3B0UX

Trna-dihydrouridine synthase from thermus thermophilus in complex with trna fragment
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
312
structure length
312
Chain Sequence
b'LDPRLSVAPMVDRTDRHFRFLVRQVSLGVRLYTEMTVDQAVLRGNRERLLAFRPEEHPIALQLAGSDPKSLAEAARIGEAFGYDEINLNLGCPSEKAQEGGYGACLLLDLARVREILKAMGEAVRVPVTVKMRLGLEGKETYRGLAQSVEAMAEAGVKVFVVHARSALLALSTKANREIPPLRHDWVHRLKGDFPQLTFVTNGGIRSLEEALFHLKRVDGVMLGRAVYEDPFVLEEADRRVFGLPRRPSRLEVARRMRAYLEEEVLKGTPPWAVLRHMLNLFRGRPKGRLWRRLLSEGRSLQALDRALRLME'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA (5'-R(*GP*GP*(H2U)P*A)-3')
publication title Molecular basis of dihydrouridine formation on tRNA
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase/rna
total genus 126
structure length 312
sequence length 312
chains with identical sequence Y
ec nomenclature ec 1.3.1.91: tRNA-dihydrouridine(20) synthase (NAD(P)(+)).
pdb deposition date 2011-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01207 Dus Dihydrouridine synthase (Dus)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1460 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3b0uX02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3b0uX01
3L5AA 4E38A 2VEMA 4LVDA 3CEUA 3HG5A 2X1RA 4ADTA 2UV8G 3CWNA 4UNLA 2GQAA 4K36A 2FFCA 2ABAA 2FPYA 1YLVA 3UYCA 2VXNA 1VYSX 4FNUA 1RPXA 2FTPA 2H3DA 1YXDA 1ONRA 1C8VA 2FIQA 3C2RA 4JY8A 3WK0A 1KTNA 3M16A 4MFEA 1F2JA 4UTMA 3HG3A 4X9SA 1YYAA 1KM5A 2PCQA 3I68A 1HO4A 2YXGA 4LRSA 1SZFA 1S5TA 1M7OA 1ZY9A 1IIHA 2DJLA 4Q32A 2YGYA 5G5IA 1W0MA 3TW7A 4FXSA 3CQ0A 1OX4B 3PC0A 4MOZA 3M5YA 4N9DA 4E2BA 3R5EA 2V82A 1TQJA 5LHFA 2VFFA 5HUPA 2FB3A 3BW3A 1TV5A 4IMEA 1ZENA 4BI5A 3LRMA 2VENA 5D37A 3EB2A 3UD6A 4N9CA 3DFSA 3THQA 3L2IA 2A21A 2RHGA 4AHPA 2C14A 3VCRA 3BG3A 5FEXA 3W2NA 1IF2A 3P81A 3QEZA 1TV8A 3ZFHA 3DENA 4WXYA 4JEQA 2V2HA 3A24A 1SO4A 4M6VA 1PS9A 4IXXA 4MZYA 2G95A 3QSTA 3HBLA 5AHEA 3G22A 3GX9A 4IMCA 2YCEA 3FEMA 4NJIA 4M6PA 3W7HA 4UC5A 1JCNA 3FKKA 3OIXA 2HS6A 4FEZA 2QCCA 4JS3A 2TRSA 3PWAA 1NF7A 3SFKA 3USBA 1R30A 1SO5A 1UASA 1B4EA 3W1AA 2RDUA 2Y89A 3DGRA 5MHBA 3BW4A 4AVFA 3RK8A 3UXAA 4QITA 5G2HA 3S1UA 3LLDA 3Q94A 1I2PA 3SZ8A 4XBSA 4X3ZA 1H62A 2A7NA 3LTYA 4JDYA 3QM3A 3GR8A 3I7SA 3LI0A 1ZCOA 5KZDA 5KSWA 1S5VA 3NQDA 2C3ZA 2VEIA 2YSWA 4A22A 4YXGA 3DFNA 1HL2A 2EF9A 4LRTA 3WFAA 3IGSA 1WYIA 3W7OA 1GG0A 2Q8ZA 4UIOA 1IIGA 3VE7A 2XN1A 2ALDA 1KFBA 3HIJA 1EPXA 3UWWA 3GDRA 4POCA 1QWGA 5C2XA 1VCFA 2FPVA 5EYWA 1DOSA 3NL2A 1YPIA 3NA8A 2BLEA 4OBTA 1H1ZA 4HNNA 4AHQA 5KINA 4CNNA 3EX4A 1DBTA 1FUYA 1D3HA 1SFLA 4DO4A 4Y96A 3UQNA 1PIIA 1TB3A 3HGOA 3IIZA 3ABQA 2XN2A 5DN1A 4K8EA 3LHTA 2NUXA 4FX8A 3KVMA 5DBTA 3OVPA 3DAQA 3TQ0A 4L4LA 5HWMA 4GUJA 2ZQ0A 1GZGA 1P0KA 3S8HA 3LHWA 5FF7A 4X2RA 5KMYA 4IX2A 3P84A 1SW0A 2RDTA 4IGHA 4RX0A 3NPWA 1SW7A 3W07A 2W6RA 1KTBA 1VCGA 4FNRA 3A21A 3TC7A 2Q8LA 1ICSA 3U6WA 1SZNA 2QEZA 1SO3A 1X7FA 1JJKA 3OEXA 4UTLA 3EWZA 3MJYA 3UZ5A 1GTHA 2WJZA 3IEBA 5HR6A 5CG7A 1QFEA 3Q37A 3GDTA 1OYAA 2NWRA 1KFCA 2E6DA 4O1DA 4YCOA 1FDZA 3N19B 4PL1A 3BLFA 2G5WA 5AC7A 1I2QA 4O19A 2H3BA 3W1LA 3LXCA 1VYRA 1YTKA 5LHEA 1T96A 1QO5A 2QR6A 3I7RA 3V75A 1LRNA 5DXXA 1R2TA 4UMAA 3MWAA 5K9DA 3W7RA 4N9EA 1VQTA 2V8ZA 3JRKA 3C4UA 1LLZA 2GJNA 1UB3A 4CQAA 2ZTKA 5H2ZA 3W70A 3WK3A 3PBVA 3EWUA 3W76A 3G24A 3PB2A 3ZWTA 1TPVA 3GKAA 1MXSA 3O6DA 1TIMA 3MW7A 3W74A 2AQWA 2PURA 3LCXA 4B5NA 3W23A 5CPLA 4GFSA 4FNSA 4WY0B 5F4SA 5I3GA 1AL7A 4LUJA 1TJPA 1F6PA 3S1VA 3TC6A 4IOTA 3FIGA 1BKSA 3R13A 4KFOA 3GK0A 2ABBA 3KRUA 1HTIA 1R47A 4CCDA 4IXHA 5K4ZA 3W2MA 3GAKA 1HFBA 2DZPA 3GVGA 3TKFA 1ML1A 1KM4A 1WV2A 1QR7A 5C55A 2E6AA 2YYUA 4PTNA 4NQ1A 1O4UA 2A2IA 1DVJA 5DY3A 3NL5A 4PC8A 5ABTA 1DHPA 1UCWA 3TIMA 2RH9A 2V5LA 3AJXA 4E2DA 4LW7A 1QCWA 2OCZA 3PUDA 4Z1BA 3TMQA 4TMBA 1DQWA 3CIXA 5DLCA 4WY0F 4UTJA 1B9BA 1FDJA 3NDOA 4NVTA 3NPXA 4FO4A 3BPWA 3W7JA 4N2YA 1SQ7A 2DORA 3FJLA 4HPJA 4QQ3A 3UY8A 1YDNA 1Q45A 4LWWA 5AC8A 1OABA 4UFMA 5EY5A 4LY8A 5LNUA 3MP5A 1XC4A 4BWLA 5D33A 1K7XA 5F2GA 2PC4A 4AAJA 1FWTA 4NX0A 3UWYA 2H8ZA 1K8YA 5BOOA 1FXPA 4IPIA 5AC6A 5D09A 4O52A 2QCEA 4HSOA 1FCUA 5G2WA 4FXRA 1JRCA 3PG9A 3C56A 3CU2A 4OE7A 1OK6A 1K8ZA 3BW2A 3NQ6A 2QCLA 1JQVA 4E0CA 4OU1A 1K7EA 4O1AA 1LCOA 5I3KA 1O60A 4JX6A 2CW6A 3CLMA 5EL1A 5A5WA 2FJKA 3M0ZA 3G3DA 4OT7A 3L0NA 4QM1A 3YPIA 1WAUA 3EX3A 3LV5A 4UFJA 3WJZA 2V9DA 5FEZA 2E5BA 3QW3A 3BO9A 3QPYA 4JTGA 3H54A 4CQ9A 1SUXA 1A50A 3DFQA 2XN0A 5EA9A 4UTWC 3LCWA 3SJ3A 1EP3A 3W7KA 4WOQA 1ZAHA 1RQEA 1SSDA 2ATMA 1QPRA 1Q6RA 1K03A 1M5WA 3T44A 2Z2UA 3SSJA 