4E17A

Alpha-e-catenin is an autoinhibited molecule that co-activates vinculin
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
256
structure length
246
Chain Sequence
IQMPVFHTRTIESILEPVAQQISHLVIMHEEGEIPDLTAPVSAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVRAAQMLQADPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKGIEEALKNRNFTVEKMSAEINEIIRVLQLTSWD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vinculin
publication title Conformational plasticity of alpha-catenin revealed by binding interactions with vinculin
rcsb
source organism Gallus gallus
molecule tags Cell adhesion
total genus 105
structure length 246
sequence length 256
ec nomenclature
pdb deposition date 2012-03-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 4e17A02
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 4e17A01
2B0HA 1U89A 4P9TA 5L0CA 1U6HA 2L7AA 1SYQA 1XWJA 3H2VA 4E18A 4IGGA 5FZTA 1T01A 5L0JA 4W8PA 4EHPA 3H2UA 1L7CA 4E17A 5L0DA 3MYIA 5L0IA 3RF3A 2GDCA 1TR2A 1DOVA 3ZDLA 1ZW3A 1ZVZA 3T6GB 5L0GA 2IBFA 4K1OA 3TJ6A 1DOWA 2GWWA 4PR9A 1RKEB 4DJ9A 2LQGA 5L0HA 1RKEA 5L0FA 4ONSA 1ST6A 2X0CA 3TJ5A 3VF0A 1RKCA 1QKRA 3S90A 2HSQA 1ZW2A 1H6GA 1YDIA
chains in the Genus database with same CATH superfamily
4P6IC 1BR1A 3FAPB 3GODA 2LSEA 4O6MA 2DYSC 2DB4A 3NMKA 4HEAJ 1Q0KA 2LIGA 4HFKB 3Q7LA 4JJGA 5IY5C 1BR4A 1LS4A 2YRFA 3NG1A 4IGGA 1A41A 3O10A 4BJTA 1GGQA 2CDQA 3S9OA 5L0JA 2W4MA 3W8HA 3K6BA 4Q5SF 2GDCA 2Y3BA 1E84A 4JEAA 2O9XA 1ZVZA 3DM9B 2PFDA 3GORA 5JP7A 4MVRA 3N0TA 2M64A 4N6CA 2IM8A 2LQGA 2HJ3A 2AWYA 3JSZA 1ST6A 2HKVA 4QDLA 4CS9A 2QTVA 1E85A 3TULA 5JRAA 1WGWA 3CSKA 4YL0A 4L6RA 1M2VB 2A69F 1NFNA 2Q00A 2R7OA 4NC3A 1U6HA 4A2NB 3H2VA 2QUPA 1YJGA 2A1DD 3EFOA 3UNGC 2XXAB 3TOMA 3AGTA 4ER9A 4CIHA 4M63A 2H8AA 4MS2A 4YWQA 4C3DA 2OKUA 4OIRF 3SNHA 3O6XA 1FMVA 4AL0A 5KYUB 4N06A 1A7EA 1FTSA 1LE4A 1TR2A 3GWLA 4O6YA 3L8JA 3N2ZB 2KJGA 4U5FE 1WATA 3ZDLA 4BJ6C 1E83A 2VCAA 2GFHA 2R7QA 2UUIA 4IARA 1OCOC 4CBEA 1VMAA 5FCLA 1Z6AA 1K05A 4J30B 3TOLA 1YYXA 1NLXA 5DVWA 2R7RA 2IXMA 1H7IA 1TQGA 2C03A 3QVYA 4JC7A 5JSLA 3W4YA 4G7ZF 4F4BA 4LERA 3I5PA 1K04A 1NZEA 4BJ5C 4G7OF 4G0HA 4XEKA 3BRJA 3TQOA 1U89A 3U8PA 5KYXA 2I8BA 2VB6A 3EQLF 4JIOA 5AC4A 3QVZA 3BEHA 2XM0A 3MBGA 3ABLC 4E7ZA 1QVXA 4R32A 1YARO 4FWVA 5FZTA 3RQFA 3DXJF 5JS5A 3DE8A 1YA9A 3FXHA 3M1CB 4JZAA 4K7BA 4NTFA 2XLEA 1LI5A 3ZWIA 1Z63A 4PJNA 3ZIBA 3HLZA 4ULWA 2XLOA 2EIKC 5DS6A 1QPUA 3GM2A 1TWGA 2X51A 4P9FA 1YVIA 1FNTc 1ZHWA 4AE4A 256BA 3AG1C 4XPWA 3JRTA 1EKYA 2YL0A 4U5DE 1T6IA 2AWCA 1FMWA 1BR2A 3I5QA 4Q4ZF 1HE1A 1C17M 3B71A 3IQ6A 4MVMA 4JE9A 