5T3WA

Marburg virus vp30 bound to nucleoprotein
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
153
structure length
137
Chain Sequence
VDLPPPPLYADVLTLENLGHILSYLHRSEIGKLDETSLRAALSLTCAGIRKTNRSLINTMTELHMNHENLPQDQNGVIKQTYTGIHLDKGGQFEAALWQGWDKRSISLFVQAALYVMNNIPCESSISVQASYDHFIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Fusion protein of Nucleoprotein and Minor nucleoprotein VP30
publication title The Ebola Virus VP30-NP Interaction Is a Regulator of Viral RNA Synthesis.
pubmed doi rcsb
source organism Lake victoria marburgvirus (strain musoke-80)
molecule tags Viral protein
total genus 50
structure length 137
sequence length 153
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2016-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11507 Transcript_VP30 Ebola virus-specific transcription factor VP30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1160 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 5t3wA00
3V7OA 5DVWA 5T3WA 5T3TA 2I8BA
chains in the Genus database with same CATH superfamily
1O87A 3ABMC 3IQCA 4MQ9F 5HSWA 2KYHA 1PV3A 1BR2A 2P0NA 1HE9A 1Y6DA 5EK0A 1Q0KA 2A68F 1OCCC 3ZWIA 4BJ5A 5KYUA 3A11A 4AE4B 1M2OA 4E7ZA 1YAUO 4O6YA 4A2NB 2HSBA 4N6HA 3SXYA 3LNRA 2W45A 1YJGA 1Z6AA 1OR2A 1SYQA 2R03A 2YZSA 3EHNA 4AX2A 5BQGA 4BG0A 1FTSA 2J9VA 2R7OA 3FMSA 2Q3TA 2Q7RA 4EBJA 3ZTMA 4J7YA 5COGA 3H65A 1A0BA 2XLVA 4GQHA 4U5DE 3MFNA 4Z9HA 1ZHZA 2NUTB 1FMVA 1LI5A 1WGWA 2PF4E 3FOOA 3IQ6A 3RF3A 4NTAA 1ZW2A 3OEOA 5A69A 1NFNA 4AL1A 2XXAB 2A6EF 1I4YA 4J7TA 1E85A 3AGUA 2HS5A 2OQMA 4G78A 1YARO 2WB7A 2GFHA 4E0HA 5L3VA 3UMKA 2FGYA 3TK0A 2EILC 1T6UA 2Z15A 1ZU5A 1SZIA 1DOVA 3EH2A 3RFYA 3GEEA 2NUTA 1VLTA 2IXOA 2B0JA 4HFKB 2HV7A 3ZC4A 4DBRA 2HUJA 1QSPA 4XLPF 2IXPA 3EGXB 3QW0A 4H54A 4IARA 5L0CA 5L3QA 1Z63A 4C7OB 3ZVRA 4LDKA 4BJTA 4CSAC 4WABA 1MNEA 5A6BA 4JJGA 1BR4A 2VH3A 3WAQA 1ZZPA 1RJ9A 2MWQA 2NUPB 2WVNA 3V5ZA 1E84A 4W8KA 3U8PA 2VCBA 3DXJF 2P7VA 4DRJB 3J06A 2VC9A 3B0PA 2R7WA 1A7DA 3M4BA 3Q6MA 3N0TA 3NMIA 4G0HA 1WWPA 4JC7A 4AL0A 4U9DA 3EGXA 1YZCA 3GM1A 4QI2A 3B29A 4C7OA 1OKKA 5L0IA 1V54C 3NKDA 3DKAA 4K7BA 1EI7A 1VYIA 3SXKA 1WASA 1R4TA 2FFHA 3Q7GA 2QUPA 2C03A 2EIMC 2NUPA 1OCRC 3L1MA 3Q6NA 2I8BA 3POVA 2EIKC 2OU6A 4MS2A 3FVYA 1WTYA 3LESA 4PR9A 3IQTA 2HKVA 2XLMA 4LACB 3VAYA 1JOGA 1AEPA 2CDQA 3US6A 4C3EA 4LDRA 3SXZA 3E70C 2B0HA 3JSEO 2ETSA 5TJ5E 3RVZA 3DE9A 4DXWA 4PJLA 4IAQA 4ULWA 3EZHA 4BEMJ 1CGNA 3CSKA 2ZXWC 1A7VA 2W4MA 3B9QA 1CPQA 4EBBA 2LFFA 3DI5A 1OW8A 1Q0DA 1LS4A 1TQGA 3CAXA 2A0UA 2V26A 2YWAA 3KL4A 5KYNA 4XEKA 3NKEA 1GQAA 1LVKA 3U8VA 5L0JA 2XLHA 1IZMA 4XTKA 4YWQA 3LNMB 4FESA 3KYIA 5F28E 4Q4ZF 2LSEA 1BZ4A 2A0BA 4G7HF 3FXHA 2Q00A 5JT4A 4PJNA 2YLIA 1WATA 2Y69C 3GWLA 3C8GA 3MBGA 4CS8C 2OCCC 1M6TA 2YVKA 1G4US 5DS4A 1OQCA 1YYXA 4DVYP 4P9TA 1B68A 1ZYRF 1XWJA 1Y4CA 1ZW3A 1D1BA 2QLAA 1GGQA 3GEIA 2WZLA 1L7CA 2Q4FA 3DD7A 3WG7C 1YZAA 2XLDA 2XS8A 3S29A 5KYWA 1M2VB 2ASRA 4ANJA 3HJCA 1QPUA 4JZAA 1MMAA 4XLNF 4MVMA 1ZHWA 5AC4A 2EPMX 4CS9C 4X0RA 2GAQA 3QTHA 4JEBA 4JURI 5DQTA 4NCQA 2L7AA 3WHNA 4OD4A 2IOQA 3NDBB 4PACA 1LE4A 4JRZA 3U9JA 1G4WR 1NLXA 3FOPA 3M1CB 3W8IA 2GWWA 3JYYA 3ZTZA 1M56C 5JVEA 256BA 1U89A 1LE2A 1V4AA 2J46A 1RCPA 2KK1A 3ECSA 3NYLA 4YT5A 3T9OA 1HMDA 3U3FA 1I5NA 1K05A 2F22A 5JS5A 4DOZA 1Q0MA 4L6RA 3NYJA 1Q0GA 5KYXB 3UNGC 4D4XA 3JTLO 1EQ1A 3RKOF 3TOLA 1D0XA 3V5YA 4OIQF 4MVZA 2X0CA 1YYJA 2VCAA 2Y3DA 2EINC 2J9WA 3EGDA 2YL0A 3PMRA 3LS1A 3ZG1A 3RIPA 4CSAA 2DGJA 4ZLCA 1BDJB 1YA9A 2XLOA 2YKZA 2LIGA 4XEVA 1V74B 