4E17A

Alpha-e-catenin is an autoinhibited molecule that co-activates vinculin
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
256
structure length
246
Chain Sequence
IQMPVFHTRTIESILEPVAQQISHLVIMHEEGEIPDLTAPVSAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVRAAQMLQADPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKGIEEALKNRNFTVEKMSAEINEIIRVLQLTSWD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vinculin
publication title Conformational plasticity of alpha-catenin revealed by binding interactions with vinculin
rcsb
source organism Gallus gallus
molecule tags Cell adhesion
total genus 105
structure length 246
sequence length 256
ec nomenclature
pdb deposition date 2012-03-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 4e17A02
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 4e17A01
1L7CA 1ZW2A 3TJ6A 1U6HA 3ZDLA 3VF0A 1ST6A 1U89A 5L0GA 1ZVZA 2GWWA 1DOVA 4EHPA 3T6GB 4K1OA 1T01A 5L0IA 1H6GA 2B0HA 4PR9A 5L0JA 2HSQA 1ZW3A 1DOWA 5L0DA 3S90A 2IBFA 2GDCA 2X0CA 4IGGA 5FZTA 1YDIA 4ONSA 1RKEA 4P9TA 3RF3A 2L7AA 5L0CA 4DJ9A 1TR2A 1XWJA 1QKRA 3H2UA 4E18A 1RKCA 1SYQA 3H2VA 3TJ5A 4E17A 3MYIA 2LQGA 1RKEB 4W8PA 5L0HA 5L0FA
chains in the Genus database with same CATH superfamily
3PDMP 1HMDA 3ITFA 4JKVA 4XQ1A 3TJ6A 4J7TA 3W2WA 4AX2A 4YL1A 1FFHA 3EPVA 3DM9B 4D4XA 2G3VA 3L1MA 2YWAA 5FCLA 5L0GA 1GM5A 1APCA 1OXKA 2XLWA 1H9GA 4G78A 4HE8D 3GEEA 2PX3A 3U0CA 2J8WA 4PJLA 2M64A 3DAGA 4U5DE 2HJMA 1E83A 3L0IA 4N06A 4BJ1A 4YL3A 2DYSC 3B29A 2H8AA 2HJ3A 5B3SC 3RQGA 2IM8A 2XLOA 4OINF 2FFHA 3LLIA 2DI3A 1PD0A 2PFDA 4PK4A 1BBHA 2Z15A 1D1BA 4JURI 4CS9A 1ORJA 1TR2A 2WB7A 3AG2C 3HNIA 1FMVA 1NLXA 1E86A 2NSFA 3G4XA 3LEOA 3B0UX 3QMKA 3E9VA 3KYJA 3ZTZA 2KSFA 1G8XA 2XRHA 2LQGA 3MYIA 3EGXB 4DBQA 4LLEA 5L0HA 3T4RA 4XPWA 4BJ6C 3C8GA 1MMDA 4FAPB 1C17M 4FWVA 4BJTA 1OKKD 2R7WA 1FR0A 4O7GA 2OKUA 4Z9JA 2VASA 3ZC4A 1JMWA 3U5SA 3AQBA 4JIOA 1MMGA 4XPYA 4IRUA 1FTSA 2XM4A 4E7ZA 5L0IA 2J9WA 1I4ZA 4DRHB 3DMDA 1N1CA 2OG2A 2NUPA 3MYFA 2JD3A 3F46A 1ZW3A 1DOWA 3N0TA 4A4AA 3ZVRA 1IW7F 1M2VB 4EIYA 1OCZC 3CSKA 4Z9IA 4ULWA 1UG7A 3WG7C 2RD9A 2MYSA 1TWAA 2PNOA 3BEHA 3FXHA 3U9JA 3VRCA 3KKBA 2QUPA 3C7JA 2R05A 5JT4A 1AVOB 2A0UA 2XLMA 5E33A 4MVMA 2AP3A 3DXJF 4CX9A 3TOLA 1Z6AA 3IQCA 2E87A 4CS9C 3FVYA 4P9FA 3UGOA 4IARA 2YHSA 3EQLF 2W45A 3SXYA 1J8YF 3U9MA 3HNKA 4U9EA 2YVKA 2XLEA 1D0ZA 1H7IA 1M2VA 2CDQA 4JE9A 3ASOC 4PJMA 1TFOB 3KH2A 4XLPF 4R32A 1WATA 1CGME 5COMA 1HMOA 2OJED 3CQZA 4BEMJ 3VM6A 4NY3A 2A1DD 3FMSA 4E0IA 3JRTA 5B1AC 3S90A 2F22A 4LERA 1ZHYA 4MW3A 4PJJA 4CBEA 3GM3A 5BQHA 2IXOA 1FNTc 5COGA 