4E17A

Alpha-e-catenin is an autoinhibited molecule that co-activates vinculin
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
256
structure length
246
Chain Sequence
IQMPVFHTRTIESILEPVAQQISHLVIMHEEGEIPDLTAPVSAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVRAAQMLQADPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKGIEEALKNRNFTVEKMSAEINEIIRVLQLTSWD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational plasticity of alpha-catenin revealed by binding interactions with vinculin
rcsb
source organism Gallus gallus
molecule tags Cell adhesion
molecule keywords Vinculin
total genus 105
structure length 246
sequence length 256
ec nomenclature
pdb deposition date 2012-03-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 4e17A02
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 4e17A01
2IBFA 4ONSA 3VF0A 5L0HA 4EHPA 1H6GA 2GDCA 3ZDLA 1YDIA 1L7CA 1TR2A 1U89A 1RKCA 1QKRA 3TJ6A 2B0HA 1U6HA 3S90A 4DJ9A 1XWJA 1DOVA 1ZW2A 4PR9A 5FZTA 4E17A 5L0CA 1ZVZA 2X0CA 1T01A 4K1OA 1RKEA 1DOWA 1ZW3A 2L7AA 3T6GB 5L0JA 1SYQA 3H2VA 3TJ5A 5L0FA 2GWWA 4W8PA 2LQGA 5L0IA 4P9TA 2HSQA 3RF3A 1RKEB 3MYIA 5L0GA 3H2UA 5L0DA 4E18A 4IGGA 1ST6A
chains in the Genus database with same CATH superfamily
1JOGA 1BR1A 2R7RA 2WB7A 1I4YA 1QLEC 3UR3C 2CNWD 4EHPA 1ZZPA 2R7XA 1G8XA 2VCBA 2XXAA 3LS1A 1SF8A 1WOLA 4XLNF 2QLAA 5KYXA 2A6HF 2D4UA 3I5PA 1M2VA 1LIHA 2F22A 256BA 4PJJA 1EI7A 1VMAA 3U3FA 3UMKA 3JSEO 4JIOA 2ZPAA 3AG3C 3IQTA 4N6CA 3LAYA 2V3CC 4Q5SF 3S29A 4BJ5A 2WVOA 1H9GA 2M4EA 4MS2A 4XLPF 2LQGA 2J46A 1S05A 3LEVA 3GWNA 3G50A 4C3EA 3DM5A 4M63A 1NFOA 4YK5A 1BR2A 1C02A 2Q3TA 3EHMA 1M57C 4KBLA 4CJGA 1YLMA 1ZHZA 3CZ6A 3DMDA 3LNMB 4ONSA 5KYYA 4IARA 3W2VA 4XPWA 2P61A 4IJJA 4MTOA 3Q7GA 4CS8A 2J9BA 3DJNB 4LACB 1D0YA 1VK5A 1NBBA 5L3QA 4CDVA 3JSZA 2XRHA 1UG7A 3RW0A 4E17A 5L0CA 4ZLDA 3K33A 3ZTMA 2FFHA 2LP4A 2QTVA 1R5ID 2YLDA 1QVXA 3IQ6A 4JURI 4JKVA 3NDBB 1DOWA 2XM4A 2B0JA 1QSPA 4MNDA 3TD7A 3W4YA 4O7GA 1D1CA 2H7BA 2LK4A 2OEXA 5DQZA 5JS5A 2L81A 1T6UA 3WHNA 3GEIA 3TJ5A 4EBJA 2IYLD 3EGXB 2AVKA 4Z9HA 4MVOA 2QE9A 3GEEA 4JZAA 3MYFA 4NC3A 2DB4A 2A1DD 2KK1A 2Q9AA 2VC9A 2YHSA 3H2UA 3MYIA 4Z9JA 3GODA 5JT4A 4G0HA 1OW7A 4OINF 2LIGA 3EGDA 3VAYA 1N1CA 5E3AA 3IHUA 2C04A 3V5ZA 1E84A 4JCZA 1OCCC 4KNWA 2CNWA 3DI5A 1S7ZA 4U5CE 2EPNA 2B0HA 1UFBA 1MNEA 4G7ZF 4HFKB 2GAQA 3ZTZA 3L0IA 1J8MF 4BJ6C 1O5HA 5B3SC 5HSWA 3C7JA 3JCUQ 5D92A 5BQIA 1E86A 4Q7CA 4ULVA 4QI0A 3AG4C 2OJQA 4CDYA 1HY5A 2LFFA 4U5FE 5HV9A 3U0CA 5KYWB 4CSAA 5L0FA 1NU9C 2GWWA 3O10A 1E85A 4YL0A 4JCHA 2HJ3A 3T6BA 3GWLA 1Z5ZA 2CGEA 2P0NA 2MHRA 3ASNC 