1SF8A 2ICWG 2E87A 3X2QC 4MVOA 1UFBA 1QKRA 5KYXA 2EPNA 1AUEA 3QZCA 2KJGA 1G5ZA 2L6FA 1RXQA 3K1IA 1TWHA 4EIYA 3GEHA 2X51A 2WL8A 2HSQA 2WVOA 5E33A 3LEVA 1FR0A 3L8IA 1RKEB 2ZXOA 3KKBA 4EHPA 2GA0A 1H9GA 2OEXA 4MTOA 5AGFA 5T3TA 3UMIA 2YHSA 3RQGA 4LERA 1EA8A 4U5GA 3AJMA 2J9UA 3GODA 3EQLF 3JSZA 1LKXA 1LPEA 2PFDA 5COMA 4KC9A 3V5XA 4AE4A 1GS9A 1LI7A 4EWCA 1NZEA 3LS0A 5CIVA 1CPRA 4BPMA 4CIHA 1Z5ZA 2YL3A 3DZAA 3T6BA 4LDQA 4IWBA 1YVIA 3CQZA 4QI0A 4CDAA 1XZPA 4U5FE 4OINF 4YN0B 3S9OA 2OG2A 4RD9A 5K0IA 1E83A 1VOMA 2ZXRA 2KSFA 3HNLA 3O6XA 4PK4A 4ULVA 5COFA 1E86A 3H2UA 3S84A 1NG1A 3PHF2 2XXAA 1FAPB 5KYYB 4CJGA 2IXMA 3U5SA 5DQZA 1T9KA 2FAPB 3Q7LA 4KBLA 3G4ZA 3IEEA 1TR2A 2TMVP 1APCA 3DE8A 3HNJA 1QQ3A 1MMGA 2ZD9A 4XPXA 3ABLC 3LLKA 1K04A 2Y39A 2L81A 2LP4A 1QLEC 3PDMP 1OW6A 1TWAA 3M79A 4H4KC 3S28A 2L9JA 1CGME 5BQIA 1TWCA 1C02A 1G8XA 1MMDA 1A41A 2LD6A 4Z9IA 4CS9A 2R7XA 4C3BA 3AG4C 2Y3BA 3K1HA 4PFPA 1KU2A 3EHMA 3F47A 3CZ6A 1NFOA 2KC3A 2PX0A 2V3CC 3MYFA 2Q9AA 1R5ID 2YQYA 4HEAJ 2YLGA 2MYSA 1J8MF 3SXMA 3NRHA 3W2WA 1MNDA 2Q9BA 3ATPA 2EPKX 4K0DA 1ORSC 2PBEA 3MYIA 5E3CA 3RQEA 3S27A 3SNHA 2R7VA 3EFOB 1J8YF 3JZ0A 4MTFA 2Y3GA 5DVWA 1K40A 3O55A 1TFKB 2LCHA 2YL1A 3M4CA 1VB5A 1SR2A 5B1AC 3TJ5A 4BJ5C 1U0BB 1E2XA 1D0ZA 1FFTC 3ASOC 3VM6A 4A4AA 2J7PD 2EIJC 3U2LA 2DYRC 1OR3A 1WOLA 4BEJA 2EPOA 2R7SA 4JVSA 1W2WA 3EPVA 3ZSUA 3AOUA 3CEXA 3EFOA 1ORJA 2J7PA 3AG3C 3KPHA 4U5HA 5B3SC 5BUOA 1O5HA 3L0IA 1ZHTA 2LQGA 5L0HA 1YDIA 2J9BA 3DAGA 1TWGA 2HMZA 4IJJA 3B0UX 1HW1A 2UUIA 3RYLA 1JMWA 3U3BA 2HJ3A 4QDLA 1T01A 4IAOA 3LAYA 4NTFA 3NMJA 3WODF 3OWTA 1QVXA 2NG1A 2J8WA 5F5FA 4HFFB 2NSGA 3ABKC 4NQFA 2CGEA 4NC3A 4E17A 1PCXA 2KQ9A 4MVSA 3R7CA 4CDVA 1H9TA 3BRJA 4ER9A 4GEHA 5D91A 4FAPB 1NBBA 2UUHA 3IQ5A 4HE8D 4LLEA 4YL1A 3TOMA 4DBQA 1JPNA 4I1MA 3O39A 4FX5A 3I5PA 4WGZA 4CDYA 1RKCA 3JT1A 1JRAA 3C8ZA 1T5OA 4LLCA 1MQVA 3QVYA 1C17M 2P6VA 3EJNA 1M2VA 3G50A 4K1OA 2JPUA 1JAFA 2IXNA 4O6NA 3TJ6A 2ZXPA 3QMKA 2AVKA 5T3WA 2DYSC 3FAPB 3G4XA 5JSLA 1CGOA 2A1DD 2J0WA 2OOCA 4YL3A 5E2QA 4Z9JA 2DI3A 1HMOA 2QY9A 3RQFA 4I3MA 2DB4A 4E18A 5BQHA 4GYTA 1V55C 3N2ZB 3V7OA 2VB6A 3W8HA 4YT2A 4MVUA 4N06A 2XSEA 1WN0A 3LEOA 2G3KA 1QZXA 2PX3A 4XPYA 4O6MA 4RBNA 4IRUA 4E7SA 3MLGA 4YL0A 4CJOA 5JLIA 4XQ1A 2RD9A 2H7BA 3QVZA 1TFOB 3QW1A 2D5RB 3IHUA 2MHRA 4I44A 1VYKA 4ONSA 1DOWA 2AU5A 3O10A 3F46A 4U5BE 3DJNB 1Q0FA 2XLEA 3K66A 1UG7A 2HFIA 5KYUB 3RH3A 1Z23A 1FFHA 4R32A 3HTKC 1NU9C 2WZFA 1LIHA 4OIPF 3FDQA 4E0IA 3AQCA 1BBHA 1VK5A 2JD3A 3I4UA 2CCYA 2BC5A 1O3UA 2OEVA 4J32B 2R9RB 2VASA 4P9FA 5JUAA 1YLMA 4C3DA 1JPJA 2XS1A 3A9CA 1EKYA 1GM5A 4MNDA 2AWYA 1N1CA 2KNHA 2YL7A 2AP3A 4BJ6C 4OIRF 1PD0A 3JRMO 1RKEA 3C62A 3DM9B 4F4BA 3S0XA 2HMQA 4CX9A 4CS7A 5L0FA 5DLJA 3FHDA 4CIPA 1ORYA 3K6BA 2W9YA 5F5HA 4BJ1A 1KNYA 4DRIB 2J0XA 2J45A 2R7QA 3T4RA 5DS6A 3SYNA 1NSGB 4NTBA 3RW0A 4B6IA 1S05A 4M63A 2IBFA 1D1AA 2O9XA 3ASNC 3BEHA 2YLDA 3HLZA 3NG1A 1F1MA 3W4YA 2GDCA 1HW2A 2Q9CA 4CS8A 4YK5A 1VMAA 4G7OF 4JCHA 2BE5F 1NU7D 1ZVZA 3KH2A 2L6HA 4U5CE 2R7UA 5HV9A 1OXKA 2IM8A 2P61A 4CBEA 1Z7Qc 1RMVA 5KYYA 2KW3C 3KYJA 1VTMP 1RJ9B 4PJJA 3OA1A 2WZGA 4JTCB 4JW1A 1D0YA 3UGOA 4EKWA 2CW0F 1IW7F 3M15A 5FCLA 3DWWA 3PCVA 5A6BD 2EPLX 3DMDA 1ZHXA 4PJMA 3AG1C 3VYWA 2NSFA 3GWNA 3E9VA 2XL6A 5B3IA 4KI2A 3SZRA 3TULA 2A6HF 3I5QA 4YJWA 4WGYA 4MW3A 4YT4A 4EBKA 3VF0A 3ZDLA 4YT8A 2H7VC 1YA7O 1OKKD 4Q5SF 3K33A 4NY3A 2QE9A 3EG9B 4DJ9A 2W4BA 4IGGA 4O7GA 2R7TA 4XPWA 4MVRA 5IY5C 3DJUB 3ZQYA 3JRTA 3K1IC 4IB4A 2H7OA 4U5EE 3LJBA 1FMWA 4JEAA 2CNWD 4PFOA 2Y3HA 1KTMA 3ZQVA 