2W4MA 4WGZA 5T1DB 2YLGA 1KNYA 3LNMB 1LI7A 4WJ0A 1K40A 5A6BA 1NG1A 3SZRA 1TWCA 2H7BA 2ASRA 1LS1A 2CNWA 2EPLX 3GODA 1ZU5A 4L6RA 1ZZPA 4DRJB 3NKEA 4DVZA 5KYUB 3JYHA 4H54A 2HSBA 1VYKA 1M57C 3FAJA 2DYRC 2KNHA 3PHF2 5KYWB 2PF4E 1QPUA 3FOOA 2YL1A 2DB4A 5EK0A 2XS8A 2J46A 3L8JA 4JW1A 3HNLA 4MTGA 3DD7A 2HUJA 1ZU4A 1OCCC 3MFNA 2OU6A 4MTFA 2J45A 1OR2A 4NTAA 5F5FA 5B3IA 3EHNA 1Z23A 3B9QA 2HKVA 2XL8A 3DKAA 4G0HA 3LUTB 2NUTA 4DRIB 2CW0F 3U3FA 3PCVA 1ZHWA 3U8VA 2XSEA 4CS7A 1V54C 2L9JA 5DS5A 1SYQA 1G4WR 1PD1A 4PJNA 2XS1A 3JZ0A 5A6JA 1EA8A 1R4TA 5DLJA 1I5NA 3X2QC 5JVEA 2J0XA 3O55A 1U89A 2ZD9A 4OD4A 1U0BB 5A6AA 1GGQA 2LD6A 2KGOA 3GWNA 3LESA 4EHPA 1T01A 4DBRA 3M4BA 2B0HA 1SZIA 1A0BA 5L3QA 5L0DA 3SP1A 2Q9CA 4JEAA 4IGGA 3DE8A 3LNRA 3O6XA 2HMQA 4E7SA 2Q3TA 4I1OB 2L7AA 2R7XA 1Q0KA 1YVIA 5CIVA 2XL4A 3ABLC 2OJQA 5KYNA 2CGEA 2M4EA 1V4AA 2QE9A 1YLMA 3H2VA 4J32B 3TJ5A 3TK0A 2YLIA 5D91A 4AE4B 4CSAA 4O6YA 2Y69C 3W2VA 4BPMA 5L3VA 5L0FA 3SNHA 2LFFA 2ZPAA 3ASNC 4U5GA 3R2PA 1QQ3A 4JVSA 5AC4A 4B6IA 4YK5A 1LS4A 4XPXA 3G50A 5T3WA 4Q5SF 1DOVA 3LAYA 3T6GB 1HE1A 1T5OA 2QY9A 4K1OA 4C3DA 4EWCA 2BL2A 4BJ5C 2YQYA 3K1IA 1TQGA 5KYUA 4OIOF 2XXAA 1ZHZA 5BQGA 4PFOA 256BA 5B1BC 1T6QA 4PACA 2Q9AA 2XM0A 4C7OB 2D5RB 1A7VA 3RF3A 5L0CA 1JRAA 2A0BA 4DJ9A 5KYXA 4YN0B 1D0XA 3AJMA 2XLHA 3RW0A 3ZQVA 2XLVA 2AU5A 4JRZA 3EZHA 1K04A 2GA0A 4EBJA 4AL1A 1RKEB 2OOCA 4KBLA 3EH1A 3EFOB 1OCRC 3MBGA 1LKXA 1ZW2A 3W4YA 3T9OA 4CDVA 3GORA 3K66A 1A41A 2NSGA 2WVNA 4JCZA 2EIKC 4ANJA 1VMAA 4J7YA 5JP7A 1E2XA 1C03A 1NU7D 3WHNA 4Z9HA 2Q00A 2PP4A 4RDAA 3AG1C 1H6GA 2KW3C 5L0JA 2C04A 2LFDA 1OW6A 1F1MA 4MVUA 3AQCA 2X51A 4F4BA 2AWCA 3X1OA 1NU9C 3L8IA 2MWQA 1LE2A 4JTAB 3EGXA 3T6BA 3U2LA 5KYYB 3S29A 1OCOC 3GANA 3SYNA 1FFTC 2IOQA 2YL7A 3SXMA 2I15A 3W8HA 3C8GD 1VB5A 4YJWA 1YA9A 3S0XA 2LCHA 3NMIA 1BR1A 1SR2A 1L7CA 3I4UA 4O6NA 1Z3IX 2KJGA 2VCCA 2R25A 1WGWA 1WN0A 2A6EF 2C03A 1JR8A 1VLTA 2UUHA 3LEVA 2WL8A 2BC5A 3EG9B 2IYLD 4JEBA 2FGYA 1S7ZA 2KK1A 2QLAA 3POVA 1MMNA 3UGPA 1HW1A 1D1CA 1OW7A 1Q0GA 3GM1A 3PMRA 2EIJC 4NCQA 2P6VA 4BJ6A 4G7OF 4XEVA 1GQAA 3ECSA 5F5HA 3E70C 2X0CA 1MNEA 3KL4A 4KNVA 3ZG1A 4CS8C 3VAYA 1RXQA 2WZGA 1EI7A 1TFKB 3DE9A 3ZWIA 3CZ6A 3A11A 3B71A 4LACB 4LLCA 4MVOA 4XEFA 1YYJA 1NBBA 2Y3GA 3NRHA 3ABMC 2LIGA 4YT2A 3RYLA 1E84A 3EG9A 1OR3A 2J7PA 1QVXA 1SMYF 3G4ZA 3IHUA 4K0DA 3NYJA 2V26A 3S9OA 3ZTMA 5A6KA 4YT5A 1VOMA 2XXAB 2W9YA 2R02A 3DI5A 4YL0A 1ST6A 1BR4A 2GAQA 4CJGA 3HJCA 3RQEA 5DS6A 2R9RB 3NG1A 2Y3HA 4KNWA 3RVZA 1NFNA 1YA7O 2KC3A 2L6HA 1Y6DA 3K6BA 1M6TA 3B0VC 4U5EE 4A2NB 2FAPB 1AEPA 2Q7RA 3ZIBA 1IZMA 1LPEA 2CYDA 4GEHA 5JRAA 1CGNA 5A6BD 