3UWVA 3O16A 1Q3NA 4RZ5A 1TPFA 2Q3OA 3HG2A 5C6MA 4WD0A 5AHFA 1FX6A 4OWGA 3IVTA 4WZHA 2QCDB 3EX6A 2WKJA 4JY9A 3UPBA 4JYEA 3LRLA 3E49A 4A29A 4XKYB 4ZQPA 1CI1A 3W1NA 1LBMA 1O95A 3TNOA 4OHQA 3NXFA 3O15A 4Z08A 4BI6A 3L67A 1TTQA 3W85A 1SO6A 1VH7A 5U4NA 3W87A 4O17A 5D30A 2QUUA 1EP1A 2A5HA 3TR2A 2YYTA 1XXXA 4R33A 1NAL1 3TQVA 2QKFA 5L6UA 3LHUA 2C6QA 3M41A 1KV8A 1OFOA 3TFCA 3W2JA 1WBHA 3QH2A 3LGEA 2WSRA 2TPSA 3T7VA 2GVJA 4Y90A 4EIVA 3EWYA 1XM3A 4GE8A 3O07A 2VELA 2GQ9A 4FNPA 2YW4A 1EX5A 3VNDA 1MEWA 1AW5A 1CW2A 1U83A 3MHUA 1ADOA 1GYNA 1TPB1 2ZRZA 4CNOA 1KM6A 1KA9F 1YADA 1VYPX 5CKSA 1Z48A 5BW6A 5LGZA 2ZA3A 2VFHA 4LVGA 2J27A 2V2CA 3O6CA 4I7VA 4JX4A 4QIUA 3KVLA 3TJXA 4DPPA 1YPFA 3T55A 3ANYA 2EAWA 5FESA 2A6LA 5AHMA 2QAFA 3HGSA 2NV2A 3ABSA 4J9JA 4ICNA 4Y6GA 3IGUA 1P1XA 1LRQA 1FQ0A 2VFIA 3TDFA 4S1FA 4DBEA 4CCCA 1HG3A 3W2KA 3B8DA 3CC1A 2VOMA 3EKLA 3VI2A 3PBWA 5G4EA 1QPQA 3W9ZA 3LHVA 2X1TA 5CPMA 3HF3A 1K02A 3PBUA 4XZ9A 4C1KA 4O57A 3GYEA 4MJZA 3W2UA 3OVQA 3OVRA 3MHGA 3QFEA 4WQ6A 4YMZA 2Q3RA 3W83A 3WJSA 3CIWA 1Q6QA 2CLMA 4N9BA 1SW3A 1TPC1 3GLCA 4NXKA 5E0KA 1H7OA 1OHLA 7TIMA 1SFJA 1I2NA 4BFAA 3W7GA 4O50A 1VZWA 4DF0A 3STFA 4O11A 1EIXA 4PFMA 5D38A 4H3DA 1V7YA 3DKJA 4MUZA 1G4TA 3O8AA 3N9RA 4AEOA 2X16A 1TSIA 4PL2A 4PA8A 3FA5A 3KAOA 5C54A 5AHIA 3W1MA 4IWWA 1L6WA 2PRMA 4CLMA 1OX4A 4TMCA 1IGSA 4A2SA 3TQKA 2DP3A 3G1FA 4JTHA 3BK0A 2R8WA 1PVNA 3W7EA 1NVMA 1XUUA 4PCFA 1W5OA 2RDWA 2HS8A 4LV9A 2GVLA 1O94A 1PHQA 2V30A 3IGXA 1K8XA 4GBUA 1G7VA 3HMJG 4NUWA 5DBUA 4G1KA 4RR4A 1N8FA 1DJQA 4ZQNA 3QZEA 3TFXA 2QCFA 5HUOA 1JCJA 3IRDA 1EWEA 2D73A 4O18A 4TX9A 4UTHA 1LBFA 5FI8A 4XTDA 5K4XA 3W88A 3P80A 3BV4A 2Y7FA 4NT0A 3W6YA 5FEPA 1W56A 2ZZ6A 5K9XA 3W72A 4QAIA 3O1NA 4C1LA 1Q6LA 2ZZ1A 3TV8A 3L65A 4UTKA 2E5CA 4K39A 4Q4KA 5CZJA 5FF0A 2H6RA 3U2OA 5AN7A 3CM4A 3CTLA 2JKAA 3KX6A 1TTPA 2Y6ZA 4ZZ9A 4ZQCA 1LOQA 1TMHA 4MPQA 1VLIA 4U28A 5LGXA 5G2IA 3ZR4A 1K7FA 3GDKA 3QJAA 3NAVA 3KRSA 2YZRA 3IVUA 3L5LA 2VKZG 1ZNNA 5K2ZA 3S5NA 3G8EA 1AMKA 2NX9A 3G1SA 3HG4A 3HJZA 4OV4A 1KTCA 3P8JA 1Y0EA 1W3NA 4HPXA 2ZZ3A 3R12A 1FCVA 3NZ1A 4H6KA 4I7UA 3CB8A 1N55A 1A5CA 4GRSA 3UNDA 1D3GA 1EUNA 4TU1A 3DHFA 4Z1DA 3W1PA 2ZA1A 1J4EA 1H7PA 1WA3A 4HHPA 4AWSA 3EXTA 2QUTA 4XTIA 4Z0JA 5J5DA 2Y70A 3BLEA 4MYXA 1VLWA 4BF9A 3GXTA 3O05A 4AMAA 1OF8A 2V81A 3NQVA 3QMSA 4GXMA 5I3JA 3M44A 4JTJA 5DXYA 3EXRA 1H1YA 5F4XA 4LVBA 1JUKA 4FF7A 2QCNA 2WNNA 3G1HA 1TREA 3KVKA 2Z1BA 3G0XA 3LLFA 3LCLA 2E6YA 4NJGA 4AH7A 3S9YA 5HJLA 1LORA 2R14A 2TYSA 1OFBA 4RCXA 3RMJA 1RD5A 3RF9A 1GVFA 3O6YX 1EB3A 3CEPA 4LVFA 3FFSA 1OG0A 1EWDA 3QW4B 3STEA 3TAOA 3NR0A 6TIMA 1SR9A 4JD4A 2OJPA 1TYGA 1ZAIA 1GEQA 1IXOA 4NZFA 1XCFA 5HMSA 4FIQA 2VFEA 3L0GA 3DI0A 5AFDA 1THFD 3G1VA 3C2EA 1GVQA 4GUFA 3KFTA 2ZFAA 4NNBA 3PULA 1PCWA 4MVAA 2VFDA 2O7SA 4JYDA 1J5TA 1F5ZA 2ZZ5A 4M7SA 1JR1A 4OQVA 3OBKA 3SY5A 4YLWA 5DELA 1G7UA 4XUGA 4RLIA 1VCVA 1W31A 2R91A 4MIMA 3DFOA 2W79A 3O63A 3DFTA 5TQLA 1AW2A 1W5PA 3GB6A 2ZRUA 3TUUA 2CU0A 4O13A 4LOCA 1FXQA 2WQPA 1T8XA 1TO3A 3E12A 3KVJA 3N14A 1WXJA 4NJKA 4ZL1A 3W73A 3N3MA 4MZ1A 3VFLA 1F05A 3GKFA 3CHVA 3NPUA 3FKRA 5D32A 4AWTA 1ZAJA 4MFDA 4NJJA 2J9XA 3QSRA 1FWSA 1GVSA 1JCLA 4JTEA 3W7MA 3NL3A 1TQXA 4O1CA 1QPOA 3GNNA 4HNTA 4XBKA 3P67A 4AXKA 3DH7A 1D9EA 4EVZA 2NUYA 3K30A 1LDCA 4FB7A 4NNAA 4O1BA 1VHNA 4EF8A 1M7PA 2RKXA 2ISWA 1H63A 2DZSA 1TV7A 3W7QA 1G67A 4FNQA 4HN4A 1KV5A 3E96A 3T4CA 1MEIA 3LTSA 4FX7A 3SR7A 4ONVA 3BG9A 1WOBA 2NV1A 2FPTA 3LX9A 3TU9A 4S2CA 3LI1A 5LNSA 4DXVA 4GWEA 3P5YA 4QJ1A 3JR2A 1J2WA 2BZNA 2WPBA 5E93A 2I9EA 2WO5A 3PS7A 3M9YA 5F1UA 2FQIA 3SIZA 4EF9A 1TTIA 3HGJA 5AB3A 2CFFA 1ICQA 1TPDA 2Y85A 1H7XA 3IV3A 5D2XA 1GQNA 1ZJIA 3LHZA 5IBXC 3BG5A 1T0OA 5K7JA 4MLRA 3TK7A 4IQLA 1G69A 1I8JA 2H8XA 2CWNA 3QMRA 1I2RA 4IX0A 1X1OA 3NVTA 1L6SA 1OFPA 3G1DA 4K37A 2E1DA 1PHWA 4I9AA 5LNVA 4UFHA 5L9FA 3OA3A 4XQ6A 3TW6A 2PRHA 1IXPA 1EUAA 3I7QA 2OMAA 3PVFA 5LZLA 2JKPA 4WX2A 3M1ZA 1XUZA 1VHCA 1Z41A 3CT7A 4O8RA 2VEPA 3NO5A 4KKXA 2ZZ4A 1KBIA 1MSSA 1T99A 2G97A 3STCA 1MEHA 1ME9A 1LTDA 2Z0IA 3R89A 2Y7GA 1ICPA 2JGYA 4H4IA 3S0CA 5F2IA 4Q33A 2QJHA 1JUEA 5C5YA 4DF1A 1JRBA 3E02A 1W54A 1KM3A 1WDWA 1VC4A 5IM51 1XDMA 4ML9A 1DL3A 1E51A 5HWJA 5AHNA 3W22A 3KHJA 2BX7A 4ZQMA 4PH6A 1LYXA 2NZLA 1W37A 3A5VA 4LV4A 1SU5A 2ZYFA 3SGUA 1TRIA 3C61A 3P61A 5EPDA 1HUVA 2C16A 3LHYA 1RV8A 1Q6OA 1A5SA 3W7IA 4A3UA 4K6AA 4UTWA 5J5RA 1NFBA 3IIOA 3A23A 1KFLA 4D2JA 1VGAA 1UUMA 4ZMGA 4UMBA 4UR8A 4UTUA 4XWUA 2B0MA 3AO0A 3L0KA 4NXSA 3HQ1A 3S5ZA 3PSVA 1R2SA 2J6XA 3IIXA 3B4UA 2DZTA 4GJ1A 3GR7A 3LOTA 3R2GA 4O4WA 