5T3WA

Marburg virus vp30 bound to nucleoprotein
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
153
structure length
137
Chain Sequence
b'VDLPPPPLYADVLTLENLGHILSYLHRSEIGKLDETSLRAALSLTCAGIRKTNRSLINTMTELHMNHENLPQDQNGVIKQTYTGIHLDKGGQFEAALWQGWDKRSISLFVQAALYVMNNIPCESSISVQASYDHFIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Fusion protein of Nucleoprotein and Minor nucleoprotein VP30
publication title The Ebola Virus VP30-NP Interaction Is a Regulator of Viral RNA Synthesis.
pubmed doi rcsb
source organism Lake victoria marburgvirus (strain musoke-80)
molecule tags Viral protein
total genus 50
structure length 137
sequence length 153
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2016-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11507 Transcript_VP30 Ebola virus-specific transcription factor VP30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1160 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 5t3wA00
3V7OA 2I8BA 5T3TA 5DVWA 5T3WA
chains in the Genus database with same CATH superfamily
3LS1A 3HNKA 5E33A 5GPGB 1CGNA 3VRCA 2JPUA 3TD7A 4CJOA 5L0CA 2L6FA 2KQ9A 2P0NA 3CSKA 4L6RA 4C3DA 2VASA 2A68F 1G8XA 3AQBA 3WHNA 4U5BE 1T6UA 3JSZA 3DJUB 3ZVRA 1LS4A 3QW1A 2V3CC 4E17A 2XL8A 2L7AA 1BZ4A 2R7QA 1MMGA 4LLEA 2NSFA 4XPWA 1QSPA 5DS5A 4DRJB 4YJWA 3DZAA 3BRJA 4J30B 1SYQA 2JX0A 1OW8A 3KH2A 2J9BA 4OIOF 3EH1A 3GM2A 4H4KC 4QDLA 4QI2A 2G3VA 1U0BB 2PBEA 2P7VA 3ZSUA 4HE8D 4NTFA 1KTMA 2G3KA 2MWQA 2A0BA 2A6HF 1DOVA 1Y6DA 1UFBA 1ZW3A 1LE4A 3L34A 3ZTMA 1FTSA 4MTFA 1MQVA 4XPXA 4JTAB 1OKKA 4IB4A 2YLGA 1T6QA 4U9DA 1H6GA 2XLHA 2D4UA 1ORYA 3HNJA 4HFKB 1TQGA 2PX3A 4IRUA 4E0IA 5CIVA 3AQCA 4BJ1A 4IAOA 5KYUB 5E3CA 4JTDB 1T5OA 1Y4CA 2EIJC 2Q3TA 3MLGA 1Q0MA 4KNWA 4IGGA 3VM6A 2FFHA 3C63A 1RJ9B 2HSQA 5FZTA 1RCPA 3B0UX 3GORA 3UR3C 3ABKC 2OEXA 1M6TA 1NZEA 2KC3A 2J7PD 3K6BA 3R2PA 3FOPA 4DVYP 5L0HA 4LDKA 1BR4A 2A6EF 3UMKA 2A1DD 3B9QA 5COFA 5A6KA 3S0XA 2XXAA 1F1MA 2WL8A 2W9YA 2HJ3A 1HMOA 2Q9CA 1D1CA 3RQFA 3I4UA 1ZHXA 1NU9C 2CYDA 1MMDA 1H7IA 1HY5A 5DQTA 4G78A 2Y3GA 2YRFA 1BR1A 4AE4B 4C3EA 4N4WA 1ZHZA 2FGYA 3LAYA 5KYNA 1M2VB 3F46A 2RD9A 2BC5A 4ULWA 4GQHA 5BQGA 4MW8A 1VOMA 1YZCA 1ZZPA 2XLDA 1QPUA 3JSEO 2B0HA 4NQFA 4OD4A 3AGUA 3NMIA 4U5EE 2WZLA 4ER9A 1YJGA 2D5RB 2LSEA 2GWWA 5JSLA 3BEHA 3RKOF 3TOMA 4CSAA 3N2ZB 3X2QC 3UGOA 2VCBA 2EPMX 3DKAA 1LPEA 3SP1A 3NKDA 4QI0A 1OCCC 2HMZA 4LDRA 1ZHYA 1ZW2A 2R9RB 3NDBB 3EZIA 1M56C 1WTYA 1EQ1A 5L3QA 3FHDA 3GEEA 1OW7A 5K0IA 3EGXA 2GA0A 2NPUA 4MVZA 2CNWD 4U5HA 5D92A 3V5YA 4RDAA 5A6AA 3J06A 1JMWA 2L9JA 3QVZA 4GEHA 2Y39A 4JTCB 5JLIA 2I8BA 2R7XA 3DXJF 4JRZA 4EBJA 2Z15A 1Z63A 4U5GA 3EPVA 3PCVA 3EFOA 2W45A 3M15A 3DD7A 3OA1A 4U5DE 2H8AA 3IEEA 4MTOA 4R32A 4YL3A 3SNHA 3DE9A 5B3SC 4CS7A 1OR2A 4EWCA 4J7TA 3NRHA 2QLAA 3JT1A 4BEJA 1S05A 1U89A 2NUTB 3U8PA 3SXZA 4OINF 5DQZA 4PACA 5CI9A 1Q0GA 3K1HA 1K40A 3UGPA 3NYJA 3O6XA 2IYLD 1JAFA 3RVZA 3L1MA 5EGYA 2LK4A 4N6HA 3M4CA 1OW6A 2HSBA 2BL2A 2ZXOA 2ZXWC 2XL4A 4FESA 4OD5A 3W8IA 5KYYA 1YYJA 2IXPA 2KNHA 4YN0B 3S27A 1GM5A 2R7OA 2YEVA 1GS9A 4JCZA 4ANJA 5A69A 4CIPA 2XM0A 3ABMC 1D0ZA 1SR2A 1K04A 1PD1A 4P6IC 3ZC4A 3C8GB 5L0GA 4XEVA 3C8GD 1C02A 1EA8A 1OQCA 2WVOA 3H2VA 4MS2A 1A7VA 1FAPB 4AK9A 4F4BA 3B0VC 3GEHA 2EPLX 3GM1A 1FR0A 3G50A 4W8KA 2LFDA 3MBGA 4WGZA 2WB7A 5AGFA 5JP7A 4OIRF 1TFOB 4K1OA 2NUPB 2OCCC 3FDQA 5F28E 1ORSC 1QLEC 1RMVA 2X0CA 4JVSA 2AWCA 1YA9A 1C17M 2IXNA 2ZXPA 3US6A 3JCUQ 2XLOA 3I5QA 3B71A 3GODA 4JKVA 1FFHA 3EGDB 4PJMA 2EINC 4DVZA 3ABLC 3TOLA 4PJNA 