2OEXA 2R03A 2GDCA 1T6UA 2CNWD 5FZTA 2HV7A 4G7ZF 1K05A 3TQOA 2J7PD 2G3KA 3S28A 1GS9A 2Y3BA 1R5ID 1YZAA 2EPKX 3V5ZA 1HE9A 1LVKA 3QZCA 3U3BA 2YRFA 5EHHA 4U5FE 5DVWA 5KYWA 2IXMA 4XEKA 4Q7CA 3DJNB 2KQ9A 1A7DA 1A7EA 3K33A 4CIHA 4KI2A 4U5CE 2YL0A 1CPRA 3EGDB 3GM2A 4MVSA 4XWJA 2UUIA 4KC9A 4OIQF 2R7OA 3EHMA 1JOGA 4I1MA 2VCBA 2XLDA 4EBBA 3HNJA 4UDVA 1O87A 2ETSA 4AL0A 5GPGB 2AVKA 4CDAA 4E0HA 4NTBA 3Q7GA 1SF8A 1H9TA 1VTMP 1RMVA 2R7SA 3TULA 1D1AA 3RVYA 2Y3DA 5AGFA 3UR3C 1QKRA 4HFKB 2IXNA 3FDQA 4JTCB 5HV9A 2NG1A 3HTKC 3H65A 4RBNA 4LDRA 4LDQA 2R7VA 3FHDA 4HFFB 4AK9A 3R7CA 4C3BA 5F28E 4W8PA 3DJUB 4DVYP 3WAQA 1Q0FA 1BR2A 4QDLA 2ZXOA 3Q7LA 4U5BE 4EUKB 2EILC 3VF0A 4EKWA 2Q4FA 3HLZA 5JUAA 5E3CA 4XLNF 1OXBA 1ZVZA 1M56C 1NSGB 2H7OA 2VC9A 4IAQA 5JS5A 3JRMO 4N4WA 4I44A 4JJFA 1VYIA 1O5HA 1YARO 2QNLA 4MTOA 4ULVA 3SEOA 1MMAA 4JJGA 3CAXA 3KPHA 4YWQA 1V55C 2WVOA 3AGTA 3M1CB 4X0RA 3KYIA 3LS0A 4W8KA 3JT1A 1WWPA 3UNGC 3JTLO 4AE4A 3NKDA 4JC7A 4QI2A 3RIPA 1PCXA 2PBEA 1JAFA 2TMVP 2J9UA 2WZFA 4I3MA 1JPNA 3AG3C 4DOZA 3K1HA 4JCHA 1WOLA 4MS2A 5DS4A 4C3EA 1CPQA 1RCPA 2YEVA 4ER9A 4N6CA 5JLIA 3A9CA 2EPNA 3ZDLA 3EZIA 1YYXA 4WABA 2QTVA 2OCCC 3JSZA 4OD5A 1QLEC 3JCUQ 4CJOA 3KMIA 1HW2A 4XTKA 4NTFA 1LIHA 3DWWA 1Y4CA 3RQFA 2KYHA 2RSEB 3C8GB 3QW1A 4C7OA 3V5YA 1OKKA 2EPMX 2OEVA 2R7QA 2IXPA 2P1AA 2ZXPA 2HV6A 2J0WA 1CGOA 3DM5A 1D0YA 1VLSA 3SXZA 5T3TA 3S27A 3GEHA 1RKEA 3C62A 2NUPB 2VH3A 3US6A 4WGYA 2G62A 1J8MF 3EFOA 1NZEA 2JX0A 1KTMA 3FOPA 3Q6MA 4BEJA 1NFOA 4BJ5A 3M15A 3NMJA 2HFIA 4QI0A 3AGUA 4DXWA 4G7HF 2XL6A 3F47A 1V74B 5BUOA 1WTYA 1G5ZA 2LP4A 3HKKA 2J9VA 4P6IC 2WZLA 4GQHA 3DAFA 1OW8A 1Q0MA 5DQZA 4ZLCA 1UFBA 2GWWA 3OWTA 3U8PA 2L6FA 3W8IA 2CCYA 4JZAA 5KYYA 5BQIA 5E2QA 1LE4A 3K7DA 2P0NA 3RKOF 3QVYA 2IBFA 3LS1A 1YDIA 2BE5F 1LI5A 4ONSA 1EQ1A 3OA1A 4P9TA 4H4KC 3I5QA 3H2UA 5TJ5E 5HSWA 2MHRA 2HZ8A 3TOMA 3IQ6A 3SXKA 1ZHXA 2LSEA 2VB6A 3NMKA 1EKYA 3U2MA 1KU2A 1U6HA 3I5PA 3M79A 1ORYA 4D4NA 2B0JA 2P7VA 4YT8A 5AC5A 1YZCA 1C02A 4IAOA 4IB4A 5DQTA 4U5HA 1MQVA 3O39A 2A69F 4PR9A 2VCAA 1WASA 1ZYRF 2O9XA 2YZSA 1AUEA 3NDBB 2OQMA 3QVZA 2ZXWC 1W2WA 1VK5A 4BG0A 3OEOA 1TKNA 1BDJB 2ZXRA 3C8ZA 3EH2A 1YAUO 3IQ5A 1FMWA 4OIPF 3MLGA 1QZXA 4MW8A 5CI8A 3TD7A 3B0PA 1RKCA 4M63A 3AG4C 4LDKA 3UMHA 2JPUA 5JSLA 4CS8A 2NUTB 3LLKA 2R7UA 4MVQA 3UMIA 3ZSUA 3L34A 3N24A 2I8BA 2A6HF 3ATPA 4N6HA 5EGYA 1OQCA 3NYLA 4U9DA 2V3CC 2WVQA 3CEXA 5COFA 3GWLA 1TWGA 1RJ9B 1HY5A 4CDYA 4YT4A 5A69A 3M4CA 1FAPB 2EIMC 1TWHA 1M2OA 1XZPA 2YL3A 1Z63A 1MNDA 4FX5A 2DGJA 2Y39A 3WODF 3IPMO 2L81A 1E85A 4CSAC 3J06A 4NC3A 2A68F 1I4YA 2YLDA 4GYTA 4MVZA 4MVRA 3EJNA 4O6MA 