5T3WA

Marburg virus vp30 bound to nucleoprotein
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
153
structure length
137
Chain Sequence
VDLPPPPLYADVLTLENLGHILSYLHRSEIGKLDETSLRAALSLTCAGIRKTNRSLINTMTELHMNHENLPQDQNGVIKQTYTGIHLDKGGQFEAALWQGWDKRSISLFVQAALYVMNNIPCESSISVQASYDHFIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords Fusion protein of Nucleoprotein and Minor nucleoprotein VP30
publication title The Ebola Virus VP30-NP Interaction Is a Regulator of Viral RNA Synthesis.
pubmed doi rcsb
source organism Lake victoria marburgvirus (strain musoke-80)
total genus 50
structure length 137
sequence length 153
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2016-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11507 Transcript_VP30 Ebola virus-specific transcription factor VP30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1160 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 5t3wA00
5T3WA 5DVWA 5T3TA 3V7OA 2I8BA
chains in the Genus database with same CATH superfamily
3ABLC 2BE5F 4PJLA 4EHPA 4XPYA 3ZSUA 1OCRC 4LACB 4QI0A 1QQ3A 1EA8A 1S05A 1VLTA 2QTVA 2XL4A 3B0PA 3LJBA 3G4XA 2H7OA 1RKEB 3FOOA 4A4AA 3AOUA 1OW7A 4D4XA 4ER9A 2XRHA 2ETSA 2HZ8A 4A2NB 3TOLA 1CPRA 2PBEA 3C62A 5F5HA 4YL3A 2FGYA 3JTLO 3FDQA 2L6HA 4JJFA 3EHNA 4E17A 2IM8A 2YVKA 4PFPA 2M64A 2FFHA 2J46A 2XL6A 3LEVA 1M57C 1A0BA 3DAGA 4JEBA 5TJ5E 3UNGC 1YJGA 1Z5ZA 4OD4A 3POVA 2J0WA 2EIKC 4IJJA 1U89A 4DOZA 4XLPF 1QSPA 3K7DA 2B0HA 1N1CA 2ZXPA 3GANA 3DE8A 1Z63A 1AVOB 4JW1A 2P6VA 2XM0A 4EIYA 5COMA 2VC9A 2VCAA 2OCCC 4WJ0A 4MNDA 2EPLX 1TFOB 1R4TA 2CYDA 3M4BA 3Q7GA 4CX9A 4W8KA 4KBLA 1Q0KA 2KC3A 2H8AA 5D91A 4JVSA 2L6GA 3GORA 4PJNA 3U2MA 5E3AA 1K40A 3LESA 1AEPA 3DI5A 3DM9B 1O87A 3KL4A 3A9CA 1TWCA 4UDVA 1F1MA 1VOMA 2KW3C 3AJMA 4M63A 4MVMA 2O9XA 3B71A 3F46A 3LLKA 1GS9A 2DI3A 1ZHTA 4L6RA 4E0HA 1WATA 5KYWB 1E85A 3ZDLA 3R7CA 5L0GA 1BR1A 1V55C 4JRZA 3RFYA 3NKDA 4CJGA 5KYYA 3NMIA 3DMDA 3T6BA 3AQBA 1OR2A 1G8XA 1MQVA 1ZU5A 2C03A 4KNWA 3LS0A 3LNRA 2EINC 5L0CA 2Q9CA 2LP4A 4XPXA 2PX3A 5B1BC 4ONSA 2UUHA 1HW1A 1JPJA 2NUPB 2XLEA 4N06A 3RW0A 3KYIA 1ZHWA 4H4KC 5DQTA 2MYSA 5L0DA 3S27A 2R7WA 3I5PA 5L0HA 4YT5A 2UUIA 2L6FA 4OD5A 2CCYA 2DB4A 3B0VC 1M2VB 2YRFA 5E3CA 2NSGA 3C8GA 5B3SC 3M15A 4G0HA 4IARA 1NLXA 3HNJA 2GA0A 2GWWA 4LDKA 3UMKA 1LPEA 1G4WR 4IB4A 4NCQA 1OW6A 3AG3C 4NY3A 4R32A 3TOMA 2XXAB 2OU6A 3DXJF 3F47A 2HV7A 3H2VA 2Q9BA 3MBGA 5GPGB 4DRIB 2KSFA 4G7ZF 4JTCB 4MS2A 3AGTA 3NMJA 3RVYA 2YEVA 4MVSA 4N6HA 4U5EE 4YT2A 1VTMP 2WB7A 3EFOA 1YYJA 4O79A 3IPMO 3RVZA 1LE2A 3TK0A 2ASRA 3C8ZA 1E2XA 3L0IA 4JURI 4YL0A 2HJMA 5FZTA 3A11A 3N0TA 4XEVA 3RQFA 3N2ZB 4C7OA 1Y6DA 3GM1A 1UG7A 2CW0F 1HE9A 1FFTC 1TWHA 4JC7A 3PDMP 4XEFA 1JOGA 4XTKA 3T6JA 3EHMA 4I44A 1M6TA 3K66A 5COGA 2J7PD 2XL8A 1MMAA 2A1DD 4LDRA 2IXNA 1RKEA 2Y3DA 4CS9A 4E18A 2AWYA 3KMIA 3DJNB 1LI5A 3US6A 2KGOA 1FMWA 4U5CE 1J8YF 2IXPA 2G62A 2R03A 1TWAA 3Q6NA 4G78A 1Q0DA 4MVOA 2XS1A 3SEOA 1T6IA 3ATPA 3VF0A 4IAOA 2VH3A 3QZCA 3NDBB 2IXMA 2ZXRA 3GM2A 4N4WA 3GEEA 5L0FA 4DXWA 2W45A 3FVYA 4MQ9F 4MVRA 1E83A 1C03A 2P0NA 2WL8A 1VB5A 1T5OA 3L1MA 3O55A 5JP7A 2YL3A 2A6EF 4BJ5C 1GGQA 3VM6A 4CBEA 3O10A 1MNDA 4EWCA 1RKCA 1Q0GA 3ASNC 2YKZA 5T3TA 4U5FE 5BUOA 3S0XA 2XSEA 1DOWA 4K0DA 1Q0MA 3M1CB 5HSWA 1OKKA 1R5ID 1T9KA 3EG9B 2A69F 2BL2A 3CEXA 1WN0A 1D0XA 4Q4ZF 3DKAA 3V5XA 3FOPA 3MX3A 2L81A 1ZVZA 2IYLD 2YLGA 5BQGA 2PF4E 4OIRF 1FMVA 1CGOA 1SZIA 1WWPA 1YDIA 2Y3GA 3IHUA 4I3MA 5A69A 2A68F 4BEMJ 4YT4A 4P6IC 4MTOA 5JVEA 5KYWA 4JEAA 