5DY2A 3P7YA 5HR7A 2HSAA 3NL6A 2P0OA 1GYLA 3MBFA 3WK2A 2EHHA 1FWRA 1QAPA 3ABOA 3LCIA 1GJPA 2IQTA 1F76A 4HKPA 3UWZA 5EBUA 4A21A 3PB0A 4A2RA 4LS0A 1H7WA 2GJLA 4AF0B 1EP2A 2NWSA 3B03A 4FHAA 1JQXA 2CLEA 2NXHA 2HMCA 3MYPA 1WBJA 3C0JA 3P62A 3FJ6A 5G4WA 3WJXA 2C13A 1FCQA 3C2OA 1QPNA 3H55A 2F7FA 4ADUA 1H51A 1XKYA 3TMLA 2AGKA 2ZBTA 4OGZA 4O0KA 4TR9A 3MYOA 1ME7A 2A7RA 3E9AA 1P0NA 1YDOA 3S1XA 3LBCA 3LDVA 1F73A 3S5OA 4BK9A 2A4AA 2PRLA 3NEVA 3ELFA 4JICA 1TJRA 3LCFA 3W1RA 3TSBA 3UY7A 3MP4A 2F84A 4AWUA 2FLIA 5G1YA 3MI6A 1AG1O 1NSJA 3IIVA 3UPWA 3G0SA 3O06A 4YWIA 3WK1A 1O5XA 2DZVA 3PG8A 4MLJA 4RKAA 4ZQOA 2YX0A 4UFKA 2ZRVA 3BLIA 3CWOX 4UTTC 1G4SA 2OT1A 5CZSA 1QNVA 4NZJA 3L21A 3RLVA 2E77A 2VFGA 4RK8A 1X8FA 3LXBA 2Y63A 1W3TA 4K7YA 1UJPA 3L68A 4UCGA 3S42A 1YTEA 3PAJA 1BTMA 2BTMA 4UUIA 1DKWA 1EEPA 3QPZA 3S5YA 3NQ7A 1OFQA 2ZCGA 4WXZA 2X1UA 1F6KA 4JTIA 1QO2A 2QJIA 4JTSA 5D02A 3M6YA 1Z44A 1W5QA 3EX1A 2C1HA 5CGQA 1L6YA 1LZOA 3I6RA 4Z1AA 3LCHA 1WX0A 2RFGA 4L4MA 2J9ZA 1I4NA 1RZMA 1U5JA 3W3OA 1PL9A 5LNRA 5KZMA 2C0AA 2YR1A 3OHIA 5D04C 5EKYA 3MMTA 3TXZA 2R94A 1YXYA 4UFLA 3M5XA 4JDBA 4Z1CA 3NGJA 1H5YA 4LT9A 1RQBA 3NQEA 1O5KA 2J24A 3S1WA 5D2YA 1S3HA 4UMCA 2X1SA 1DJNA 4O15A 3TSDA 1H60A 1GG1A 1SZGA 3HO8A 1YXCA 4FNTA 1H61A 1KLZA 3HB9A 3LBMA 3NQFA 3T40A 2E68A 1OX6A 3EWBX 4MZ8A 3IIPA 4MY1A 5GVJA 2DZXA 2QJGA 2VEKA 3PUEA 2O7QA 1A5BA 3L9CA 1W3IA 2QDHA 2QCHA 2Y88A 3VKJA 1QOPA 3LCGA 3G1YA 3L66A 1OFEA 1AW1A 1KLYA 4AB4A 4DEFA 4N6EA 3UZJA 3W7PA 1B3OA 2J9YA 1KBJA 1TPWA 3F4NA 4O10A 4CCEA 4CQ8A 2JGQA 1DV7A 3PY2A 4OV9A 3OG3A 8TIMA 3DI1A 2B7NA 2X30A 3NNTA 4N6FA 5BNKA 5K3VA 2VC6A 2NX3A 1MZHA 4O28A 3PSWA 4RJEA 2YDAA 3FS2A 2G96A 3G8RA 4JTKA 1YDVA 5F4WA 3W1TA 4BR1A 2CZEA 5AYZA 3GIYA 1FDYA 2FB2A 2ZRWA 4TIMA 5BRBA 4NU7A 3PR2A 3ABRA 1YTDA 4MKNA 4R7JA 4QISA 2HTMA 3G1XA 4JTFA 4JIPA 1RQHA 4O16A 3C3NA 1K3UA 3P8IA 3NQ2A 4M6QA 1DQXA 2FDSA 1TCDA 1ZALA 2C19A 3LERA 4O0ZA 2AAMA 3B0UX 5AYYA 2I14A 2QUVA 4IPJA 2BWGA 2NX1A 3FYPA 3TAKA 1KFEA 3MBDA 1XBZA 2B7PA 1VRDA 3M7WA 1G4PA 4LC8A 3W1XA 3NG3A 3HGRA 4K8HA 3C52A 3H53A 4O12A 1QDSA 5AHLA 4GNJA 2OT0A 3W7CA 5F2LA 2QCMA 3LTPA 1TRDA 4HNUA 1VJIA 1W5NA 4QSHA 3LM7A 1PCKA 1GVRA 1GTEA 3P60A 2GQ8A 2W0UA 4N02A 3TSMA 1JVNA 3EXSA 5SWUA 4RXGA 3RU6A 3BGJA 3NYZA 3PF3A 2V0TA 4LVAA 2A85A 4MY9A 3KXQA 4R53A 3C6CA 4JYFA 3MP3A 1VS1A 1W5MA 1LP6A 4LS2A 2WOQA 4LC6A 4AHOA 4KFNA 5D03A 3QYQA 4O53A 3LXAA 1FY6A 1W1ZA 2GUUA 4JTLA 2Y7DA 5KZEA 5HQEA 5T26A 3RFAA 5LNWA 1EA0A 3FYOA 1H50A 5FEWA 4JIQA 2PE4A 2Z6IA 2ISVA 3W2LA 1XBVA 3N2MA 3BARA 5HINA 3D0CA 1KM0A 2YW3A 2Y62A 2B7QA 5D2VA 2A1YA 3NQ8A 2A7PA 4HT3A 4JTTA 3GXPA 5HWNA 1PE1A 2B7OA 3I65A 2JK2A 4R34A 3P74A 1LM1A 1XDLA 3C8FA 4WUIA 3B0VC 5TBOA 4KFPA 1G6CA 5EMUA 2NUWA 4K38A 1XBYA 4IUOA 1V5XA 1FCBA 4DO6A 3P82A 3RLUA 2TSYA 1UBSA 3VE9A 4O4VA 3INPA 3RNDA 1FBAA 1X6UA 1PV8A 3EX2A 1LOSA 4KWWA 3F1QA 4LUIA 2CLOA 3GNDA 3C2FA 4M5PA 4M7TA 4UFIA 4WY0A 2YFOA 4LU0A 1WQ5A 5A8GA 3W86A 2XFWA 1L2UA 4DELA 2KZHA 4HNVA 1X1ZA 1NF0A 5KITA 2Y61A 1RVGA 1XFBA 1GVOA 3MI3A 3N34A 4DPQA 2QAPA 3A5FA 3C2VA 3KRZA 3A22A 1ALDA 1JCYA 2DU2A 3EWXA 2E5DA 4IMFA 4DBDA 3R8RA 1R2RA 3STGA 3E0IA 3ATYA 2WNQA 1BEUA 3DHDA 4JR5A 1JULA 3W7DA 1I45A 2X2GA 3LV6A 3QQ0A 5DCBA 5E1QA 4PEKA 3TH6A 3TROA 5K9CA 5CPNA 1IXQA 3JS3A 1C29A 4UXDA 1UUOA 3N9SA 1DORA 5CSSA 1F74A 4JNMA 1GWJA 2OZ0A 1XL9A 4M19A 4MY8A 2CLKA 1G4EA 1OYBA 3F4WA 6ALDA 3M5ZA 1KW1A 3PUOA 1SZEA 1TPEA 2CLHA 1L9WA 1JUBA 4JGDA 5CPOA 3G18A 1I2OA 5HULA 4ADSA 2B4GA 3SECA 5D05A 4BI7A 1OX5A 4Z0SA 3HPSA 4S2BA 4ALDA 3ZWSA 1FWNA 3M47A 4GUIA 3W7LA 1OFRA 4EOUA 1QOQA 3B05A 2WV8A 3NQGA 5I3HA 5IBXA 4LS1A 2WNZA 3SW6A 5LKYA 2Z6JA 2ZRXA 1S5WA 3M43A 3WJWA 1B4KA 3WJYA 1W8SA 4RZ4A 4O54A 1P4CA 3SGZA 2GVGA 2JKEA 1M6JA 4Y9AA 4BWLC 1TTJA 2OX1A 5H91A 4P61A 4TO8A 2V2DA 5FF2A 5AYXA 4PODA 2DJXA 4GC4A 2DZWA 1RR2A 2GOUA 3A9IA 5HNRA 3HPZA 1TPH1 3GDLA 4YL2A 4ZQRA 3MI2A 4EWND 3EWWA 3F03K 2C15A 4NNCA 2I1OA 3EEGA 5LSMA 4GUGA 2CLIA 1QMLA 1P5BA 1ZHAA 3W1QA 4MYAA 3THAA 4KWVA 1H7RA 4FX6M 3B06A 3DXIA 3GZ3A 1A53A 2EGZA 2QCDA 4WOZA 1LROA 3HOJA 2BXVA 1JCMP 1SPQA 4XKYA 4ZVJA 3QF0A 4RZ6A 2ZZ7A 4K7VA 2V5BA 2NLIA 4UR7A 3TE9A 3QRHA 2GPTA 3NOEA 4Y8FA 3DU0A 2ISSA 2WSYA 2EPHA 5DCDA 1N7KA 4DO5A 2BSLA 2E6FA 5KTLA 4YCPA 1WOAA 4AF0A 2YPIA 3BGGA 4IMDA 5U7SA 3L5MA 4ORMA 5DCEA 2H90A 1SSGA 3NZRA 3CPRA 4JXCA 5BMWA 3DFPA 3DKLA 3TX9A 2LLEA 1LRTA 5FF4A 5D2WA 3HPXA 3TXVA 1OFAA 2ZRYA 3TA6A 4FIRA 1IXNA 5CSRA 3Q2DA 4DQWA 4JTUA 3TCEA 4RV8A 1GT8A 3NPVA 4RXFA 4U4MA 1JCXA 3S6DA 4NJHA 2YFNA 1OJXA 2CLLA 1OF6A 5CZ0A 3Q58A 