4J30B 5AC5A 5GPGB 2HV6A 2YEVA 1OW7A 2PNOA 3L8JA 3EZIA 1Z3IX 4P6IC 3B0VC 2XRHA 4JJFA 1M57C 2XLWA 4JCZA 2CNWA 3GM3A 1L3PA 1TKNA 2RSEB 3EG9A 3FAJA 1ZHYA 2M64A 3MX3A 3S90A 4N6CA 3AGTA 3ITFA 3C63A 4JKVA 3TD7A 4DRHB 4ZLDA 1A7EA 3C7JA 5CI8A 4WJ0A 4KNWA 2IYLD 1AVOB 2WVQA 3K7DA 1BR1A 3GANA 2AWCA 5A6JA 3C8GB 3U0CA 4U9EA 1OXBA 5JRAA 5L0DA 4G7ZF 4D4NA 2CYDA 1OCOC 3NYMA 5KYWB 3LUTB 1S7ZA 3C8GD 4XEFA 3U9MA 3UGPA 1FNTc 3ZIBA 2JX0A 2OJQA 4DVZA 4OIOF 5T1DB 4BJ6A 1OCZC 3L34A 1XZQA 2QTVA 1LS1A 2I15A 1I4ZA 2LFDA 1LM3B 2BL2A 4AK9A 5E3AA 3GM2A 3LLIA 4MVQA 4W8PA 1MMNA 3NMKA 4O79A 3T6GB 5A6KA 5EHHA 1D1CA 3AQBA 3HNIA 1HY5A 2VCCA 5L0GA 5DS5A 3KMIA 4JTAB 2XL4A 2YRFA 1ZU4A 3C18A 1SMYF 4I1OB 2HJMA 2XM0A 3HNKA 3DAFA 2OKUA 5B1BC 3VRCA 2R7RA 2A69F 3JYHA 2HZ8A 2XM4A 3JCUQ 1VLSA 3SEOA 3UR3C 1ST6A 2P1AA 1H6GA 1HE1A 4KNVA 3X1OA 3H2VA 4N4WA 4Q7CA 3T6JA 2LK4A 2R05A 5EGYA 4JIOA 3DM5A 2C04A 3B71A 3EGDB 4MTGA 3UMHA 4FWVA 2H8AA 4JE9A 4OD5A 3W2VA 1T6QA 2M4EA 4EUKB 2PP4A 2QNLA 2XL8A 3EH1A 3HKKA 2L6GA 2NPUA 1C03A 2R25A 4RDAA 5CI9A 5JP7A 2OJED 2ZPAA 2G62A 3GORA 5A6AA 4XWJA 5D92A 3RVYA 4JTDB 3U2MA 3N24A 2KGOA 1PD1A 1U6HA 1JR8A 2D4UA 3IPMO 4UDVA 1H7IA 3TQOA 2G3VA 4MW8A 1T6IA 5FZTA 3AG2C 3SP1A 2R02A 3R2PA
chains in the Genus database with same CATH topology
1O87A 3ABMC 4MQ9F 5HSWA 1BR2A 2A68F 1OCCC 4BJ5A 5KYUA 4AE4B 1M2OA 4E7ZA 4O6YA 4A2NB 3LNRA 2W45A 1Z6AA 4AX2A 3EHNA 4BG0A 2YZSA 1FTSA 2J9VA 2R7OA 2Q3TA 3H65A 4U5DE 1ZHZA 2NUTB 1FMVA 1WGWA 2PF4E 3OEOA 2XXAB 2A6EF 2WB7A 2GFHA 5L3VA 3UMKA 2FGYA 2EILC 2Z15A 1ZU5A 1SZIA 3EH2A 3RFYA 2NUTA 2IXOA 2B0JA 4HFKB 2HV7A 3ZC4A 4DBRA 4XLPF 2IXPA 3EGXB 1Z63A 5L3QA 4C7OB 3ZVRA 4BJTA 4CSAC 1MNEA 4JJGA 1BR4A 2VH3A 1RJ9A 2MWQA 2NUPB 2WVNA 4W8KA 3DXJF 2P7VA 3B0PA 2R7WA 3Q6MA 3N0TA 4G0HA 3EGXA 4QI2A 4C7OA 1OKKA 1V54C 3NKDA 4K7BA 1VYIA 2FFHA 3Q7GA 2C03A 2EIMC 2NUPA 1OCRC 3Q6NA 3POVA 2I8BA 2EIKC 3FVYA 3LESA 4LACB 3VAYA 2CDQA 4C3EA 3E70C 4PJLA 4ULWA 3EZHA 3CSKA 2ZXWC 2W4MA 3B9QA 4EBBA 5KYNA 2V26A 3KL4A 3NKEA 1LVKA 1IZMA 4XTKA 4YWQA 4FESA 4Q4ZF 2LSEA 4G7HF 4PJNA 2Y69C 4CS8C 2OCCC 5DS4A 4DVYP 1ZYRF 1D1BA 3WG7C 2WZLA 3DD7A 5KYWA 3S29A 1M2VB 4ANJA 3HJCA 4XLNF 4JZAA 1MMAA 1ZHWA 4CS9C 4X0RA 4JURI 5DQTA 4OD4A 2IOQA 3NDBB 3M1CB 3W8IA 1M56C 4YT5A 2J46A 3NYLA 3ECSA 4DOZA 3NYJA 5KYXB 3UNGC 3RKOF 1D0XA 4OIQF 2Y3DA 4CSAA 2EINC 2J9WA 3EGDA 3PMRA 3LS1A 3ZG1A 3RIPA 2DGJA 4ZLCA 1SF8A 3X2QC 2E87A 5KYXA 3QZCA 2KJGA 1TWHA 2X51A 2WL8A 5E33A 2WVOA 3LEVA 2ZXOA 3KKBA 5T3TA 3UMIA 2YHSA 4LERA 4U5GA 2J9UA 3GODA 3EQLF 3JSZA 1LKXA 2PFDA 4AE4A 4KC9A 4EWCA 1NZEA 3LS0A 4CIHA 1Z5ZA 3DZAA 3T6BA 4IWBA 3CQZA 4QI0A 4U5FE 4OINF 4YN0B 2OG2A 4RD9A 1VOMA 2ZXRA 3O6XA 4PK4A 1NG1A 3PHF2 2XXAA 5KYYB 2IXMA 5DQZA 3Q7LA 4KBLA 3IEEA 1TR2A 1MMGA 3ABLC 3LLKA 2Y39A 2L81A 1QLEC 1TWAA 4H4KC 3S28A 2L9JA 1TWCA 1G8XA 1MMDA 4CS9A 2R7XA 4C3BA 3AG4C 2Y3BA 3K1HA 4PFPA 1KU2A 3EHMA 3F47A 3CZ6A 2PX0A 2V3CC 2Q9AA 4HEAJ 2MYSA 1J8MF 3W2WA 3NRHA 1MNDA 2Q9BA 4K0DA 5E3CA 3SNHA 3S27A 2R7VA 3EFOB 1J8YF 2Y3GA 5DVWA 4BJ5C 5B1AC 1D0ZA 1FFTC 3ASOC 2J7PD 2EIJC 2DYRC 4BEJA 2R7SA 4JVSA 1W2WA 3EPVA 3ZSUA 3EFOA 2J7PA 3AG3C 4U5HA 5B3SC 5BUOA 1O5HA 3L0IA 1ZHTA 3DAGA 1TWGA 4IJJA 3B0UX 3RYLA 4QDLA 4IAOA 3LAYA 3WODF 3OWTA 2NG1A 5F5FA 4HFFB 3ABKC 2CGEA 1PCXA 2KQ9A 4GEHA 5D91A 4LLEA 4HE8D 4DBQA 1JPNA 4I1MA 3O39A 4FX5A 3I5PA 3JT1A 4LLCA 2P6VA 3EJNA 1M2VA 2IXNA 4O6NA 2ZXPA 3QMKA 5T3WA 2DYSC 2A1DD 2J0WA 5E2QA 2QY9A 4I3MA 4GYTA 1V55C 3N2ZB 3V7OA 2VB6A 3W8HA 4YT2A 4N06A 2XSEA 4E7SA 2G3KA 1QZXA 2PX3A 4O6MA 4RBNA 