1A7DA 2PF4E 3HLZA 4JC7A 1JR8A 4ZLCA 4J32B 3ZQVA 1OKKD 1NU7D 2HZ8A 5B1BC 3K1IC 5A6BA 2CGEA 3ITFA 4OIQF 5EHHA 4MVQA 2KK1A 1N1CA 5HSWA 1OXKA 4XPYA 1AUEA 2L6GA 1B68A 2J46A 5T3WA 5DS4A 2KW3C 3H2UA 2HV6A 3AGTA 2IXMA 4O6YA 5CI8A 4E7ZA 2EIKC 3AJMA 4IWBA 3DI5A 1OR3A 3I5PA 3C62A 4G7HF 4DOZA 2OKUA 4P9TA 4H54A 3LESA 1YZAA 3POVA 4NTAA 2A69F 1VK5A 3U5SA 4FWVA 4PR9A 1ZU4A 5FCLA 3OEOA 2WZGA 2J9VA 3EG9B 1LI7A 3EHNA 3U2MA 4O6NA 3E70C 1YDIA 4YL1A 3IQ5A 2LP4A 2ZXRA 4CIHA 1S7ZA 2LCHA 1LS1A 2DGJA 2M4EA 3KYJA 3QZCA 4XTKA 1NLXA 2XLVA 1G4US 2OQMA 2YQYA 3V5XA 1MMNA 1T6IA 1WGWA 5L0DA 2WZFA 3Q7GA 5L3VA 2G62A 1Z3IX 2YL1A 3LNRA 1TWAA 1PV3A 4J7YA 5KYWA 3HNIA 2X51A 2V26A 3H65A 3PDMP 3ZTZA 1V74B 4EKWA 4N06A 2HUJA 1TR2A 3WODF 4C7OA 1ZHTA 5F5FA 3U3BA 3CAXA 3ZDLA 3JTLO 4BEMJ 4YT2A 4LACB 1RKEB 3AOUA 3NMJA 2RSEB 4JIOA 4CS8C 2XM4A 1CGOA 2YHSA 5L0IA 1ZHWA 4MNDA 2KJGA 3U0CA 1K05A 2C03A 4P9FA 3RH3A 1TKNA 1VYIA 4YK5A 2EPOA 3ASNC 4XLPF 2R7UA 1CPQA 3DJNB 2MYSA 4XQ1A 1JOGA 4WGYA 4AL0A 4E18A 2PFDA 4G0HA 3A9CA 4ONSA 4K7BA 1WATA 2Q9BA 3FMSA 4E0HA 2GFHA 1H9TA 5AC4A 3TJ5A 1Q0KA 2LIGA 2PP4A 4KBLA 3G4XA 2Q00A 2R7WA 4DXWA 3O55A 1R4TA 2R7RA 3FVYA 3KKBA 2XLEA 1L3PA 4G7ZF 3JZ0A 1TWCA 3LEVA 2ICWG 2XLMA 3AG1C 2EPNA 4M63A 3WAQA 4BJ6C 4FX5A 5JUAA 2J9UA 2VH3A 3U9JA 1HE9A 4U5CE 5T3TA 4G7OF 4Z9HA 1FFTC 2XRHA 2XS1A 3RQEA 3AG2C 4KI2A 4DBQA 2ASRA 2R03A 3MX3A 3QMKA 4BG0A 4BJTA 4A4AA 3TULA 3GWLA 3W2WA 3SYNA 5BUOA 3QTHA 3K1IA 1XZQA 2CCYA 4NC3A 4KNVA 1RJ9A 1AEPA 4EBKA 3KL4A 3LNMB 3VAYA 4JJFA 1UG7A 2EIMC 4NTBA 2YLIA 1QQ3A 3K33A 5KYXB 2OEVA 4OIPF 5B3IA 3X1OA 5L0JA 3PHF2 1MNEA 3RYLA 3MYFA 1U6HA 3TJ6A 2DB4A 1CPRA 3F47A 4HEAJ 3EHMA 4I1OB 3S28A 1FMVA 3W2VA 3LJBA 5A6JA 2HKVA 4AE4A 2PX0A 1IZMA 4GYTA 3T9OA 4DBRA 3NKEA 4I3MA 2XL6A 1M2VA 2OOCA 2EILC 3V7OA 1VMAA 1ZYRF 2H7OA 4IARA 4YT5A 1QZXA 2YKZA 1H9GA 4YL0A 3S90A 5JS5A 1Z6AA 5A6BD 3E9VA 2DI3A 1VLTA 1YYXA 2Y69C 3IPMO 3MYIA 4JURI 1WASA 3U3FA 1OXBA 1O3UA 2AWYA 2GDCA 1NFOA 3Q6MA 4EBBA 4ZLDA 2IOQA 1RKCA 2LD6A 2LFFA 4C3BA 1E84A 2R7SA 4EIYA 2QTVA 3K7DA 4BJ5C 3JYYA 2YL7A 1JPNA 5COGA 2W4MA 1Z23A 3PMRA 4ULVA 1J8YF 1HMDA 1D0XA 4HFFB 4CS8A 3B29A 4LDQA 1FMWA 3ASOC 4CX9A 3GEIA 5BQIA 1PD0A 4YT4A 1T01A 2YLDA 4JEAA 4PJLA 1WN0A 2CW0F 3GM3A 1XWJA 2Q9AA 1NG1A 1SF8A 1G5ZA 1V55C 4MVUA 3TK0A 1OCRC 5IY5C 3C18A 4K0DA 3DAFA 1G4WR 3LUTB 4XWJA 3RVYA 1OCOC 4CSAC 3DM5A 1I5NA 1SMYF 3SXMA 2NUTA 3U9MA 4CJGA 1QVXA 3EQLF 2UUHA 5BQHA 1HE1A 2OJQA 1M57C 4JZAA 3S29A 4BJ6A 2XXAB 4E7SA 3KMIA 1NFNA 3HNLA 3JRMO 1D1BA 3LS0A 3IHUA 3AG3C 4JE9A 1YAUO 3ZG1A 1VYKA 3T4RA 4AL1A 3A11A 4KC9A 2L6HA 2AP3A 3CQZA 2DYSC 3U2LA 3Q7LA 256BA 2HJMA 3EZHA 3C8GA 5T1DB 2MHRA 1D1AA 3ZQYA 4JW1A 3M79A 1JRAA 3NYMA 1L7CA 3O10A 3T6GB 4JEBA 3WG7C 4BPMA 4DRHB 1LE2A 3C7JA 4MVOA 1KNYA 2W4BA 1Q0DA 3RF3A 2F22A 2I15A 4FAPB 1APCA 2NUPA 1LKXA 4MQ9F 2DYRC 2Q7RA 2YVKA 3FAPB 1BBHA 3UMIA 4EHPA 3DE8A 3L8IA 5DLJA 3W8HA 4WJ0A 4Q4ZF 1M2OA 3ZIBA 4JJGA 2XLWA 2TMVP 2B0JA 2KYHA 3EGDA 2H7BA 4RBNA 5F5HA 2P61A 1I4YA 4IJJA 3C8ZA 2HS5A 1LIHA 1DOWA 2QY9A 3ATPA 2CDQA 3EGXB 5DS6A 3R7CA 3JYHA 1D0YA 1YARO 2L81A 2YZSA 3FXHA 2QUPA 2O9XA 1ZU5A 1XZPA 3TQOA 2NG1A 3V5ZA 3N24A 3SXKA 1PCXA 1E85A 2VCAA 2AVKA 3HTKC 3QW0A 3ZWIA 2E87A 2NSGA 1MNDA 3EFOB 4N6CA 3U8VA 5B1AC 4CBEA 4PFPA 2J8WA 4U5FE 1LVKA 1V54C 1EKYA 5DVWA 2IXOA 3NMKA 1QKRA 2IM8A 1V4AA 1VLSA 3HJCA 4MVMA 2QE9A 4U9EA 3LLKA 1Z7Qc 1CGME 1I4ZA 2FAPB 3VYWA 2XS8A 4MVRA 4BJ5A 1W2WA 1HW1A 2OG2A 2AU5A 2WVNA 3M4BA 4CS9C 2R02A 3RIPA 3EG9A 2HV7A 1AVOB 3AG4C 3RQGA 5KYYB 4PK4A 3ECSA 3DM9B 1HW2A 