1OFDA 4LNYA 1R46A 4UNKA 4QNEA 3G0UA 3W7NA 1KFJA 2ZTJA 1GPWA 3LB0A 1KFKA 1LBLA 4WJEA 3NQAA 1TPUA 2E09A 3KOFA 5AOUA 1CX9A 1OK4A 1C9DA 3W84A 3W75A 3NM3A 3UWUA 1MO0A 3SI9A 2CZDA 1HO1A 4CNPA 2CLFA 3EKZA 3U8GA 1LLWA 3NQMA 4X22A 5FF3A 5D2TA 3GXNA 3B04A 2ZZ2A 2QDGA 4QNWA 2C18A 4W9TA 5F2MA 3MO7A 4LTSA 1ZFJA 3UXDA 2ZA2A 3UWQA 3B0PA 3IVSA 3PBYA 4IJBA 4DF2A 2J88A 3QC3A 4N4PA 4I7WA 2ZDRA 3G1AA 5I3FA 1XI3A 3G3MA 4GUHA 1A5AA 1OVDA 3QMTA 2QCGA 5BMXA 3W1UA 4UTIA 2JBMA 1ME8A 4ORIA 2ATSA 3MUXA 1GOXA 3V1PA 5CZTA 2DZUA 4UTTA 3N73A 3ZS4A 1VPXA 5F1VA 3NM1A 5G1TA 4JN6A 4JX5A 5TIMA 1AL8A 2TMDA 2NXIA 3TJLA 4HSNA 2P1FA 3QQ1A 3GDMA 3DBPA 1KM1A 1BWKA 3ATZA 1Z42A 1XBXA 1F7BA 1FWWA 2EKCA 4MJMA 1B57A 3FOKA 2CZ5A 5I3IA 2P10A 3M5VA 2WSQA 3N2XA 1KM2A 3FLUA 2Y7EA 4HIBA 4IMGA 4P2VA 1BWLA 3NQCA 4N4QA 2NXGA 1AK5A 3MHFA 1NEYA 3W71A 3LRKA 1OYCA 3PM6A 4O14A 3GAYA 1H7NA 2CZFA 3P5ZA 1LOLA 4NX5A 3T78A 2A0NA 1VR6A 2A6NA 2QF7A 3DZ1A 3BVJA
chains in the Genus database with same CATH superfamily
5FAGA 2Z1XA 3NYMA 4LVDA 3NYLA 2G50A 3IUIA 4QSFA 4XEFA 4GVFA 2Y8VA 3KDNA 3CWNA 2D4UA 4UNLA 4CQBA 2GQAA 3DESA 3F2CA 2CCYA 3IEEA 2Y5EA 3TTSA 1LL4A 1P6CA 2VXNA 3ARVA 1LQAA 1EDTA 3D6NA 4UDVA 1RPXA 1RY8A 1C8VA 3RM9A 3UESA 2XXAB 3MC5A 3WK0A 3L4TA 2PCQA 3I68A 1HO4A 1YQ2A 4NYYA 2QUMA 4G7ZF 1SZFA 1EX1A 2PTWA 4KWSA 3UR8A 1TZ9A 4C6DA 4FXSA 3TN6A 2OB3A 4MOZA 3TJ4A 1A4LA 1T01A 1PDYA 3V4BA 2Q00A 2VFFA 3BSMA 5HUPA 5DMMA 2D2JA 2PDKA 5L0FA 1DWGM 3LRMA 2VENA 3EB2A 3TR9A 2VOTA 3THQA 1C8YA 4A3RA 3ITVA 2RHGA 2VRJA 3SADA 1ZCCA 2FHFA 4J3XA 5HMFA 2NQHA 3CZLA 4WK9A 3UZXA 1QW7A 1DE5A 1QI0A 4H41A 4E17A 1SO4A 4W84A 1POKA 3QR0A 3R8GA 3HBLA 3WO8A 5AHEA 3G22A 2VR2A 1JOGA 2OXNA 3FEMA 4M6PA 1XWJA 4C6QA 4HYVA 2TRSA 4NAFA 2VX7A 5CH9A 1PKNA 1TWZA 2QVNA 2W3ZA 1AFSA 1B4EA 3UJRA 2RDUA 4HOWA 4AZ7A 3DGRA 5HQLA 3RYSA 1QW9A 2XH7A 4H7ZA 1P1MA 2QUNA 1VBGA 1VBUA 2YB4A 1I2PA 3RRAA 1OD0A 1F61A 4X3ZA 4ZTYA 1V3IA 1CGVA 1EXBA 3AS0A 1XLAA 3O6AA 2RGMA 1ZCOA 4R7WA 4GG9A 1G5ZA 4YXGA 1HL2A 2ZUWA 3PTDA 3MVTA 4LRTA 1WYIA 1JGMA 1R3RA 2FZ9A 1IIGA 2A6HF 2WZGA 2XGIA 3ORWA 2DI3A 1EH9A 4GXPA 4JTAA 2Z28A 2YA1A 3UMKA 4POCA 4DX3A 4C1NA 1DOSA 4OBTA 1Y5XA 5AVNA 3VC6A 1H1ZA 4HNNA 4AVOA 1QK0A 1KNYA 4G1NA 1EC9A 4YIWA 4GX8A 3IIZA 4DAFA 3ARRA 3BLOA 4K8EA 1S2UA 4JNZA 2C79A 5DBTA 4PTMA 4I1MA 4L4LA 1XIDA 2YCLB 4F0KA 1GZGA 2J0XA 3LHWA 5CLTA 4X2RA 1TFOB 4IX2A 1AD4A 5HATA 1K05A 2XIQA 1VFHA 2FZNA 4GZ7A 4XZLX 3RVZA 2J9WA 1YBQB 3U0CA 1ONEA 3UW6A 4FNRA 4NI8A 4JURI 4V27A 4AK9A 1Q6EA 4KCTA 1SZNA 3TJIA 4JW1A 1SO3A 3GS6A 2C1GA 3S6TA 4FS9A 3GM3A 1CNVA 4R9OA 5DLJA 2ZXBA 1QFEA 1OYAA 2IOQA 1FWFC 4YCOA 1LT7A 2G5WA 5DQTA 4O19A 3W1LA 2X7VA 4O6YA 1UR9A 3T6CA 1OKKA 2QR6A 1C92A 4J27A 5T9BG 5K9DA 4GI8A 3QBUA 3QY7A 2XZ7A 3AS3A 3TVAA 4N9EA 1W3KA 3UU0A 1LLZA 3CNYA 3VPLA 4PCTA 3WDJA 1UB3A 3M6DA 3LU2A 4LAMA 3KBJA 1CGTA 1UR2A 1OSEA 3BLKA 4C6KA 4GISA 4GINA 1BGGA 4UZSA 5FIPA 4PMXA 3O6DA 3MW7A 3W74A 3CAWA 1OG6A 2VD8A 4Q7CA 2PWEA 4AZHA 2FMNA 3QHNA 4LUJA 1TJPA 3CZEA 2A0BA 3S1VA 2P53A 1JI2A 4G9PA 3ZJKA 1M9HA 3BAIA 4Q7BA 4IOTA 2WVNA 4QRNA 3RCYA 4W88A 4NZ3A 1OADA 5HBFA 2BHZA 3W2MA 4U5FE 3GAKA 2VZSA 4EBJA 4I8DA 1KM4A 3GG1A 3U4AA 3IARA 1OW7A 2X40A 7REQB 1A5NC 4E0IA 3SRHA 1YA7O 2RH9A 2V5LA 4HMNA 3Q4DA 3G6LA 2YVKA 5B7YA 4LW7A 2OCZA 4QHRA 3ARYA 3B8WA 1N2VA 5T8GA 3OBAA 1FDJA 2DZBA 3FV9A 4HU4A 1F8IA 1ADSA 3QKZA 4J7YA 4FO4A 3WHNA 1KKRA 4IPLA 1SQ7A 1Z69A 3BLLA 4WABA 2DORA 3FDGA 3FJLA 3ZQYA 4HPJA 3UMHA 3UY8A 1YDNA 1Q45A 4LWWA 8CGTA 3I4KA 3EDEA 1NZEA 4R88A 3KLKA 1JPDX 3MP5A 1XC4A 4NQFA 3N3TA 3WSUA 3EPVA 2PC4A 3BZJA 4OIQF 3IWPA 3VD3A 3VXGA 1QK2A 5EMJA 4AD2A 3MDWA 4IPIA 2CPUA 5D09A 1RA0A 2R1PA 4U33A 1K9EA 3IJLA 3SN0A 2QCEA 5C0QA 3SXMA 3VTRA 4EWJA 4Y8EA 3MUZ1 3PG9A 4O1EA 3UXKA 4C6MA 3GFYA 3C56A 4OE7A 1NFPA 3JRTA 3I4UA 3BW2A 2D22A 3K8LA 1JQVA 4E0CA 2BVTA 1NBBA 1K7EA 3TOLA 2X0HA 1LCOA 2J7PD 1DIDA 5EL1A 5A5WA 3RLHA 1HKWA 2FJKA 4IARA 5JQ9A 4D6FA 2P3EA 4UFJA 3ABMC 5FEZA 2E5BA 1XH1A 1AH0A 4CQ9A 1SUXA 1ZTVA 4UTWC 3LCWA 2F9RA 3TQOA 4WOQA 5MKGA 5BQHA 1E3XA 1SSDA 4AL0A 3U2ZA 3ITYA 3SSJA 1MMNA 2VEFA 4KT2A 5C6MA 4QP0A 1FWJC 2UY4A 4WD0A 1YAUO 1K8CA 3ISIX 3EX6A 3WDHA 2WHLA 4JY9A 1IEXA 4H7VA 4H6RA 3UPBA 3LRLA 3H8AA 4YJ5A 4GO9A 1CI1A 2PDIA 3TNOA 1TFVA 4OHQA 3TN3A 1I0BA 2J66A 4IG2A 3L67A 3OJGA 3WMBA 3GTXA 3W85A 2R03A 1VH7A 3BSGA 3W87A 5D30A 1EP1A 2Z15A 1D0ZA 4J1OA 1Q0FA 2GDQA 1RLCL 1BYBA 1KV8A 3CAKA 2TPSA 5DMLA 3EWYA 1JGIA 4I90A 2Z2AA 4CX9A 1C17M 4LF2A 2DDXA 4H2HA 4AEFA 2AL2A 4FNPA 3FSTA 4CGTA 1JDDA 5DF0A 2HMQA 1EX5A 3VNDA 1OCQA 4LDKA 1U83A 