2H7VC 3S84A 1XWJA 3IEEA 3EGDA 2D4UA 5E3AA 3QW0A 1QSPA 2PX0A 1RJ9A 2HMZA 2HS5A 5CI9A 4E17A 1YJGA 3UMKA 2R7RA 2NPUA 3V5XA 1L3PA 3T6JA 1B68A 5K0IA 3BRJA 4HEAJ 1G4US 1T9KA 3GEIA 2ICWG 3O10A 1Z7Qc 3RFYA 3RH3A 3V7OA 2GFHA 3ABKC 3K1IC 4JTDB 2P61A 5D92A 1S05A 3VYWA 1O3UA 1Z5ZA 4PFPA 3DZAA 4J30B 3MX3A 1ZHTA 2R7TA 3QTHA 4IJJA 4K7BA 3JSEO 3LJBA 2L6GA 3C63A 2J9BA 2HSQA 2Q9BA 4MQ9F 4RD9A 3AOUA 3NYMA 2AWYA 2YKZA 1XZQA 4O79A 4EBKA 5IY5C 1JPJA 1T6IA 2LK4A 1LM3B 3JYYA 4IWBA 4MNDA 4OIRF 4Q4ZF 3FAPB 4FESA 4ZLDA 4CIPA 1BZ4A 1ORSC 1Q0DA 3ZQYA 4E18A 2EINC 3IQTA 4NQFA 3C18A 3Q6NA 1PV3A 2W4BA 2EPOA 5KYXB 3N2ZB
chains in the Genus database with same CATH topology
1L7CA 1ZW2A 3TJ6A 1U6HA 3ZDLA 3VF0A 1ST6A 1U89A 5L0GA 1ZVZA 2GWWA 1DOVA 4EHPA 3T6GB 4K1OA 1T01A 5L0IA 1H6GA 2B0HA 4PR9A 5L0JA 2HSQA 1ZW3A 1DOWA 5L0DA 3S90A 2IBFA 2GDCA 2X0CA 4IGGA 5FZTA 1YDIA 4ONSA 1RKEA 4P9TA 3RF3A 2L7AA 5L0CA 4DJ9A 1TR2A 1XWJA 1QKRA 3H2UA 4E18A 1RKCA 1SYQA 3H2VA 3TJ5A 4E17A 3MYIA 2LQGA 1RKEB 4W8PA 5L0HA 5L0FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L7C A;  1ZW2 A;  3TJ6 A;  1U6H A;  3ZDL A;  3VF0 A;  1ST6 A;  1U89 A;  5L0G A;  1ZVZ A;  2GWW A;  1DOV A;  4EHP A;  3T6G B;  4K1O A;  1T01 A;  5L0I A;  1H6G A;  2B0H A;  4PR9 A;  5L0J A;  2HSQ A;  1ZW3 A;  1DOW A;  5L0D A;  3S90 A;  2IBF A;  2GDC A;  2X0C A;  4IGG A;  5FZT A;  1YDI A;  4ONS A;  1RKE A;  4P9T A;  3RF3 A;  2L7A A;  5L0C A;  4DJ9 A;  1TR2 A;  1XWJ A;  1QKR A;  3H2U A;  4E18 A;  1RKC A;  1SYQ A;  3H2V A;  3TJ5 A;  4E17 A;  3MYI A;  2LQG A;  1RKE B;  4W8P A;  5L0H A;  5L0F A; 
#chains in the Genus database with same CATH topology
 3PDM P;  1HMD A;  3ITF A;  4JKV A;  4XQ1 A;  3TJ6 A;  4J7T A;  3W2W A;  4AX2 A;  4YL1 A;  1FFH A;  3EPV A;  3DM9 B;  4D4X A;  2G3V A;  3L1M A;  2YWA A;  5FCL A;  5L0G A;  1GM5 A;  1APC A;  1OXK A;  2XLW A;  1H9G A;  4G78 A;  4HE8 D;  3GEE A;  2PX3 A;  3U0C A;  2J8W A;  4PJL A;  2M64 A;  3DAG A;  4U5D E;  2HJM A;  1E83 A;  3L0I A;  4N06 A;  4BJ1 A;  4YL3 A;  2DYS C;  3B29 A;  2H8A A;  2HJ3 A;  5B3S C;  3RQG A;  2IM8 A;  2XLO A;  4OIN F;  2FFH A;  3LLI A;  2DI3 A;  1PD0 A;  2PFD A;  4PK4 A;  1BBH A;  2Z15 A;  1D1B A;  4JUR I;  4CS9 A;  1ORJ A;  1TR2 A;  2WB7 A;  3AG2 C;  3HNI A;  1FMV A;  1NLX A;  1E86 A;  2NSF A;  3G4X A;  3LEO A;  3B0U X;  3QMK A;  3E9V A;  3KYJ A;  3ZTZ A;  2KSF A;  1G8X A;  2XRH A;  2LQG A;  3MYI A;  3EGX B;  4DBQ A;  4LLE A;  5L0H A;  3T4R A;  4XPW A;  4BJ6 C;  3C8G A;  1MMD A;  4FAP B;  1C17 M;  4FWV A;  4BJT A;  1OKK D;  2R7W A;  1FR0 A;  4O7G A;  2OKU A;  4Z9J A;  2VAS A;  3ZC4 A;  