2ZPAA 1T6UA 2GFHA 2EPOA 4JJGA 3UGPA 1DOVA 2R7QA 1S7ZA 1HY5A 2D5RB 4FESA 1QVXA 2CNWA 2J9BA 2HV6A 3DE9A 3U9MA 3CAXA 2J9UA 3M4CA 5KYXB 1A7DA 4RDAA 2HKVA 1YA7O 4E0IA 3DD7A 2XLOA 1BBHA 3EH2A 4Z9JA 4KC9A 4EBJA 4X0RA 3AGUA 3OA1A 2R7SA 4XWJA 2R7UA 1LS1A 3IEEA 3EGDA 1LVKA 1MMNA 2VB6A 4XLNF 2EILC 4D4NA 2Q3TA 1G4US 4IWBA 4NC3A 2Z15A 1D1BA 1O5HA 1FR0A 4AX2A 4BPMA 1M2VA 3MYFA 2X51A 2GAQA 3JYYA 1M56C 1ZHXA 2YLIA 3QMKA 1NSGB 3SZRA 3VAYA 1YARO 2W4BA 4CDVA 1D0YA 3VRCA 1ORSC 3JYHA 1M2OA 1ORYA 2WZGA 2XXAA 4P9TA 2ZD9A 4ZLDA 3LUTB 1OR3A 2XS8A 3IQ5A 2I8BA 4J7TA 1OXBA 1IW7F 4NTAA 1B68A 3RF3A 2R02A 1ORJA 3KYJA 5EHHA 3OEOA 2D4UA 3FAPB 2G3VA 2EPKX 4O7GA 3TD7A 3V5YA 5AC4A 2BC5A 3ZTZA 5T3WA 3GEHA 3ZWIA 3QVYA 5CI9A 1D1AA 1V74B 2HUJA 3AG1C 5KYUB 4IAQA 3L34A 3SXYA 1D0ZA 3ECSA 2H7VC 2YZSA 1NFNA 2HSQA 2IXOA 2PNOA 5A6BD 4WABA 1LE4A 3ASOC 1PV3A 3ZVRA 4BJTA 3PMRA 3NYJA 4U5DE 3W4YA 1E86A 5T1DB 2JPUA 2GDCA 2Y69C 1Z23A 4YN0B 1UFBA 3AQCA 3QTHA 5L0IA 3RKOF 1TR2A 2WVOA 3FXHA 3EGXB 4F4BA 4WGYA 3UMHA 4Z9IA 3W2VA 1NFOA 3ZIBA 4N6CA 2DYRC 1NU7D 3T6GB 2QLAA 5EGYA 4AK9A 5HV9A 1FNTc 3TULA 3JRTA 4YT8A 4DBRA 1QLEC 4U5GA 4OIPF 4MTFA 5IY5C 1TKNA 2HSBA 2KQ9A 3S84A 4QI2A 1V4AA 2OJED 1IZMA 1JPNA 5B1AC 1T01A 4IGGA 1H6GA 1YZAA 3KH2A 4C3BA 4RD9A 2XLMA 1QKRA 2YWAA 2YHSA 5EK0A 2ICWG 3ABKC 4LDQA 2C04A 3EQLF 4BEJA 1XZPA 4PJMA 2RSEB 2NUTB 4GQHA 4K7BA 1PD0A 2LFFA 4JZAA 3EG9A 5KYNA 3EZIA 1I5NA 1PD1A 3ABMC 3JT1A 3QW1A 1A7VA 1FFHA 3NRHA 1U0BB 3SXZA 3NG1A 3MYIA 3T4RA 5DVWA 3TJ6A 1MMDA 3HKKA 4G7HF 5JRAA 4MVQA 4EBKA 3E70C 4JKVA 1JRAA 2V26A 3WG7C 4LLCA 4NQFA 1VMAA 2LIGA 3WHNA 2MWQA 4NTBA 3I5QA 1YVIA 2Y3HA 4YJWA 2AWCA 3IQ6A 1MMGA 4IRUA 3VYWA 2L7AA 1ZYRF 4CDAA 4CS7A 4FX5A 2JD3A 1GM5A 4J32B 5KYYB 3FHDA 2LFDA 2R7OA 1KTMA 1D1CA 4JTAB 4O6NA 3WAQA 1BDJB 3Q7LA 1BZ4A 2R9RB 5AGFA 4WGZA 3X1OA 2AU5A 3RIPA 1NBBA 1W2WA 5L3QA 2AP3A 1RJ9B 1XZQA 2QE9A 2WVQA 2YL7A 1HMOA 4DRHB 4U5HA 5DQZA 4O6MA 256BA 4FAPB 2LK4A 2HFIA 1APCA 1OCZC 3QVZA 2IOQA 4J7YA 4E7SA 1WOLA 2J9VA 3J06A 1ZW3A 4C3DA 1KU2A 5E2QA 2XLDA 3GWNA 2Q7RA 1YZCA 1L7CA 4JIOA 5E33A 4E7ZA 1RMVA 2F22A 1Q0FA 3DJUB 1CPQA 2RD9A 1TFKB 2W9YA 1KNYA 2YQYA 2OG2A 5JUAA 3B9QA 1TWGA 4O6YA 3C63A 1ZU4A 2A0BA 3JRMO 4AE4B 1EQ1A 4YWQA 5DS4A 3I4UA 3JSZA 4HE8D 3V7OA 4B6IA 2KNHA 1H9GA 4CSAC 1BR2A 2J0XA 5DS5A 1A7EA 2LD6A 2PFDA 4KI2A 3RQGA 3GEIA 1ST6A 3IQTA 4MW8A 3U2LA 1K04A 1OXKA 4OIOF 4CS8A 1ZW2A 5JS5A 2XLWA 4I1OB 4JE9A 1JMWA 4Q5SF 1YA9A 2YLDA 4CS8C 2HJ3A 2J7PA 3K6BA 1J8MF 2NUPA 3NMKA 3U8VA 3T9OA 3ZTMA 3WODF 5A6AA 4CDYA 4CS9C 3JCUQ 1SF8A 4RBNA 4PFOA 3U8PA 3CQZA 3NYLA 5D92A 2P1AA 3U9JA 1AUEA 2Y39A 1A41A 3EGXA 4ZLCA 2B0JA 1HW2A 3N24A 3UGOA 1CGNA 3KKBA 4FWVA 1ZZPA 2Q4FA 4Z9HA 3HNKA 2HMQA 2MHRA 3O39A 3C8GD 4H54A 1QZXA 4NTFA 2QNLA 2XLHA 3SXMA 2H7BA 1T6QA 1LIHA 3K33A 4HFFB 4C3EA 3NYMA 5JLIA 4ULWA 3L8JA 5CI8A 1LI7A 3Q6MA 1ZHYA 3U3BA 1CGME 4MVZA 2I15A 2E87A 1O3UA 1I4YA 1Z3IX 1LM3B 2WZLA 3LLIA 1Y4CA 3EH1A 2NUTA 4OINF 3B29A 2AVKA 3GWLA 2OQMA 4PJJA 1LKXA 4U9DA 2ZXOA 2J45A 3JSEO 4AL0A 1BR4A 2Q9AA 4DVYP 2FAPB 4XEKA 3LAYA 3C18A 4CIHA 2VASA 5DLJA 4HEAJ 3U0CA 4EBBA 3ITFA 2QUPA 2CGEA 3DWWA 1NG1A 2LSEA 1PCXA 2KYHA 3W2WA 1K05A 2G3KA 3S9OA 1SMYF 2R7RA 3UMIA 3M79A 3ZG1A 2OJQA 2QY9A 2A6HF 5K0IA 4K1OA 1Z7Qc 5F28E 2TMVP 1VYKA 3GM3A 2YL0A 3PHF2 3R2PA 3AG4C 4G7OF 5A6JA 4DJ9A 1HMDA 4PR9A 2X0CA 4GEHA 3V5ZA 5JSLA 2LQGA 2NPUA 1FTSA 1YAUO 3QW0A 2HS5A 5COFA 2JX0A 5DS6A 3CSKA 1H7IA 4YK5A 1EI7A 1QPUA 4Q7CA 3UR3C 3BEHA 2M4EA 1NZEA 3O6XA 5BQIA 2EPMX 2Y3BA 2R7VA 5BQHA 5CIVA 3EGDB 1OCOC 1RJ9A 