3S27A 2MYSA 5CI9A 4PJLA 4JTDB 2Q9AA 2NG1A 4OIOF 5COMA 3H65A 4BG0A 1PV3A 2VCBA 5A6BA 4XQ1A 2EPOA 1UG7A 3IPMO 3QMKA 4I1OB 1G4WR 3IQCA 2XL8A 4RD9A 3U3BA 3UR3C 4PK4A 3T9OA 5HSWA 2L81A 5L0IA 3RF3A 3WAQA 3T6BA 1VYIA 3T6GB 3DKAA 5CIVA 1WOLA 1MNDA 1A7DA 2EIMC 2HSBA 2R7SA 4LDKA 4JJFA 4QI0A 5L0HA 2HZ8A 1M57C 1XZPA 3AJMA 3C62A 1D1AA 3OWTA 1TWHA 1S7ZA 4BEMJ 1OW8A 1JR8A 2Q9BA 2XL4A 1CPQA 3NKEA 4J7YA 2V26A 4LLCA 3EGXB 3CAXA 3VF0A 4BJ6A 4E17A 1NG1A 5CI8A 4I44A 1ZU4A 5T1DB 2NUPB 3JZ0A 1WASA 3ZTMA 2P1AA 4G78A 2ZXRA 1NBBA 4CSAA 3N24A 2XLWA 3SZRA 4C7OA 3SXMA 1I4ZA 4YL1A 2LFFA 4YN0B 3K1HA 4N6HA 2WL8A 3C63A 5EHHA 1AVOB 1VOMA 1G4US 4DRJB 1T6UA 1C02A 3VYWA 3A11A 1NFOA 4BJ5A 4MNDA 2NSFA 1LIHA 2QLAA 4D4NA 5DS4A 1L3PA 3EH1A 3U2MA 2LCHA 5B3SC 1J8YF 1Q0FA 2A0UA 4XWJA 1V4AA 5KYWB 2FFHA 1LM3B 3VAYA 1HY5A 1YAUO 4ULVA 2EINC 3GEEA 2Q3TA 1I5NA 2ICWG 2R7UA 2J45A 3TD7A 2XRHA 2ZD9A 3AG4C 4I3MA 4E0IA 1JOGA 1KU2A 1YA7O 2ETSA 2YHSA 4IJJA 5KYNA 3UGOA 1AEPA 2DGJA 2BL2A 4DRIB 4UDVA 3AG3C 3DWWA 2GA0A 1TKNA 2H7OA 3ABMC 2OEVA 1TWAA 3FOPA 2PF4E 2OCCC 2FAPB 4MQ9F 4EIYA 1T01A 1ZHYA 3U9JA 4DBRA 2DI3A 5F28E 1Y4CA 2R05A 3IHUA 4W8PA 3ZG1A 3EGDB 2C04A 4MVUA 1C03A 1SMYF 4QI2A 1SF8A 1F1MA 2EPLX 1AUEA 4JW1A 1CPRA 2RSEB 2HMQA 2QE9A 5L0GA 1OCRC 1VYKA 3JT1A 1MNEA 4MVSA 4AX2A 1ZU5A 2KW3C 2WVOA 3M4CA 4IB4A 4RBNA 1LVKA 4U5CE 1A7VA 3QW0A 4KNWA 4ONSA 5D91A 4GQHA 4ZLDA 1FFHA 2HUJA 4K0DA 1QKRA 2TMVP 3ASNC 1GQAA 3LUTB 3FHDA 4Z9JA 2NUTA 2YQYA 5JLIA 3J06A 1SZIA 2P0NA 1D1BA 4NY3A 1E2XA 1JRAA 1MMAA 1MMDA 3SEOA 3FDQA 1Z23A 4E18A 3K1IC 1OKKD 2J9BA 2Y3DA 3EG9B 3U5SA 4CDVA 5E3CA 1OQCA 2XM4A 1YZCA 4MTOA 3K66A 3WG7C 5KYUA 4LDRA 5L0DA 3MYIA 2LK4A 2YEVA 5D92A 4WGZA 4U9DA 1WWPA 2EPKX 3WODF 2OG2A 2HS5A 4J7TA 3E70C 2Q4FA 1FFTC 1BZ4A 1OCZC 2CGEA 1HW1A 4XPXA 4CS7A 4DVZA 4IAOA 3V7OA 3HNIA 1I4YA 2CW0F 3LAYA 4WABA 2IXNA 2X0CA 1VLSA 4GYTA 3TJ5A 4A4AA 1HW2A 1EQ1A 1CGOA 5JUAA 1ZW2A 4U9EA 2XS1A 1YDIA 4JRZA 4DVYP 2OQMA 3HKKA 1ZYRF 2L7AA 3EFOB 2XSEA 4Z9IA 3ZVRA 4N4WA 2J8WA 2RD9A 3SP1A 3ABKC 1IW7F 3DAGA 3NMJA 1T6QA 4DRHB 2D5RB 4XLPF 2YLGA 2H7VC 3S28A 1G8XA 1FR0A 3FVYA 4CJOA 1OXKA 3TK0A 3ZQYA 5EGYA 2CYDA 3JYHA 1BBHA 3NYMA 2DYRC 3W2VA 1U0BB 4OIQF 1J8MF 2I15A 1KNYA 3HTKC 5L0FA 2LD6A 3POVA 2KSFA 4EWCA 3M15A 1QSPA 3KL4A 3W2WA 5L3VA 3T6JA 4WGYA 2VC9A 3AGUA 4C7OB 3GEIA 4JCHA 1NU7D 2R25A 5A6AA 1JMWA 3MYFA 3PMRA 4JVSA 4PACA 3PHF2 3QTHA 4DOZA 4MVOA 5E3AA 4C3BA 3F46A 4JTCB 1OW6A 2YLDA 5E33A 1VB5A 3RH3A 1GM5A 1MMGA 4XPYA 2VCCA 4O79A 1YLMA 5T3WA 4BEJA 3C8GB 1LI7A 1DOVA 2L9JA 4E0HA 2YL7A 1BDJB 3LNRA 3K1IA 4AE4B 4EBKA 4YT4A 5F5FA 3NYJA 3DM5A 1N1CA 2J7PD 3V5XA 