3GANA 5KYXB 3QVYA 1M2VB 1G4US 1OQCA 2J7PA 3O55A 2GDCA 3M79A 1NU7D 2W45A 5B1AC 1K04A 3DXJF 1JPJA 4IWBA 2JD3A 3SZRA 3TOLA 4MTFA 2A68F 2XLWA 1YJGA 2ZXPA 3RYLA 4BEJA 4YL3A 5COFA 4DJ9A 1LI5A 2L6FA 2P6VA 3W2WA 4P6IC 5AC4A 1CGME 5BQHA 1QQ3A 2EIMC 4C7OA 1RCPA 3M4CA 2R7VA 4G78A 4DRIB 4XTKA 4C3BA 2HKVA 4BJTA 2L6GA 2KSFA 4U9EA 4ANJA 1SZIA 2DYRC 1OKKD 2R25A 1T9KA 3E9VA 3NKEA 5AC5A 2V26A 1PCXA 5FCLA 3N2ZB 2YWAA 4ZLCA 1ZYRF 2AU5A 4P9TA 5DVWA 2NUTA 3RF3A 5JUAA 3HNJA 4CS9C 3C8GD 3OEOA 1I4ZA 2VB6A 4PJNA 5E33A 3EFOB 3S9OA 3AG1C 3G4XA 4RD9A 2I15A 3EZIA 3R7CA 3UNGC 4A4AA 4FAPB 1YVIA 1YDIA 4OD4A 1OR3A 1ORJA 1MMDA 5TJ5E 1YYXA 1TQGA 1T6IA 4JEBA 3S90A 1TWGA 4CX9A 1KNYA 5KYUB 5E3CA 3VM6A 2HZ8A 3W8IA 1O3UA 4LDKA 3FOPA 5A6BD 3EG9B 1LI7A 3M15A 2WVQA 2BL2A 5L3VA 3JRTA 1Z23A 3A11A 2XLVA 4KC9A 4PJMA 1ZU4A 4OIPF 2YL7A 4FWVA 2WL8A 4W8PA 2L6HA 4JJFA 4BEMJ 1G4WR 3ASOC 4LLEA 5B3IA 1EKYA 2XL4A 1RKEB 3DAGA 2HMZA 1JAFA 2WZGA 5COMA 4MVRA 1KTMA 4KNVA 4A2NB 2UUIA 4EIYA 3VF0A 2EPOA 1MQVA 2OEVA 1TFOB 1XZPA 3HLZA 3NMIA 5F5HA 4G7OF 1L7CA 1RKCA 2KW3C 3EFOA 2Q7RA 2KC3A 2NUPA 4WGZA 3TJ6A 4DBRA 2EIJC 4ULWA 4EWCA 3C8GB 3HJCA 4X0RA 5BQGA 2M64A 2LCHA 2QUPA 1OXKA 1SMYF 4I44A 1AUEA 1MNDA 2OKUA 1JR8A 2FGYA 4MVUA 3K1IA 3S84A 4DXWA 3J06A 3SEOA 2EPLX 4O6NA 4E0IA 1VLSA 4NTAA 2CCYA 2IXMA 5L0IA 2HSQA 2OQMA 3JYHA 1A0BA 2PNOA 1QPUA 3O6XA 4YWQA 3G4ZA 5T3TA 3S28A 5EGYA 1RJ9B 2IM8A 4CSAC 1FAPB 3AGTA 3RKOF 2PFDA 3NG1A 1CGNA 1U89A 1QKRA 3UGPA 1OCZC 4B6IA 4WGYA 3ZVRA 2WVNA 3AG2C 3U2LA 1I5NA 3C18A 5A6KA 1ZVZA 3HNIA 4WJ0A 3S0XA 4UDVA 2Q9CA 5DS6A 1Y6DA 2PX3A 1CGOA 3LLIA 4H4KC 1U0BB 1ZHTA 2D5RB 3DWWA 2H7VC 4J7TA 4MW8A 1V74B 3TOMA 3SYNA 4N6HA 2C03A 4U5GA 1AEPA 2XL8A 3H2VA 5JSLA 5DS5A 4IAQA 3B71A 5CIVA 2OJED 3LLKA 4K7BA 2QNLA 5DLJA 3UMHA 3CAXA 1WTYA 2HSBA 3RIPA 3T4RA 1Q0GA 1ORYA 2Z15A 3K1IC 2YZSA 2NSGA 2ASRA 3N24A 3MBGA 4MVZA 3W8HA 2AWYA 2VCAA 2BE5F 1U6HA 1LS4A 2TMVP 4BG0A 2LD6A 1HW1A 1LKXA 1DOVA 1ZW2A 3Q7LA 1H7IA 4E7ZA 3POVA 4H54A 2R7UA 1G5ZA 5CI9A 4DVZA 1EQ1A 1T6QA 2H8AA 3NRHA 2G3KA 2A0BA 3R2PA 3E70C 4N4WA 4Z9IA 3T6GB 4EBBA 1XZQA 3M4BA 4PJLA 1M2OA 3NMKA 3S27A 3JTLO 4J7YA 4ER9A 3NKDA 3T6JA 4BJ6A 1PV3A 2HV7A 3ECSA 3PDMP 3Q6MA 5COGA 5T1DB 3TQOA 5KYUA 2P7VA 2DYSC 3C8GA 2KNHA 3HKKA 3NYJA 4BJ5C 5L0HA 2ETSA 4OD5A 3TK0A 4CBEA 2ZXRA 4I1MA 1Q0MA 1ZHYA 3PMRA 3EQLF 4DOZA 1PD1A 1Z6AA 4HFFB 2PP4A 3OWTA 3L8JA 4I3MA 4JEAA 3IQCA 2Y3HA 1HE1A 5A6BA 3EZHA 3HNKA 3NMJA 1FMWA 2IXOA 3FXHA 4D4NA 2GA0A 2YEVA 4OIOF 1HE9A 2DGJA 5DS4A 2BC5A 2A6EF 2CW0F 2J9WA 3MLGA 3OA1A 3I4UA 4E0HA 4IRUA 2J7PD 3ZWIA 4CS9A 3JT1A 2IXPA 3C63A 4GEHA 2A69F 4QDLA 1NZEA 