4IRUA 3MLGA 2H7BA 2D5RB 4I44A 1VYKA 3F46A 4U5BE 3DJNB 3K66A 5KYUB 3RH3A 1Z23A 1FFHA 3HTKC 1NU9C 2WZFA 4OIPF 3FDQA 3AQCA 1VK5A 2JD3A 3I4UA 4J32B 2VASA 4C3DA 1JPJA 4MNDA 1N1CA 2KNHA 4BJ6C 4OIRF 1PD0A 3DM9B 4F4BA 3S0XA 4CS7A 5DLJA 3FHDA 3K6BA 2W9YA 5F5HA 4BJ1A 2J0XA 2J45A 2R7QA 3T4RA 5DS6A 3SYNA 4B6IA 4M63A 1D1AA 2O9XA 3ASNC 3HLZA 3NG1A 2Q9CA 4CS8A 1VMAA 4G7OF 4JCHA 2BE5F 1NU7D 3KH2A 4U5CE 2R7UA 4CBEA 5KYYA 2KW3C 1RJ9B 4PJJA 3OA1A 2WZGA 4JW1A 1D0YA 3UGOA 2CW0F 1IW7F 5FCLA 3DMDA 1ZHXA 4PJMA 3AG1C 3VYWA 3E9VA 4KI2A 3SZRA 2A6HF 3I5QA 4YJWA 4YT4A 4YT8A 2H7VC 1OKKD 4Q5SF 3K33A 4NY3A 3EG9B 2W4BA 4O7GA 2R7TA 5IY5C 3DJUB 3JRTA 3K1IC 4U5EE 2H7OA 3LJBA 1FMWA 4PFOA 2CNWD 2Y3HA 4J30B 2HV6A 2YEVA 4P6IC 3B0VC 3EZIA 1Z3IX 2XRHA 4JJFA 1M57C 2CNWA 1TKNA 3EG9A 3FAJA 1ZHYA 3MX3A 3ITFA 3TD7A 4ZLDA 5CI8A 4WJ0A 4KNWA 2IYLD 3K7DA 2WVQA 1BR1A 3GANA 4G7ZF 1OCOC 3NYMA 5KYWB 3UGPA 1S7ZA 3ZIBA 4DVZA 4OIOF 5T1DB 4BJ6A 1OCZC 3L34A 2QTVA 1LS1A 4AK9A 5E3AA 3LLIA 1MMNA 4O79A 5EHHA 1D1CA 3AQBA 5DS5A 3KMIA 2XL4A 1ZU4A 1SMYF 4I1OB 3DAFA 5B1BC 2R7RA 2A69F 3JYHA 3JCUQ 3SEOA 3UR3C 1ST6A 3X1OA 4KNVA 4Q7CA 3T6JA 5EGYA 3DM5A 2C04A 3EGDB 3UMHA 4FWVA 4OD5A 3W2VA 2M4EA 2PP4A 3EH1A 4RDAA 5CI9A 2ZPAA 2G62A 4XWJA 5D92A 3N24A 2KGOA 1PD1A 2G3VA 3AG2C 3SP1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V7O A;  5DVW A;  5T3W A;  5T3T A;  2I8B A; 
#chains in the Genus database with same CATH topology
 1O87 A;  3ABM C;  3IQC A;  4MQ9 F;  5HSW A;  2KYH A;  1PV3 A;  1BR2 A;  2P0N A;  1HE9 A;  1Y6D A;  5EK0 A;  1Q0K A;  2A68 F;  1OCC C;  3ZWI A;  4BJ5 A;  5KYU A;  3A11 A;  4AE4 B;  1M2O A;  4E7Z A;  1YAU O;  4O6Y A;  4A2N B;  2HSB A;  4N6H A;  3SXY A;  3LNR A;  2W45 A;  1YJG A;  1Z6A A;  1OR2 A;  1SYQ A;  2R03 A;  2YZS A;  3EHN A;  4AX2 A;  5BQG A;  4BG0 A;  1FTS A;  2J9V A;  2R7O A;  3FMS A;  2Q3T A;  2Q7R A;  4EBJ A;  3ZTM A;  4J7Y A;  5COG A;  3H65 A;  1A0B A;  2XLV A;  4GQH A;  4U5D E;  3MFN A;  4Z9H A;  1ZHZ A;  2NUT B;  1FMV A;  1LI5 A;  1WGW A;  2PF4 E;  3FOO A;  3IQ6 A;  3RF3 A;  4NTA A;  1ZW2 A;  3OEO A;  5A69 A;  1NFN A;  4AL1 A;  2XXA B;  2A6E F;  1I4Y A;  4J7T A;  1E85 A;  3AGU A;  2HS5 A;  2OQM A;  4G78 A;  1YAR O;  2WB7 A;  2GFH A;  4E0H A;  5L3V A;  3UMK A;  2FGY A;  3TK0 A;  2EIL C;  1T6U A;  2Z15 A;  1ZU5 A;  1SZI A;  1DOV A;  3EH2 A;  3RFY A;  3GEE A;  2NUT A;  1VLT A;  2IXO A;  2B0J A;  4HFK B;  2HV7 A;  3ZC4 A;  4DBR A;  2HUJ A;  1QSP A;  4XLP F;  2IXP A;  3EGX B;  3QW0 A;  4H54 A;  4IAR A;  5L0C A;  5L3Q A;  1Z63 A;  4C7O B;  3ZVR A;  4LDK A;  4BJT A;  4CSA C;  4WAB A;  1MNE A;  5A6B A;  4JJG A;  1BR4 A;  2VH3 A;  3WAQ A;  1ZZP A;  1RJ9 A;  2MWQ A;  2NUP B;  2WVN A;  3V5Z A;  1E84 A;  4W8K A;  3U8P A;  2VCB A;  3DXJ F;  2P7V A;  4DRJ B;  3J06 A;  2VC9 A;  3B0P A;  2R7W A;  1A7D A;  3M4B A;  3Q6M A;  3N0T A;  3NMI A;  4G0H A;  1WWP A;  4JC7 A;  4AL0 A;  4U9D A;  3EGX A;  1YZC A;  3GM1 A;  4QI2 A;  3B29 A;  4C7O A;  1OKK A;  5L0I A;  1V54 C;  3NKD A;  3DKA A;  4K7B A;  1EI7 A;  1VYI A;  3SXK A;  1WAS A;  1R4T A;  2FFH A;  3Q7G A;  2QUP A;  2C03 A;  2EIM C;  2NUP A;  1OCR C;  3L1M A;  3Q6N A;  2I8B A;  3POV A;  2EIK C;  2OU6 A;  4MS2 A;  3FVY A;  1WTY A;  3LES A;  4PR9 A;  3IQT A;  2HKV A;  2XLM A;  4LAC B;  3VAY A;  1JOG A;  1AEP A;  2CDQ A;  3US6 A;  4C3E A;  4LDR A;  3SXZ A;  3E70 C;  2B0H A;  3JSE O;  2ETS A;  5TJ5 E;  3RVZ A;  3DE9 A;  4DXW A;  4PJL A;  4IAQ A;  4ULW A;  3EZH A;  4BEM J;  1CGN A;  3CSK A;  2ZXW C;  1A7V A;  2W4M A;  