1JMW A;  3U5S A;  3AQB A;  4JIO A;  1MMG A;  4XPY A;  4IRU A;  1FTS A;  2XM4 A;  4E7Z A;  5L0I A;  2J9W A;  1I4Z A;  4DRH B;  3DMD A;  1N1C A;  2OG2 A;  2NUP A;  3MYF A;  2JD3 A;  3F46 A;  1ZW3 A;  1DOW A;  3N0T A;  4A4A A;  3ZVR A;  1IW7 F;  1M2V B;  4EIY A;  1OCZ C;  3CSK A;  4Z9I A;  4ULW A;  1UG7 A;  3WG7 C;  2RD9 A;  2MYS A;  1TWA A;  2PNO A;  3BEH A;  3FXH A;  3U9J A;  3VRC A;  3KKB A;  2QUP A;  3C7J A;  2R05 A;  5JT4 A;  1AVO B;  2A0U A;  2XLM A;  5E33 A;  4MVM A;  2AP3 A;  3DXJ F;  4CX9 A;  3TOL A;  1Z6A A;  3IQC A;  2E87 A;  4CS9 C;  3FVY A;  4P9F A;  3UGO A;  4IAR A;  2YHS A;  3EQL F;  2W45 A;  3SXY A;  1J8Y F;  3U9M A;  3HNK A;  4U9E A;  2YVK A;  2XLE A;  1D0Z A;  1H7I A;  1M2V A;  2CDQ A;  4JE9 A;  3ASO C;  4PJM A;  1TFO B;  3KH2 A;  4XLP F;  4R32 A;  1WAT A;  1CGM E;  5COM A;  1HMO A;  2OJE D;  3CQZ A;  4BEM J;  3VM6 A;  4NY3 A;  2A1D D;  3FMS A;  4E0I A;  3JRT A;  5B1A C;  3S90 A;  2F22 A;  4LER A;  1ZHY A;  4MW3 A;  4PJJ A;  4CBE A;  3GM3 A;  5BQH A;  2IXO A;  1FNT c;  5COG A;  2W4M A;  4WGZ A;  5T1D B;  2YLG A;  1KNY A;  3LNM B;  1LI7 A;  4WJ0 A;  1K40 A;  5A6B A;  1NG1 A;  3SZR A;  1TWC A;  2H7B A;  2ASR A;  1LS1 A;  2CNW A;  2EPL X;  3GOD A;  1ZU5 A;  4L6R A;  1ZZP A;  4DRJ B;  3NKE A;  4DVZ A;  5KYU B;  3JYH A;  4H54 A;  2HSB A;  1VYK A;  1M57 C;  3FAJ A;  2DYR C;  2KNH A;  3PHF 2;  5KYW B;  2PF4 E;  1QPU A;  3FOO A;  2YL1 A;  2DB4 A;  5EK0 A;  2XS8 A;  2J46 A;  3L8J A;  4JW1 A;  3HNL A;  4MTG A;  3DD7 A;  2HUJ A;  1ZU4 A;  1OCC C;  3MFN A;  2OU6 A;  4MTF A;  2J45 A;  1OR2 A;  4NTA A;  5F5F A;  5B3I A;  3EHN A;  1Z23 A;  3B9Q A;  2HKV A;  2XL8 A;  3DKA A;  4G0H A;  3LUT B;  2NUT A;  4DRI B;  2CW0 F;  3U3F A;  3PCV A;  1ZHW A;  3U8V A;  2XSE A;  4CS7 A;  1V54 C;  2L9J A;  5DS5 A;  1SYQ A;  1G4W R;  1PD1 A;  4PJN A;  2XS1 A;  3JZ0 A;  5A6J A;  1EA8 A;  1R4T A;  5DLJ A;  1I5N A;  3X2Q C;  5JVE A;  2J0X A;  3O55 A;  1U89 A;  2ZD9 A;  4OD4 A;  1U0B B;  5A6A A;  1GGQ A;  2LD6 A;  2KGO A;  3GWN A;  3LES A;  4EHP A;  1T01 A;  4DBR A;  3M4B A;  2B0H A;  1SZI A;  1A0B A;  5L3Q A;  5L0D A;  3SP1 A;  2Q9C A;  4JEA A;  4IGG A;  3DE8 A;  3LNR A;  3O6X A;  2HMQ A;  4E7S A;  2Q3T A;  4I1O B;  2L7A A;  2R7X A;  1Q0K A;  1YVI A;  5CIV A;  2XL4 A;  3ABL C;  2OJQ A;  5KYN A;  2CGE A;  2M4E A;  1V4A A;  2QE9 A;  1YLM A;  3H2V A;  4J32 B;  3TJ5 A;  3TK0 A;  2YLI A;  5D91 A;  4AE4 B;  4CSA A;  4O6Y A;  2Y69 C;  3W2V A;  4BPM A;  5L3V A;  5L0F A;  3SNH A;  2LFF A;  2ZPA A;  3ASN C;  4U5G A;  3R2P A;  1QQ3 A;  4JVS A;  5AC4 A;  4B6I A;  4YK5 A;  1LS4 A;  4XPX