5F28E 4OIRF 3QZCA 1D0ZA 3IPMO 4U5DE 2NG1A 3LNRA 2WZLA 4JRZA 2LSEA 4MTGA 4L6RA 1IZMA 4JE9A 3AGUA 4BPMA 3PHF2 4C3DA 5B1BC 4RDAA 4JVSA 1WATA 1QZXA 4WABA 1OXBA 2JX0A 2MYSA 3MX3A 3SXZA 4YN0B 4E7SA 4XEKA 3KH2A 4HEAJ 1D1AA 3VRCA 1GQAA 3EH1A 2YL1A 3JRMO 3JYYA 1LPEA 3U5SA 3Q6NA 4K1OA 1ZHXA 2EINC 2YL3A 3ZSUA 1YAUO 3C8ZA 4J30B 1LE4A 2XLEA 1M56C 2AWCA 4GYTA 3GM2A 4CJOA 1GM5A 2XLOA 3RH3A 3UMIA 4HE8D 2KYHA 2O9XA 3CSKA 2J45A 3RQEA 4F4BA 3B0VC 2PBEA 2XS1A 1M6TA 1BDJB 4PACA 3BEHA 2G62A 4YT8A 4K0DA 2Y3DA 4XWJA 4CS8C 3L34A 4XPXA 2KQ9A 3KKBA 3RQGA 1TR2A 2A0UA 4W8KA 3RQFA 3DE8A 1B68A 3K1HA 2HFIA 3EHNA 4NQFA 3GEHA 1HMOA 4IAOA 4XEVA 5E2QA 1VOMA 4PR9A 3SXKA 5A6AA 3WG7C 5D91A 3GM1A 5A69A 3TULA 4YL1A 2ICWG 4U5HA 3EGXA 2RD9A 1T01A 1Z7Qc 3VYWA 3AQBA 4AK9A 5BUOA 3ABLC 3NYMA 4LDQA 3ZG1A 4CIPA 4NTFA 3FMSA 3LS0A 4C7OB 1ZHWA 1JMWA 4CIHA 2QY9A 2Y39A 1BBHA 1VLTA 1A7DA 2Y3BA 3GM3A 2H7OA 3X2QC 3C62A 4EKWA 2KGOA 4AL1A 2OU6A 3HTKC 4BJ1A 1D1BA 2J0WA 3F47A 4DRJB 4JTAB 3B29A 1NSGB 3V7OA 4YT2A 2Q00A 2NUTB 3KPHA 1BR4A 1VTMP 4JJGA 4AE4A 4OIQF 1APCA 2Q4FA 3FHDA 3RVYA 4YT4A 5A6JA 2OCCC 3DAFA 1E83A 1YZAA 4GQHA 2XXAB 1YYJA 1FTSA 1W2WA 3DM9B 3PCVA 2XLHA 3U8VA 3IQ5A 1CPQA 3QW0A 3SXYA 5KYWA 4FX5A 2L7AA 3BRJA 4DVYP 2R7OA 3FDQA 3ZC4A 3DKAA 2YL0A 1MMNA 1SYQA 1NLXA 3RVZA 3UGOA 3LESA 3EG9A 2J9UA 1RXQA 2W9YA 2YLGA 4MVMA 4EBKA 2IOQA 3ZQVA 4D4XA 1A41A 2P1AA 4J32B 3B0UX 2R7TA 1CPRA 4NTBA 1ST6A 2HJMA 3N0TA 4YJWA 3ABMC 4JC7A 1H6GA 2EIKC 4CDAA 2CDQA 4O6MA 1T5OA 1R4TA 2YKZA 1GGQA 3QVZA 1FFTC 1GS9A 2OG2A 2R7QA 1OW8A 1YA9A 2X51A 1AVOB 2ZD9A 4NCQA 2R9RB 2XM0A 3DD7A 4PFOA 1XWJA 2ZXOA 2R7WA 1D0XA 2AP3A 3ZIBA 3SNHA 4AX2A 1WN0A 3B9QA 3A9CA 2NSFA 3ATPA 2XSEA 5CI8A 2X0CA 4N06A 1ZW3A 1MMAA 1OR2A 3L1MA 2MWQA 1L3PA 4FESA 3US6A 3ITFA 2IXNA 1WGWA 2ZXWC 4R32A 1TWAA 4JW1A 2R02A 3CEXA 2R05A 4E18A 2W4MA 2IBFA 3FAJA 1KU2A 1WWPA 4XEFA 1MMGA 2HS5A 2HUJA 4MVSA 1PD0A 1YA7O 2EPKX 2XLMA 1RJ9A 1VYKA 5KYYB 4Q4ZF 3EH2A 1NG1A 1FFHA 2WZFA 1SR2A 2J9VA 5FZTA 3U2MA 5EHHA 2PF4E 2YLIA 5T3WA 1Q0DA 1A7EA 3L8IA 3SXMA 3U8PA 3T9OA 5JLIA 5KYNA 1LM3B 2CYDA 1JPNA 2Y69C 3EJNA 4P9FA 4U5BE 1OKKA 3IEEA 1IW7F 3LJBA 5L0JA 1ZU5A 4KI2A 3X1OA 2PX0A 5DQTA 4U9DA 1J8YF 1NFNA 1VYIA 1TFKB 3V5YA 3ZQYA 4AE4B 1OW6A 3AOUA 3JZ0A 5EK0A 1Y4CA 1FMVA 3ABKC 1TWCA 2NPUA 2JPUA 5L0GA 2NUPB 1Z63A 1ORSC 2LFDA 2HV6A 4O79A 1RMVA 3EPVA 3QTHA 3V5XA 1V4AA 4LERA 1FNTc 4IB4A 1V55C 3CQZA 1Q0KA 2EILC 2RSEB 5JVEA 3FOOA 2G3VA 4MVQA 3KYJA 4XQ1A 3EGDB 5AGFA 3HNLA 3U3BA 3DE9A 3RFYA 2R7SA 3O39A 1F1MA 3WAQA 3MFNA 3QMKA 1E2XA 1RKEA 2YVKA 1O87A 3K66A 3KYIA 2XL6A 3U9MA 4PK4A 4EUKB 3KMIA 1K05A 1TWHA 3GORA 