3B9Q A;  1CPQ A;  4EBB A;  2LFF A;  3DI5 A;  1OW8 A;  1Q0D A;  1LS4 A;  1TQG A;  3CAX A;  2A0U A;  2V26 A;  2YWA A;  3KL4 A;  5KYN A;  4XEK A;  3NKE A;  1GQA A;  1LVK A;  3U8V A;  5L0J A;  2XLH A;  1IZM A;  4XTK A;  4YWQ A;  3LNM B;  4FES A;  3KYI A;  5F28 E;  4Q4Z F;  2LSE A;  1BZ4 A;  2A0B A;  4G7H F;  3FXH A;  2Q00 A;  5JT4 A;  4PJN A;  2YLI A;  1WAT A;  2Y69 C;  3GWL A;  3C8G A;  3MBG A;  4CS8 C;  2OCC C;  1M6T A;  2YVK A;  1G4U S;  5DS4 A;  1OQC A;  1YYX A;  4DVY P;  4P9T A;  1B68 A;  1ZYR F;  1XWJ A;  1Y4C A;  1ZW3 A;  1D1B A;  2QLA A;  1GGQ A;  3GEI A;  2WZL A;  1L7C A;  2Q4F A;  3DD7 A;  3WG7 C;  1YZA A;  2XLD A;  2XS8 A;  3S29 A;  5KYW A;  1M2V B;  2ASR A;  4ANJ A;  3HJC A;  1QPU A;  4JZA A;  1MMA A;  4XLN F;  4MVM A;  1ZHW A;  5AC4 A;  2EPM X;  4CS9 C;  4X0R A;  2GAQ A;  3QTH A;  4JEB A;  4JUR I;  5DQT A;  4NCQ A;  2L7A A;  3WHN A;  4OD4 A;  2IOQ A;  3NDB B;  4PAC A;  1LE4 A;  4JRZ A;  3U9J A;  1G4W R;  1NLX A;  3FOP A;  3M1C B;  3W8I A;  2GWW A;  3JYY A;  3ZTZ A;  1M56 C;  5JVE A;  256B A;  1U89 A;  1LE2 A;  1V4A A;  2J46 A;  1RCP A;  2KK1 A;  3ECS A;  3NYL A;  4YT5 A;  3T9O A;  1HMD A;  3U3F A;  1I5N A;  1K05 A;  2F22 A;  5JS5 A;  4DOZ A;  1Q0M A;  4L6R A;  3NYJ A;  1Q0G A;  5KYX B;  3UNG C;  4D4X A;  3JTL O;  1EQ1 A;  3RKO F;  3TOL A;  1D0X A;  3V5Y A;  4OIQ F;  4MVZ A;  2X0C A;  1YYJ A;  2VCA A;  2Y3D A;  2EIN C;  2J9W A;  3EGD A;  2YL0 A;  3PMR A;  3LS1 A;  3ZG1 A;  3RIP A;  4CSA A;  2DGJ A;  4ZLC A;  1BDJ B;  1YA9 A;  2XLO A;  2YKZ A;  2LIG A;  4XEV A;  1V74 B;  1SF8 A;  2ICW G;  2E87 A;  3X2Q C;  4MVO A;  1UFB A;  1QKR A;  5KYX A;  2EPN A;  1AUE A;  3QZC A;  2KJG A;  1G5Z A;  2L6F A;  1RXQ A;  3K1I A;  1TWH A;  4EIY A;  3GEH A;  2X51 A;  2WL8 A;  2HSQ A;  2WVO A;  5E33 A;  3LEV A;  1FR0 A;  3L8I A;  1RKE B;  2ZXO A;  3KKB A;  4EHP A;  2GA0 A;  1H9G A;  2OEX A;  4MTO A;  5AGF A;  5T3T A;  3UMI A;  2YHS A;  3RQG A;  4LER A;  1EA8 A;  4U5G A;  3AJM A;  2J9U A;  3GOD A;  3EQL F;  3JSZ A;  1LKX A;  1LPE A;  2PFD A;  5COM A;  4KC9 A;  3V5X A;  4AE4 A;  1GS9 A;  1LI7 A;  4EWC A;  1NZE A;  3LS0 A;  5CIV A;  1CPR A;  4BPM A;  4CIH A;  1Z5Z A;  2YL3 A;  3DZA A;  3T6B A;  4LDQ A;  4IWB A;  1YVI A;  3CQZ A;  4QI0 A;  4CDA A;  1XZP A;  4U5F E;  4OIN F;  4YN0 B;  3S9O A;  2OG2 A;  4RD9 A;  5K0I A;  1E83 A;  1VOM A;  2ZXR A;  2KSF A;  3HNL A;  3O6X A;  4PK4 A;  4ULV A;  5COF A;  1E86 A;  3H2U A;  3S84 A;  1NG1 A;  3PHF 2;  2XXA A;  1FAP B;  5KYY B;  4CJG A;  2IXM A;  3U5S A;  5DQZ A;  1T9K A;  2FAP B;  3Q7L A;  4KBL A;  3G4Z A;  3IEE A;  1TR2 A;  2TMV P;  1APC A;  3DE8 A;  3HNJ A;  1QQ3 A;  1MMG A;  2ZD9 A;  4XPX A;  3ABL C;  3LLK A;  1K04 A;  2Y39 A;  2L81 A;  2LP4 A;  1QLE C;  3PDM P;  1OW6 A;  1TWA A;  3M79 A;  4H4K C;  3S28 A;  2L9J A;  1CGM E;  5BQI A;  1TWC A;  1C02 A;  1G8X A;  1MMD A;  1A41 A;  2LD6 A;  4Z9I A;  4CS9 A;  2R7X A;  4C3B A;  3AG4 C;  2Y3B A;  3K1H A;  4PFP A;  1KU2 A;  3EHM A;  3F47 A;  3CZ6 A;  1NFO A;  2KC3 A;  2PX0 A;  2V3C C;  3MYF A;  2Q9A A;  1R5I D;  2YQY A;  4HEA J;  2YLG A;  2MYS A;  1J8M F;  3SXM A;  3NRH A;  3W2W A;  1MND A;  2Q9B A;  3ATP A;  2EPK X;  4K0D A;  1ORS C;  2PBE A;  3MYI A;  5E3C A;  3RQE A;  3S27 A;  3SNH A;  2R7V A;  3EFO B;  1J8Y F;  3JZ0 A;  4MTF A;  2Y3G A;  5DVW A;  1K40 A;  3O55 A;  1TFK B;  2LCH A;  2YL1 A;  3M4C A;  1VB5 A;  1SR2 A;  5B1A C;  3TJ5 A;  4BJ5 C;  1U0B B;  1E2X A;  1D0Z A;  1FFT C;  3ASO C;  3VM6 A;  4A4A A;  2J7P D;  2EIJ C;  3U2L