A;  3G50 A;  5T3W A;  4Q5S F;  1DOV A;  3LAY A;  3T6G B;  1HE1 A;  1T5O A;  2QY9 A;  4K1O A;  4C3D A;  4EWC A;  2BL2 A;  4BJ5 C;  2YQY A;  3K1I A;  1TQG A;  5KYU A;  4OIO F;  2XXA A;  1ZHZ A;  5BQG A;  4PFO A;  256B A;  5B1B C;  1T6Q A;  4PAC A;  2Q9A A;  2XM0 A;  4C7O B;  2D5R B;  1A7V A;  3RF3 A;  5L0C A;  1JRA A;  2A0B A;  4DJ9 A;  5KYX A;  4YN0 B;  1D0X A;  3AJM A;  2XLH A;  3RW0 A;  3ZQV A;  2XLV A;  2AU5 A;  4JRZ A;  3EZH A;  1K04 A;  2GA0 A;  4EBJ A;  4AL1 A;  1RKE B;  2OOC A;  4KBL A;  3EH1 A;  3EFO B;  1OCR C;  3MBG A;  1LKX A;  1ZW2 A;  3W4Y A;  3T9O A;  4CDV A;  3GOR A;  3K66 A;  1A41 A;  2NSG A;  2WVN A;  4JCZ A;  2EIK C;  4ANJ A;  1VMA A;  4J7Y A;  5JP7 A;  1E2X A;  1C03 A;  1NU7 D;  3WHN A;  4Z9H A;  2Q00 A;  2PP4 A;  4RDA A;  3AG1 C;  1H6G A;  2KW3 C;  5L0J A;  2C04 A;  2LFD A;  1OW6 A;  1F1M A;  4MVU A;  3AQC A;  2X51 A;  4F4B A;  2AWC A;  3X1O A;  1NU9 C;  3L8I A;  2MWQ A;  1LE2 A;  4JTA B;  3EGX A;  3T6B A;  3U2L A;  5KYY B;  3S29 A;  1OCO C;  3GAN A;  3SYN A;  1FFT C;  2IOQ A;  2YL7 A;  3SXM A;  2I15 A;  3W8H A;  3C8G D;  1VB5 A;  4YJW A;  1YA9 A;  3S0X A;  2LCH A;  3NMI A;  1BR1 A;  1SR2 A;  1L7C A;  3I4U A;  4O6N A;  1Z3I X;  2KJG A;  2VCC A;  2R25 A;  1WGW A;  1WN0 A;  2A6E F;  2C03 A;  1JR8 A;  1VLT A;  2UUH A;  3LEV A;  2WL8 A;  2BC5 A;  3EG9 B;  2IYL D;  4JEB A;  2FGY A;  1S7Z A;  2KK1 A;  2QLA A;  3POV A;  1MMN A;  3UGP A;  1HW1 A;  1D1C A;  1OW7 A;  1Q0G A;  3GM1 A;  3PMR A;  2EIJ C;  4NCQ A;  2P6V A;  4BJ6 A;  4G7O F;  4XEV A;  1GQA A;  3ECS A;  5F5H A;  3E70 C;  2X0C A;  1MNE A;  3KL4 A;  4KNV A;  3ZG1 A;  4CS8 C;  3VAY A;  1RXQ A;  2WZG A;  1EI7 A;  1TFK B;  3DE9 A;  3ZWI A;  3CZ6 A;  3A11 A;  3B71 A;  4LAC B;  4LLC A;  4MVO A;  4XEF A;  1YYJ A;  1NBB A;  2Y3G A;  3NRH A;  3ABM C;  2LIG A;  4YT2 A;  3RYL A;  1E84 A;  3EG9 A;  1OR3 A;  2J7P A;  1QVX A;  1SMY F;  3G4Z A;  3IHU A;  4K0D A;  3NYJ A;  2V26 A;  3S9O A;  3ZTM A;  5A6K A;  4YT5 A;  1VOM A;  2XXA B;  2W9Y A;  2R02 A;  3DI5 A;  4YL0 A;  1ST6 A;  1BR4 A;  2GAQ A;  4CJG A;  3HJC A;  3RQE A;  5DS6 A;  2R9R B;  3NG1 A;  2Y3H A;  4KNW A;  3RVZ A;  1NFN A;  1YA7 O;  2KC3 A;  2L6H A;  1Y6D A;  3K6B A;  1M6T A;  3B0V C;  4U5E E;  4A2N B;  2FAP B;  1AEP A;  2Q7R A;  3ZIB A;  1IZM A;  1LPE A;  2CYD A;  4GEH A;  5JRA A;  1CGN A;  5A6B D;  2OEX A;  2R03 A;  2GDC A;  1T6U A;  2CNW D;  5FZT A;  2HV7 A;  4G7Z F;  1K05 A;  3TQO A;  2J7P D;  2G3K A;  3S28 A;  1GS9 A;  2Y3B A;  1R5I D;  1YZA A;  2EPK X;  3V5Z A;  1HE9 A;  1LVK A;  3QZC A;  3U3B A;  2YRF A;  5EHH A;  4U5F E;  5DVW