1HMDA 2VCCA 3DJUB 4DRHB 2XLDA 5F5FA 3QW1A 2EPMX 2YQYA 1LE2A 2J0XA 3AJMA 1LS1A 2J8WA 4U5EE 1TKNA 1WASA 3K6BA 1V54C 4RBNA 1YZCA 1Z3IX 5JRAA 2OOCA 4LDRA 4DBQA 4PFPA 1EA8A 1FR0A 2Q9BA 3I5QA 3FAPB 4IGGA 5IY5C 4CS7A 3K7DA 4NY3A 3SP1A 2YRFA 3U9JA 3AQCA 3ZDLA 1C03A 4XPYA 4LLCA 3LEOA 2UUHA 1OCRC 1JRAA 5K0IA 2GFHA 1K40A 1VB5A 4QI2A 4JTCB 2DI3A 3H65A 1C17M 1OCOC 2VH3A 5JP7A 3B0PA 4JTDB 4YT5A 1LVKA 1HW2A 3WODF 4MQ9F 2Y3GA 1Q0FA 2I8BA 4MW3A 4O6YA 1A7VA 4G7HF 3NYLA 1YARO 2KJGA 2R03A 3FVYA 2XS8A 1H9TA 2L9JA 3LUTB 3M1CB 1BZ4A 2W4BA 5L0DA 4AL0A 3DZAA 2HMQA 2FAPB 3F46A 5GPGB 4I1OB 2E87A 2VASA 3KL4A
chains in the Genus database with same CATH topology
2IBFA 4ONSA 3VF0A 5L0HA 4EHPA 1H6GA 2GDCA 3ZDLA 1YDIA 1L7CA 1TR2A 1U89A 1RKCA 1QKRA 3TJ6A 2B0HA 1U6HA 3S90A 4DJ9A 1XWJA 1DOVA 1ZW2A 4PR9A 5FZTA 4E17A 5L0CA 1ZVZA 2X0CA 1T01A 4K1OA 1RKEA 1DOWA 1ZW3A 2L7AA 3T6GB 5L0JA 1SYQA 3H2VA 3TJ5A 5L0FA 2GWWA 4W8PA 2LQGA 5L0IA 4P9TA 2HSQA 3RF3A 1RKEB 3MYIA 5L0GA 3H2UA 5L0DA 4E18A 4IGGA 1ST6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IBF A;  4ONS A;  3VF0 A;  5L0H A;  4EHP A;  1H6G A;  2GDC A;  3ZDL A;  1YDI A;  1L7C A;  1TR2 A;  1U89 A;  1RKC A;  1QKR A;  3TJ6 A;  2B0H A;  1U6H A;  3S90 A;  4DJ9 A;  1XWJ A;  1DOV A;  1ZW2 A;  4PR9 A;  5FZT A;  4E17 A;  5L0C A;  1ZVZ A;  2X0C A;  1T01 A;  4K1O A;  1RKE A;  1DOW A;  1ZW3 A;  2L7A A;  3T6G B;  5L0J A;  1SYQ A;  3H2V A;  3TJ5 A;  5L0F A;  2GWW A;  4W8P A;  2LQG A;  5L0I A;  4P9T A;  2HSQ A;  3RF3 A;  1RKE B;  3MYI A;  5L0G A;  3H2U A;  5L0D A;  4E18 A;  4IGG A;  1ST6 A; 
#chains in the Genus database with same CATH topology
 1JOG A;  1BR1 A;  2R7R A;  2WB7 A;  1I4Y A;  1QLE C;  3UR3 C;  2CNW D;  4EHP A;  1ZZP A;  2R7X A;  1G8X A;  2VCB A;  2XXA A;  3LS1 A;  1SF8 A;  1WOL A;  4XLN F;  2QLA A;  5KYX A;  2A6H F;  2D4U A;  3I5P A;  1M2V A;  1LIH A;  2F22 A;  256B A;  4PJJ A;  1EI7 A;  1VMA A;  3U3F A;  3UMK A;  3JSE O;  4JIO A;  2ZPA A;  3AG3 C;  3IQT A;  4N6C A;  3LAY A;  2V3C C;  4Q5S F;  3S29 A;  4BJ5 A;  2WVO A;  1H9G A;  2M4E A;  4MS2 A;  4XLP F;  2LQG A;  2J46 A;  1S05 A;  3LEV A;  3GWN A;  3G50 A;  4C3E A;  3DM5 A;  4M63 A;  1NFO A;  4YK5 A;  1BR2 A;  1C02 A;  2Q3T A;  3EHM A;  1M57 C;  4KBL A;  4CJG A;  1YLM A;  1ZHZ A;  3CZ6 A;  3DMD A;  3LNM B;  4ONS A;  5KYY A;  4IAR A;  3W2V A;  4XPW A;  2P61 A;  4IJJ A;  4MTO A;  3Q7G A;  4CS8 A;  2J9B A;  3DJN B;  4LAC B;  1D0Y A;  1VK5 A;  1NBB A;  5L3Q A;  4CDV A;  3JSZ A;  2XRH A;  1UG7 A;  3RW0 A;  4E17 A;  5L0C A;  4ZLD A;  3K33 A;  3ZTM A;  2FFH A;  2LP4 A;  2QTV A;  1R5I D;  2YLD