2R25A 2XM4A 4EUKB 3NKEA 4U5BE 3G50A 3W8IA 3ZQYA 1GQAA 3H65A 4OIQF 4PK4A 3ZQVA 1WASA 3S90A 2VCCA 2DGJA 1XWJA 5L3VA 3EPVA 3G4ZA 1VK5A 1Z6AA 2XLVA 4LLEA 4CJOA 2R7TA 3HJCA 3B0UX 1OKKD 1NU9C 1LS4A 2OEVA 2YL1A 3K1IA 3LNMB 4MTGA 1SYQA 3MLGA 3U5SA 1C17M 4P9FA 4AE4A 4DBQA 3IQCA 2DYSC 1FAPB 2P61A 3K1IC 3OWTA 2PP4A 3FAJA 3RQEA 4BG0A 3PCVA 1RXQA 3C7JA 3MFNA 3SXKA 4J30B 5L0JA 1SR2A 2CDQA 2PX0A 5KYXA 3TQOA 3HTKC 4ANJA 3L8IA 2NSFA 5A6BA 2J8WA 4QDLA 2EPNA 3U3FA 2CNWD 5AC5A 2OEXA 4CSAA 4BJ6A 4KNVA 3AG2C 4JCHA 1WGWA 4EKWA 1OQCA 4CIPA 1C02A 3FMSA 1VYIA 3HLZA 2V3CC 3RYLA 4BJ6C 3BRJA 2HMZA 4DVZA 1I4ZA 2P7VA 3K1HA 1MNEA 3RH3A 4MVUA 1ZHZA 2A0UA 4GYTA 4JCZA 4PACA 5FCLA 3C8GB 4LERA 4MW3A 2NG1A 2L9JA 1YYXA 4W8PA 2WZFA 3ZC4A 4AL1A 3CZ6A 3SYNA 4XQ1A 3TJ5A 3LEOA 5JT4A 4HFKB 1VLSA 2J9WA 3SNHA 1L3PA 4BJ5A 1RCPA 1OW8A 3JZ0A 3DZAA 2ZXWC 3HNLA 3E9VA 1G5ZA 1OCCC 1EKYA 2OOCA 2KK1A 1TQGA 3HNIA 2EIJC 3LS1A 1HE1A 4U9EA 3EJNA 3EFOB 1WTYA 2R05A 4JTDB 4YL1A 4BJ1A 5B3IA 3W8HA 5KYUA 5A6KA 3KPHA 4I1MA 3SP1A 2WVNA 2IBFA 3EZHA 3DAFA 2W4MA 5F5FA 2OKUA 1V54C 2LCHA 1JR8A 4DRJB 3S29A 1JAFA 4XPWA 1E84A 4ULVA 4C7OB 1U6HA 2Q00A 2VCBA 3DM5A 3S28A 3X2QC 1YLMA 2R7XA 2EIMC 3GODA 1H9TA 3H2UA 2KJGA
chains in the Genus database with same CATH topology
3ABLC 2BE5F 4PJLA 3ZSUA 1OCRC 4LACB 4QI0A 2QTVA 2XL4A 3B0PA 3LJBA 2H7OA 2XRHA 4A2NB 5F5HA 2FGYA 3FDQA 4JJFA 3EHNA 4PFPA 2FFHA 2J46A 3LEVA 1M57C 3DAGA 3UNGC 1Z5ZA 4OD4A 3POVA 2J0WA 2EIKC 4IJJA 4DOZA 4XLPF 3K7DA 1N1CA 2ZXPA 3GANA 1Z63A 4JW1A 2P6VA 2OCCC 4WJ0A 4MNDA 3Q7GA 4W8KA 4KBLA 5D91A 4JVSA 4PJNA 5E3AA 3LESA 3DM9B 1O87A 3KL4A 1TWCA 4YT4A 1VOMA 2KW3C 4M63A 2O9XA 3F46A 5KYWB 3LLKA 1ZHTA 1BR1A 1V55C 3RFYA 3NKDA 5KYYA 3DMDA 3T6BA 3AQBA 1ZU5A 1G8XA 2C03A 4KNWA 3LS0A 3LNRA 2EINC 2Q9CA 2PX3A 5B1BC 1JPJA 2NUPB 4N06A 4H4KC 1ZHWA 5DQTA 2MYSA 3S27A 2R7WA 3I5PA 4YT5A 4OD5A 3B0VC 1M2VB 5E3CA 5B3SC 4G0HA 3UMKA 4NY3A 2XXAB 3AG3C 3DXJF 3F47A 2HV7A 2Q9BA 4G7ZF 2YEVA 4U5EE 4YT2A 2WB7A 3EFOA 4O79A 4JURI 3L0IA 3N0TA 3N2ZB 4C7OA 2CW0F 1FFTC 1TWHA 4XTKA 3T6JA 3EHMA 4I44A 3K66A 2J7PD 1MMAA 2A1DD 2IXNA 2Y3DA 4CS9A 3KMIA 3DJNB 2KGOA 1FMWA 4U5CE 1J8YF 2IXPA 2G62A 3SEOA 1TWAA 3Q6NA 4CS9C 4IAOA 2VH3A 3QZCA 3NDBB 2IXMA 2ZXRA 2W45A 3FVYA 4MQ9F 2WL8A 2A6EF 4BJ5C 4CBEA 1MNDA 4EWCA 3ASNC 5T3TA 5BUOA 4U5FE 3S0XA 2XSEA 5HSWA 4K0DA 3M1CB 1OKKA 3EG9B 2A69F 1D0XA 4Q4ZF 3MX3A 2L81A 2IYLD 2PF4E 4OIRF 1FMVA 1SZIA 4I3MA 2Y3GA 4CSAA 2A68F 4P6IC 5KYWA 4JJGA 2ZPAA 2GFHA 3UGPA 2R7QA 1S7ZA 2D5RB 4FESA 2CNWA 2HV6A 2J9UA 5KYXB 4RDAA 3DD7A 3EH2A 4KC9A 4X0RA 3OA1A 2R7SA 4XWJA 2R7UA 1LS1A 3IEEA 3EGDA 1LVKA 1MMNA 2VB6A 4XLNF 2EILC 2Q3TA 4IWBA 2Z15A 1D1BA 1O5HA 4AX2A 1M2VA 2X51A 1M56C 1ZHXA 3QMKA 3VAYA 3SZRA 2W4BA 1D0YA 3JYHA 1M2OA 2WZGA 2XXAA 4ZLDA 2I8BA 1IW7F 5EHHA 3OEOA 4O7GA 2G3VA 3TD7A 5T3WA 5CI9A 1D1AA 3AG1C 5KYUB 3L34A 1D0ZA 3ECSA 2H7VC 2YZSA 2IXOA 3ASOC 3ZVRA 4BJTA 3PMRA 3NYJA 4U5DE 5T1DB 2Y69C 1Z23A 4YN0B 3AQCA 3RKOF 1TR2A 2WVOA 3EGXB 4F4BA 3UMHA 3W2VA 3ZIBA 2DYRC 1NU7D 5EGYA 4AK9A 3JRTA 4YT8A 4DBRA 1QLEC 4U5GA 4OIPF 5IY5C 1TKNA 4QI2A 2KQ9A 5B1AC 1IZMA 1JPNA 3KH2A 4C3BA 4RD9A 2YHSA 3ABKC 2C04A 3EQLF 4BEJA 4PJMA 2NUTB 4K7BA 1PD0A 4JZAA 3EG9A 5KYNA 3EZIA 1PD1A 3ABMC 3JT1A 1FFHA 3NRHA 3NG1A 3T4RA 5DVWA 1MMDA 4G7HF 3E70C 2V26A 3WG7C 4LLCA 1VMAA 2MWQA 3I5QA 2Y3HA 4YJWA 3VYWA 1MMGA 4IRUA 1ZYRF 4CS7A 4FX5A 2JD3A 4J32B 5KYYB 3FHDA 2R7OA 1D1CA 4O6NA 3Q7LA 3X1OA 3RIPA 5L3QA 1W2WA 2WVQA 1RJ9B 4U5HA 5DQZA 4O6MA 1OCZC 2IOQA 4E7SA 2J9VA 4C3DA 1KU2A 5E2QA 4E7ZA 5E33A 