1GYNA 1TPB1 1KM6A 1YADA 3S1GA 2PDBA 2VFHA 5E5CA 4XX6A 2F2KA 1WDDA 4JX4A 2E67A 3S90A 4C3BA 3EHNA 2FH8A 3ANYA 2EAWA 5C7VA 5FESA 4M8UA 2G3MA 3QGAC 3LSBA 4ICNA 4MVQA 4ENLA 5I09A 5I23A 4CNUA 3H4XA 2PPGA 2R7WA 1JDAA 1KBLA 1RBLA 4S1FA 3UYIA 4DBEA 4CCCA 3CC1A 2E25A 5LIXX 2X1TA 4B4FA 4XZ9A 3GYEA 5DO8A 1EA9C 3W83A 3WJSA 1EIBA 1IR2A 1Q6QA 2CIPA 4N9BA 4MADA 1VIWA 1SW3A 1TPC1 3GLCA 1PTGA 7TIMA 4XSLA 1I2NA 4BFAA 3W7GA 3T9PA 4G8TA 2C8NA 3AHXA 2XXAA 1UR3M 4U5BE 4QBXA 5D38A 3RJXA 1E1CB 3H6OA 3LS1A 2X51A 1V7YA 3K13A 2WZMA 7ENLA 2IQ0A 4IIHA 3N9RA 4GKTA 4K8GA 1OGBA 3LG3A 4IFKB 3HNJA 2YXXA 1R86A 4U3CA 3PCVA 4MTGA 3W1MA 1MXDA 4C6IA 1IGSA 3TQKA 2FFHA 7PTDA 3G1FA 4G5DA 2R8WA 1CGNA 2BB0A 4JIOA 1ZJHA 4R85A 4TVDA 4L56A 5I2UA 1XYFA 4TXEA 1VPQA 2D20A 1K8XA 4GBUA 3WMCA 3RLGA 3QZAA 3DKAA 3WLJA 3U8VA 1YNPA 1N8FA 1QXLA 1DJQA 2QHAA 4ZQNA 4PMNA 2QCFA 4TQTA 3IRDA 1EWEA 4TX9A 4UTHA 5FI8A 1DWIM 3DFHA 3UGOA 3P0WA 4D8ZA 4OZOA 4QDWA 3AUOA 3W6YA 2J7GA 4K1WA 1REQB 3WUEA 2ZZ6A 1E15A 2DVXA 1W9UA 5CC5A 4CQCA 4MQ9F 3AWNA 3DD7A 4X60A 3VKCA 3GEIA 2NSGA 4Q4KA 2H6RA 3PZOA 4WGZA 1XGZA 2O92A 1C03A 5AVHA 2IPWA 3U2EA 2P50A 1TMHA 3IK2A 3ANUA 2Q02A 1NDVA 4Y7EA 3ZR4A 3KRSA 1K04A 2YZRA 3IVUA 3EB3A 4ZOBA 4TVCA 5BUOA 1ZNNA 4YT2A 5I77A 3S5NA 1C8XA 4LH8A 1UIPA 3I5QA 4Q3MA 1SJAA 2QLAA 3HJZA 1T6IA 1UQZA 1LKXA 1Z7AA 4Q4OA 1AH3A 4X63A 4ROPA 1HW1A 4HPXA 3VABA 4F2UA 4OD4A 1N55A 3FCPA 3I6TA 1A5CA 2AMXA 2VTFA 4IL0A 1D3GA 4AZIA 3DHFA 1RA5A 4U2YA 1V4YA 1WA3A 4KCVA 3AI0A 1YNYA 3VYLA 3ZVIA 4XTIA 3M4HA 5J5DA 2Y70A 4J3ZA 1EGZA 1GVYA 2YCLA 5I3JA 4GC3A 1SMAA 3RMEA 4ZSTA 2PCEA 4S38A 2QCNA 2WNNA 1RXOB 3KVKA 1YBQA 3G0XA 1D1BA 3GDBA 4MNJA 2PTXA 3N6QA 3B8IA 4CDVA 1ZHXA 3OA5A 2RJGA 3GW0A 3LEPA 2YDSA 4PULA 2HCVA 1PX4A 4V2XA 4M0XA 4ZENA 5A6SA 4PK4A 1GVFA 3JZUA 3O6YX 1KWGA 1OG0A 1EWDA 2J7EA 2E28A 3W6MA 2BHUA 3V1HA 1O5QA 4MVZA 4I9JA 1SR9A 4QAWA 4JD4A 4E4UA 1D1CA 2D3NA 2OJPA 4HBKA 2GK1A 4M6UA 1ZAIA 4YT8A 1GEQA 3E5BA 4NZFA 3CO4A 3CAVA 3DI0A 5AFDA 3BOXA 2WWDA 1XYBA 3C8ZA 3E0LA 3FVYA 4LYKA 4I6KA 4JIRA 3EZIA 1BKHA 1X97A 3EBVA 3VX1A 5MF5A 3KFTA 3NSXA 4CD4A 4GABA 2PLMA 1ZZMA 4KNVA 1OEPA 1F5ZA 2FVKA 2PGFA 2I7GA 4OQVA 2QPXA 3BEHA 5DELA 3WBYA 3OGVA 1PSCA 1TWGA 5IHRA 3O63A 4LCQA 1TIWA 1D8CA 2R9RB 3WENA 3L4UA 3H4GA 3M0MA 2WQPA 2PF0A 4AUBA 5BWAA 4UQBA 4ZL1A 1WXJA 2PDLA 2ZD9A 3N3MA 3VFLA 1O68A 2BC5A 4GQ0A 1VFOA 4Q4RA 5E6YA 3NPUA 3TYEA 4NJJA 3U48A 2PNOA 4E2OA 1U0BB 1Q4WA 2HROA 4JTEA 1P0BA 3NL3A 4U5KA 1TQXA 4LYRA 1E0VA 2ZX7A 4HNTA 4DBQA 3WH6A 5CPSA 4AXKA 1WWPA 2ANUA 4XKMA 5BU9A 1LDCA 4LGXA 5CCZA 1QNRA 3RVYA 2D2HA 4EF8A 1M7PA 3W7QA 4CBEA 4S3CA 4MAZA 3ANVA 3RW0A 3MS8A 3E96A 3T4CA 1KCXA 2OQHA 4NHVA 4ATWA 4EK7A 3VOCA 1ECEA 1QHZA 3KMIA 4EXQA 3VKAA 1UKTA 3SURA 4QJ1A 3JR2A 3TD7A 2BXZA 1UD3A 1S7ZA 1LF1A 4MNKA 3GE7A 2H9AB 2OEKA 4X0VA 3SIZA 1JAEA 4HK6A 3HGJA 5AB3A 5A1AA 2V67A 3FJNA 5D2XA 3MCOA 4DN1A 1OBAA 1ZJIA 1A5OC 3WFZA 4IP7A 5A94A 1A5KC 5A2AA 3E9VA 5K7JA 2NVCA 3QMRA 1I2RA 1WXYA 4WVXA 4Z42C 1MNZA 4XD6A 3VAVA 2RGLA 4I9AA 3AMLA 4UFHA 1M7XA 3EFOB 3I7QA 1V0LA 1MQRA 3BC9A 2OMAA 3TW9A 4LNCA 4E8CA 1MFUA 3NO5A 3GVRA 3RU8X 3FXGA 2ZZ4A 5LIYX 1T99A 3H2UA 3OLDA 2UY3A 4GY7A 1TUFA 4YU1A 3ID7A 3AXHA 1KXVA 3OQ8A 4AE4B 4ZGYA 4Q33A 4XIAA 2QJHA 3VDHA 1W54A 1WDWA 3BOLA 1VC4A 5A6KA 3IQCA 3H70A 4ULWA 4E2VA 1XQKA 5F28E 2VCCA 4LBRA 5HWJA 3W22A 3V7PA 4Z2JA 2WC4A 3M4CA 3E38A 4ZSUA 3URNA 5CAKA 2FYMA 3A5VA 4GVIA 5RUBA 3TYUA 1E2XA 3SIMA 2Z1KA 5KETA 3P61A 3LHYA 2C16A 1G5AA 2P0IA 1B9ZA 1A5SA 1MW3A 3C0QA 4K6AA 1U1UA 4UTWA 3SN4A 1M01A 3V5FA 1KFLA 4DNHA 5JS5A 4WDTA 4D72A 4UMBA 4UTUA 4XWUA 4H4KC 2ZADA 2HZ8A 1NDWA 3HQ1A 1HMDA 5GPGB 4BA0A 5FJPA 3IIXA 2FJUB 1UWSA 3VMOA 2DZTA 4GJ1A 5DY2A 4ERIA 5FD0A 3FNDA 1OZMA 3LN3A 3MBFA 1RXQA 3I4EA 1ZHZA 2EHHA 1A3HA 1GJPA 1F76A 3IUHA 4JTCA 3VO0A 4A21A 3OZPA 3AHYA 1OC5A 4GBDA 2VGFA 1H7WA 2GJLA 2PDNA 5XIAA 4J40A 5DQPA 4F4BA 1XSKA 5EMLA 2CLEA 2NXHA 2OKTA 3ICJA 1I4YA 1WBJA 3WLSA 3L0IA 3ONCA 3P62A 5G4WA 3WJXA 1Z6AA 3C2OA 2HVNA 4ADUA 3TMLA 2ZBTA 4TR9A 1XGEA 3STPA 2J0WA 3E9AA 1YDOA 3MU7A 2FVLA 1FH7A 4ERGA 3VNLA 4BK9A 1AVOB 1GONA 2PA6A 1FFQA 3VILA 3EB4A 3BJSA 2XPKA 2VJXA 1I5NA 3D5HA 3MI6A 1AG1O 1NSJA 4L4OA 1YLMA 2DZVA 4RKAA 2YX0A 4UFKA 2VCAA 3VOJA 2J74A 4BCEA 2XIOA 3H65A 4FA3A 1VENA 4NZJA 1KR0A 3RLVA 2E77A 4RK8A 2CEQA 3FDKA 5FKYA 4MWAE 2BOFX 1XLFA 1E1CA 1BYAA 4NP7A 1AA1B 4UCGA 4PSPA 1Z3NA 2VM8A 2QJMA 1A7EA 1NFGA 4IFKA 5M5DA 2Z1VA 3NQ7A 5AY7A 4WXZA 1NWTA 2QJIA 4OD5A 5FZTA 3SXZA 5CC6A 2XS8A 3GO2A 1W5QA 4Z2LA 3N0TA 1NP0A 2C1HA 2GSHA 1L6YA 4QS6A 1R3VA 1G1YA 1NDYA 