A;  1QVX A;  3IQ6 A;  4JUR I;  4JKV A;  3NDB B;  1DOW A;  2XM4 A;  2B0J A;  1QSP A;  4MND A;  3TD7 A;  3W4Y A;  4O7G A;  1D1C A;  2H7B A;  2LK4 A;  2OEX A;  5DQZ A;  5JS5 A;  2L81 A;  1T6U A;  3WHN A;  3GEI A;  3TJ5 A;  4EBJ A;  2IYL D;  3EGX B;  2AVK A;  4Z9H A;  4MVO A;  2QE9 A;  3GEE A;  4JZA A;  3MYF A;  4NC3 A;  2DB4 A;  2A1D D;  2KK1 A;  2Q9A A;  2VC9 A;  2YHS A;  3H2U A;  3MYI A;  4Z9J A;  3GOD A;  5JT4 A;  4G0H A;  1OW7 A;  4OIN F;  2LIG A;  3EGD A;  3VAY A;  1N1C A;  5E3A A;  3IHU A;  2C04 A;  3V5Z A;  1E84 A;  4JCZ A;  1OCC C;  4KNW A;  2CNW A;  3DI5 A;  1S7Z A;  4U5C E;  2EPN A;  2B0H A;  1UFB A;  1MNE A;  4G7Z F;  4HFK B;  2GAQ A;  3ZTZ A;  3L0I A;  1J8M F;  4BJ6 C;  1O5H A;  5B3S C;  5HSW A;  3C7J A;  3JCU Q;  5D92 A;  5BQI A;  1E86 A;  4Q7C A;  4ULV A;  4QI0 A;  3AG4 C;  2OJQ A;  4CDY A;  1HY5 A;  2LFF A;  4U5F E;  5HV9 A;  3U0C A;  5KYW B;  4CSA A;  5L0F A;  1NU9 C;  2GWW A;  3O10 A;  1E85 A;  4YL0 A;  4JCH A;  2HJ3 A;  3T6B A;  3GWL A;  1Z5Z A;  2CGE A;  2P0N A;  2MHR A;  3ASN C;  3GAN A;  5KYX B;  3QVY A;  1M2V B;  1G4U S;  1OQC A;  2J7P A;  3O55 A;  2GDC A;  3M79 A;  1NU7 D;  2W45 A;  5B1A C;  1K04 A;  3DXJ F;  1JPJ A;  4IWB A;  2JD3 A;  3SZR A;  3TOL A;  4MTF A;  2A68 F;  2XLW A;  1YJG A;  2ZXP A;  3RYL A;  4BEJ A;  4YL3 A;  5COF A;  4DJ9 A;  1LI5 A;  2L6F A;  2P6V A;  3W2W A;  4P6I C;  5AC4 A;  1CGM E;  5BQH A;  1QQ3 A;  2EIM C;  4C7O A;  1RCP A;  3M4C A;  2R7V A;  4G78 A;  4DRI B;  4XTK A;  4C3B A;  2HKV A;  4BJT A;  2L6G A;  2KSF A;  4U9E A;  4ANJ A;  1SZI A;  2DYR C;  1OKK D;  2R25 A;  1T9K A;  3E9V A;  3NKE A;  5AC5 A;  2V26 A;  1PCX A;  5FCL A;  3N2Z B;  2YWA A;  4ZLC A;  1ZYR F;  2AU5 A;  4P9T A;  5DVW A;  2NUT A;  3RF3 A;  5JUA A;  3HNJ A;  4CS9 C;  3C8G D;  3OEO A;  1I4Z A;  2VB6 A;  4PJN A;  5E33 A;  3EFO B;  3S9O A;  3AG1 C;  3G4X A;  4RD9 A;  2I15 A;  3EZI A;  3R7C A;  3UNG C;  4A4A A;  4FAP B;  1YVI A;  1YDI A;  4OD4 A;  1OR3 A;  1ORJ A;  1MMD A;  5TJ5 E;  1YYX A;  1TQG A;  1T6I A;  4JEB A;  3S90 A;  1TWG A;  4CX9 A;  1KNY A;  5KYU B;  5E3C A;  3VM6 A;  2HZ8 A;  3W8I A;  1O3U A;  4LDK A;  3FOP A;  5A6B D;  3EG9 B;  1LI7 A;  3M15 A;  2WVQ A;  2BL2 A;  5L3V A;  3JRT A;  1Z23 A;  3A11 A;  2XLV A;  4KC9 A;  4PJM A;  1ZU4 A;  4OIP F;  2YL7 A;  4FWV A;  2WL8 A;  4W8P A;  2L6H A;  4JJF A;  4BEM J;  1G4W R;  3ASO C;  4LLE A;  5B3I A;  1EKY A;  2XL4 A;  1RKE B;  3DAG A;  2HMZ A;  1JAF A;  2WZG A;  5COM A;  4MVR A;  1KTM A;  4KNV A;  4A2N B;  2UUI A;  4EIY A;  3VF0 A;  2EPO A;  1MQV A;  2OEV A;  1TFO B;  1XZP A;  3HLZ A;  3NMI