2YL3A 4DRIB 3RW0A 3SZRA 3B0PA 2KSFA 1ST6A 4O6MA 5AC5A 1LI5A 4B6IA 5KYUA 4UDVA 2YWAA 2M64A 3EJNA 2J0WA 2R7TA 2A0UA 5TJ5E 1SZIA 4WABA 3NG1A 4DJ9A 3KPHA 4EUKB 1ORJA 1YA7O 2Y3HA 5E2QA 3RFYA 2J7PA 4MVSA 3GANA 4AX2A 4RD9A 4IAQA 2ZD9A 1E2XA 2J0XA 2VC9A 1T9KA 3QVYA 5L0FA 1FNTc 2R25A 4PJJA 1BDJB 3W4YA 1LM3B 3DWWA 3L8JA 1OCZC 2HMQA 3G4ZA 4JCHA 1ZVZA 3CZ6A 4X0RA 1KU2A 3K66A 1RKEA 4CDYA 4YT8A 1JPJA 1O87A 5COMA 4D4NA 5JVEA 3SXYA 4CDAA 2XSEA 4YWQA 3GWNA 3Q6NA 1Z5ZA 1E86A 3HKKA 3SEOA 1NBBA 2H7VC 4CDVA 2WVQA 3S9OA 4XEFA 4LERA 3O39A 3VF0A 3T6JA 1RXQA 3L0IA 4O7GA 3DMDA 4W8PA 3OWTA 1O5HA 5JT4A 1VTMP 3KYIA 2ETSA 2J9WA 1TFKB 2BE5F 2Y3BA 3S84A 1E83A 3M1CB 5HV9A 2J45A 4MW3A 3CEXA 2R05A 3LLIA 1TWGA 3NYLA 2QNLA 2PNOA 3JRTA 1GQAA 2P1AA 2OU6A 1VB5A 4A2NB 2HFIA 4LLCA 2P6VA 2VCCA 1A0BA 4Q7CA 1YLMA 1IW7F 3UNGC 1A41A 2ZPAA 4PFOA 2CNWA 2OJED 3T6BA 1MMAA 3IQ6A 2C04A 4XEKA 2R7VA 2UUIA 5JRAA 3MFNA 5EK0A 2Q4FA 4D4XA 2VB6A 1R5ID 1J8MF 3DAGA 1GGQA 4Z9IA 1YVIA 5E3AA 1Q0FA 2EPKX 2KGOA 2LQGA 1C03A 1BR2A 2IBFA 4MTGA 2Y3DA 3IQCA 1WOLA 3IQTA 3EH2A 4Q5SF 4XLNF 1TWHA 3FAJA 1A7EA 4NCQA 2GAQA 1NSGB 3FOOA 3N0TA 2JD3A 3UMHA 5KYXA 4NY3A 5KYWB 4I44A 1WWPA 2YL0A 3LEOA 4O79A 4C7OB 4I1MA 4Z9JA 5D91A 1EI7A 4CS9A
chains in the Genus database with same CATH topology
3LS1A 5E33A 3TD7A 2KQ9A 3CSKA 4C3DA 2VASA 2A68F 1G8XA 3AQBA 4U5BE 3JSZA 3DJUB 3ZVRA 2V3CC 2R7QA 1MMGA 4LLEA 5DS5A 4YJWA 3DZAA 4J30B 3KH2A 4OIOF 3EH1A 4H4KC 4QDLA 4QI2A 2G3VA 2P7VA 3ZSUA 4HE8D 2G3KA 2MWQA 2A6HF 3L34A 1FTSA 1OKKA 4HFKB 2PX3A 4IRUA 3AQCA 4BJ1A 4IAOA 5KYUB 5E3CA 4KNWA 2EIJC 2Q3TA 3MLGA 2FFHA 1RJ9B 3B0UX 3UR3C 3ABKC 1NZEA 2J7PD 3K6BA 4DVYP 1BR4A 2A6EF 3UMKA 2A1DD 3B9QA 3S0XA 2XXAA 2WL8A 2W9YA 2Q9CA 1D1CA 3I4UA 1ZHXA 1NU9C 1MMDA 5DQTA 2Y3GA 1BR1A 4AE4B 4C3EA 1ZHZA 2FGYA 3LAYA 5KYNA 1M2VB 3F46A 4ULWA 1VOMA 4OD4A 4U5EE 2WZLA 2D5RB 2LSEA 3RKOF 4CSAA 3N2ZB 3X2QC 3UGOA 3SP1A 3NKDA 4QI0A 1OCCC 1ZHYA 3NDBB 3EZIA 1M56C 5L3QA 3FHDA 3EGXA 2CNWD 4U5HA 5D92A 4RDAA 2L9JA 4GEHA 2Y39A 2R7XA 2I8BA 3DXJF 1Z63A 2Z15A 4U5GA 3EPVA 3EFOA 2W45A 3OA1A 3DD7A 4U5DE 3IEEA 3SNHA 5B3SC 4CS7A 4EWCA 3NRHA 3JT1A 4BEJA 2NUTB 4OINF 5DQZA 5CI9A 3K1HA 3UGPA 3NYJA 3O6XA 2IYLD 5EGYA 3W8IA 4OD5A 2ZXOA 2ZXWC 2XL4A 4FESA 5KYYA 2IXPA 4YN0B 2KNHA 3S27A 2R7OA 2YEVA 4ANJA 3ABMC 1D0ZA 4P6IC 1PD1A 3ZC4A 4AK9A 2WVOA 4F4BA 3B0VC 4W8KA 4OIRF 2WB7A 2NUPB 2OCCC 3FDQA 1QLEC 4JVSA 2IXNA 2ZXPA 3JCUQ 3I5QA 3GODA 1FFHA 3EGDB 4PJMA 2EINC 4DVZA 3ABLC 4PJNA 2PF4E 3HLZA 4ZLCA 4J32B 1OKKD 1NU7D 5B1BC 3K1IC 2CGEA 3ITFA 4OIQF 5EHHA 1N1CA 5HSWA 2J46A 5T3WA 5DS4A 2KW3C 4O6YA 2HV6A 2IXMA 5CI8A 4E7ZA 2EIKC 4IWBA 3I5PA 4G7HF 4DOZA 3LESA 3POVA 1VK5A 2A69F 4FWVA 1ZU4A 5FCLA 3OEOA 2WZGA 2J9VA 3EG9B 3EHNA 4O6NA 3E70C 2ZXRA 4CIHA 1S7ZA 1LS1A 2DGJA 2M4EA 3QZCA 4XTKA 1MMNA 1WGWA 2WZFA 3Q7GA 5L3VA 2G62A 1Z3IX 3LNRA 1TWAA 5KYWA 2X51A 2V26A 3H65A 4N06A 4C7OA 1TR2A 3WODF 1ZHTA 5F5FA 4YT2A 4LACB 4CS8C 2YHSA 1ZHWA 4MNDA 2KJGA 2C03A 3RH3A 1TKNA 1VYIA 3ASNC 4XLPF 2R7UA 3DJNB 2MYSA 2PFDA 4G0HA 4K7BA 2Q9BA 2GFHA 2PP4A 4KBLA 2R7WA 2R7RA 3FVYA 3KKBA 4G7ZF 3LEVA 1TWCA 3AG1C 4M63A 4BJ6C 4FX5A 2J9UA 2VH3A 5T3TA 4U5CE 4G7OF 1FFTC 2XRHA 3AG2C 4KI2A 4DBQA 3MX3A 3QMKA 4BG0A 4BJTA 3W2WA 3SYNA 5BUOA 4KNVA 1RJ9A 3KL4A 3VAYA 4JJFA 2EIMC 5KYXB 3K33A 4OIPF 3X1OA 3PHF2 1MNEA 3RYLA 3F47A 4HEAJ 3EHMA 4I1OB 3S28A 1FMVA 3W2VA 3LJBA 4AE4A 4DBRA 2PX0A 1IZMA 4GYTA 3NKEA 4I3MA 1M2VA 2EILC 3V7OA 1VMAA 1ZYRF 2H7OA 4YT5A 1QZXA 1Z6AA 3E9VA 2Y69C 4JURI 3Q6MA 4EBBA 4ZLDA 2IOQA 4C3BA 2R7SA 2QTVA 