4IP5A 2IPGA 4HTYA 1NP2A 4DNMA 3GNPA 1ISVA 3NDZA 4L6HA 1W9PA 1MDLA 2YR1A 5EKYA 1Q7QA 3MMTA 3LS9A 1N8WA 3M5XA 2DIEA 1J9YA 1H5YA 4LT9A 1ZBKA 1RQBA 3E2VA 2WVVB 3BZGA 1REQA 4NC3A 2PDGA 3MKVA 1S3HA 3CQHA 4UMCA 3WNNA 4C7OA 1PKYA 1KO0A 4BF5A 1H60A 3RITA 2Q9AA 2F61A 4FNTA 3JVAA 2HBVA 1R38A 3L34A 3MV01 5T3TA 4L6DA 3T2OA 3RF3A 4QEHA 2YZSA 2KYHA 2HPMA 2GWNA 4QDPA 2VEKA 2XSXA 4YVXA 2O7QA 2B81A 3AISA 3L9CA 3L8JA 1W3IA 5HMDA 4HMDA 3L66A 1GOMA 1GKPA 2OEJA 3VIGA 4S3GA 3EDDA 1KBJA 3UFYA 4CCEA 1BXNA 3FOPA 1JEZA 4CQ8A 2JGQA 1HF6A 2PD9A 4OV9A 8TIMA 3DI1A 3NNTA 1A4MA 1U1HA 4N6FA 5BNKA 2VC6A 1NOFA 1ISXA 4DWSD 3RRXA 1I1XA 3PSWA 4QLJA 5A69A 3JCUQ 3UR2A 4JTKA 4M29A 4JE9A 1DJWA 3WQFA 5JUVA 4OJYA 1MW1A 1Q6DA 4I1OB 3QQWA 4Z2IA 2ZUTA 2ZRWA 1VOMA 2D0HA 2OYKA 2WKLA 1NWUA 2ZE3A 2CXEA 3W8HA 2X42A 3PANA 1CGWA 4QISA 3W2WA 2HTMA 3P0XA 3G1XA 4JTFA 4O16A 1K3UA 3IQ5A 2I56A 3AMGA 4YL0A 1DQXA 3AGTA 4CDYA 2WK2A 3SNHA 1WOLA 3LQGA 1S2VA 2W4XA 4S3AA 1ADDA 1MW0A 2V5CA 4J3SA 4OUEA 1MDRA 3G6MA 2BWGA 2VC5A 1GOKA 1XRSA 3TLLA 3CO8A 4F2TA 1XBZA 4DJFC 4M82A 4K8HA 2X0SA 3HGRA 3C52A 3H53A 4LCRA 4C7GA 1QDSA 4GNJA 4QJ4B 3W7CA 3GEEA 2QCMA 4QDMA 2DYRC 1TRDA 1NY1A 4QSHA 1W5NA 3SUUA 1PCKA 4N02A 4RXGA 4O6MA 3ZT5A 1XYZA 3GFXA 3PF3A 3PZMA 2ZUVA 2YA0A 2Z26A 1WZMA 4WCJA 3C6CA 4W4QA 4JYFA 4EAMA 2CERA 1W5MA 1LP6A 2WOQA 3VIMA 5D03A 3OBEA 1PZ1A 4A3QA 3RXZA 4O53A 1W1ZA 1XSIA 3RR1A 3H2MA 1BTCA 5KZEA 4F0HA 2J7BA 1EA0A 1E86A 4P5UA 5FEWA 7CGTA 3NVDA 4IHCA 2PE4A 2Z6IA 3N2MA 3DI5A 4AISA 3BARA 3EDFA 4H83A 2DFAA 2C91A 1H41A 4GYFA 1KM0A 2B7QA 2A1YA 4HB7A 2JD3A 3NQ8A 2A7PA 5TJ5E 2R9RA 4DWSB 4H9MA 1UZDA 5HWNA 3P74A 3WDQA 1CLKA 2GDUA 2F6XA 4QDLA 1LQ2A 2XINA 4DBUA 2NUWA 3OWTA 1V5XA 3P82A 4PE8A 3VKBA 1WZAA 1PV8A 3EX2A 1E5NA 4PZVA 1NSGB 1XZPA 3UWEA 3C2FA 4M5PA 4M7TA 4WY0A 4LU0A 1WQ5A 3W86A 1H09A 1EFZA 4H01A 2KZHA 1NF0A 1XFBA 3IAPA 3N34A 5DS6A 4UQEA 1E6XM 3ASNC 1AODA 2XVGA 2ZUUA 1TR2A 2OEXA 4JZ5A 2VQTA 3RAOA 2XWEA 2BASA 1BEUA 2H7VC 2CXGA 3DHDA 4JR5A 4JFTA 3VIPA 2H9AA 4ICMA 1JAFA 2ZXOA 3ARSA 5CPNA 1ZPTA 4J3WA 2ASHA 4P7RA 4JNMA 1E56A 3AMKA 3QV6A 4CDAA 1GWJA 1XL9A 5REQB 2PGWA 6ALDA 1KW1A 1SZEA 1TPEA 3GH4A 3FN9A 1V6UA 4C6NA 3EOLA 5HULA 4ADSA 2BBFA 3WQVA 3PHF2 3EFOA 2OKUA 4BI7A 1TWDA 1OX5A 3OYXA 1UWAA 2UY2A 3HPSA 2BY0A 3ZWSA 3K1GA 2XLEA 5L0CA 1EQ1A 3B05A 1CYGA 5COFA 3PFMA 1RUSA 3HTWA 4MTOA 2WNZA 3RX4A 1G4US 1LG2A 4AE4A 3K46A 4YTQA 5PTDA 4U10A 3TZFA 4O54A 4QJ3B 1NWSA 2GVGA 2PBOA 2DSKA 3VKDA 2OX1A 1QI2A 2RD9A 3IK4A 5H91A 2YBUA 4EPDC 2HVMA 1RR2A 1EGVA 5HNRA 3SB0A 3H26A 4ZQRA 4YT4A 3WBAA 2R7TA 3DJNB 1KGWA 1QNPA 4NNCA 2I1OA 4KEUA 4C6CA 4GUGA 2CLIA 4GK8A 3SBFA 1RMVA 3PN8A 3THAA 2OYLA 4KWVA 1KGUA 3WDIA 1H7RA 3DXIA 2G62A 3GZ3A 5CSYA 4WOZA 1IV8A 3B29A 3SCSA 5KEZA 3A4WA 2PWDA 4ZVJA 2NLIA 4K3ZA 4A6GA 1L7CA 1OC6A 2YQYA 2IBFA 3L4VA 4HCHA 2Q09A 2EPHA 5DCDA 1N7KA 4DO5A 5LXXA 4HJFA 1MMGA 1WOAA 2YPIA 2PZNA 4U2ZA 1R3YA 5BRPA 3L5MA 1HVQA 4ZB5A 5DCEA 4DZ5A 1FTXA 4UQAA 4Y9OA 3DFPA 1LRTA 2IKJA 3LESA 3HPXA 6REQB 2DT3A 3PK7A 2INZA 1EOKA 4N42A 4NILA 2PX0A 4LEQA 4JTUA 3TCEA 3OU8A 2OU4A 1GT8A 2NUTB 1UMLA 4KESA 4NJHA 1Q2SA 2CLLA 1FP9A 5CZ0A 3HJEA 5T91A 1HJQA 1DWFM 2FMOA 4G0HA 1OFDA 4LNYA 3EPOA 4UNKA 3HLZA 5D9PA 4LLEA 5KZ6A 3N2TA 1GHRA 1KFKA 3ZZ1A 3DE9A 2I5QA 3CQKA 4JC7A 1TPUA 1V08A 3HV8A 3EA3A 2DZAA 1ZB5A 4JIEA 2QIWA 1OK4A 2L7AA 1ITUA 4GD0A 3W75A 2CZDA 3WH8A 2CLFA 2PI6A 1LLWA 3W00A 3NQMA 2AU5A 3GXNA 2DGJA 4PBFA 2QDGA 3QHMA 1B31A 9RUBA 3UWQA 1YZAA 4J2MA 2PFHA 3PBYA 4N4PA 3QC3A 4QX4A 1HKVA 3G3MA 1H1NA 3PZTA 4K1GA 4RV3A 4NZ5A 5HNUA 5HANA 3K1HA 3T0AA 1ZP3A 1PD0A 1TV3A 2WM0A 1A41A 1VPXA 3KL0A 4RPQA 4JQ4A 3PMRA 4HSNA 5LA1A 1XIHA 2Q8XA 5FOOA 4Z17A 3T2QA 1AEPA 1BWKA 3ARTA 3S84A 2HWGA 2EKCA 9XIMA 4MJMA 1OZQA 5E0CA 1ZLPA 3FOKA 4CS7A 5I3IA 3TZNA 1DPMA 1BWLA 4L65A 4DJEC 2NXGA 2ZX8A 3QMKA 4ES4A 2HRWA 1NEYA 4BJ1A 1LIHA 1FMVA 2PLJA 3PM6A 4O14A 5C9RA 1H7NA 1D8WA 2CZFA 3P5ZA 4NX5A 1JZ5A 4RNIA 2A6NA 2QF7A 3RN6A 1A7VA 3WODF 4E38A 4C7DA 3R2PA 3J06A 3SP1A 2X1RA 3HG5A 3U5YA 4ADTA 2DH3A 3UPMA 1JF6A 4B2DA 2FFCA 4QROA 2ABAA 1LWHA 1YW1A 5JRAA 2WJDA 1TWHA 4Z2KA 2FTPA 4L80A 1UZ4A 1ONRA 5A8NA 3GANA 1MFVA 2FIQA 5EMYA 3C2RA 2GSJA 3QVYA 4PFPA 1KTNA 3M16A 4MFEA 4X9SA 1YYAA 3V5YA 2YXGA 1AUEA 4WF7A 2HV6A 4LRSA 4TTUA 1NFNA 1SR2A 1M7OA 3LUTA 5DRIA 4V28A 4XLPF 4FAMA 2XRHA 2EINC 1XYLA 4C3EA 1P0DA 4ILSA 1W0MA 3HFTA 1PZ2A 4ZXLA 3SCPA 3CQ0A 1O5HA 3PC0A 2OO6A 4JIHA 2GOKA 3JT1A 3KRBA 4OECA 3H23A 3UG5A 4BI5A 2W92A 2O0TA 4TTGA 3KEHA 5D37A 4HFKB 4ZFCA 4DOZA 2A21A 1MNSA 4AHPA 3DM9B 3VCRA 2C04A 3BG3A 4DI8A 