A;  5F5H A;  4G7O F;  1L7C A;  1RKC A;  2KW3 C;  3EFO A;  2Q7R A;  2KC3 A;  2NUP A;  4WGZ A;  3TJ6 A;  4DBR A;  2EIJ C;  4ULW A;  4EWC A;  3C8G B;  3HJC A;  4X0R A;  5BQG A;  2M64 A;  2LCH A;  2QUP A;  1OXK A;  1SMY F;  4I44 A;  1AUE A;  1MND A;  2OKU A;  1JR8 A;  2FGY A;  4MVU A;  3K1I A;  3S84 A;  4DXW A;  3J06 A;  3SEO A;  2EPL X;  4O6N A;  4E0I A;  1VLS A;  4NTA A;  2CCY A;  2IXM A;  5L0I A;  2HSQ A;  2OQM A;  3JYH A;  1A0B A;  2PNO A;  1QPU A;  3O6X A;  4YWQ A;  3G4Z A;  5T3T A;  3S28 A;  5EGY A;  1RJ9 B;  2IM8 A;  4CSA C;  1FAP B;  3AGT A;  3RKO F;  2PFD A;  3NG1 A;  1CGN A;  1U89 A;  1QKR A;  3UGP A;  1OCZ C;  4B6I A;  4WGY A;  3ZVR A;  2WVN A;  3AG2 C;  3U2L A;  1I5N A;  3C18 A;  5A6K A;  1ZVZ A;  3HNI A;  4WJ0 A;  3S0X A;  4UDV A;  2Q9C A;  5DS6 A;  1Y6D A;  2PX3 A;  1CGO A;  3LLI A;  4H4K C;  1U0B B;  1ZHT A;  2D5R B;  3DWW A;  2H7V C;  4J7T A;  4MW8 A;  1V74 B;  3TOM A;  3SYN A;  4N6H A;  2C03 A;  4U5G A;  1AEP A;  2XL8 A;  3H2V A;  5JSL A;  5DS5 A;  4IAQ A;  3B71 A;  5CIV A;  2OJE D;  3LLK A;  4K7B A;  2QNL A;  5DLJ A;  3UMH A;  3CAX A;  1WTY A;  2HSB A;  3RIP A;  3T4R A;  1Q0G A;  1ORY A;  2Z15 A;  3K1I C;  2YZS A;  2NSG A;  2ASR A;  3N24 A;  3MBG A;  4MVZ A;  3W8H A;  2AWY A;  2VCA A;  2BE5 F;  1U6H A;  1LS4 A;  2TMV P;  4BG0 A;  2LD6 A;  1HW1 A;  1LKX A;  1DOV A;  1ZW2 A;  3Q7L A;  1H7I A;  4E7Z A;  3POV A;  4H54 A;  2R7U A;  1G5Z A;  5CI9 A;  4DVZ A;  1EQ1 A;  1T6Q A;  2H8A A;  3NRH A;  2G3K A;  2A0B A;  3R2P A;  3E70 C;  4N4W A;  4Z9I A;  3T6G B;  4EBB A;  1XZQ A;  3M4B A;  4PJL A;  1M2O A;  3NMK A;  3S27 A;  3JTL O;  4J7Y A;  4ER9 A;  3NKD A;  3T6J A;  4BJ6 A;  1PV3 A;  2HV7 A;  3ECS A;  3PDM P;  3Q6M A;  5COG A;  5T1D B;  3TQO A;  5KYU A;  2P7V A;  2DYS C;  3C8G A;  2KNH A;  3HKK A;  3NYJ A;  4BJ5 C;  5L0H A;  2ETS A;  4OD5 A;  3TK0 A;  4CBE A;  2ZXR A;  4I1M A;  1Q0M A;  1ZHY A;  3PMR A;  3EQL F;  4DOZ A;  1PD1 A;  1Z6A A;  4HFF B;  2PP4 A;  3OWT A;  3L8J A;  4I3M A;  4JEA A;  3IQC A;  2Y3H A;  1HE1 A;  5A6B A;  3EZH A;  3HNK A;  3NMJ A;  1FMW A;  2IXO A;  3FXH A;  4D4N A;  2GA0 A;  2YEV A;  4OIO F;  1HE9 A;  2DGJ A;  5DS4 A;  2BC5 A;  2A6E F;  2CW0 F;  2J9W A;  3MLG A;  3OA1 A;  3I4U A;  4E0H A;  4IRU A;  2J7P D;  3ZWI A;  4CS9 A;  3JT1 A;  2IXP A;  3C63 A;  4GEH A;  2A69 F;  4QDL A;  1NZE A;  5F28 E;  4OIR F;  3QZC A;  1D0Z A;  3IPM O;  4U5D E;  2NG1 A;  3LNR A;  2WZL A;  4JRZ A;  2LSE A;  4MTG A;  4L6R A;  1IZM A;  4JE9 A;  3AGU A;  4BPM A;  3PHF 2;  4C3D A;  5B1B C;  4RDA A;  4JVS A;  1WAT A;  1QZX A;  4WAB A;  1OXB A;  2JX0 