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...