3K7DA 4BJ5C 1JPNA 2W4MA 1Z23A 3PMRA 1J8YF 4CS8A 1D0XA 4HFFB 1FMWA 3ASOC 1PD0A 4YT4A 4PJLA 2CW0F 2Q9AA 1NG1A 1SF8A 1V55C 1OCRC 5IY5C 4K0DA 3DAFA 4XWJA 1OCOC 4CSAC 3DM5A 1SMYF 2NUTA 3EQLF 1M57C 4JZAA 3S29A 4BJ6A 2XXAB 4E7SA 3KMIA 1D1BA 3LS0A 3ZG1A 3AG3C 1VYKA 3T4RA 4KC9A 3CQZA 2DYSC 3Q7LA 3EZHA 5T1DB 1D1AA 4JW1A 3NYMA 3WG7C 2W4BA 2NUPA 1LKXA 4MQ9F 2DYRC 3UMIA 5DLJA 3W8HA 4WJ0A 4Q4ZF 1M2OA 3ZIBA 4JJGA 2B0JA 3EGDA 2H7BA 4RBNA 5F5HA 4IJJA 2QY9A 5DS6A 2CDQA 3EGXB 3JYHA 1D0YA 2L81A 2YZSA 2O9XA 1ZU5A 2NG1A 3N24A 1PCXA 3HTKC 2E87A 1MNDA 3EFOB 5B1AC 4CBEA 4PFPA 4U5FE 1LVKA 1V54C 5DVWA 2IXOA 3HJCA 3LLKA 3VYWA 4BJ5A 1W2WA 2OG2A 2WVNA 4CS9C 3RIPA 3EG9A 2HV7A 3AG4C 5KYYB 4PK4A 3ECSA 3DM9B 3SZRA 3B0PA 1ST6A 4O6MA 4B6IA 5KYUA 3EJNA 2J0WA 2R7TA 1SZIA 3NG1A 2Y3HA 5E2QA 3RFYA 2J7PA 4AX2A 3GANA 4RD9A 2J0XA 4PJJA 4JCHA 1OCZC 4X0RA 3CZ6A 1KU2A 3K66A 4YT8A 1JPJA 1O87A 2XSEA 4YWQA 3Q6NA 1Z5ZA 3SEOA 2H7VC 2WVQA 4LERA 3O39A 3T6JA 3L0IA 4O7GA 3DMDA 3OWTA 1O5HA 2J9WA 2BE5F 2Y3BA 3M1CB 2J45A 3LLIA 1TWGA 3NYLA 3JRTA 4A2NB 3UNGC 4LLCA 2P6VA 4Q7CA 1IW7F 2ZPAA 4PFOA 2CNWA 3T6BA 1MMAA 2C04A 2R7VA 2VB6A 3DAGA 1J8MF 2KGOA 1BR2A 2Y3DA 3EH2A 4Q5SF 4XLNF 1TWHA 3FAJA 3N0TA 2JD3A 3UMHA 5KYXA 4NY3A 5KYWB 4I44A 4O79A 4C7OB 4I1MA 5D91A 5E3AA 4CS9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V7O A;  2I8B A;  5T3T A;  5DVW A;  5T3W A; 
#chains in the Genus database with same CATH topology
 3LS1 A;  3HNK A;  5E33 A;  5GPG B;  1CGN A;  3VRC A;  2JPU A;  3TD7 A;  4CJO A;  5L0C A;  2L6F A;  2KQ9 A;  2P0N A;  3CSK A;  4L6R A;  4C3D A;  2VAS A;  2A68 F;  1G8X A;  3AQB A;  3WHN A;  4U5B E;  1T6U A;  3JSZ A;  3DJU B;  3ZVR A;  1LS4 A;  3QW1 A;  2V3C C;  4E17 A;  2XL8 A;  2L7A A;  1BZ4 A;  2R7Q A;  1MMG A;  4LLE A;  2NSF A;  4XPW A;  1QSP A;  5DS5 A;  4DRJ B;  4YJW A;  3DZA A;  3BRJ A;  4J30 B;  1SYQ A;  2JX0 A;  1OW8 A;  3KH2 A;  2J9B A;  4OIO F;  3EH1 A;  3GM2 A;  4H4K C;  4QDL A;  4QI2 A;  2G3V A;  1U0B B;  2PBE A;  2P7V A;  3ZSU A;  4HE8 D;  4NTF A;  1KTM A;  2G3K A;  2MWQ A;  2A0B A;  2A6H F;  1DOV A;  1Y6D A;  1UFB A;  1ZW3 A;  1LE4 A;  3L34 A;  3ZTM A;  1FTS A;  4MTF A;  1MQV A;  4XPX A;  4JTA B;  1OKK A;  4IB4 A;  2YLG A;  1T6Q A;  4U9D A;  1H6G A;  2XLH A;  2D4U A;  1ORY A;  3HNJ A;  4HFK B;  1TQG A;  2PX3 A;  4IRU A;  4E0I A;  5CIV A;  3AQC A;  4BJ1 A;  4IAO A;  5KYU B;  5E3C A;  4JTD B;  1T5O A;  1Y4C A;  2EIJ C;  2Q3T A;  3MLG A;  1Q0M A;  4KNW A;  4IGG A;  3VM6 A;  2FFH A;  3C63 A;  1RJ9 B;  2HSQ A;  5FZT A;  1RCP A;  3B0U X;  3GOR A;  3UR3 C;  3ABK C;  2OEX A;  1M6T A;  1NZE A;  2KC3 A;  2J7P D;  3K6B A;  3R2P A;  3FOP A;  4DVY P;  5L0H A;  4LDK A;  1BR4 A;  2A6E F;  3UMK A;  2A1D D;  3B9Q A;  5COF A;  5A6K A;  3S0X A;  2XXA A;  1F1M A;  2WL8 A;  2W9Y A;  2HJ3 A;  1HMO A;  2Q9C A;  1D1C A;  3RQF A;  3I4U A;  1ZHX A;  1NU9 C;  2CYD A;  1MMD A;  1H7I A;  1HY5 A;  5DQT A;  4G78 A;  2Y3G A;  2YRF A;  1BR1 A;  4AE4 B;  4C3E A;  4N4W A;  1ZHZ A;  2FGY A;  3LAY A;  5KYN A;  1M2V B;  3F46 A;  2RD9 A;  2BC5 A;  4ULW A;  4GQH A;  5BQG A;  4MW8 A;  1VOM A;  1YZC A;  1ZZP A;  2XLD A;  1QPU A;  3JSE O;  2B0H A;  4NQF A;  4OD4 A;  3AGU A;  3NMI A;  4U5E E;  2WZL A;  4ER9 A;  1YJG A;  2D5R B;  2LSE A;  2GWW A;  5JSL A;  3BEH A;  3RKO F;  3TOM A;  4CSA A;  3N2Z B;  3X2Q C;  3UGO A;  2VCB A;  2EPM X;  3DKA A;  1LPE A;  3SP1 A;  3NKD A;  4QI0 A;  1OCC C;  2HMZ A;  4LDR A;  1ZHY A;  1ZW2 A;  2R9R B;  3NDB B;  3EZI A;  1M56 C;  1WTY A;  1EQ1 A;  5L3Q A;  