3V5ZA 5KYYA 3EGXA 4U5HA 1MMNA 2A6HF 2XLMA 4H4KC 1RCPA 5AGFA 4RDAA 1Q0GA 2LFDA 2A68F 2YLIA 4IAQA 4JEBA 3O39A 3X1OA 2H7BA 3HNJA 1H9TA 2R7TA 1QZXA 1Z3IX 1TWCA 4JTAB 2XLVA 4B6IA 4E7SA 1ORJA 4JKVA 4JURI 1V74B 3Q6NA 2EILC 2JPUA 3WHNA 3HNLA 4OIPF 4PJJA 2W4BA 2WVNA 2EPMX 2WZGA 2J9WA 3PCVA 3NYLA 2IBFA 5B1AC 3TJ6A 2ZXOA 1OR2A 4PR9A 2Q7RA 3KKBA 1RKEA 1O3UA 1RKCA 4ANJA 3B0VC 1RJ9B 4JCZA 1H6GA 4FAPB 5TJ5E 3R7CA 2R7WA 2B0HA 3KMIA 2VH3A 5L0CA 5A6KA 1K40A 1W2WA 1ORSC 2KNHA 3DD7A 4OD4A 3EHMA 5T3TA 2Y39A 5DQZA 4C3EA 2XL6A 4CDYA 3AOUA 4XEVA 1OR3A 4AK9A 2Y69C 3ATPA 2WVQA 3H2UA 3G4ZA 5B3IA 3JTLO 3EZIA 4KBLA 4IRUA 4O7GA 4HFFB 2OJED 3E9VA 4CS8A 2B0JA 2OU6A 3T4RA 4KC9A 5F5HA 2AVKA 2HFIA 2J9VA 3I4UA 3C7JA 2M4EA 3NDBB 5K0IA 3MFNA 4KNVA 4NTAA 1TFOB 1HMDA 2IOQA 3DJNB 4O6NA 2ZXPA 5B1BC 3RIPA 3LESA 1APCA 4EKWA 3U0CA 4LDQA 2GAQA 2L6FA 3HNKA 2PBEA 1M2VA 2YL1A 2OOCA 2HV6A 4P9TA 5DQTA 3UGPA 3V5YA 2Z15A 1SYQA 2NSGA 2R9RB 1Q0MA 2V3CC 5A6JA 4LACB 3EG9A 3UMKA 2XXAA 2IYLD 3R2PA 1NU9C 2EPNA 3FAJA 4X0RA 5HV9A 3LNMB 2G3VA 2F22A 2PX0A 4HE8D 4EUKB 1O5HA 1SR2A 2HMZA 4NTBA 1TFKB 3RW0A 3S29A 3SYNA 2Q9CA 2ZPAA 1HMOA 2WZFA 3CQZA 1OKKA 3M4BA 3A9CA 5BQGA 1DOWA 3DJUB 3L8IA 1LKXA 3ECSA 5E2QA 4XLNF 1M56C 1ZHTA 4DJ9A 2AP3A 3Q6MA 1JAFA 1O87A 3M79A 3DZAA 1M2OA 2NUTB 3G50A 4AL1A 2A0BA 2G62A 3MLGA 4U5GA 2QY9A 3B29A 3ZSUA 3GM3A 3UMHA 1QQ3A 1OCCC 1R4TA 2FGYA 1RXQA 2W45A 3JSEO 1YYJA 3O55A 3QZCA 1JPNA 4H54A 3RVZA 4BJ1A 1EI7A 1D0ZA 3NKDA 3C18A 3EHNA 4EHPA 5COGA 2ZXWC 4EBBA 1IZMA 1L7CA 4YT2A 5BQIA 3F47A 1ZZPA 2KYHA 3RQGA 1R5ID 2CCYA 1Z7Qc 2OEXA 2JX0A 3ASOC 4FX5A 3U8VA 3CZ6A 2P6VA 2GWWA 2L6HA 2YZSA 5L3QA 2Y3HA 3U2LA 2XLDA 2VASA 2XLHA 3SXYA 1XZQA 1CGME 4W8KA 1HE9A 1QLEC 2PX3A 3MX3A 3RKOF 3GM1A 5DLJA 5JVEA 5EK0A 4DXWA 4CSAC 3ZTZA 3LS0A 1LS1A 2HSQA 5GPGB 2ASRA 1E86A 3K33A 4G7HF 3IEEA 3U3FA 2MWQA 2E87A 1D0YA 2J9UA 2Y3GA 5AC5A 3C8ZA 5KYXB 1KTMA 3LLKA 3EH2A 4MW3A 1XWJA 3C8GD 4U5EE 4CS8C 3DAFA 2CNWD 2R7XA 1WN0A 3IQTA 1UFBA 1H9GA 3L0IA 4MVZA 3PDMP 3G4XA 4CJGA 5JT4A 3AQCA 3RFYA 4CX9A 4OD5A 4Z9HA 2KQ9A 2IXPA 2YWAA 3C8GA 3ITFA 2R7VA 3DE9A 1PD1A 4YL3A 2CNWA 3UMIA 2QNLA 2OJQA 2XS8A 2PNOA 1NSGB 3KYJA 4ZLCA 5BUOA 2J46A 4EBJA 4FESA 2J0XA 2YVKA 3JRMO 3NRHA 5A6BD 3B9QA 2WB7A 2KGOA 4BPMA 4YT8A 4YK5A 3LEVA 2NUPA 2P7VA 3DMDA 1ZHXA 1ZHZA 3GEHA 1WTYA 4MTFA 3EPVA 4MVQA 4YT5A 1B68A 3SXKA 4NQFA 2J7PA 3RVYA 3AQBA 2LP4A 3QW1A 5COFA 1YZAA 3VM6A 4NCQA 1G5ZA 3EJNA 3JYYA 3KPHA 3S84A 2J0WA 4MW8A 3LS1A 3HJCA 3US6A 4CS9C 4DBQA 4KI2A 4YJWA 3B0PA 3LLIA 2BC5A 4MTGA 2PP4A 4XEFA 4U5BE 1VTMP 3OA1A 2JD3A 5KYWA 1V54C 3JCUQ 2D4UA 1JPJA 2UUHA 3CEXA 1CGNA 