3GU9A 5FEXA 3W2NA 2P7VA 3P81A 1ZBWA 1QI5A 2V3FA 2V2HA 1ENUA 3U3HA 4M6VA 2G95A 3APGA 3W6LA 2ZDSA 3WLQA 4IMCA 5BU6A 5IXEA 2YCEA 2PBGA 3BSHA 2QW5A 4CU7A 1ZL1A 3RDKA 4UC5A 3KYJA 1JCNA 4L9XA 2HS6A 4FEZA 2QCCA 4H7CA 2QYGA 3PWAA 3M0KA 4Q8UA 2FDMA 3IJQA 2FGBA 2JFEX 4OINF 3G77A 1JZ8A 4HE8D 1QASA 3U2CA 2DGAA 4N7QA 3GM8A 1YNQA 2AVKA 3MSRA 2F6KA 1T9KA 4QITA 2WHKA 8RUCA 1V6VA 4Q6XA 3S1UA 3CTTA 3Q94A 3K7DA 4Y9NA 2W5FA 1JCTA 2PDYA 1MQQA 3AIQA 4JDYA 4WJ8A 3QM3A 3GR8A 2RJHA 5LA2A 3E0WA 3LI0A 3CAXA 3WF3A 5KSWA 1S5VA 2C3ZA 5GJPA 3VCNA 2VEIA 3PNUA 1F3EA 4B4HA 4W7WA 4GPNA 1Z89A 3WFAA 5DX7A 3IGSA 4BQ3A 3W7OA 2Q8ZA 3UGRA 1VP5A 4F8XA 4DJFA 3R11A 4HA4A 2IXPA 3RKOF 1F4AA 1M2VB 3HPFA 1HX0A 1WB0A 3HIJA 4DM1A 3GDRA 3OPSA 1VCFA 5AZ0A 3VVGA 3NL2A 1YARO 1YPIA 4XAYA 4DHGA 1BBHA 4AHQA 4CNNA 3EX4A 2VZVA 1NIUA 2EPKX 2QNLA 1UP3A 4JFWA 3QVZA 4PJNA 4FXJA 1TB3A 4PMUA 5L0GA 3LHTA 2NUXA 4AY7A 3KVMA 4QFUA 3UVAA 3DAQA 3TQ0A 4CD8A 3LLXA 4IGNA 3BICA 4J28A 2LFFA 3QGVA 4W5UA 1Q7MA 2RDXA 2WLYA 2RDTA 4IISA 4RX0A 3NPWA 2BNJA 1R5ID 4JPGA 4UNIA 2XDFA 1VCGA 1TWIA 3N15A 4TVUA 2Q8LA 3A3WA 3HA1A 1LI5A 5L3VA 1X7FA 2BVDA 1MMAA 3OEXA 3EWZA 5HQMA 2ISDA 5KYXB 2HQAA 4EPBC 5HR6A 2FHCA 2VWTA 5CG7A 3W53A 1E6ZA 4MDOA 2NWRA 1GM5A 3N19B 2V38A 1R87A 1I2QA 4DZIA 3UNGC 2JF7A 5H1WA 3U9MA 1VYRA 3AG3C 1E72M 5LHEA 3CQJA 1QO5A 5A8PA 3SFWA 3AOUA 1R2TA 3GHSA 1Q63A 3K66A 4BEQA 1VFMA 3VGEA 1SM9A 1VQTA 2REQB 2F2HA 3FEQA 3NYDA 3P14A 1L8PA 3I3DA 4KI2A 1BR2A 2C7FA 4LB3A 3QLLA 5H2ZA 3W70A 3EWUA 3G24A 4EX4A 5REQA 3PJUA 3GKAA 1O6IA 1FWCC 1MXSA 3OW1A 3TJ6A 1UP2A 2PURA 3LCXA 4HNCA 5JH1A 3G2GA 4I8YA 4Q8WA 4WJ0A 1V02E 4GFSA 1XH0A 5E70A 3NZPA 3T05A 2OGJA 1AL7A 1R3WA 2ZUSA 5A6BD 1LWIA 1JNEA 1Z5ZA 1SGJA 4YYFA 1GKQA 3O6XA 3GWQA 1EOMA 3CQZA 1FA2A 3DFYA 3H2EA 4U5GA 4KFOA 3WG6A 4CCDA 1R47A 3HTKC 2ZC1A 4D6EA 1A3WA 4Z2HA 1RLDA 3GNRA 1H6GA 5C55A 2E6AA 3U2LA 4NQ1A 3NGFA 4HA1A 4DI9A 3KW3A 1UH3A 2OLAA 2POZA 1DVJA 4MVUA 1LI7A 3CZKA 4PC8A 2MUCA 1J8YF 4XSMA 4M81A 3TIMA 2L81A 4XB3A 4QR6A 1V74B 1W2WA 7A3HA 1BQCA 3WNMA 4OBSA 1VBRA 5DLCA 1V6WA 4UTJA 5HK4A 5DMNA 1B9BA 2WJFA 4NVTA 4D6HA 3BPWA 3R94A 4N2YA 5ABGA 3ZIBA 1QVXA 2V5KA 3PFRA 1W1IE 4LY8A 1A5UA 1HKKA 2J75A 3K1DA 2R1NA 4JAWA 5F2GA 3PNZA 4U5EE 4KCWA 3IANA 1V0MA 3LZ5A 3UJEA 1AMYA 3KM8A 2WMKA 4BJ6C 4D1IA 4AYGA 2X09A 1EHAA 1WTYA 1ZJBA 2Z27A 4DBSA 1UQYA 3LQLA 2YL9A 3EGDB 3BH4A 2NUPB 3CHFA 1T5AA 3HPAA 5E09A 5I03A 1YA9A 3LSCA 3YPIA 3GSMA 4XD4A 2EO7A 3DECA 1J2BA 3QW1A 4LXFA 5LIWX 6REQA 3BO9A 4JTGA 1AVAA 1ISZA 5HNNA 2NSXA 4QCFA 4RBNA 2XN0A 5EA9A 4PTVA 4QLKA 3B9OA 4CD7A 3W7KA 2OLSA 2NUTA 3GWLA 1RQEA 4LPCA 2XH0A 1K03A 3T44A 1T41A 1A0CA 2QMJA 2I5IA 5HV9A 3HN3A 1FHVA 3HG2A 1SJBA 2OZ8A 3B8UA 3LMYA 4MGGA 1QI4A 4FLSA 3S47A 4OWGA 1IWPA 4B90A 3Q67A 1FKXA 2QCDB 3WH7A 2WKJA 4AFYA 4BQ4A 4JYEA 3PPFA 4AWEA 1JPMA 4HK7A 4C6JA 4J35A 2QPSA 4ZQPA 3B9QA 2F38A 1O95A 3ZOAA 3AIEA 1AQHA 4KGJA 4AIOA 2G8ZA 2O9RA 1TTQA 3NTYA 1TWAA 3E2RA 1IHIA 3H2VA 4O17A 1EL3A 2G3VA 2DQXA 3SYNA 1QNOA 1PWLA 3CYVA 1VTMP 1UG7A 2J46A 4I44A 2BV9A 3TQVA 4GIYA 4QI2A 3T2PA 3LHUA 1GCYA 4W7UA 3WQCA 3M41A 1OFOA 3GXMA 3W2JA 3HQNA 1WBHA 2TMVP 1RD6A 1H9GA 2XS1A 4WDUA 3V18A 1E4NA 1XM3A 3N9KA 1MRQA 3BURA 3VM7A 3ITLA 1ZW2A 3O07A 2GQ9A 1JPIA 3AMDA 3R58A 2D1ZA 3URQA 1AW5A 1T6MA 2ZRZA 5ABHA 4MB4A 3K5XA 1HGWA 2WVTA 2CESA 2NVDA 5E3AA 1KFWA 2V2CA 4I7VA 4QIUA 1PX8A 3FAPB 3NSMA 6TAAA 2QAFA 2YB1A 3HGSA 1QVBA 4J9JA 3AG2C 3AZTA 1P1XA 4C6EA 4XVDA 1UA7A 4HPHA 1FQ0A 4HVXA 4DLMA 2PWHA 1ISWA 3TDFA 4EPKA 1XP3A 1HG3A 2B31A 3ZXWA 1RKEA 3B8DA 3VI2A 2VOMA 3LMZA 3PBWA 3C8GB 1XIJA 3K1IC 3RCNA 4DJ9A 3LHVA 3N04A 5CPMA 3DG7A 3HF3A 1V3LA 4XPYA 4O57A 3EWCA 1F1MA 3OVRA 3QFEA 3FK4A 3EYPA 4YMZA 2Q3RA 3BAYA 2GYIA 3E1F1 3AG1C 3H24A 1V3MA 3A3HA 4KRUA 2J8WA 1T6UA 3VIKA 5E0KA 1H7OA 1YIXA 4ACYA 4L5ZA 1FWBC 4DJEA 1J0ZA 1HGYA 1T8QA 1HJSA 3ZJ6A 4O50A 1VZWA 1CIUA 4O11A 4W8KA 4B9ZA 3DKJA 4MUZA 1G8XA 4Q5SF 1V51A 4XO6A 4PL2A 4PA8A 3CBWA 1EKYA 4DM2A 1L6WA 2PRMA 4CLMA 4U5HA 1K6WA 4TMCA 3OLIA 3LEVA 4A2SA 1DXFA 5FJRA 3GM1A 5L0IA 4I5RA 3URBA 1PVNA 3Q65A 1XUUA 2RDWA 1A7DA 2GVLA 1O94A 1PHQA 4URIA 3IRSA 3Q6MA 3E0FA 3UETA 1G7VA 1JXJA 4MTFA 1GUVA 5DT5A 1TE6A 2B0JA 5DBUA 3MYFA 1C91A 1BVNP 3CMFA 1LE4A 1JCJA 1AD1A 4O18A 1LBFA 4HA3A 3TYDA 3W88A 4KERA 1R8LA 5D8WA 4HNLA 3P80A 4US5A 1UZ1A 3BV4A 1UR1A 5FEPA 4DYEA 2XYLA 1W1TA 1V0NA 3G1RA 2VEGA 4F0RA 3SSZA 1GOOA 4QAIA 3O1NA 4GYKA 1GZJA 3W25A 3WLMA 5TF0A 3U9IA 5I5RA 2ZZ1A 3TV8A 2JPUA 4WGYA 3QV7A 4UTKA 1E40A 2Z29A 3N4EA 5E33A 4RL3A 4WDXA 5AN7A 4ERAA 4X0NA 1V0KA 1Y65A 4YL1A 4ZZ9A 