3FHD A;  3GEE A;  1OW7 A;  5K0I A;  3EGX A;  2GA0 A;  2NPU A;  4MVZ A;  2CNW D;  4U5H A;  5D92 A;  3V5Y A;  4RDA A;  5A6A A;  3J06 A;  1JMW A;  2L9J A;  3QVZ A;  4GEH A;  2Y39 A;  4JTC B;  5JLI A;  2I8B A;  2R7X A;  3DXJ F;  4JRZ A;  4EBJ A;  2Z15 A;  1Z63 A;  4U5G A;  3EPV A;  3PCV A;  3EFO A;  2W45 A;  3M15 A;  3DD7 A;  3OA1 A;  4U5D E;  2H8A A;  3IEE A;  4MTO A;  4R32 A;  4YL3 A;  3SNH A;  3DE9 A;  5B3S C;  4CS7 A;  1OR2 A;  4EWC A;  4J7T A;  3NRH A;  2QLA A;  3JT1 A;  4BEJ A;  1S05 A;  1U89 A;  2NUT B;  3U8P A;  3SXZ A;  4OIN F;  5DQZ A;  4PAC A;  5CI9 A;  1Q0G A;  3K1H A;  1K40 A;  3UGP A;  3NYJ A;  3O6X A;  2IYL D;  1JAF A;  3RVZ A;  3L1M A;  5EGY A;  2LK4 A;  4N6H A;  3M4C A;  1OW6 A;  2HSB A;  2BL2 A;  2ZXO A;  2ZXW C;  2XL4 A;  4FES A;  4OD5 A;  3W8I A;  5KYY A;  1YYJ A;  2IXP A;  2KNH A;  4YN0 B;  3S27 A;  1GM5 A;  2R7O A;  2YEV A;  1GS9 A;  4JCZ A;  4ANJ A;  5A69 A;  4CIP A;  2XM0 A;  3ABM C;  1D0Z A;  1SR2 A;  1K04 A;  1PD1 A;  4P6I C;  3ZC4 A;  3C8G B;  5L0G A;  4XEV A;  3C8G D;  1C02 A;  1EA8 A;  1OQC A;  2WVO A;  3H2V A;  4MS2 A;  1A7V A;  1FAP B;  4AK9 A;  4F4B A;  3B0V C;  3GEH A;  2EPL X;  3GM1 A;  1FR0 A;  3G50 A;  4W8K A;  2LFD A;  3MBG A;  4WGZ A;  2WB7 A;  5AGF A;  5JP7 A;  4OIR F;  1TFO B;  4K1O A;  2NUP B;  2OCC C;  3FDQ A;  5F28 E;  1ORS C;  1QLE C;  1RMV A;  2X0C A;  4JVS A;  2AWC A;  1YA9 A;  1C17 M;  2IXN A;  2ZXP A;  3US6 A;  3JCU Q;  2XLO A;  3I5Q A;  3B71 A;  3GOD A;  4JKV A;  1FFH A;  3EGD B;  4PJM A;  2EIN C;  4DVZ A;  3ABL C;  3TOL A;  4PJN A;  1A7D A;  2PF4 E;  3HLZ A;  4JC7 A;  1JR8 A;  4ZLC A;  4J32 B;  3ZQV A;  1OKK D;  1NU7 D;  2HZ8 A;  5B1B C;  3K1I C;  5A6B A;  2CGE A;  3ITF A;  4OIQ F;  5EHH A;  4MVQ A;  2KK1 A;  1N1C A;  5HSW A;  1OXK A;  4XPY A;  1AUE A;  2L6G A;  1B68 A;  2J46 A;  5T3W A;  5DS4 A;  2KW3 C;  3H2U A;  2HV6 A;  3AGT A;  2IXM A;  4O6Y A;  5CI8 A;  4E7Z A;  2EIK C;  3AJM A;  4IWB A;  3DI5 A;  1OR3 A;  3I5P A;  3C62 A;  4G7H F;  4DOZ A;  2OKU A;  4P9T A;  4H54 A;  3LES A;  1YZA A;  3POV A;  4NTA A;  2A69 F;  1VK5 A;  3U5S A;  4FWV A;  4PR9 A;  1ZU4 A;  5FCL A;  3OEO A;  2WZG A;  2J9V A;  3EG9 B;  1LI7 A;  3EHN A;  3U2M A;  4O6N A;  3E70 C;  1YDI A;  4YL1 A;  3IQ5 A;  2LP4 A;  2ZXR A;  4CIH A;  1S7Z A;  2LCH A;  1LS1 A;  2DGJ A;  2M4E A;  3KYJ A;  3QZC A;  4XTK A;  1NLX A;  2XLV A;  1G4U S;  2OQM A;  2YQY A;  3V5X A;  1MMN A;  1T6I A;  1WGW A;  5L0D A;  2WZF A;  3Q7G A;  5L3V A;  2G62 A;  1Z3I X;  2YL1 A;  3LNR A;  1TWA A;  1PV3 A;  4J7Y A;  5KYW A;  3HNI A;  2X51 A;  2V26 A;  3H65 A;  3PDM P;  3ZTZ A;  1V74 B;  4EKW A;  4N06 A;  2HUJ A;  1TR2 A;  3WOD F;  4C7O A;  1ZHT A;  5F5F A;  3U3B A;  3CAX A;  3ZDL A;  3JTL O;  4BEM J;  4YT2 A;  4LAC B;  1RKE B;  3AOU A;  3NMJ A;  2RSE B;  4JIO A;  4CS8 C;  2XM4 A;  1CGO A;  2YHS A;  5L0I A;  1ZHW A;  4MND A;  2KJG A;  3U0C A;  1K05 A;  2C03 A;  4P9F A;  3RH3 A;  1TKN A;  1VYI A;  4YK5 A;  2EPO A;  3ASN C;  4XLP F;  2R7U A;  1CPQ A;  3DJN B;  2MYS A;  4XQ1 A;  1JOG A;  4WGY A;  4AL0 A;  4E18 A;  2PFD A;  4G0H A;  3A9C A;  4ONS A;  4K7B A;  1WAT A;  2Q9B A;  3FMS A;  4E0H A;  2GFH A;  1H9T A;  5AC4 A;  3TJ5 A;  1Q0K A;  2LIG A;  2PP4 A;  4KBL A;  3G4X A;  2Q00 A;  2R7W A;  4DXW A;  3O55 A;  1R4T A;  2R7R A;  3FVY A;  3KKB A;  2XLE A;  1L3P A;  4G7Z F;  3JZ0 A;  1TWC A;  3LEV A;  2ICW G;  2XLM A;  3AG1 C;  2EPN A;  4M63 A;  3WAQ A;  4BJ6 C;  4FX5 A;  5JUA A;  2J9U A;  2VH3 A;  3U9J A;  1HE9 A;  4U5C E;  5T3T