2HV7A 3RQEA 2YKZA 1PCXA 1D0XA 4PFPA 5KYYB 3LJBA 4PJMA 1OXBA 4CDAA 3KH2A 1RJ9A 3LEOA 1OW7A 4WJ0A 1PD0A 1ORYA 1T5OA 3FOOA 3RYLA 1D1CA 3K7DA 4I1MA 2IXOA 3S0XA 3L34A 3FMSA 1FAPB 5BQHA 2AU5A 1Y6DA 2YL3A 1VK5A 3GANA 1GS9A 2L6GA 3EZHA 4Q7CA 4OINF 3VRCA 1MQVA 1V55C 1Q0DA 2BE5F 2NPUA 1A0BA 4LLEA 3SXZA 3U9MA 5DS5A 2WZLA 4GEHA 2EIJC 4J32B 3Q7GA 2G3KA 4PFOA 1EA8A 1Z5ZA 3KYIA 2A6EF 4XTKA 3ZC4A 3EGDA 2KK1A 3ZQVA 3GWNA 2R02A 1ZW3A 5A69A 2KC3A 2MHRA 4IWBA 4K1OA 3X2QC 1T9KA 2R03A 2W9YA 3IQ5A 4CIPA 1RKEB 3L1MA 3DI5A 3NMIA 1LE2A 4D4XA 1S05A 2P61A 1VLTA 1LPEA 3OEOA 3AG2C 2HJMA 1M6TA 3B0UX 3S90A 3W8IA 1RMVA
chains in the Genus database with same CATH topology
2B0HA 1U89A 4P9TA 5L0CA 1U6HA 2L7AA 1SYQA 1XWJA 3H2VA 4E18A 4IGGA 5FZTA 1T01A 5L0JA 4W8PA 4EHPA 3H2UA 1L7CA 4E17A 5L0DA 3MYIA 5L0IA 3RF3A 2GDCA 1TR2A 1DOVA 3ZDLA 1ZW3A 1ZVZA 3T6GB 5L0GA 2IBFA 4K1OA 3TJ6A 1DOWA 2GWWA 4PR9A 1RKEB 4DJ9A 2LQGA 5L0HA 1RKEA 5L0FA 4ONSA 1ST6A 2X0CA 3TJ5A 3VF0A 1RKCA 1QKRA 3S90A 2HSQA 1ZW2A 1H6GA 1YDIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B0H A;  1U89 A;  4P9T A;  5L0C A;  1U6H A;  2L7A A;  1SYQ A;  1XWJ A;  3H2V A;  4E18 A;  4IGG A;  5FZT A;  1T01 A;  5L0J A;  4W8P A;  4EHP A;  3H2U A;  1L7C A;  4E17 A;  5L0D A;  3MYI A;  5L0I A;  3RF3 A;  2GDC A;  1TR2 A;  1DOV A;  3ZDL A;  1ZW3 A;  1ZVZ A;  3T6G B;  5L0G A;  2IBF A;  4K1O A;  3TJ6 A;  1DOW A;  2GWW A;  4PR9 A;  1RKE B;  4DJ9 A;  2LQG A;  5L0H A;  1RKE A;  5L0F A;  4ONS A;  1ST6 A;  2X0C A;  3TJ5 A;  3VF0 A;  1RKC A;  1QKR A;  3S90 A;  2HSQ A;  1ZW2 A;  1H6G A;  1YDI A; 
#chains in the Genus database with same CATH topology
 4P6I C;  1BR1 A;  3FAP B;  3GOD A;  2LSE A;  4O6M A;  2DYS C;  2DB4 A;  3NMK A;  4HEA J;  1Q0K A;  2LIG A;  4HFK B;  3Q7L A;  4JJG A;  5IY5 C;  1BR4 A;  1LS4 A;  2YRF A;  3NG1 A;  4IGG A;  1A41 A;  3O10 A;  4BJT A;  1GGQ A;  2CDQ A;  3S9O A;  5L0J A;  2W4M A;  3W8H A;  3K6B A;  4Q5S F;  2GDC A;  2Y3B A;  1E84 A;  4JEA A;  2O9X A;  1ZVZ A;  3DM9 B;  2PFD A;  3GOR A;  5JP7 A;  4MVR A;  3N0T A;  2M64 A;  4N6C A;  2IM8 A;  2LQG A;  2HJ3 A;  2AWY A;  3JSZ A;  1ST6 A;  2HKV A;  4QDL A;  4CS9 A;  2QTV A;  1E85 A;  3TUL A;  5JRA A;  1WGW A;  3CSK A;  4YL0 A;  4L6R A;  1M2V B;  2A69 F;  1NFN A;  2Q00 A;  2R7O A;  4NC3 A;  1U6H A;  4A2N B;  3H2V A;  2QUP A;  1YJG A;  2A1D D;  3EFO A;  3UNG C;  2XXA B;  3TOM A;  3AGT A;  4ER9 A;  4CIH A;  4M63 A;  2H8A A;  4MS2 A;  4YWQ A;  4C3D A;  2OKU A;  4OIR F;  3SNH A;  3O6X A;  1FMV A;  4AL0 A;  5KYU B;  4N06 A;  1A7E A;  1FTS A;  1LE4 A;  1TR2 A;  3GWL A;  4O6Y A;  3L8J A;  