3DJUB 2W9YA 2OG2A 3B9QA 1TWGA 4O6YA 1ZU4A 4AE4B 4YWQA 5DS4A 3I4UA 3JSZA 4HE8D 3V7OA 4B6IA 2KNHA 4CSAC 1BR2A 2J0XA 5DS5A 4KI2A 2PFDA 1ST6A 4OIOF 4CS8A 4I1OB 4Q5SF 4CS8C 2J7PA 3K6BA 1J8MF 2NUPA 3WODF 3JCUQ 1SF8A 4RBNA 4PFOA 3CQZA 3NYLA 5D92A 2Y39A 3EGXA 4ZLCA 2B0JA 3N24A 3UGOA 3KKBA 4FWVA 3O39A 1QZXA 2H7BA 3K33A 4HFFB 4C3EA 3NYMA 4ULWA 5CI8A 3Q6MA 1ZHYA 2E87A 1Z3IX 3LLIA 2NUTA 2WZLA 3EH1A 4OINF 4PJJA 1LKXA 2ZXOA 2J45A 1BR4A 2Q9AA 4DVYP 3LAYA 4CIHA 2VASA 5DLJA 4HEAJ 4EBBA 3ITFA 2CGEA 1NG1A 2LSEA 1PCXA 3W2WA 2G3KA 1SMYF 2R7RA 3UMIA 3ZG1A 2QY9A 2A6HF 1VYKA 3PHF2 4G7OF 3AG4C 4GEHA 1FTSA 5DS6A 3CSKA 4Q7CA 3UR3C 2M4EA 1NZEA 3O6XA 2Y3BA 2R7VA 3EGDB 1OCOC 1RJ9A 3NKEA 4U5BE 3W8IA 3H65A 4OIQF 4PK4A 2DGJA 5L3VA 3EPVA 1VK5A 1Z6AA 4LLEA 2R7TA 3HJCA 3B0UX 1OKKD 1NU9C 3MLGA 4DBQA 4AE4A 3OWTA 2DYSC 3K1IC 2PP4A 3FAJA 4BG0A 4J30B 2CDQA 2PX0A 5KYXA 3HTKC 4ANJA 4QDLA 2CNWD 4BJ6A 4KNVA 3AG2C 4JCHA 1WGWA 3HLZA 1VYIA 2V3CC 3RYLA 4BJ6C 4DVZA 2P7VA 3K1HA 1MNEA 3RH3A 1ZHZA 4GYTA 5FCLA 4LERA 2NG1A 2L9JA 2WZFA 3ZC4A 3CZ6A 3SYNA 4HFKB 2J9WA 3SNHA 4BJ5A 3DZAA 2ZXWC 3E9VA 1OCCC 3LS1A 2EIJC 3EJNA 3EFOB 4BJ1A 3W8HA 5KYUA 4I1MA 3SP1A 2WVNA 3EZHA 3DAFA 2W4MA 5F5FA 1V54C 4C7OB 3S29A 3X2QC 3DM5A 3S28A 2R7XA 2EIMC 3GODA 2KJGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5T3W A;  5DVW A;  5T3T A;  3V7O A;  2I8B A; 
#chains in the Genus database with same CATH topology
 3ABL C;  2BE5 F;  4PJL A;  4EHP A;  4XPY A;  3ZSU A;  1OCR C;  4LAC B;  4QI0 A;  1QQ3 A;  1EA8 A;  1S05 A;  1VLT A;  2QTV A;  2XL4 A;  3B0P A;  3LJB A;  3G4X A;  2H7O A;  1RKE B;  3FOO A;  4A4A A;  3AOU A;  1OW7 A;  4D4X A;  4ER9 A;  2XRH A;  2ETS A;  2HZ8 A;  4A2N B;  3TOL A;  1CPR A;  2PBE A;  3C62 A;  5F5H A;  4YL3 A;  2FGY A;  3JTL O;  3FDQ A;  2L6H A;  4JJF A;  3EHN A;  4E17 A;  2IM8 A;  2YVK A;  4PFP A;  2M64 A;  2FFH A;  2J46 A;  2XL6 A;  3LEV A;  1M57 C;  1A0B A;  3DAG A;  4JEB A;  5TJ5 E;  3UNG C;  1YJG A;  1Z5Z A;  4OD4 A;  3POV A;  2J0W A;  2EIK C;  4IJJ A;  1U89 A;  4DOZ A;  4XLP F;  1QSP A;  3K7D A;  2B0H A;  1N1C A;  2ZXP A;  3GAN A;  3DE8 A;  1Z63 A;  1AVO B;  4JW1 A;  2P6V A;  2XM0 A;  4EIY A;  5COM A;  2VC9 A;  2VCA A;  2OCC C;  4WJ0 A;  4MND A;  2EPL X;  1TFO B;  1R4T A;  2CYD A;  3M4B A;  3Q7G A;  4CX9 A;  4W8K A;  4KBL A;  1Q0K A;  2KC3 A;  2H8A A;  5D91 A;  4JVS A;  2L6G A;  3GOR A;  4PJN A;  3U2M A;  5E3A A;  1K40 A;  3LES A;  1AEP A;  3DI5 A;  3DM9 B;  1O87 A;  3KL4 A;  3A9C A;  1TWC A;  4UDV A;  1F1M A;  1VOM A;  2KW3 C;  3AJM A;  4M63 A;  4MVM A;  2O9X A;  3B71 A;  3F46 A;  3LLK A;  1GS9 A;  2DI3 A;  1ZHT A;  4L6R A;  4E0H A;  1WAT A;  5KYW B;  1E85 A;  3ZDL A;  3R7C A;  5L0G A;  1BR1 A;  1V55 C;  4JRZ A;  3RFY A;  3NKD A;  4CJG A;  5KYY A;  3NMI A;  3DMD A;  3T6B A;  3AQB A;  1OR2 A;  1G8X A;  1MQV A;  1ZU5 A;  2C03 A;  4KNW A;  3LS0 A;  3LNR A;  2EIN C;  5L0C A;  2Q9C A;  2LP4 A;  4XPX A;  2PX3 A;  5B1B C;  4ONS A;  2UUH A;  1HW1 A;  1JPJ A;  2NUP B;  2XLE A;  4N06 A;  3RW0 A;  3KYI A;  1ZHW A;  4H4K C;  5DQT A;  2MYS A;  5L0D A;  3S27 A;  2R7W A;  3I5P A;  5L0H A;  4YT5 A;  2UUI A;  2L6F A;  4OD5 A;  2CCY A;  2DB4 A;  3B0V C;  1M2V B;  2YRF A;  5E3C A;  2NSG A;  3C8G A;  5B3S C;  3M15 A;  4G0H A;  4IAR A;  1NLX A;  3HNJ A;  2GA0 A;  2GWW A;  4LDK A;  3UMK A;  1LPE A;  1G4W R;  4IB4 A;  4NCQ A;  1OW6 A;  3AG3 C;  4NY3 A;  4R32 A;  3TOM A;  2XXA B;  2OU6 A;  3DXJ F;  3F47 A;  2HV7 A;  3H2V A;  2Q9B A;  3MBG A;  5GPG B;  4DRI B;  2KSF A;  