A;  4G7O F;  4Z9H A;  1FFT C;  2XRH A;  2XS1 A;  3RQE A;  3AG2 C;  4KI2 A;  4DBQ A;  2ASR A;  2R03 A;  3MX3 A;  3QMK A;  4BG0 A;  4BJT A;  4A4A A;  3TUL A;  3GWL A;  3W2W A;  3SYN A;  5BUO A;  3QTH A;  3K1I A;  1XZQ A;  2CCY A;  4NC3 A;  4KNV A;  1RJ9 A;  1AEP A;  4EBK A;  3KL4 A;  3LNM B;  3VAY A;  4JJF A;  1UG7 A;  2EIM C;  4NTB A;  2YLI A;  1QQ3 A;  3K33 A;  5KYX B;  2OEV A;  4OIP F;  5B3I A;  3X1O A;  5L0J A;  3PHF 2;  1MNE A;  3RYL A;  3MYF A;  1U6H A;  3TJ6 A;  2DB4 A;  1CPR A;  3F47 A;  4HEA J;  3EHM A;  4I1O B;  3S28 A;  1FMV A;  3W2V A;  3LJB A;  5A6J A;  2HKV A;  4AE4 A;  2PX0 A;  1IZM A;  4GYT A;  3T9O A;  4DBR A;  3NKE A;  4I3M A;  2XL6 A;  1M2V A;  2OOC A;  2EIL C;  3V7O A;  1VMA A;  1ZYR F;  2H7O A;  4IAR A;  4YT5 A;  1QZX A;  2YKZ A;  1H9G A;  4YL0 A;  3S90 A;  5JS5 A;  1Z6A A;  5A6B D;  3E9V A;  2DI3 A;  1VLT A;  1YYX A;  2Y69 C;  3IPM O;  3MYI A;  4JUR I;  1WAS A;  3U3F A;  1OXB A;  1O3U A;  2AWY A;  2GDC A;  1NFO A;  3Q6M A;  4EBB A;  4ZLD A;  2IOQ A;  1RKC A;  2LD6 A;  2LFF A;  4C3B A;  1E84 A;  2R7S A;  4EIY A;  2QTV A;  3K7D A;  4BJ5 C;  3JYY A;  2YL7 A;  1JPN A;  5COG A;  2W4M A;  1Z23 A;  3PMR A;  4ULV A;  1J8Y F;  1HMD A;  1D0X A;  4HFF B;  4CS8 A;  3B29 A;  4LDQ A;  1FMW A;  3ASO C;  4CX9 A;  3GEI A;  5BQI A;  1PD0 A;  4YT4 A;  1T01 A;  2YLD A;  4JEA A;  4PJL A;  1WN0 A;  2CW0 F;  3GM3 A;  1XWJ A;  2Q9A A;  1NG1 A;  1SF8 A;  1G5Z A;  1V55 C;  4MVU A;  3TK0 A;  1OCR C;  5IY5 C;  3C18 A;  4K0D A;  3DAF A;  1G4W R;  3LUT B;  4XWJ A;  3RVY A;  1OCO C;  4CSA C;  3DM5 A;  1I5N A;  1SMY F;  3SXM A;  2NUT A;  3U9M A;  4CJG A;  1QVX A;  3EQL F;  2UUH A;  5BQH A;  1HE1 A;  2OJQ A;  1M57 C;  4JZA A;  3S29 A;  4BJ6 A;  2XXA B;  4E7S A;  3KMI A;  1NFN A;  3HNL A;  3JRM O;  1D1B A;  3LS0 A;  3IHU A;  3AG3 C;  4JE9 A;  1YAU O;  3ZG1 A;  1VYK A;  3T4R A;  4AL1 A;  3A11 A;  4KC9 A;  2L6H A;  2AP3 A;  3CQZ A;  2DYS C;  3U2L A;  3Q7L A;  256B A;  2HJM A;  3EZH A;  3C8G A;  5T1D B;  2MHR A;  1D1A A;  3ZQY A;  4JW1 A;  3M79 A;  1JRA A;  3NYM A;  1L7C A;  3O10 A;  3T6G B;  4JEB A;  3WG7 C;  4BPM A;  4DRH B;  1LE2 A;  3C7J A;  4MVO A;  1KNY A;  2W4B A;  1Q0D A;  3RF3 A;  2F22 A;  2I15 A;  4FAP B;  1APC A;  2NUP A;  1LKX A;  4MQ9 F;  2DYR C;  2Q7R A;  2YVK A;  3FAP B;  1BBH A;  3UMI A;  4EHP A;  3DE8 A;  3L8I A;  5DLJ A;  3W8H A;  4WJ0 A;  4Q4Z F;  1M2O A;  3ZIB A;  4JJG A;  2XLW A;  2TMV P;  2B0J A;  2KYH A;  3EGD A;  2H7B A;  4RBN A;  5F5H A;  2P61 A;  1I4Y A;  4IJJ A;  3C8Z A;  2HS5 A;  1LIH A;  1DOW A;  2QY9 A;  3ATP A;  2CDQ A;  3EGX B;  5DS6 A;  3R7C A;  3JYH A;  1D0Y A;  1YAR O;  2L81 A;  2YZS A;  3FXH A;  2QUP A;  2O9X A;  1ZU5 A;  1XZP A;  3TQO A;  2NG1 A;  3V5Z A;  3N24 A;  3SXK A;  1PCX A;  1E85 A;  2VCA A;  2AVK A;  3HTK C;  3QW0 A;  3ZWI A;  2E87 A;  2NSG A;  1MND A;  3EFO B;  4N6C A;  3U8V A;  5B1A C;  4CBE A;  4PFP A;  2J8W A;  4U5F E;  1LVK A;  1V54 C;  1EKY A;  5DVW A;  2IXO A;  3NMK A;  1QKR A;  2IM8 A;  1V4A A;  1VLS A;  3HJC A;  4MVM A;  2QE9 A;  4U9E A;  3LLK A;  1Z7Q c;  1CGM E;  1I4Z A;  2FAP B;  3VYW A;  2XS8 A;  4MVR A;  4BJ5 A;  1W2W A;  1HW1 A;  2OG2 A;  2AU5 A;  2WVN A;  3M4B A;  4CS9 C;  2R02 A;  3RIP A;  3EG9 A;  2HV7 A;  1AVO B;  3AG4 C;  3RQG A;  5KYY B;  4PK4 A;  3ECS A;  3DM9 B;  1HW2 A;  2YL3 A;  4DRI B;  3RW0 A;  3SZR A;  3B0P A;  2KSF A;  1ST6 A;  4O6M A;  5AC5 A;  1LI5 A;  4B6I A;  5KYU A;  4UDV A;  2YWA A;  2M64 A;  3EJN A;  2J0W A;  2R7T A;  2A0U A;  5TJ5 E;  