3N2Z B;  2KJG A;  4U5F E;  1WAT A;  3ZDL A;  4BJ6 C;  1E83 A;  2VCA A;  2GFH A;  2R7Q A;  2UUI A;  4IAR A;  1OCO C;  4CBE A;  1VMA A;  5FCL A;  1Z6A A;  1K05 A;  4J30 B;  3TOL A;  1YYX A;  1NLX A;  5DVW A;  2R7R A;  2IXM A;  1H7I A;  1TQG A;  2C03 A;  3QVY A;  4JC7 A;  5JSL A;  3W4Y A;  4G7Z F;  4F4B A;  4LER A;  3I5P A;  1K04 A;  1NZE A;  4BJ5 C;  4G7O F;  4G0H A;  4XEK A;  3BRJ A;  3TQO A;  1U89 A;  3U8P A;  5KYX A;  2I8B A;  2VB6 A;  3EQL F;  4JIO A;  5AC4 A;  3QVZ A;  3BEH A;  2XM0 A;  3MBG A;  3ABL C;  4E7Z A;  1QVX A;  4R32 A;  1YAR O;  4FWV A;  5FZT A;  3RQF A;  3DXJ F;  5JS5 A;  3DE8 A;  1YA9 A;  3FXH A;  3M1C B;  4JZA A;  4K7B A;  4NTF A;  2XLE A;  1LI5 A;  3ZWI A;  1Z63 A;  4PJN A;  3ZIB A;  3HLZ A;  4ULW A;  2XLO A;  2EIK C;  5DS6 A;  1QPU A;  3GM2 A;  1TWG A;  2X51 A;  4P9F A;  1YVI A;  1FNT c;  1ZHW A;  4AE4 A;  256B A;  3AG1 C;  4XPW A;  3JRT A;  1EKY A;  2YL0 A;  4U5D E;  1T6I A;  2AWC A;  1FMW A;  1BR2 A;  3I5Q A;  4Q4Z F;  1HE1 A;  1C17 M;  3B71 A;  3IQ6 A;  4MVM A;  4JE9 A;  3S27 A;  2MYS A;  5CI9 A;  4PJL A;  4JTD B;  2Q9A A;  2NG1 A;  4OIO F;  5COM A;  3H65 A;  4BG0 A;  1PV3 A;  2VCB A;  5A6B A;  4XQ1 A;  2EPO A;  1UG7 A;  3IPM O;  3QMK A;  4I1O B;  1G4W R;  3IQC A;  2XL8 A;  4RD9 A;  3U3B A;  3UR3 C;  4PK4 A;  3T9O A;  5HSW A;  2L81 A;  5L0I A;  3RF3 A;  3WAQ A;  3T6B A;  1VYI A;  3T6G B;  3DKA A;  5CIV A;  1WOL A;  1MND A;  1A7D A;  2EIM C;  2HSB A;  2R7S A;  4LDK A;  4JJF A;  4QI0 A;  5L0H A;  2HZ8 A;  1M57 C;  1XZP A;  3AJM A;  3C62 A;  1D1A A;  3OWT A;  1TWH A;  1S7Z A;  4BEM J;  1OW8 A;  1JR8 A;  2Q9B A;  2XL4 A;  1CPQ A;  3NKE A;  4J7Y A;  2V26 A;  4LLC A;  3EGX B;  3CAX A;  3VF0 A;  4BJ6 A;  4E17 A;  1NG1 A;  5CI8 A;  4I44 A;  1ZU4 A;  5T1D B;  2NUP B;  3JZ0 A;  1WAS A;  3ZTM A;  2P1A A;  4G78 A;  2ZXR A;  1NBB A;  4CSA A;  3N24 A;  2XLW A;  3SZR A;  4C7O A;  3SXM A;  1I4Z A;  4YL1 A;  2LFF A;  4YN0 B;  3K1H A;  4N6H A;  2WL8 A;  3C63 A;  5EHH A;  1AVO B;  1VOM A;  1G4U S;  4DRJ B;  1T6U A;  1C02 A;  3VYW A;  3A11 A;  1NFO A;  4BJ5 A;  4MND A;  2NSF A;  1LIH A;  2QLA A;  4D4N A;  5DS4 A;  1L3P A;  3EH1 A;  3U2M A;  2LCH A;  5B3S C;  1J8Y F;  1Q0F A;  2A0U A;  4XWJ A;  1V4A A;  5KYW B;  2FFH A;  1LM3 B;  3VAY A;  1HY5 A;  1YAU O;  4ULV A;  2EIN C;  3GEE A;  2Q3T A;  1I5N A;  2ICW G;  2R7U A;  2J45 A;  3TD7 A;  2XRH A;  2ZD9 A;  3AG4 C;  4I3M A;  4E0I A;  1JOG A;  1KU2 A;  1YA7 O;  2ETS A;  2YHS A;  4IJJ A;  5KYN A;  3UGO A;  1AEP A;  2DGJ A;  2BL2 A;  4DRI B;  4UDV A;  3AG3 C;  3DWW A;  2GA0 A;  1TKN A;  2H7O A;  3ABM C;  2OEV