A;  2MYS A;  3MX3 A;  3SXZ A;  4YN0 B;  4E7S A;  4XEK A;  3KH2 A;  4HEA J;  1D1A A;  3VRC A;  1GQA A;  3EH1 A;  2YL1 A;  3JRM O;  3JYY A;  1LPE A;  3U5S A;  3Q6N A;  4K1O A;  1ZHX A;  2EIN C;  2YL3 A;  3ZSU A;  1YAU O;  3C8Z A;  4J30 B;  1LE4 A;  2XLE A;  1M56 C;  2AWC A;  4GYT A;  3GM2 A;  4CJO A;  1GM5 A;  2XLO A;  3RH3 A;  3UMI A;  4HE8 D;  2KYH A;  2O9X A;  3CSK A;  2J45 A;  3RQE A;  4F4B A;  3B0V C;  2PBE A;  2XS1 A;  1M6T A;  1BDJ B;  4PAC A;  3BEH A;  2G62 A;  4YT8 A;  4K0D A;  2Y3D A;  4XWJ A;  4CS8 C;  3L34 A;  4XPX A;  2KQ9 A;  3KKB A;  3RQG A;  1TR2 A;  2A0U A;  4W8K A;  3RQF A;  3DE8 A;  1B68 A;  3K1H A;  2HFI A;  3EHN A;  4NQF A;  3GEH A;  1HMO A;  4IAO A;  4XEV A;  5E2Q A;  1VOM A;  4PR9 A;  3SXK A;  5A6A A;  3WG7 C;  5D91 A;  3GM1 A;  5A69 A;  3TUL A;  4YL1 A;  2ICW G;  4U5H A;  3EGX A;  2RD9 A;  1T01 A;  1Z7Q c;  3VYW A;  3AQB A;  4AK9 A;  5BUO A;  3ABL C;  3NYM A;  4LDQ A;  3ZG1 A;  4CIP A;  4NTF A;  3FMS A;  3LS0 A;  4C7O B;  1ZHW A;  1JMW A;  4CIH A;  2QY9 A;  2Y39 A;  1BBH A;  1VLT A;  1A7D A;  2Y3B A;  3GM3 A;  2H7O A;  3X2Q C;  3C62 A;  4EKW A;  2KGO A;  4AL1 A;  2OU6 A;  3HTK C;  4BJ1 A;  1D1B A;  2J0W A;  3F47 A;  4DRJ B;  4JTA B;  3B29 A;  1NSG B;  3V7O A;  4YT2 A;  2Q00 A;  2NUT B;  3KPH A;  1BR4 A;  1VTM P;  4JJG A;  4AE4 A;  4OIQ F;  1APC A;  2Q4F A;  3FHD A;  3RVY A;  4YT4 A;  5A6J A;  2OCC C;  3DAF A;  1E83 A;  1YZA A;  4GQH A;  2XXA B;  1YYJ A;  1FTS A;  1W2W A;  3DM9 B;  3PCV A;  2XLH A;  3U8V A;  3IQ5 A;  1CPQ A;  3QW0 A;  3SXY A;  5KYW A;  4FX5 A;  2L7A A;  3BRJ A;  4DVY P;  2R7O A;  3FDQ A;  3ZC4 A;  3DKA A;  2YL0 A;  1MMN A;  1SYQ A;  1NLX A;  3RVZ A;  3UGO A;  3LES A;  3EG9 A;  2J9U A;  1RXQ A;  2W9Y A;  2YLG A;  4MVM A;  4EBK A;  2IOQ A;  3ZQV A;  4D4X A;  1A41 A;  2P1A A;  4J32 B;  3B0U X;  2R7T A;  1CPR A;  4NTB A;  1ST6 A;  2HJM A;  3N0T A;  4YJW A;  3ABM C;  4JC7 A;  1H6G A;  2EIK C;  4CDA A;  2CDQ A;  4O6M A;  1T5O A;  1R4T A;  2YKZ A;  1GGQ A;  3QVZ A;  1FFT C;  1GS9 A;  2OG2 A;  2R7Q A;  1OW8 A;  1YA9 A;  2X51 A;  1AVO B;  2ZD9 A;  4NCQ A;  2R9R B;  2XM0 A;  3DD7 A;  4PFO A;  1XWJ A;  2ZXO A;  2R7W A;  1D0X A;  2AP3 A;  3ZIB A;  3SNH A;  4AX2 A;  1WN0 A;  3B9Q A;  3A9C A;  2NSF A;  3ATP A;  2XSE A;  5CI8 A;  2X0C A;  4N06 A;  1ZW3 A;  1MMA A;  1OR2 A;  3L1M A;  2MWQ A;  1L3P A;  4FES A;  3US6 A;  3ITF A;  2IXN A;  1WGW A;  2ZXW C;  4R32 A;  1TWA A;  4JW1 A;  2R02 A;  3CEX A;  2R05 A;  4E18 A;  2W4M A;  2IBF A;  3FAJ A;  1KU2 A;  1WWP A;  4XEF A;  1MMG A;  2HS5 A;  2HUJ A;  4MVS A;  1PD0 A;  1YA7 O;  2EPK