1SZI A;  4WAB A;  3NG1 A;  4DJ9 A;  3KPH A;  4EUK B;  1ORJ A;  1YA7 O;  2Y3H A;  5E2Q A;  3RFY A;  2J7P A;  4MVS A;  3GAN A;  4AX2 A;  4RD9 A;  4IAQ A;  2ZD9 A;  1E2X A;  2J0X A;  2VC9 A;  1T9K A;  3QVY A;  5L0F A;  1FNT c;  2R25 A;  4PJJ A;  1BDJ B;  3W4Y A;  1LM3 B;  3DWW A;  3L8J A;  1OCZ C;  2HMQ A;  3G4Z A;  4JCH A;  1ZVZ A;  3CZ6 A;  4X0R A;  1KU2 A;  3K66 A;  1RKE A;  4CDY A;  4YT8 A;  1JPJ A;  1O87 A;  5COM A;  4D4N A;  5JVE A;  3SXY A;  4CDA A;  2XSE A;  4YWQ A;  3GWN A;  3Q6N A;  1Z5Z A;  1E86 A;  3HKK A;  3SEO A;  1NBB A;  2H7V C;  4CDV A;  2WVQ A;  3S9O A;  4XEF A;  4LER A;  3O39 A;  3VF0 A;  3T6J A;  1RXQ A;  3L0I A;  4O7G A;  3DMD A;  4W8P A;  3OWT A;  1O5H A;  5JT4 A;  1VTM P;  3KYI A;  2ETS A;  2J9W A;  1TFK B;  2BE5 F;  2Y3B A;  3S84 A;  1E83 A;  3M1C B;  5HV9 A;  2J45 A;  4MW3 A;  3CEX A;  2R05 A;  3LLI A;  1TWG A;  3NYL A;  2QNL A;  2PNO A;  3JRT A;  1GQA A;  2P1A A;  2OU6 A;  1VB5 A;  4A2N B;  2HFI A;  4LLC A;  2P6V A;  2VCC A;  1A0B A;  4Q7C A;  1YLM A;  1IW7 F;  3UNG C;  1A41 A;  2ZPA A;  4PFO A;  2CNW A;  2OJE D;  3T6B A;  1MMA A;  3IQ6 A;  2C04 A;  4XEK A;  2R7V A;  2UUI A;  5JRA A;  3MFN A;  5EK0 A;  2Q4F A;  4D4X A;  2VB6 A;  1R5I D;  1J8M F;  3DAG A;  1GGQ A;  4Z9I A;  1YVI A;  5E3A A;  1Q0F A;  2EPK X;  2KGO A;  2LQG A;  1C03 A;  1BR2 A;  2IBF A;  4MTG A;  2Y3D A;  3IQC A;  1WOL A;  3IQT A;  3EH2 A;  4Q5S F;  4XLN F;  1TWH A;  3FAJ A;  1A7E A;  4NCQ A;  2GAQ A;  1NSG B;  3FOO A;  3N0T A;  2JD3 A;  3UMH A;  5KYX A;  4NY3 A;  5KYW B;  4I44 A;  1WWP A;  2YL0 A;  3LEO A;  4O79 A;  4C7O B;  4I1M A;  4Z9J A;  5D91 A;  1EI7 A;  4CS9 A; 
#chains in the Genus database with same CATH homology
 3LS1 A;  5E33 A;  3TD7 A;  2KQ9 A;  3CSK A;  4C3D A;  2VAS A;  2A68 F;  1G8X A;  3AQB A;  4U5B E;  3JSZ A;  3DJU B;  3ZVR A;  2V3C C;  2R7Q A;  1MMG A;  4LLE A;  5DS5 A;  4YJW A;  3DZA A;  4J30 B;  3KH2 A;  4OIO F;  3EH1 A;  4H4K C;  4QDL A;  4QI2 A;  2G3V A;  2P7V A;  3ZSU A;  4HE8 D;  2G3K A;  2MWQ A;  2A6H F;  3L34 A;  1FTS A;  1OKK A;  4HFK B;  2PX3 A;  4IRU A;  3AQC A;  4BJ1 A;  4IAO A;  5KYU B;  5E3C A;  4KNW A;  2EIJ C;  2Q3T A;  3MLG A;  2FFH A;  1RJ9 B;  3B0U X;  3UR3 C;  3ABK C;  1NZE A;  2J7P D;  3K6B A;  4DVY P;  1BR4 A;  2A6E F;  3UMK A;  2A1D D;  3B9Q A;  3S0X A;  2XXA A;  2WL8 A;  2W9Y A;  2Q9C A;  1D1C A;  3I4U A;  1ZHX A;  1NU9 C;  1MMD A;  5DQT A;  2Y3G A;  1BR1 A;  4AE4 B;  4C3E A;  1ZHZ A;  2FGY A;  3LAY A;  5KYN A;  1M2V B;  3F46 A;  4ULW A;  1VOM A;  4OD4 A;  4U5E E;  2WZL A;  2D5R B;  2LSE A;  3RKO F;  4CSA A;  3N2Z B;  3X2Q C;  3UGO A;  3SP1 A;  3NKD A;  4QI0 A;  1OCC C;  1ZHY A;  3NDB B;  3EZI A;  1M56 C;  5L3Q A;  3FHD A;  3EGX A;  2CNW D;  4U5H A;  5D92 A;  4RDA A;  2L9J A;  4GEH A;  2Y39 A;  2R7X A;  2I8B A;  3DXJ F;  1Z63 A;  2Z15 A;  4U5G A;  3EPV A;  3EFO A;  2W45 A;  3OA1 A;  3DD7 A;  4U5D E;  3IEE A;  3SNH A;  5B3S C;  4CS7 A;  4EWC A;  3NRH A;  3JT1 A;  4BEJ A;  2NUT B;  4OIN F;  5DQZ A;  5CI9 A;  3K1H A;  3UGP A;  3NYJ A;  3O6X A;  2IYL D;  5EGY A;  3W8I A;  4OD5 A;  2ZXO A;  2ZXW C;  2XL4 A;  4FES A;  5KYY A;  2IXP A;  4YN0 B;  2KNH A;  3S27 A;  2R7O A;  2YEV A;  4ANJ A;  3ABM C;  1D0Z A;  4P6I C;  1PD1 A;  3ZC4 A;  4AK9 A;  2WVO A;  4F4B A;  3B0V C;  4W8K A;  4OIR F;  2WB7 A;  2NUP B;  2OCC C;  3FDQ A;  1QLE C;  4JVS A;  2IXN A;  2ZXP A;  3JCU Q;  3I5Q A;  3GOD A;  1FFH A;  3EGD B;  4PJM A;  2EIN C;  4DVZ A;  3ABL C;  4PJN A;  2PF4 E;  3HLZ A;  4ZLC A;  