4G7Z F;  4JTC B;  4MS2 A;  3AGT A;  3NMJ A;  3RVY A;  2YEV A;  4MVS A;  4N6H A;  4U5E E;  4YT2 A;  1VTM P;  2WB7 A;  3EFO A;  1YYJ A;  4O79 A;  3IPM O;  3RVZ A;  1LE2 A;  3TK0 A;  2ASR A;  3C8Z A;  1E2X A;  3L0I A;  4JUR I;  4YL0 A;  2HJM A;  5FZT A;  3A11 A;  3N0T A;  4XEV A;  3RQF A;  3N2Z B;  4C7O A;  1Y6D A;  3GM1 A;  1UG7 A;  2CW0 F;  1HE9 A;  1FFT C;  1TWH A;  4JC7 A;  3PDM P;  4XEF A;  1JOG A;  4XTK A;  3T6J A;  3EHM A;  4I44 A;  1M6T A;  3K66 A;  5COG A;  2J7P D;  2XL8 A;  1MMA A;  2A1D D;  4LDR A;  2IXN A;  1RKE A;  2Y3D A;  4CS9 A;  4E18 A;  2AWY A;  3KMI A;  3DJN B;  1LI5 A;  3US6 A;  2KGO A;  1FMW A;  4U5C E;  1J8Y F;  2IXP A;  2G62 A;  2R03 A;  1TWA A;  3Q6N A;  4G78 A;  1Q0D A;  4MVO A;  2XS1 A;  3SEO A;  1T6I A;  3ATP A;  3VF0 A;  4IAO A;  2VH3 A;  3QZC A;  3NDB B;  2IXM A;  2ZXR A;  3GM2 A;  4N4W A;  3GEE A;  5L0F A;  4DXW A;  2W45 A;  3FVY A;  4MQ9 F;  4MVR A;  1E83 A;  1C03 A;  2P0N A;  2WL8 A;  1VB5 A;  1T5O A;  3L1M A;  3O55 A;  5JP7 A;  2YL3 A;  2A6E F;  4BJ5 C;  1GGQ A;  3VM6 A;  4CBE A;  3O10 A;  1MND A;  4EWC A;  1RKC A;  1Q0G A;  3ASN C;  2YKZ A;  5T3T A;  4U5F E;  5BUO A;  3S0X A;  2XSE A;  1DOW A;  4K0D A;  1Q0M A;  3M1C B;  5HSW A;  1OKK A;  1R5I D;  1T9K A;  3EG9 B;  2A69 F;  2BL2 A;  3CEX A;  1WN0 A;  1D0X A;  4Q4Z F;  3DKA A;  3V5X A;  3FOP A;  3MX3 A;  2L81 A;  1ZVZ A;  2IYL D;  2YLG A;  5BQG A;  2PF4 E;  4OIR F;  1FMV A;  1CGO A;  1SZI A;  1WWP A;  1YDI A;  2Y3G A;  3IHU A;  4I3M A;  5A69 A;  2A68 F;  4BEM J;  4YT4 A;  4P6I C;  4MTO A;  5JVE A;  5KYW A;  4JEA A;  2ZPA A;  1T6U A;  2GFH A;  2EPO A;  4JJG A;  3UGP A;  1DOV A;  2R7Q A;  1S7Z A;  1HY5 A;  2D5R B;  4FES A;  1QVX A;  2CNW A;  2J9B A;  2HV6 A;  3DE9 A;  3U9M A;  3CAX A;  2J9U A;  3M4C A;  5KYX B;  1A7D A;  4RDA A;  2HKV A;  1YA7 O;  4E0I A;  3DD7 A;  2XLO A;  1BBH A;  3EH2 A;  4Z9J A;  4KC9 A;  4EBJ A;  4X0R A;  3AGU A;  3OA1 A;  2R7S A;  4XWJ A;  2R7U A;  1LS1 A;  3IEE A;  3EGD A;  1LVK A;  1MMN A;  2VB6 A;  4XLN F;  2EIL C;  4D4N A;  2Q3T A;  1G4U S;  4IWB A;  4NC3 A;  2Z15 A;  1D1B A;  1O5H A;  1FR0 A;  4AX2 A;  4BPM A;  1M2V A;  3MYF A;  2X51 A;  2GAQ A;  3JYY A;  1M56 C;  1ZHX A;  2YLI A;  3QMK A;  1NSG B;  3SZR A;  3VAY A;  1YAR O;  2W4B A;  4CDV A;  1D0Y A;  3VRC A;  1ORS C;  3JYH A;  1M2O A;  1ORY A;  2WZG A;  2XXA A;  4P9T A;  2ZD9 A;  4ZLD A;  3LUT B;  1OR3 A;  2XS8 A;  3IQ5 A;  2I8B A;  4J7T A;  1OXB A;  1IW7 F;  4NTA A;  1B68 A;  3RF3 A;  2R02 A;  1ORJ A;  3KYJ A;  5EHH A;  3OEO A;  2D4U A;  3FAP B;  2G3V A;  2EPK X;  4O7G A;  3TD7 A;  3V5Y A;  5AC4 A;  2BC5 A;  3ZTZ A;  5T3W A;  3GEH A;  3ZWI A;  3QVY A;  5CI9 A;  1D1A A;  1V74 B;  2HUJ A;  3AG1 C;  5KYU B;  4IAQ A;  3L34 A;  3SXY A;  1D0Z A;  3ECS A;  2H7V C;  2YZS A;  1NFN A;  2HSQ A;  2IXO A;  2PNO A;  5A6B D;  4WAB A;  1LE4 A;  3ASO C;  1PV3 A;  3ZVR A;  4BJT A;  3PMR A;  3NYJ A;  4U5D E;  3W4Y A;  1E86 A;  5T1D B;  2JPU A;  2GDC A;  2Y69 C;  1Z23 A;  4YN0 B;  1UFB A;  3AQC A;  3QTH A;  5L0I A;  3RKO F;  1TR2 A;  2WVO A;  3FXH A;  3EGX B;  4F4B A;  4WGY A;  3UMH A;  4Z9I A;  3W2V A;  1NFO A;  3ZIB A;  4N6C A;  2DYR C;  1NU7 D;  3T6G B;  2QLA A;  5EGY A;  4AK9 A;  5HV9 A;  1FNT c;  3TUL A;  3JRT A;  4YT8 A;  4DBR A;  1QLE C;  4U5G A;  4OIP F;  4MTF A;  5IY5 C;  1TKN A;  2HSB A;  2KQ9 A;  3S84 A;  4QI2 A;  1V4A A;  2OJE D;  1IZM A;  1JPN A;  5B1A C;  1T01 A;  4IGG A;  1H6G A;  1YZA A;  3KH2 A;  4C3B A;  4RD9 A;  2XLM A;  1QKR A;  2YWA A;  2YHS