A;  2DYR C;  1OR3 A;  1WOL A;  4BEJ A;  2EPO A;  2R7S A;  4JVS A;  1W2W A;  3EPV A;  3ZSU A;  3AOU A;  3CEX A;  3EFO A;  1ORJ A;  2J7P A;  3AG3 C;  3KPH A;  4U5H A;  5B3S C;  5BUO A;  1O5H A;  3L0I A;  1ZHT A;  2LQG A;  5L0H A;  1YDI A;  2J9B A;  3DAG A;  1TWG A;  2HMZ A;  4IJJ A;  3B0U X;  1HW1 A;  2UUI A;  3RYL A;  1JMW A;  3U3B A;  2HJ3 A;  4QDL A;  1T01 A;  4IAO A;  3LAY A;  4NTF A;  3NMJ A;  3WOD F;  3OWT A;  1QVX A;  2NG1 A;  2J8W A;  5F5F A;  4HFF B;  2NSG A;  3ABK C;  4NQF A;  2CGE A;  4NC3 A;  4E17 A;  1PCX A;  2KQ9 A;  4MVS A;  3R7C A;  4CDV A;  1H9T A;  3BRJ A;  4ER9 A;  4GEH A;  5D91 A;  4FAP B;  1NBB A;  2UUH A;  3IQ5 A;  4HE8 D;  4LLE A;  4YL1 A;  3TOM A;  4DBQ A;  1JPN A;  4I1M A;  3O39 A;  4FX5 A;  3I5P A;  4WGZ A;  4CDY A;  1RKC A;  3JT1 A;  1JRA A;  3C8Z A;  1T5O A;  4LLC A;  1MQV A;  3QVY A;  1C17 M;  2P6V A;  3EJN A;  1M2V A;  3G50 A;  4K1O A;  2JPU A;  1JAF A;  2IXN A;  4O6N A;  3TJ6 A;  2ZXP A;  3QMK A;  2AVK A;  5T3W A;  2DYS C;  3FAP B;  3G4X A;  5JSL A;  1CGO A;  2A1D D;  2J0W A;  2OOC A;  4YL3 A;  5E2Q A;  4Z9J A;  2DI3 A;  1HMO A;  2QY9 A;  3RQF A;  4I3M A;  2DB4 A;  4E18 A;  5BQH A;  4GYT A;  1V55 C;  3N2Z B;  3V7O A;  2VB6 A;  3W8H A;  4YT2 A;  4MVU A;  4N06 A;  2XSE A;  1WN0 A;  3LEO A;  2G3K A;  1QZX A;  2PX3 A;  4XPY A;  4O6M A;  4RBN A;  4IRU A;  4E7S A;  3MLG A;  4YL0 A;  4CJO A;  5JLI A;  4XQ1 A;  2RD9 A;  2H7B A;  3QVZ A;  1TFO B;  3QW1 A;  2D5R B;  3IHU A;  2MHR A;  4I44 A;  1VYK A;  4ONS A;  1DOW A;  2AU5 A;  3O10 A;  3F46 A;  4U5B E;  3DJN B;  1Q0F A;  2XLE A;  3K66 A;  1UG7 A;  2HFI A;  5KYU B;  3RH3 A;  1Z23 A;  1FFH A;  4R32 A;  3HTK C;  1NU9 C;  2WZF A;  1LIH A;  4OIP F;  3FDQ A;  4E0I A;  3AQC A;  1BBH A;  1VK5 A;  2JD3 A;  3I4U A;  2CCY A;  2BC5 A;  1O3U A;  2OEV A;  4J32 B;  2R9R B;  2VAS A;  4P9F A;  5JUA A;  1YLM A;  4C3D A;  1JPJ A;  2XS1 A;  3A9C A;  1EKY A;  1GM5 A;  4MND A;  2AWY A;  1N1C A;  2KNH A;  2YL7 A;  2AP3 A;  4BJ6 C;  4OIR F;  1PD0 A;  3JRM O;  1RKE A;  3C62 A;  3DM9 B;  4F4B A;  3S0X A;  2HMQ A;  4CX9 A;  4CS7 A;  5L0F A;  5DLJ A;  3FHD A;  4CIP A;  1ORY A;  3K6B A;  2W9Y A;  5F5H A;  4BJ1 A;  1KNY A;  4DRI B;  2J0X A;  2J45 A;  2R7Q A;  3T4R A;  5DS6 A;  3SYN A;  1NSG B;  4NTB A;  3RW0 A;  4B6I A;  1S05 A;  4M63 A;  2IBF A;  1D1A A;  2O9X A;  3ASN C;  3BEH A;  2YLD A;  3HLZ A;  3NG1 A;  1F1M A;  3W4Y A;  2GDC A;  1HW2 A;  2Q9C A;  4CS8 A;  4YK5 A;  1VMA A;  4G7O F;  4JCH A;  2BE5 F;  1NU7 D;  1ZVZ A;  3KH2 A;  2L6H A;  4U5C E;  2R7U A;  5HV9 A;  1OXK A;  2IM8 A;  2P61 A;  4CBE A;  1Z7Q c;  1RMV A;  5KYY A;  2KW3 C;  3KYJ A;  1VTM P;  1RJ9 B;  4PJJ A;  3OA1 A;  2WZG A;  4JTC B;  4JW1 A;  1D0Y A;  3UGO A;  4EKW A;  2CW0 F;  1IW7 F;  3M15 A;  5FCL A;  3DWW A;  3PCV A;  5A6B D;  2EPL X;  3DMD A;  1ZHX A;  4PJM A;  3AG1 C;  3VYW A;  2NSF A;  3GWN A;  3E9V A;  2XL6 A;  5B3I A;  4KI2 A;  3SZR A;  3TUL A;  2A6H F;  3I5Q A;  4YJW A;  4WGY A;  4MW3 A;  4YT4 A;  4EBK A;  3VF0 A;  3ZDL A;  4YT8 A;  2H7V C;  1YA7 O;  1OKK D;  4Q5S F;  3K33 A;  4NY3 A;  2QE9 A;  3EG9 B;  4DJ9 A;  2W4B A;  4IGG A;  4O7G A;  2R7T A;  4XPW A;  4MVR A;  5IY5 C;  3DJU B;  3ZQY A;  3JRT A;  3K1I C;  4IB4 A;  2H7O A;  4U5E E;  3LJB A;  1FMW A;  4JEA A;  2CNW D;  4PFO A;  2Y3H A;  1KTM A;  3ZQV A;  4J30 B;  5AC5 A;  5GPG B;  2HV6 A;  2YEV A;  1OW7 A;  2PNO A;  3L8J A;  3EZI A;  1Z3I X;  4P6I C;  3B0V C;  2XRH A;  4JJF A;  1M57 C;  2XLW A;  4JCZ A;  2CNW A;  3GM3 A;  1L3P A;  1TKN A;  2RSE B;  3EG9 A;  3FAJ A;  1ZHY A;  2M64 A;  3MX3 A;  3S90 A;  4N6C A;  3AGT A;  3ITF A;  3C63 A;  4JKV A;  3TD7 A;  4DRH B;  4ZLD A;  1A7E A;  3C7J A;  5CI8 A;  4WJ0 A;  4KNW A;  2IYL D;  1AVO B;  2WVQ A;  3K7D A;  1BR1 A;  3GAN A;  2AWC A;  5A6J A;  3C8G B;  3U0C A;  4U9E A;  1OXB A;  5JRA A;  5L0D A;  4G7Z F;  4D4N A;  2CYD A;  1OCO C;  3NYM A;  5KYW B;  3LUT B;  1S7Z A;  3C8G D;  4XEF A;  3U9M A;  3UGP A;  1FNT c;  3ZIB A;  2JX0 A;  2OJQ A;  4DVZ A;  4OIO F;  5T1D B;  4BJ6 A;  1OCZ C;  3L34 A;  1XZQ A;  2QTV A;  1LS1 A;  2I15 A;  1I4Z A;  2LFD A;  1LM3 B;  2BL2 A;  4AK9 A;  5E3A A;  3GM2 A;  3LLI A;  4MVQ A;  4W8P A;  1MMN A;  3NMK A;  4O79 A;  3T6G B;  5A6K A;  5EHH A;  1D1C A;  3AQB A;  3HNI A;  1HY5 A;  2VCC A;  5L0G A;  5DS5 A;  3KMI A;  4JTA B;  2XL4 A;  2YRF A;  1ZU4 A;  3C18 A;  1SMY F;  4I1O B;  2HJM A;  2XM0 A;  3HNK A;  3DAF A;  2OKU A;  5B1B C;  3VRC A;  2R7R A;  2A69 F;  3JYH A;  2HZ8 A;  2XM4 A;  3JCU Q;  1VLS A;  3SEO A;  3UR3 C;  1ST6 A;  2P1A A;  1H6G A;  1HE1 A;  4KNV A;  3X1O A;  3H2V A;  4N4W A;  4Q7C A;  3T6J A;  2LK4 A;  2R05 A;  5EGY A;  4JIO A;  3DM5 A;  2C04 A;  3B71 A;  3EGD B;  4MTG A;  3UMH A;  4FWV A;  2H8A A;  4JE9 A;  4OD5 A;  3W2V A;  1T6Q A;  2M4E A;  4EUK B;  2PP4 A;  2QNL A;  2XL8 A;  3EH1 A;  3HKK A;  2L6G A;  2NPU A;  1C03 A;  2R25 A;  4RDA A;  5CI9 A;  5JP7 A;  2OJE D;  2ZPA A;  2G62 A;  3GOR A;  5A6A A;  4XWJ A;  5D92 A;  3RVY A;  4JTD B;  3U2M A;  3N24 A;  2KGO A;  1PD1 A;  1U6H A;  1JR8 A;  2D4U A;  3IPM O;  4UDV A;  1H7I A;  3TQO A;  2G3V A;  4MW8 A;  1T6I A;  5FZT A;  3AG2 C;  3SP1 A;  2R02 A;  3R2P A; 
#chains in the Genus database with same CATH homology
 1O87 A;  3ABM C;  4MQ9 F;  5HSW A;  1BR2 A;  2A68 F;  1OCC C;  4BJ5 A;  5KYU A;  4AE4 B;  1M2O A;  4E7Z A;  4O6Y A;  4A2N B;  3LNR A;  2W45 A;  1Z6A A;  4AX2 A;  3EHN A;  4BG0 A;  2YZS A;  1FTS A;  2J9V A;  2R7O A;  2Q3T A;  3H65 A;  4U5D E;  1ZHZ A;  2NUT B;  1FMV A;  1WGW A;  2PF4 E;  3OEO A;  2XXA B;  2A6E F;  2WB7 A;  2GFH A;  5L3V A;  3UMK A;  2FGY A;  2EIL C;  2Z15 A;  1ZU5 A;  1SZI A;  3EH2 A;  3RFY A;  2NUT A;  2IXO A;  2B0J A;  4HFK B;  2HV7 A;  3ZC4 A;  4DBR A;  4XLP F;  2IXP A;  3EGX B;  1Z63 A;  5L3Q A;  4C7O B;  3ZVR A;  4BJT A;  4CSA C;  1MNE A;  4JJG A;  1BR4 A;  2VH3 A;  1RJ9 A;  2MWQ A;  2NUP B;  2WVN A;  4W8K A;  3DXJ F;  2P7V A;  3B0P A;  2R7W A;  3Q6M A;  3N0T A;  4G0H A;  3EGX A;  4QI2 A;  4C7O A;  1OKK A;  1V54 C;  3NKD A;  4K7B A;  1VYI A;  2FFH A;  3Q7G A;  2C03 A;  2EIM C;  2NUP A;  1OCR C;  3Q6N A;  3POV A;  2I8B A;  2EIK C;  3FVY A;  3LES A;  4LAC B;  3VAY A;  2CDQ A;  4C3E A;  3E70 C;  4PJL A;  4ULW A;  3EZH A;  3CSK A;  2ZXW C;  2W4M A;  3B9Q A;  4EBB A;  5KYN A;  2V26 A;  3KL4 A;  3NKE A;  1LVK A;  1IZM A;  4XTK A;  4YWQ A;  4FES A;  4Q4Z F;  2LSE A;  4G7H F;  4PJN A;  2Y69 C;  4CS8 C;  2OCC C;  5DS4 A;  4DVY P;  1ZYR F;  1D1B A;  3WG7 C;  2WZL A;  3DD7 A;  5KYW A;  3S29 A;  1M2V B;  4ANJ A;  3HJC A;  4XLN F;  4JZA A;  1MMA A;  1ZHW A;  4CS9 C;  4X0R A;  4JUR I;  5DQT A;  4OD4 A;  2IOQ A;  3NDB B;  3M1C B;  3W8I A;  1M56 C;  4YT5 A;  2J46 A;  3NYL A;  3ECS A;  4DOZ A;  3NYJ A;  5KYX B;  3UNG C;  3RKO F;  1D0X A;  4OIQ F;  2Y3D A;  4CSA A;  2EIN C;  2J9W A;  3EGD A;  3PMR A;  3LS1 A;  3ZG1 A;  3RIP A;  2DGJ A;  4ZLC A;  1SF8 A;  3X2Q C;  2E87 A;  5KYX A;  3QZC A;  2KJG A;  1TWH A;  2X51 A;  2WL8 A;  5E33 A;  2WVO A;  3LEV A;  2ZXO A;  3KKB A;  5T3T A;  3UMI A;  