A;  5KYW A;  2IXM A;  4XEK A;  4Q7C A;  3DJN B;  2KQ9 A;  1A7D A;  1A7E A;  3K33 A;  4CIH A;  4KI2 A;  4U5C E;  2YL0 A;  1CPR A;  3EGD B;  3GM2 A;  4MVS A;  4XWJ A;  2UUI A;  4KC9 A;  4OIQ F;  2R7O A;  3EHM A;  1JOG A;  4I1M A;  2VCB A;  2XLD A;  4EBB A;  3HNJ A;  4UDV A;  1O87 A;  2ETS A;  4AL0 A;  5GPG B;  2AVK A;  4CDA A;  4E0H A;  4NTB A;  3Q7G A;  1SF8 A;  1H9T A;  1VTM P;  1RMV A;  2R7S A;  3TUL A;  1D1A A;  3RVY A;  2Y3D A;  5AGF A;  3UR3 C;  1QKR A;  4HFK B;  2IXN A;  3FDQ A;  4JTC B;  5HV9 A;  2NG1 A;  3HTK C;  3H65 A;  4RBN A;  4LDR A;  4LDQ A;  2R7V A;  3FHD A;  4HFF B;  4AK9 A;  3R7C A;  4C3B A;  5F28 E;  4W8P A;  3DJU B;  4DVY P;  3WAQ A;  1Q0F A;  1BR2 A;  4QDL A;  2ZXO A;  3Q7L A;  4U5B E;  4EUK B;  2EIL C;  3VF0 A;  4EKW A;  2Q4F A;  3HLZ A;  5JUA A;  5E3C A;  4XLN F;  1OXB A;  1ZVZ A;  1M56 C;  1NSG B;  2H7O A;  2VC9 A;  4IAQ A;  5JS5 A;  3JRM O;  4N4W A;  4I44 A;  4JJF A;  1VYI A;  1O5H A;  1YAR O;  2QNL A;  4MTO A;  4ULV A;  3SEO A;  1MMA A;  4JJG A;  3CAX A;  3KPH A;  4YWQ A;  1V55 C;  2WVO A;  3AGT A;  3M1C B;  4X0R A;  3KYI A;  3LS0 A;  4W8K A;  3JT1 A;  1WWP A;  3UNG C;  3JTL O;  4AE4 A;  3NKD A;  4JC7 A;  4QI2 A;  3RIP A;  1PCX A;  2PBE A;  1JAF A;  2TMV P;  2J9U A;  2WZF A;  4I3M A;  1JPN A;  3AG3 C;  4DOZ A;  3K1H A;  4JCH A;  1WOL A;  4MS2 A;  5DS4 A;  4C3E A;  1CPQ A;  1RCP A;  2YEV A;  4ER9 A;  4N6C A;  5JLI A;  3A9C A;  2EPN A;  3ZDL A;  3EZI A;  1YYX A;  4WAB A;  2QTV A;  2OCC C;  3JSZ A;  4OD5 A;  1QLE C;  3JCU Q;  4CJO A;  3KMI A;  1HW2 A;  4XTK A;  4NTF A;  1LIH A;  3DWW A;  1Y4C A;  3RQF A;  2KYH A;  2RSE B;  3C8G B;  3QW1 A;  4C7O A;  3V5Y A;  1OKK A;  2EPM X;  2OEV A;  2R7Q A;  2IXP A;  2P1A A;  2ZXP A;  2HV6 A;  2J0W A;  1CGO A;  3DM5 A;  1D0Y A;  1VLS A;  3SXZ A;  5T3T A;  3S27 A;  3GEH A;  1RKE A;  3C62 A;  2NUP B;  2VH3 A;  3US6 A;  4WGY A;  2G62 A;  1J8M F;  3EFO A;  1NZE A;  2JX0 A;  1KTM A;  3FOP A;  3Q6M A;  4BEJ A;  1NFO A;  4BJ5 A;  3M15 A;  3NMJ A;  2HFI A;  4QI0 A;  3AGU A;  4DXW A;  4G7H F;  2XL6 A;  3F47 A;  1V74 B;  5BUO A;  1WTY A;  1G5Z A;  2LP4 A;  3HKK A;  2J9V A;  4P6I C;  2WZL A;  4GQH A;  3DAF A;  1OW8 A;  1Q0M A;  5DQZ A;  4ZLC A;  1UFB A;  2GWW A;  3OWT A;  3U8P A;  2L6F A;  3W8I A;  2CCY A;  4JZA A;  5KYY A;  5BQI A;  5E2Q A;  1LE4 A;  3K7D A;  2P0N A;  3RKO F;  3QVY A;  2IBF A;  3LS1 A;  1YDI A;  2BE5 F;  1LI5 A;  4ONS A;  1EQ1 A;  3OA1 A;  4P9T A;  4H4K C;  3I5Q A;  3H2U A;  5TJ5 E;  5HSW A;  2MHR A;  2HZ8 A;  3TOM A;  3IQ6 A;  3SXK A;  1ZHX A;  2LSE A;  2VB6 A;  3NMK A;  1EKY A;  3U2M