A;  1TWA A;  3FOP A;  2PF4 E;  2OCC C;  2FAP B;  4MQ9 F;  4EIY A;  1T01 A;  1ZHY A;  3U9J A;  4DBR A;  2DI3 A;  5F28 E;  1Y4C A;  2R05 A;  3IHU A;  4W8P A;  3ZG1 A;  3EGD B;  2C04 A;  4MVU A;  1C03 A;  1SMY F;  4QI2 A;  1SF8 A;  1F1M A;  2EPL X;  1AUE A;  4JW1 A;  1CPR A;  2RSE B;  2HMQ A;  2QE9 A;  5L0G A;  1OCR C;  1VYK A;  3JT1 A;  1MNE A;  4MVS A;  4AX2 A;  1ZU5 A;  2KW3 C;  2WVO A;  3M4C A;  4IB4 A;  4RBN A;  1LVK A;  4U5C E;  1A7V A;  3QW0 A;  4KNW A;  4ONS A;  5D91 A;  4GQH A;  4ZLD A;  1FFH A;  2HUJ A;  4K0D A;  1QKR A;  2TMV P;  3ASN C;  1GQA A;  3LUT B;  3FHD A;  4Z9J A;  2NUT A;  2YQY A;  5JLI A;  3J06 A;  1SZI A;  2P0N A;  1D1B A;  4NY3 A;  1E2X A;  1JRA A;  1MMA A;  1MMD A;  3SEO A;  3FDQ A;  1Z23 A;  4E18 A;  3K1I C;  1OKK D;  2J9B A;  2Y3D A;  3EG9 B;  3U5S A;  4CDV A;  5E3C A;  1OQC A;  2XM4 A;  1YZC A;  4MTO A;  3K66 A;  3WG7 C;  5KYU A;  4LDR A;  5L0D A;  3MYI A;  2LK4 A;  2YEV A;  5D92 A;  4WGZ A;  4U9D A;  1WWP A;  2EPK X;  3WOD F;  2OG2 A;  2HS5 A;  4J7T A;  3E70 C;  2Q4F A;  1FFT C;  1BZ4 A;  1OCZ C;  2CGE A;  1HW1 A;  4XPX A;  4CS7 A;  4DVZ A;  4IAO A;  3V7O A;  3HNI A;  1I4Y A;  2CW0 F;  3LAY A;  4WAB A;  2IXN A;  2X0C A;  1VLS A;  4GYT A;  3TJ5 A;  4A4A A;  1HW2 A;  1EQ1 A;  1CGO A;  5JUA A;  1ZW2 A;  4U9E A;  2XS1 A;  1YDI A;  4JRZ A;  4DVY P;  2OQM A;  3HKK A;  1ZYR F;  2L7A A;  3EFO B;  2XSE A;  4Z9I A;  3ZVR A;  4N4W A;  2J8W A;  2RD9 A;  3SP1 A;  3ABK C;  1IW7 F;  3DAG A;  3NMJ A;  1T6Q A;  4DRH B;  2D5R B;  4XLP F;  2YLG A;  2H7V C;  3S28 A;  1G8X A;  1FR0 A;  3FVY A;  4CJO A;  1OXK A;  3TK0 A;  3ZQY A;  5EGY A;  2CYD A;  3JYH A;  1BBH A;  3NYM A;  2DYR C;  3W2V A;  1U0B B;  4OIQ F;  1J8M F;  2I15 A;  1KNY A;  3HTK C;  5L0F A;  2LD6 A;  3POV A;  2KSF A;  4EWC A;  3M15 A;  1QSP A;  3KL4 A;  3W2W A;  5L3V A;  3T6J A;  4WGY A;  2VC9 A;  3AGU A;  4C7O B;  3GEI A;  4JCH A;  1NU7 D;  2R25 A;  5A6A A;  1JMW A;  3MYF A;  3PMR A;  4JVS A;  4PAC A;  3PHF 2;  3QTH A;  4DOZ A;  4MVO A;  5E3A A;  4C3B A;  3F46 A;  4JTC B;  1OW6 A;  2YLD A;  5E33 A;  1VB5 A;  3RH3 A;  1GM5 A;  1MMG A;  4XPY A;  2VCC A;  4O79 A;  1YLM A;  5T3W A;  4BEJ A;  3C8G B;  1LI7 A;  1DOV A;  2L9J A;  4E0H A;  2YL7 A;  1BDJ B;  3LNR A;  3K1I A;  4AE4 B;  4EBK A;  4YT4 A;  5F5F A;  3NYJ A;  3DM5 A;  1N1C A;  2J7P D;  3V5X A;  3V5Z A;  5KYY A;  3EGX A;  4U5H A;  1MMN A;  2A6H F;  2XLM A;  4H4K C;  1RCP A;  5AGF A;  4RDA A;  1Q0G A;  2LFD A;  2A68 F;  2YLI A;  4IAQ A;  4JEB A;  3O39 A;  3X1O A;  2H7B A;  3HNJ A;  1H9T A;  2R7T A;  1QZX A;  1Z3I X;  1TWC A;  4JTA