A;  5EK0 A;  2ICW G;  3ABK C;  4LDQ A;  2C04 A;  3EQL F;  4BEJ A;  1XZP A;  4PJM A;  2RSE B;  2NUT B;  4GQH A;  4K7B A;  1PD0 A;  2LFF A;  4JZA A;  3EG9 A;  5KYN A;  3EZI A;  1I5N A;  1PD1 A;  3ABM C;  3JT1 A;  3QW1 A;  1A7V A;  1FFH A;  3NRH A;  1U0B B;  3SXZ A;  3NG1 A;  3MYI A;  3T4R A;  5DVW A;  3TJ6 A;  1MMD A;  3HKK A;  4G7H F;  5JRA A;  4MVQ A;  4EBK A;  3E70 C;  4JKV A;  1JRA A;  2V26 A;  3WG7 C;  4LLC A;  4NQF A;  1VMA A;  2LIG A;  3WHN A;  2MWQ A;  4NTB A;  3I5Q A;  1YVI A;  2Y3H A;  4YJW A;  2AWC A;  3IQ6 A;  1MMG A;  4IRU A;  3VYW A;  2L7A A;  1ZYR F;  4CDA A;  4CS7 A;  4FX5 A;  2JD3 A;  1GM5 A;  4J32 B;  5KYY B;  3FHD A;  2LFD A;  2R7O A;  1KTM A;  1D1C A;  4JTA B;  4O6N A;  3WAQ A;  1BDJ B;  3Q7L A;  1BZ4 A;  2R9R B;  5AGF A;  4WGZ A;  3X1O A;  2AU5 A;  3RIP A;  1NBB A;  1W2W A;  5L3Q A;  2AP3 A;  1RJ9 B;  1XZQ A;  2QE9 A;  2WVQ A;  2YL7 A;  1HMO A;  4DRH B;  4U5H A;  5DQZ A;  4O6M A;  256B A;  4FAP B;  2LK4 A;  2HFI A;  1APC A;  1OCZ C;  3QVZ A;  2IOQ A;  4J7Y A;  4E7S A;  1WOL A;  2J9V A;  3J06 A;  1ZW3 A;  4C3D A;  1KU2 A;  5E2Q A;  2XLD A;  3GWN A;  2Q7R A;  1YZC A;  1L7C A;  4JIO A;  5E33 A;  4E7Z A;  1RMV A;  2F22 A;  1Q0F A;  3DJU B;  1CPQ A;  2RD9 A;  1TFK B;  2W9Y A;  1KNY A;  2YQY A;  2OG2 A;  5JUA A;  3B9Q A;  1TWG A;  4O6Y A;  3C63 A;  1ZU4 A;  2A0B A;  3JRM O;  4AE4 B;  1EQ1 A;  4YWQ A;  5DS4 A;  3I4U A;  3JSZ A;  4HE8 D;  3V7O A;  4B6I A;  2KNH A;  1H9G A;  4CSA C;  1BR2 A;  2J0X A;  5DS5 A;  1A7E A;  2LD6 A;  2PFD A;  4KI2 A;  3RQG A;  3GEI A;  1ST6 A;  3IQT A;  4MW8 A;  3U2L A;  1K04 A;  1OXK A;  4OIO F;  4CS8 A;  1ZW2 A;  5JS5 A;  2XLW A;  4I1O B;  4JE9 A;  1JMW A;  4Q5S F;  1YA9 A;  2YLD A;  4CS8 C;  2HJ3 A;  2J7P A;  3K6B A;  1J8M F;  2NUP A;  3NMK A;  3U8V A;  3T9O A;  3ZTM A;  3WOD F;  5A6A A;  4CDY A;  4CS9 C;  3JCU Q;  1SF8 A;  4RBN A;  4PFO A;  3U8P A;  3CQZ A;  3NYL A;  5D92 A;  2P1A A;  3U9J A;  1AUE A;  2Y39 A;  1A41 A;  3EGX A;  4ZLC A;  2B0J A;  1HW2 A;  3N24 A;  3UGO A;  1CGN A;  3KKB A;  4FWV A;  1ZZP A;  2Q4F A;  4Z9H A;  3HNK A;  2HMQ A;  2MHR A;  3O39 A;  3C8G D;  4H54 A;  1QZX A;  4NTF A;  2QNL A;  2XLH A;  3SXM A;  2H7B A;  1T6Q A;  1LIH A;  3K33 A;  4HFF B;  4C3E A;  3NYM A;  5JLI A;  4ULW A;  3L8J A;  5CI8 A;  1LI7 A;  3Q6M A;  1ZHY A;  3U3B A;  1CGM E;  4MVZ A;  2I15 A;  2E87 A;  1O3U A;  1I4Y A;  1Z3I X;  1LM3 B;  2WZL A;  3LLI A;  1Y4C A;  3EH1 A;  2NUT A;  4OIN F;  3B29 A;  2AVK A;  3GWL A;  2OQM A;  4PJJ A;  1LKX A;  4U9D A;  2ZXO A;  2J45 A;  3JSE O;  4AL0 A;  1BR4 A;  2Q9A A;  4DVY P;  2FAP B;  4XEK A;  3LAY A;  3C18 A;  4CIH A;  2VAS A;  5DLJ A;  4HEA J;  3U0C A;  4EBB A;  3ITF A;  2QUP A;  2CGE A;  3DWW A;  1NG1 A;  2LSE A;  1PCX A;  2KYH A;  3W2W A;  1K05 A;  2G3K A;  3S9O A;  1SMY F;  2R7R A;  3UMI A;  3M79 A;  3ZG1 A;  2OJQ A;  2QY9 A;  2A6H F;  5K0I A;  4K1O A;  1Z7Q c;  5F28 E;  2TMV P;  1VYK A;  3GM3 A;  2YL0 A;  3PHF 2;  3R2P A;  3AG4 C;  4G7O F;  5A6J A;  4DJ9 A;  1HMD A;  4PR9 A;  2X0C A;  4GEH A;  3V5Z A;  5JSL A;  2LQG A;  2NPU A;  1FTS A;  1YAU O;  3QW0 A;  2HS5 A;  5COF A;  2JX0 A;  5DS6 A;  3CSK A;  1H7I A;  4YK5 A;  1EI7 A;  1QPU A;  4Q7C A;  3UR3 C;  3BEH A;  2M4E A;  1NZE A;  3O6X A;  5BQI A;  2EPM X;  2Y3B A;  2R7V A;  5BQH A;  5CIV A;  3EGD B;  1OCO C;  1RJ9 A;  2R25 A;  2XM4 A;  4EUK B;  3NKE A;  4U5B E;  3G50 A;  3W8I A;  3ZQY A;  1GQA A;  3H65 A;  4OIQ F;  4PK4 A;  3ZQV A;  1WAS A;  3S90 A;  2VCC A;  2DGJ A;  1XWJ A;  5L3V A;  3EPV A;  3G4Z A;  1VK5 A;  1Z6A A;  2XLV A;  4LLE A;  4CJO A;  2R7T A;  3HJC A;  3B0U X;  1OKK D;  1NU9 C;  1LS4 A;  2OEV A;  2YL1 A;  3K1I A;  3LNM B;  4MTG A;  1SYQ A;  3MLG A;  3U5S A;  1C17 M;  4P9F A;  4AE4 A;  4DBQ A;  3IQC A;  2DYS C;  1FAP B;  2P61 A;  3K1I C;  3OWT A;  2PP4 A;  3FAJ A;  3RQE A;  4BG0 A;  3PCV A;  1RXQ A;  3C7J A;  3MFN A;  3SXK A;  4J30 B;  5L0J A;  1SR2 A;  2CDQ A;  2PX0 A;  5KYX A;  3TQO A;  3HTK C;  4ANJ A;  3L8I A;  2NSF A;  5A6B A;  2J8W A;  4QDL A;  2EPN A;  3U3F A;  2CNW D;  5AC5 A;  2OEX A;  4CSA A;  4BJ6 A;  4KNV A;  3AG2 C;  4JCH A;  1WGW A;  4EKW A;  1OQC A;  4CIP A;  1C02 A;  3FMS A;  1VYI A;  3HLZ A;  2V3C C;  3RYL A;  4BJ6 C;  3BRJ A;  2HMZ A;  4DVZ A;  1I4Z A;  2P7V A;  3K1H A;  1MNE A;  3RH3 A;  4MVU A;  1ZHZ A;  2A0U A;  4GYT A;  4JCZ A;  4PAC A;  5FCL A;  3C8G B;  4LER A;  4MW3 A;  2NG1 A;  2L9J A;  1YYX A;  4W8P A;  2WZF A;  3ZC4 A;  4AL1 A;  3CZ6 A;  3SYN A;  4XQ1 A;  3TJ5 A;  3LEO A;  5JT4 A;  4HFK B;  1VLS A;  2J9W A;  3SNH A;  1L3P A;  4BJ5 A;  1RCP A;  1OW8 A;  3JZ0 A;  3DZA A;  2ZXW C;  3HNL A;  3E9V A;  1G5Z A;  1OCC C;  1EKY A;  2OOC A;  2KK1 A;  1TQG A;  3HNI A;  2EIJ C;  3LS1 A;  1HE1 A;  4U9E A;  3EJN A;  3EFO B;  1WTY A;  2R05 A;  4JTD B;  4YL1 A;  4BJ1 A;  5B3I A;  3W8H A;  5KYU A;  5A6K A;  3KPH A;  4I1M A;  3SP1 A;  2WVN A;  2IBF A;  3EZH A;  3DAF A;  2W4M A;  5F5F A;  2OKU A;  1V54 C;  2LCH A;  1JR8 A;  4DRJ B;  3S29 A;  1JAF A;  4XPW A;  1E84 A;  4ULV A;  4C7O B;  1U6H A;  2Q00 A;  2VCB A;  3DM5 A;  3S28 A;  3X2Q C;  1YLM A;  2R7X A;  2EIM C;  3GOD A;  1H9T A;  3H2U A;  2KJG A; 
#chains in the Genus database with same CATH homology
 3ABL C;  2BE5 F;  4PJL A;  3ZSU A;  1OCR C;  4LAC B;  4QI0 A;  2QTV A;  2XL4 A;  3B0P A;  3LJB A;  2H7O A;  2XRH A;  4A2N B;  5F5H A;  2FGY A;  3FDQ A;  4JJF A;  3EHN A;  4PFP A;  2FFH A;  2J46 A;  3LEV A;  1M57 C;  3DAG A;  3UNG C;  1Z5Z A;  4OD4 A;  3POV A;  2J0W A;  2EIK C;  4IJJ A;  4DOZ A;  4XLP F;  3K7D A;  1N1C A;  2ZXP A;  3GAN A;  1Z63 A;  4JW1 A;  2P6V A;  2OCC C;  4WJ0 A;  4MND A;  3Q7G A;  4W8K A;  4KBL A;  5D91 A;  4JVS A;  4PJN A;  5E3A A;  3LES A;  3DM9 B;  1O87 A;  3KL4 A;  1TWC A;  4YT4 A;  1VOM A;  2KW3 C;  4M63 A;  2O9X A;  3F46 A;  5KYW B;  3LLK A;  1ZHT A;  1BR1 A;  1V55 C;  3RFY A;  3NKD A;  5KYY A;  3DMD A;  3T6B A;  3AQB A;  1ZU5 A;  1G8X A;  2C03 A;  4KNW A;  3LS0 A;  3LNR A;  2EIN C;  2Q9C A;  2PX3 A;  5B1B C;  1JPJ A;  2NUP B;  4N06 A;  4H4K C;  1ZHW A;  5DQT A;  2MYS A;  3S27 A;  2R7W A;  3I5P A;  4YT5 A;  4OD5 A;  3B0V C;  1M2V B;  5E3C A;  5B3S C;  4G0H A;  3UMK A;  4NY3 A;  2XXA B;  3AG3 C;  3DXJ F;  3F47 A;  2HV7 A;  2Q9B A;  4G7Z F;  2YEV A;  4U5E E;  4YT2 A;  2WB7 A;  3EFO A;  4O79 A;  4JUR I;  3L0I A;  3N0T A;  3N2Z B;  4C7O A;  2CW0 F;  1FFT C;  1TWH A;  4XTK A;  3T6J A;  3EHM A;  4I44 A;  3K66 A;  2J7P D;  1MMA A;  2A1D D;  2IXN A;  2Y3D A;  4CS9 A;  3KMI A;  3DJN B;  2KGO A;  1FMW A;  4U5C E;  1J8Y F;  2IXP A;  2G62 A;  3SEO A;  1TWA A;  3Q6N A;  4CS9 C;  4IAO A;  2VH3 A;  3QZC A;  3NDB B;  2IXM A;  2ZXR A;  2W45 A;  3FVY A;  4MQ9 F;  2WL8 A;  2A6E F;  4BJ5 C;  4CBE A;  1MND A;  4EWC A;  3ASN C;  5T3T A;  5BUO A;  4U5F E;  3S0X A;  2XSE A;  5HSW A;  4K0D A;  3M1C B;  1OKK A;  3EG9 B;  2A69 F;  1D0X A;  4Q4Z F;  3MX3 A;  2L81 A;  2IYL D;  2PF4 E;  4OIR F;  1FMV A;  1SZI A;  4I3M A;  2Y3G A;  4CSA A;  2A68 F;  4P6I C;  5KYW A;  4JJG A;  2ZPA A;  2GFH A;  3UGP