A;  1KU2 A;  1U6H A;  3I5P A;  3M79 A;  1ORY A;  4D4N A;  2B0J A;  2P7V A;  4YT8 A;  5AC5 A;  1YZC A;  1C02 A;  4IAO A;  4IB4 A;  5DQT A;  4U5H A;  1MQV A;  3O39 A;  2A69 F;  4PR9 A;  2VCA A;  1WAS A;  1ZYR F;  2O9X A;  2YZS A;  1AUE A;  3NDB B;  2OQM A;  3QVZ A;  2ZXW C;  1W2W A;  1VK5 A;  4BG0 A;  3OEO A;  1TKN A;  1BDJ B;  2ZXR A;  3C8Z A;  3EH2 A;  1YAU O;  3IQ5 A;  1FMW A;  4OIP F;  3MLG A;  1QZX A;  4MW8 A;  5CI8 A;  3TD7 A;  3B0P A;  1RKC A;  4M63 A;  3AG4 C;  4LDK A;  3UMH A;  2JPU A;  5JSL A;  4CS8 A;  2NUT B;  3LLK A;  2R7U A;  4MVQ A;  3UMI A;  3ZSU A;  3L34 A;  3N24 A;  2I8B A;  2A6H F;  3ATP A;  4N6H A;  5EGY A;  1OQC A;  3NYL A;  4U9D A;  2V3C C;  2WVQ A;  3CEX A;  5COF A;  3GWL A;  1TWG A;  1RJ9 B;  1HY5 A;  4CDY A;  4YT4 A;  5A69 A;  3M4C A;  1FAP B;  2EIM C;  1TWH A;  1M2O A;  1XZP A;  2YL3 A;  1Z63 A;  1MND A;  4FX5 A;  2DGJ A;  2Y39 A;  3WOD F;  3IPM O;  2L81 A;  1E85 A;  4CSA C;  3J06 A;  4NC3 A;  2A68 F;  1I4Y A;  2YLD A;  4GYT A;  4MVZ A;  4MVR A;  3EJN A;  4O6M A;  2H7V C;  3S84 A;  1XWJ A;  3IEE A;  3EGD A;  2D4U A;  5E3A A;  3QW0 A;  1QSP A;  2PX0 A;  1RJ9 A;  2HMZ A;  2HS5 A;  5CI9 A;  4E17 A;  1YJG A;  3UMK A;  2R7R A;  2NPU A;  3V5X A;  1L3P A;  3T6J A;  1B68 A;  5K0I A;  3BRJ A;  4HEA J;  1G4U S;  1T9K A;  3GEI A;  2ICW G;  3O10 A;  1Z7Q c;  3RFY A;  3RH3 A;  3V7O A;  2GFH A;  3ABK C;  3K1I C;  4JTD B;  2P61 A;  5D92 A;  1S05 A;  3VYW A;  1O3U A;  1Z5Z A;  4PFP A;  3DZA A;  4J30 B;  3MX3 A;  1ZHT A;  2R7T A;  3QTH A;  4IJJ A;  4K7B A;  3JSE O;  3LJB A;  2L6G A;  3C63 A;  2J9B A;  2HSQ A;  2Q9B A;  4MQ9 F;  4RD9 A;  3AOU A;  3NYM A;  2AWY A;  2YKZ A;  1XZQ A;  4O79 A;  4EBK A;  5IY5 C;  1JPJ A;  1T6I A;  2LK4 A;  1LM3 B;  3JYY A;  4IWB A;  4MND A;  4OIR F;  4Q4Z F;  3FAP B;  4FES A;  4ZLD A;  4CIP A;  1BZ4 A;  1ORS C;  1Q0D A;  3ZQY A;  4E18 A;  2EIN C;  3IQT A;  4NQF A;  3C18 A;  3Q6N A;  1PV3 A;  2W4B A;  2EPO A;  5KYX B;  3N2Z B; 
#chains in the Genus database with same CATH homology
 1L7C A;  1ZW2 A;  3TJ6 A;  1U6H A;  3ZDL A;  3VF0 A;  1ST6 A;  1U89 A;  5L0G A;  1ZVZ A;  2GWW A;  1DOV A;  4EHP A;  3T6G B;  4K1O A;  1T01 A;  5L0I A;  1H6G A;  2B0H A;  4PR9 A;  5L0J A;  2HSQ A;  1ZW3 A;  1DOW A;  5L0D A;  3S90 A;  2IBF A;  2GDC A;  2X0C A;  4IGG A;  5FZT A;  1YDI A;  4ONS A;  1RKE A;  4P9T A;  3RF3 A;  2L7A A;  5L0C A;  4DJ9 A;  1TR2 A;  1XWJ A;  1QKR A;  3H2U A;  4E18 A;  1RKC A;  1SYQ A;  3H2V A;  3TJ5 A;  4E17 A;  3MYI A;  2LQG A;  1RKE B;  4W8P A;  5L0H A;  5L0F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...