B;  2XLV A;  4B6I A;  4E7S A;  1ORJ A;  4JKV A;  4JUR I;  1V74 B;  3Q6N A;  2EIL C;  2JPU A;  3WHN A;  3HNL A;  4OIP F;  4PJJ A;  2W4B A;  2WVN A;  2EPM X;  2WZG A;  2J9W A;  3PCV A;  3NYL A;  2IBF A;  5B1A C;  3TJ6 A;  2ZXO A;  1OR2 A;  4PR9 A;  2Q7R A;  3KKB A;  1RKE A;  1O3U A;  1RKC A;  4ANJ A;  3B0V C;  1RJ9 B;  4JCZ A;  1H6G A;  4FAP B;  5TJ5 E;  3R7C A;  2R7W A;  2B0H A;  3KMI A;  2VH3 A;  5L0C A;  5A6K A;  1K40 A;  1W2W A;  1ORS C;  2KNH A;  3DD7 A;  4OD4 A;  3EHM A;  5T3T A;  2Y39 A;  5DQZ A;  4C3E A;  2XL6 A;  4CDY A;  3AOU A;  4XEV A;  1OR3 A;  4AK9 A;  2Y69 C;  3ATP A;  2WVQ A;  3H2U A;  3G4Z A;  5B3I A;  3JTL O;  3EZI A;  4KBL A;  4IRU A;  4O7G A;  4HFF B;  2OJE D;  3E9V A;  4CS8 A;  2B0J A;  2OU6 A;  3T4R A;  4KC9 A;  5F5H A;  2AVK A;  2HFI A;  2J9V A;  3I4U A;  3C7J A;  2M4E A;  3NDB B;  5K0I A;  3MFN A;  4KNV A;  4NTA A;  1TFO B;  1HMD A;  2IOQ A;  3DJN B;  4O6N A;  2ZXP A;  5B1B C;  3RIP A;  3LES A;  1APC A;  4EKW A;  3U0C A;  4LDQ A;  2GAQ A;  2L6F A;  3HNK A;  2PBE A;  1M2V A;  2YL1 A;  2OOC A;  2HV6 A;  4P9T A;  5DQT A;  3UGP A;  3V5Y A;  2Z15 A;  1SYQ A;  2NSG A;  2R9R B;  1Q0M A;  2V3C C;  5A6J A;  4LAC B;  3EG9 A;  3UMK A;  2XXA A;  2IYL D;  3R2P A;  1NU9 C;  2EPN A;  3FAJ A;  4X0R A;  5HV9 A;  3LNM B;  2G3V A;  2F22 A;  2PX0 A;  4HE8 D;  4EUK B;  1O5H A;  1SR2 A;  2HMZ A;  4NTB A;  1TFK B;  3RW0 A;  3S29 A;  3SYN A;  2Q9C A;  2ZPA A;  1HMO A;  2WZF A;  3CQZ A;  1OKK A;  3M4B A;  3A9C A;  5BQG A;  1DOW A;  3DJU B;  3L8I A;  1LKX A;  3ECS A;  5E2Q A;  4XLN F;  1M56 C;  1ZHT A;  4DJ9 A;  2AP3 A;  3Q6M A;  1JAF A;  1O87 A;  3M79 A;  3DZA A;  1M2O A;  2NUT B;  3G50 A;  4AL1 A;  2A0B A;  2G62 A;  3MLG A;  4U5G A;  2QY9 A;  3B29 A;  3ZSU A;  3GM3 A;  3UMH A;  1QQ3 A;  1OCC C;  1R4T A;  2FGY A;  1RXQ A;  2W45 A;  3JSE O;  1YYJ A;  3O55 A;  3QZC A;  1JPN A;  4H54 A;  3RVZ A;  4BJ1 A;  1EI7 A;  1D0Z A;  3NKD A;  3C18 A;  3EHN A;  4EHP A;  5COG A;  2ZXW C;  4EBB A;  1IZM A;  1L7C A;  4YT2 A;  5BQI A;  3F47 A;  1ZZP A;  2KYH A;  3RQG A;  1R5I D;  2CCY A;  1Z7Q c;  2OEX A;  2JX0 A;  3ASO C;  4FX5 A;  3U8V A;  3CZ6 A;  2P6V A;  2GWW A;  2L6H A;  2YZS A;  5L3Q A;  2Y3H A;  3U2L A;  2XLD A;  2VAS A;  2XLH A;  3SXY A;  1XZQ A;  1CGM E;  4W8K A;  1HE9 A;  1QLE C;  2PX3 A;  3MX3 A;  3RKO F;  3GM1 A;  5DLJ A;  5JVE A;  5EK0 A;  4DXW A;  4CSA C;  3ZTZ A;  3LS0 A;  1LS1 A;  2HSQ A;  5GPG B;  2ASR A;  1E86 A;  3K33 A;  4G7H F;  3IEE A;  3U3F A;  2MWQ A;  2E87 A;  1D0Y A;  2J9U A;  2Y3G A;  5AC5 A;  3C8Z A;  5KYX B;  1KTM A;  3LLK A;  3EH2 A;  4MW3 