A;  2R7Q A;  1S7Z A;  2D5R B;  4FES A;  2CNW A;  2HV6 A;  2J9U A;  5KYX B;  4RDA A;  3DD7 A;  3EH2 A;  4KC9 A;  4X0R A;  3OA1 A;  2R7S A;  4XWJ A;  2R7U A;  1LS1 A;  3IEE A;  3EGD A;  1LVK A;  1MMN A;  2VB6 A;  4XLN F;  2EIL C;  2Q3T A;  4IWB A;  2Z15 A;  1D1B A;  1O5H A;  4AX2 A;  1M2V A;  2X51 A;  1M56 C;  1ZHX A;  3QMK A;  3VAY A;  3SZR A;  2W4B A;  1D0Y A;  3JYH A;  1M2O A;  2WZG A;  2XXA A;  4ZLD A;  2I8B A;  1IW7 F;  5EHH A;  3OEO A;  4O7G A;  2G3V A;  3TD7 A;  5T3W A;  5CI9 A;  1D1A A;  3AG1 C;  5KYU B;  3L34 A;  1D0Z A;  3ECS A;  2H7V C;  2YZS A;  2IXO A;  3ASO C;  3ZVR A;  4BJT A;  3PMR A;  3NYJ A;  4U5D E;  5T1D B;  2Y69 C;  1Z23 A;  4YN0 B;  3AQC A;  3RKO F;  1TR2 A;  2WVO A;  3EGX B;  4F4B A;  3UMH A;  3W2V A;  3ZIB A;  2DYR C;  1NU7 D;  5EGY A;  4AK9 A;  3JRT A;  4YT8 A;  4DBR A;  1QLE C;  4U5G A;  4OIP F;  5IY5 C;  1TKN A;  4QI2 A;  2KQ9 A;  5B1A C;  1IZM A;  1JPN A;  3KH2 A;  4C3B A;  4RD9 A;  2YHS A;  3ABK C;  2C04 A;  3EQL F;  4BEJ A;  4PJM A;  2NUT B;  4K7B A;  1PD0 A;  4JZA A;  3EG9 A;  5KYN A;  3EZI A;  1PD1 A;  3ABM C;  3JT1 A;  1FFH A;  3NRH A;  3NG1 A;  3T4R A;  5DVW A;  1MMD A;  4G7H F;  3E70 C;  2V26 A;  3WG7 C;  4LLC A;  1VMA A;  2MWQ A;  3I5Q A;  2Y3H A;  4YJW A;  3VYW A;  1MMG A;  4IRU A;  1ZYR F;  4CS7 A;  4FX5 A;  2JD3 A;  4J32 B;  5KYY B;  3FHD A;  2R7O A;  1D1C A;  4O6N A;  3Q7L A;  3X1O A;  3RIP A;  5L3Q A;  1W2W A;  2WVQ A;  1RJ9 B;  4U5H A;  5DQZ A;  4O6M A;  1OCZ C;  2IOQ A;  4E7S A;  2J9V A;  4C3D A;  1KU2 A;  5E2Q A;  4E7Z A;  5E33 A;  3DJU B;  2W9Y A;  2OG2 A;  3B9Q A;  1TWG A;  4O6Y A;  1ZU4 A;  4AE4 B;  4YWQ A;  5DS4 A;  3I4U A;  3JSZ A;  4HE8 D;  3V7O A;  4B6I A;  2KNH A;  4CSA C;  1BR2 A;  2J0X A;  5DS5 A;  4KI2 A;  2PFD A;  1ST6 A;  4OIO F;  4CS8 A;  4I1O B;  4Q5S F;  4CS8 C;  2J7P A;  3K6B A;  1J8M F;  2NUP A;  3WOD F;  3JCU Q;  1SF8 A;  4RBN A;  4PFO A;  3CQZ A;  3NYL A;  5D92 A;  2Y39 A;  3EGX A;  4ZLC A;  2B0J A;  3N24 A;  3UGO A;  3KKB A;  4FWV A;  3O39 A;  1QZX A;  2H7B A;  3K33 A;  4HFF B;  4C3E A;  3NYM A;  4ULW A;  5CI8 A;  3Q6M A;  1ZHY A;  2E87 A;  1Z3I X;  3LLI A;  2NUT A;  2WZL A;  3EH1 A;  4OIN F;  4PJJ A;  1LKX A;  2ZXO A;  2J45 A;  1BR4 A;  2Q9A A;  4DVY P;  3LAY A;  4CIH A;  2VAS A;  5DLJ A;  4HEA J;  4EBB A;  3ITF A;  2CGE A;  1NG1 A;  2LSE A;  1PCX A;  3W2W A;  2G3K A;  1SMY F;  2R7R A;  3UMI A;  3ZG1 A;  2QY9 A;  2A6H F;  1VYK A;  3PHF 2;  4G7O F;  3AG4 C;  4GEH A;  1FTS A;  5DS6 A;  3CSK A;  4Q7C A;  3UR3 C;  2M4E A;  1NZE A;  3O6X A;  2Y3B A;  2R7V A;  3EGD B;  1OCO C;  1RJ9 A;  3NKE A;  4U5B E;  3W8I A;  3H65 A;  4OIQ F;  4PK4 A;  2DGJ A;  5L3V A;  3EPV A;  1VK5 A;  1Z6A A;  4LLE A;  2R7T A;  3HJC A;  3B0U X;  1OKK D;  1NU9 C;  3MLG A;  4DBQ A;  4AE4 A;  3OWT A;  2DYS C;  3K1I C;  2PP4 A;  3FAJ A;  4BG0 A;  4J30 B;  2CDQ A;  2PX0 A;  5KYX A;  3HTK C;  4ANJ A;  4QDL A;  2CNW D;  4BJ6 A;  4KNV A;  3AG2 C;  4JCH A;  1WGW A;  3HLZ A;  1VYI A;  2V3C C;  3RYL A;  4BJ6 C;  4DVZ A;  2P7V A;  3K1H A;  1MNE A;  3RH3 A;  1ZHZ A;  4GYT A;  5FCL A;  4LER A;  2NG1 A;  2L9J A;  2WZF A;  3ZC4 A;  3CZ6 A;  3SYN A;  4HFK B;  2J9W A;  3SNH A;  4BJ5 A;  3DZA A;  2ZXW C;  3E9V A;  1OCC C;  3LS1 A;  2EIJ C;  3EJN A;  3EFO B;  4BJ1 A;  3W8H A;  5KYU A;  4I1M A;  3SP1 A;  2WVN A;  3EZH A;  3DAF A;  2W4M A;  5F5F A;  1V54 C;  4C7O B;  3S29 A;  3X2Q C;  3DM5 A;  3S28 A;  2R7X A;  2EIM C;  3GOD A;  2KJG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...