4J32 B;  1OKK D;  1NU7 D;  5B1B C;  3K1I C;  2CGE A;  3ITF A;  4OIQ F;  5EHH A;  1N1C A;  5HSW A;  2J46 A;  5T3W A;  5DS4 A;  2KW3 C;  4O6Y A;  2HV6 A;  2IXM A;  5CI8 A;  4E7Z A;  2EIK C;  4IWB A;  3I5P A;  4G7H F;  4DOZ A;  3LES A;  3POV A;  1VK5 A;  2A69 F;  4FWV A;  1ZU4 A;  5FCL A;  3OEO A;  2WZG A;  2J9V A;  3EG9 B;  3EHN A;  4O6N A;  3E70 C;  2ZXR A;  4CIH A;  1S7Z A;  1LS1 A;  2DGJ A;  2M4E A;  3QZC A;  4XTK A;  1MMN A;  1WGW A;  2WZF A;  3Q7G A;  5L3V A;  2G62 A;  1Z3I X;  3LNR A;  1TWA A;  5KYW A;  2X51 A;  2V26 A;  3H65 A;  4N06 A;  4C7O A;  1TR2 A;  3WOD F;  1ZHT A;  5F5F A;  4YT2 A;  4LAC B;  4CS8 C;  2YHS A;  1ZHW A;  4MND A;  2KJG A;  2C03 A;  3RH3 A;  1TKN A;  1VYI A;  3ASN C;  4XLP F;  2R7U A;  3DJN B;  2MYS A;  2PFD A;  4G0H A;  4K7B A;  2Q9B A;  2GFH A;  2PP4 A;  4KBL A;  2R7W A;  2R7R A;  3FVY A;  3KKB A;  4G7Z F;  3LEV A;  1TWC A;  3AG1 C;  4M63 A;  4BJ6 C;  4FX5 A;  2J9U A;  2VH3 A;  5T3T A;  4U5C E;  4G7O F;  1FFT C;  2XRH A;  3AG2 C;  4KI2 A;  4DBQ A;  3MX3 A;  3QMK A;  4BG0 A;  4BJT A;  3W2W A;  3SYN A;  5BUO A;  4KNV A;  1RJ9 A;  3KL4 A;  3VAY A;  4JJF A;  2EIM C;  5KYX B;  3K33 A;  4OIP F;  3X1O A;  3PHF 2;  1MNE A;  3RYL A;  3F47 A;  4HEA J;  3EHM A;  4I1O B;  3S28 A;  1FMV A;  3W2V A;  3LJB A;  4AE4 A;  4DBR A;  2PX0 A;  1IZM A;  4GYT A;  3NKE A;  4I3M A;  1M2V A;  2EIL C;  3V7O A;  1VMA A;  1ZYR F;  2H7O A;  4YT5 A;  1QZX A;  1Z6A A;  3E9V A;  2Y69 C;  4JUR I;  3Q6M A;  4EBB A;  4ZLD A;  2IOQ A;  4C3B A;  2R7S A;  2QTV A;  3K7D A;  4BJ5 C;  1JPN A;  2W4M A;  1Z23 A;  3PMR A;  1J8Y F;  4CS8 A;  1D0X A;  4HFF B;  1FMW A;  3ASO C;  1PD0 A;  4YT4 A;  4PJL A;  2CW0 F;  2Q9A A;  1NG1 A;  1SF8 A;  1V55 C;  1OCR C;  5IY5 C;  4K0D A;  3DAF A;  4XWJ A;  1OCO C;  4CSA C;  3DM5 A;  1SMY F;  2NUT A;  3EQL F;  1M57 C;  4JZA A;  3S29 A;  4BJ6 A;  2XXA B;  4E7S A;  3KMI A;  1D1B A;  3LS0 A;  3ZG1 A;  3AG3 C;  1VYK A;  3T4R A;  4KC9 A;  3CQZ A;  2DYS C;  3Q7L A;  3EZH A;  5T1D B;  1D1A A;  4JW1 A;  3NYM A;  3WG7 C;  2W4B A;  2NUP A;  1LKX A;  4MQ9 F;  2DYR C;  3UMI A;  5DLJ A;  3W8H A;  4WJ0 A;  4Q4Z F;  1M2O A;  3ZIB A;  4JJG A;  2B0J A;  3EGD A;  2H7B A;  4RBN A;  5F5H A;  4IJJ A;  2QY9 A;  5DS6 A;  2CDQ A;  3EGX B;  3JYH A;  1D0Y A;  2L81 A;  2YZS A;  2O9X A;  1ZU5 A;  2NG1 A;  3N24 A;  1PCX A;  3HTK C;  2E87 A;  1MND A;  3EFO B;  5B1A C;  4CBE A;  4PFP A;  4U5F E;  1LVK A;  1V54 C;  5DVW A;  2IXO A;  3HJC A;  3LLK A;  3VYW A;  4BJ5 A;  1W2W A;  2OG2 A;  2WVN A;  4CS9 C;  3RIP A;  3EG9 A;  2HV7 A;  3AG4 C;  5KYY B;  4PK4 A;  3ECS A;  3DM9 B;  3SZR A;  3B0P A;  1ST6 A;  4O6M A;  4B6I A;  5KYU A;  3EJN A;  2J0W A;  2R7T A;  1SZI A;  3NG1 A;  2Y3H A;  5E2Q A;  3RFY A;  2J7P A;  4AX2 A;  3GAN A;  4RD9 A;  2J0X A;  4PJJ A;  4JCH A;  1OCZ C;  4X0R A;  3CZ6 A;  1KU2 A;  3K66 A;  4YT8 A;  1JPJ A;  1O87 A;  2XSE A;  4YWQ A;  3Q6N A;  1Z5Z A;  3SEO A;  2H7V C;  2WVQ A;  4LER A;  3O39 A;  3T6J A;  3L0I A;  4O7G A;  3DMD A;  3OWT A;  1O5H A;  2J9W A;  2BE5 F;  2Y3B A;  3M1C B;  2J45 A;  3LLI A;  1TWG A;  3NYL A;  3JRT A;  4A2N B;  3UNG C;  4LLC A;  2P6V A;  4Q7C A;  1IW7 F;  2ZPA A;  4PFO A;  2CNW A;  3T6B A;  1MMA A;  2C04 A;  2R7V A;  2VB6 A;  3DAG A;  1J8M F;  2KGO A;  1BR2 A;  2Y3D A;  3EH2 A;  4Q5S F;  4XLN F;  1TWH A;  3FAJ A;  3N0T A;  2JD3 A;  3UMH A;  5KYX A;  4NY3 A;  5KYW B;  4I44 A;  4O79 A;  4C7O B;  4I1M A;  5D91 A;  5E3A A;  4CS9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...