A;  1XWJ A;  3C8G D;  4U5E E;  4CS8 C;  3DAF A;  2CNW D;  2R7X A;  1WN0 A;  3IQT A;  1UFB A;  1H9G A;  3L0I A;  4MVZ A;  3PDM P;  3G4X A;  4CJG A;  5JT4 A;  3AQC A;  3RFY A;  4CX9 A;  4OD5 A;  4Z9H A;  2KQ9 A;  2IXP A;  2YWA A;  3C8G A;  3ITF A;  2R7V A;  3DE9 A;  1PD1 A;  4YL3 A;  2CNW A;  3UMI A;  2QNL A;  2OJQ A;  2XS8 A;  2PNO A;  1NSG B;  3KYJ A;  4ZLC A;  5BUO A;  2J46 A;  4EBJ A;  4FES A;  2J0X A;  2YVK A;  3JRM O;  3NRH A;  5A6B D;  3B9Q A;  2WB7 A;  2KGO A;  4BPM A;  4YT8 A;  4YK5 A;  3LEV A;  2NUP A;  2P7V A;  3DMD A;  1ZHX A;  1ZHZ A;  3GEH A;  1WTY A;  4MTF A;  3EPV A;  4MVQ A;  4YT5 A;  1B68 A;  3SXK A;  4NQF A;  2J7P A;  3RVY A;  3AQB A;  2LP4 A;  3QW1 A;  5COF A;  1YZA A;  3VM6 A;  4NCQ A;  1G5Z A;  3EJN A;  3JYY A;  3KPH A;  3S84 A;  2J0W A;  4MW8 A;  3LS1 A;  3HJC A;  3US6 A;  4CS9 C;  4DBQ A;  4KI2 A;  4YJW A;  3B0P A;  3LLI A;  2BC5 A;  4MTG A;  2PP4 A;  4XEF A;  4U5B E;  1VTM P;  3OA1 A;  2JD3 A;  5KYW A;  1V54 C;  3JCU Q;  2D4U A;  1JPJ A;  2UUH A;  3CEX A;  1CGN A;  2HV7 A;  3RQE A;  2YKZ A;  1PCX A;  1D0X A;  4PFP A;  5KYY B;  3LJB A;  4PJM A;  1OXB A;  4CDA A;  3KH2 A;  1RJ9 A;  3LEO A;  1OW7 A;  4WJ0 A;  1PD0 A;  1ORY A;  1T5O A;  3FOO A;  3RYL A;  1D1C A;  3K7D A;  4I1M A;  2IXO A;  3S0X A;  3L34 A;  3FMS A;  1FAP B;  5BQH A;  2AU5 A;  1Y6D A;  2YL3 A;  1VK5 A;  3GAN A;  1GS9 A;  2L6G A;  3EZH A;  4Q7C A;  4OIN F;  3VRC A;  1MQV A;  1V55 C;  1Q0D A;  2BE5 F;  2NPU A;  1A0B A;  4LLE A;  3SXZ A;  3U9M A;  5DS5 A;  2WZL A;  4GEH A;  2EIJ C;  4J32 B;  3Q7G A;  2G3K A;  4PFO A;  1EA8 A;  1Z5Z A;  3KYI A;  2A6E F;  4XTK A;  3ZC4 A;  3EGD A;  2KK1 A;  3ZQV A;  3GWN A;  2R02 A;  1ZW3 A;  5A69 A;  2KC3 A;  2MHR A;  4IWB A;  4K1O A;  3X2Q C;  1T9K A;  2R03 A;  2W9Y A;  3IQ5 A;  4CIP A;  1RKE B;  3L1M A;  3DI5 A;  3NMI A;  1LE2 A;  4D4X A;  1S05 A;  2P61 A;  1VLT A;  1LPE A;  3OEO A;  3AG2 C;  2HJM A;  1M6T A;  3B0U X;  3S90 A;  3W8I A;  1RMV A; 
#chains in the Genus database with same CATH homology
 2B0H A;  1U89 A;  4P9T A;  5L0C A;  1U6H A;  2L7A A;  1SYQ A;  1XWJ A;  3H2V A;  4E18 A;  4IGG A;  5FZT A;  1T01 A;  5L0J A;  4W8P A;  4EHP A;  3H2U A;  1L7C A;  4E17 A;  5L0D A;  3MYI A;  5L0I A;  3RF3 A;  2GDC A;  1TR2 A;  1DOV A;  3ZDL A;  1ZW3 A;  1ZVZ A;  3T6G B;  5L0G A;  2IBF A;  4K1O A;  3TJ6 A;  1DOW A;  2GWW A;  4PR9 A;  1RKE B;  4DJ9 A;  2LQG A;  5L0H A;  1RKE A;  5L0F A;  4ONS A;  1ST6 A;  2X0C A;  3TJ5 A;  3VF0 A;  1RKC A;  1QKR A;  3S90 A;  2HSQ A;  1ZW2 A;  1H6G A;  1YDI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...