2YHS A;  4LER A;  4U5G A;  2J9U A;  3GOD A;  3EQL F;  3JSZ A;  1LKX A;  2PFD A;  4AE4 A;  4KC9 A;  4EWC A;  1NZE A;  3LS0 A;  4CIH A;  1Z5Z A;  3DZA A;  3T6B A;  4IWB A;  3CQZ A;  4QI0 A;  4U5F E;  4OIN F;  4YN0 B;  2OG2 A;  4RD9 A;  1VOM A;  2ZXR A;  3O6X A;  4PK4 A;  1NG1 A;  3PHF 2;  2XXA A;  5KYY B;  2IXM A;  5DQZ A;  3Q7L A;  4KBL A;  3IEE A;  1TR2 A;  1MMG A;  3ABL C;  3LLK A;  2Y39 A;  2L81 A;  1QLE C;  1TWA A;  4H4K C;  3S28 A;  2L9J A;  1TWC A;  1G8X A;  1MMD A;  4CS9 A;  2R7X A;  4C3B A;  3AG4 C;  2Y3B A;  3K1H A;  4PFP A;  1KU2 A;  3EHM A;  3F47 A;  3CZ6 A;  2PX0 A;  2V3C C;  2Q9A A;  4HEA J;  2MYS A;  1J8M F;  3W2W A;  3NRH A;  1MND A;  2Q9B A;  4K0D A;  5E3C A;  3SNH A;  3S27 A;  2R7V A;  3EFO B;  1J8Y F;  2Y3G A;  5DVW A;  4BJ5 C;  5B1A C;  1D0Z A;  1FFT C;  3ASO C;  2J7P D;  2EIJ C;  2DYR C;  4BEJ A;  2R7S A;  4JVS A;  1W2W A;  3EPV A;  3ZSU A;  3EFO A;  2J7P A;  3AG3 C;  4U5H A;  5B3S C;  5BUO A;  1O5H A;  3L0I A;  1ZHT A;  3DAG A;  1TWG A;  4IJJ A;  3B0U X;  3RYL A;  4QDL A;  4IAO A;  3LAY A;  3WOD F;  3OWT A;  2NG1 A;  5F5F A;  4HFF B;  3ABK C;  2CGE A;  1PCX A;  2KQ9 A;  4GEH A;  5D91 A;  4LLE A;  4HE8 D;  4DBQ A;  1JPN A;  4I1M A;  3O39 A;  4FX5 A;  3I5P A;  3JT1 A;  4LLC A;  2P6V A;  3EJN A;  1M2V A;  2IXN A;  4O6N A;  2ZXP A;  3QMK A;  5T3W A;  2DYS C;  2A1D D;  2J0W A;  5E2Q A;  2QY9 A;  4I3M A;  4GYT A;  1V55 C;  3N2Z B;  3V7O A;  2VB6 A;  3W8H A;  4YT2 A;  4N06 A;  2XSE A;  4E7S A;  2G3K A;  1QZX A;  2PX3 A;  4O6M A;  4RBN A;  4IRU A;  3MLG A;  2H7B A;  2D5R B;  4I44 A;  1VYK A;  3F46 A;  4U5B E;  3DJN B;  3K66 A;  5KYU B;  3RH3 A;  1Z23 A;  1FFH A;  3HTK C;  1NU9 C;  2WZF A;  4OIP F;  3FDQ A;  3AQC A;  1VK5 A;  2JD3 A;  3I4U A;  4J32 B;  2VAS A;  4C3D A;  1JPJ A;  4MND A;  1N1C A;  2KNH A;  4BJ6 C;  4OIR F;  1PD0 A;  3DM9 B;  4F4B A;  3S0X A;  4CS7 A;  5DLJ A;  3FHD A;  3K6B A;  2W9Y A;  5F5H A;  4BJ1 A;  2J0X A;  2J45 A;  2R7Q A;  3T4R A;  5DS6 A;  3SYN A;  4B6I A;  4M63 A;  1D1A A;  2O9X A;  3ASN C;  3HLZ A;  3NG1 A;  2Q9C A;  4CS8 A;  1VMA A;  4G7O F;  4JCH A;  2BE5 F;  1NU7 D;  3KH2 A;  4U5C E;  2R7U A;  4CBE A;  5KYY A;  2KW3 C;  1RJ9 B;  4PJJ A;  3OA1 A;  2WZG A;  4JW1 A;  1D0Y A;  3UGO A;  2CW0 F;  1IW7 F;  5FCL A;  3DMD A;  1ZHX A;  4PJM A;  3AG1 C;  3VYW A;  3E9V A;  4KI2 A;  3SZR A;  2A6H F;  3I5Q A;  4YJW A;  4YT4 A;  4YT8 A;  2H7V C;  1OKK D;  4Q5S F;  3K33 A;  4NY3 A;  3EG9 B;  2W4B A;  4O7G A;  2R7T A;  5IY5 C;  3DJU B;  3JRT A;  3K1I C;  4U5E E;  2H7O A;  3LJB A;  1FMW A;  4PFO A;  2CNW D;  2Y3H A;  4J30 B;  2HV6 A;  2YEV A;  4P6I C;  3B0V C;  3EZI A;  1Z3I X;  2XRH A;  4JJF A;  1M57 C;  2CNW A;  1TKN A;  3EG9 A;  3FAJ A;  1ZHY A;  3MX3 A;  3ITF A;  3TD7 A;  4ZLD A;  5CI8 A;  4WJ0 A;  4KNW A;  2IYL D;  3K7D A;  2WVQ A;  1BR1 A;  3GAN A;  4G7Z F;  1OCO C;  3NYM A;  5KYW B;  3UGP A;  1S7Z A;  3ZIB A;  4DVZ A;  4OIO F;  5T1D B;  4BJ6 A;  1OCZ C;  3L34 A;  2QTV A;  1LS1 A;  4AK9 A;  5E3A A;  3LLI A;  1MMN A;  4O79 A;  5EHH A;  1D1C A;  3AQB A;  5DS5 A;  3KMI A;  2XL4 A;  1ZU4 A;  1SMY F;  4I1O B;  3DAF A;  5B1B C;  2R7R A;  2A69 F;  3JYH A;  3JCU Q;  3SEO A;  3UR3 C;  1ST6 A;  3X1O A;  4KNV A;  4Q7C A;  3T6J A;  5EGY A;  3DM5 A;  2C04 A;  3EGD B;  3UMH A;  4FWV A;  4OD5 A;  3W2V A;  2M4E A;  2PP4 A;  3EH1 A;  4RDA A;  5CI9 A;  2ZPA A;  2G62 A;  4XWJ A;  5D92 A;  3N24 A;  2KGO A;  1PD1 A;  2G3V A;  3AG2 C;  3SP1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...