X;  2XLM A;  1RJ9 A;  1VYK A;  5KYY B;  4Q4Z F;  3EH2 A;  1NG1 A;  1FFH A;  2WZF A;  1SR2 A;  2J9V A;  5FZT A;  3U2M A;  5EHH A;  2PF4 E;  2YLI A;  5T3W A;  1Q0D A;  1A7E A;  3L8I A;  3SXM A;  3U8P A;  3T9O A;  5JLI A;  5KYN A;  1LM3 B;  2CYD A;  1JPN A;  2Y69 C;  3EJN A;  4P9F A;  4U5B E;  1OKK A;  3IEE A;  1IW7 F;  3LJB A;  5L0J A;  1ZU5 A;  4KI2 A;  3X1O A;  2PX0 A;  5DQT A;  4U9D A;  1J8Y F;  1NFN A;  1VYI A;  1TFK B;  3V5Y A;  3ZQY A;  4AE4 B;  1OW6 A;  3AOU A;  3JZ0 A;  5EK0 A;  1Y4C A;  1FMV A;  3ABK C;  1TWC A;  2NPU A;  2JPU A;  5L0G A;  2NUP B;  1Z63 A;  1ORS C;  2LFD A;  2HV6 A;  4O79 A;  1RMV A;  3EPV A;  3QTH A;  3V5X A;  1V4A A;  4LER A;  1FNT c;  4IB4 A;  1V55 C;  3CQZ A;  1Q0K A;  2EIL C;  2RSE B;  5JVE A;  3FOO A;  2G3V A;  4MVQ A;  3KYJ A;  4XQ1 A;  3EGD B;  5AGF A;  3HNL A;  3U3B A;  3DE9 A;  3RFY A;  2R7S A;  3O39 A;  1F1M A;  3WAQ A;  3MFN A;  3QMK A;  1E2X A;  1RKE A;  2YVK A;  1O87 A;  3K66 A;  3KYI A;  2XL6 A;  3U9M A;  4PK4 A;  4EUK B;  3KMI A;  1K05 A;  1TWH A;  3GOR A;  1HMD A;  2VCC A;  3DJU B;  4DRH B;  2XLD A;  5F5F A;  3QW1 A;  2EPM X;  2YQY A;  1LE2 A;  2J0X A;  3AJM A;  1LS1 A;  2J8W A;  4U5E E;  1TKN A;  1WAS A;  3K6B A;  1V54 C;  4RBN A;  1YZC A;  1Z3I X;  5JRA A;  2OOC A;  4LDR A;  4DBQ A;  4PFP A;  1EA8 A;  1FR0 A;  2Q9B A;  3I5Q A;  3FAP B;  4IGG A;  5IY5 C;  4CS7 A;  3K7D A;  4NY3 A;  3SP1 A;  2YRF A;  3U9J A;  3AQC A;  3ZDL A;  1C03 A;  4XPY A;  4LLC A;  3LEO A;  2UUH A;  1OCR C;  1JRA A;  5K0I A;  2GFH A;  1K40 A;  1VB5 A;  4QI2 A;  4JTC B;  2DI3 A;  3H65 A;  1C17 M;  1OCO C;  2VH3 A;  5JP7 A;  3B0P A;  4JTD B;  4YT5 A;  1LVK A;  1HW2 A;  3WOD F;  4MQ9 F;  2Y3G A;  1Q0F A;  2I8B A;  4MW3 A;  4O6Y A;  1A7V A;  4G7H F;  3NYL A;  1YAR O;  2KJG A;  2R03 A;  3FVY A;  2XS8 A;  1H9T A;  2L9J A;  3LUT B;  3M1C B;  1BZ4 A;  2W4B A;  5L0D A;  4AL0 A;  3DZA A;  2HMQ A;  2FAP B;  3F46 A;  5GPG B;  4I1O B;  2E87 A;  2VAS A;  3KL4 A; 
#chains in the Genus database with same CATH homology
 2IBF A;  4ONS A;  3VF0 A;  5L0H A;  4EHP A;  1H6G A;  2GDC A;  3ZDL A;  1YDI A;  1L7C A;  1TR2 A;  1U89 A;  1RKC A;  1QKR A;  3TJ6 A;  2B0H A;  1U6H A;  3S90 A;  4DJ9 A;  1XWJ A;  1DOV A;  1ZW2 A;  4PR9 A;  5FZT A;  4E17 A;  5L0C A;  1ZVZ A;  2X0C A;  1T01 A;  4K1O A;  1RKE A;  1DOW A;  1ZW3 A;  2L7A A;  3T6G B;  5L0J A;  1SYQ A;  3H2V A;  3TJ5 A;  5L0F A;  2GWW A;  4W8P A;  2LQG A;  5L0I A;  4P9T A;  2HSQ A;  3RF3 A;  1RKE B;  3MYI A;  5L0G A;  3H2U A;  5L0D A;  4E18 A;  4IGG A;  1ST6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...