4ZQCA 4G7EB 2ZX9A 4DUXA 2I57A 1TVLA 2JEPA 3WLIA 2IKHA 4JTRA 2R7UA 3EGXB 3GDKA 3QJAA 4UWMA 4EE9A 3GRIA 3OOQA 4BHYA 5M3WA 3CAQA 3ZLGA 4NI3A 1EJUC 1R9XA 3BL3A 2NX9A 1K40A 1H49A 4PCPA 4YTRA 3TCSA 1UOZA 5BYWA 1M2VA 5J04A 1OXKA 3R12A 1FCVA 4Q8PA 3T4RA 4H6KA 4I7UA 5HSWA 5KYNA 3O55A 1EUNA 2J8TA 3WLTA 3PZVA 1KKOA 1MMFA 3GTNA 3MBGA 1J4EA 5FA5A 4LEFA 3ONBA 4KCUA 3WQGA 1QOXA 4I6VA 3ITXA 3O10A 1UR0A 3W82A 1MW2A 3FW6A 4EP8C 1OKKD 2C03A 5CPTA 2X2YA 3GXTA 3O05A 4AMAA 2VC9A 2YBTA 3NQVA 5B3IA 1UKOA 4JTJA 3F5LA 4I3MA 3EKGA 2FHBA 3WD3A 1JUKA 2G3JA 4FF7A 1OT1A 1F8MA 3R0DA 2E6YA 4AH7A 2OZTA 1BSLA 1YDIA 3US6A 3DN5A 2ZICA 4MTVA 3HNIA 2EG7A 3DXJF 3FAWA 4IWBA 1I0DA 3V5OA 5KYXA 4PTDA 4XZBA 4IPNB 3H12A 2ZVIA 3CEPA 4LVFA 4GYTA 4F79A 4RNFA 4WR3A 6TIMA 3MMWA 4HTBA 1Y8BA 4MMWA 4GX9A 1TYGA 4C1NB 1IXOA 3KUMA 1EZWA 4PR4A 3I6EA 4FIQA 2VFEA 3L0GA 3QOKA 4FALA 4IGSA 2A79A 3N17A 5IFPA 1W3HA 1RJPA 1CXFA 2REQA 3PULA 1VB9A 3TQPA 3S9ZA 2IUZA 4DWDA 4ZB2A 4JYDA 3BGAA 2ZZ5A 1CGUA 2CYGA 3SY5A 1BXBA 1W31A 4MIMA 1OW6A 5JUAA 3MJMA 4KGLA 4LUTA 4WKAA 4HQVA 5TQLA 1AW2A 4H6QA 1W5PA 3CGTA 2ZRUA 3GB6A 4LOCA 3ECSA 4HZMA 3VZYA 1UPMB 1TO3A 4C3DA 1P6WA 3KYIA 3K4AA 3E2QA 3KVJA 2SFPA 3F5KA 3W73A 1F05A 3MYIA 3QR3A 3GKFA 5JT4A 3FKRA 5D32A 4MFDA 1J6OA 1FWSA 1BVZA 1JCLA 4BEJA 2HK1A 4NF7A 2WVSA 2DSWA 4JTQA 1OW8A 3O2LA 4L6RA 1FWAC 4PEEA 2BDQA 1VF8A 1JPNA 1CGOA 1CCWB 1D9EA 3K30A 3JZEA 3BQ5A 2KSFA 1L0PA 1WDRA 5EFDA 1TA3B 1OM0A 1H63A 4HD5A 1GVIA 4FNQA 1KV5A 1MEIA 3LTSA 3COTA 3UZZA 2IPFA 1AJZA 4ONVA 2GJRA 1L8NA 1K70A 2GL5A 2NV1A 4F0LA 2EG8A 3AJMA 3NMKA 3TU9A 3NSNA 1F6YA 5CEWA 4S2CA 1CENA 1T7LA 2DIJA 1PCXA 3P5YA 1HNYA 2WPBA 2WO5A 3UR5A 2YKZA 1XIIA 3M9YA 5F1UA 3CMGA 2G3FA 1BDJB 1ICQA 1TPDA 3LNPA 5I7GA 3DAGA 1EC7A 1AUSL 3LHZA 3UP8A 3EQLF 3KBSA 4UOZA 4MLRA 3TK7A 2I9UA 3WG7C 2H8XA 3XISA 3ITCA 1L6SA 3SEOA 1FMWA 2BXYA 5ABFB 5LNVA 5DRCA 4DRIB 1E1EA 2PTZA 2W67A 1IXPA 3FYYA 3NDYA 3W27A 2NUPA 2WNWA 4U5CE 5I78A 1Z41A 3CT7A 2I16A 4O8RA 2VCBA 1KBIA 1MSSA 1EF3A 4ER9A 3XINA 3S6OA 3R25A 2G97A 2ZPAA 1MEHA 3DYMA 1LTDA 1FFRA 3O7UA 5HOSA 2PU1A 4BJ6A 2XZ9A 2XIBA 5F2IA 1QNQA 2J8FA 3BDKA 1JUEA 1KM3A 4A8LA 1XDMA 1DL3A 1XDJA 3M0HA 3SXYA 1E51A 1VFUA 3B8TA 2QQ6A 5AHNA 4IQJA 4LUSB 2V69A 4MUPA 4QTGA 1J11A 4BG0A 1VYKA 5CLWA 3GFZA 1E85A 1HJWA 3PTQA 3DERA 2ACSA 1J8MF 3I3BA 3S5SA 3QPEA 1H4PA 1TRIA 4GMEA 1S38A 3LNRA 1OC7A 2PSNA 1NFBA 3H2OA 3QZCA 2X0CA 3WBXA 4PBEA 1KXTA 4UR8A 3O39A 2B0MA 3L0KA 1U1JA 4KEZA 4MVMA 2VUNA 3S5ZA 1R2SA 3GR7A 4JEBA 2BVYA 1R9ZA 1GYLA 1KBBA 3WK2A 1FWRA 1QAPA 3ABOA 1IE7C 4DVOA 4JOMA 3TK0A 3PUGA 4HKPA 1D7FA 5EBUA 1S2CA 1IZJA 4QG8A 4A2RA 5MKGB 4AF0B 4D4XA 3HNKA 3B03A 1ZU4A 5GQBA 1MZRA 5CXPA 1JQXA 1VEOA 3V35A 3UZYA 2OGYA 4Q8MA 2HMCA 2O4QA 4H9VA 1UA3A 4WRHA 1KNWA 3SY1A 1UD5A 3FJ6A 2C13A 1FCQA 2XIIA 1QPNA 1FRBA 2F7FA 2G4FA 1XKYA 4WKHA 4OGZA 5LYRA 1P0NA 4I3GA 2QDEA 2DT0A 3LBCA 3LDVA 1M53A 1F73A 1A3XA 3L4WA 3EH1A 2YCIX 4JICA 4IG2B 3TSBA 1UHVA 1UKPA 3MP4A 3C8GA 3VRCA 2FLIA 3AS1A 3IIVA 3G0SA 3O06A 4YWIA 1W1A1 4MLJA 3WLRA 4KMQA 4HCLA 1L3PA 2POTA 3BLIA 1JR8A 4HJWA 4UZUA 3CWOX 4UTTC 3O0FA 2BVWA 1G4SA 5CZSA 3WEMA 2AWYA 1TUXA 2QVHA 4Q7IA 3VKKA 1X8FA 2Q4FA 3LXBA 4XAPA 1W3TA 3MVIA 1UC4A 3EPMA 4K7YA 1JD7A 3MFNA 2PGRA 1FWHC 4IIEA 4XG1A 1E6PA 2AL2B 3DG6A 3S42A 3PAJA 2XL8A 2XGZA 1BTMA 3K1IA 4UUIA 3DX5A 3QPZA 3U57A 2QUPA 4CN6A 1W1B1 3T0CA 1HE9A 4OIFA 2DB4A 4JTSA 1O1ZA 2L5HA 3CUFA 1JZ7A 4DUOA 3ABXA 1QI3A 3GODA 1IEWA 1IEVA 3ZC4A 3TOYA 2XFFA 1QNSA 4N0RA 4LDQA 3VDAA 3GVVA 2FVMA 1ZW3A 1U5JA 3W3OA 3JTLO 3FHQA 1XG4A 3SUSA 2WC7A 4PTWA 4IMAA 2C0AA 2VX6A 1TV2A 3MKCA 1CEOA 2OEVA 3S2JA 2R94A 2J25A 4C60A 3GIPA 3RHGA 4JDBA 3ZTMA 1QATA 1WDPA 3EZHA 3D47A 2GUBA 4JN8A 3U7VA 1JZ6A 3GHTA 1O5KA 2A3HA 4K2SA 4PFHA 1UYQA 4IRUA 5EK0A 3HO8A 3WH5A 1SZRA 4BKNA 3MA8A 2CBJA 3HB9A 3LBMA 3NQFA 4MZ8A 2VMFA 3BTNA 3KCOA 3PUEA 4Q4QA 1UOKA 4JL2A 2WVUA 2QDHA 3NO3A 4LB4A 4G7EA 1QOPA 3QGKC 3LCGA 3G1YA 4MVOA 1OFEA 3MSDA 4DZHA 2OKOA 2HXTA 3EGXA 1B3OA 3F4NA 1TPWA 1OCCC 2FZBA 3PY2A 1DV7A 3KTSA 2V3DA 3ZVRA 4L7ZA 2NX3A 2VNCA 2VR5A 2YL3A 4RJEA 2BFGA 1XIEA 2E0PA 3T81A 1YDVA 4DAIA 1XLCA 2QIIA 2QV4A 3VMNA 2P1AA 5F4WA 5C9ZA 4BEMJ 1E55A 2CZEA 2D2OA 3BRJA 3KCJA 1RCOB 2AKMA 3U0HA 2P3ZA 4TIMA 3LD5A 4LYQA 2HE5A 3II1A 4EIYA 3E3HA 4NU7A 3ABRA 1QZXA 3AIRA 4R7JA 3TA9A 4GA8A 1CBGA 1OINA 3DHUA 3HJCA 3KZSA 3AUJA 2V3EA 2Q3TA 3M64A 1TCDA 2C19A 4O0ZA 1ECQA 5A6MA 2L6FA 1E0UA 1L2QA 3B0UX 2J9VA 3UMIA 4QG6A 5AYYA 2QUVA 2GWWA 4D6IA 3S27A 2CETA 2NX1A 3DYOA 4C5YA 4FOKA 1YPXA 5T1DB 3OA1A 5A8OA 4H2CA 5L0DA 2XLMA 1VKFA 3NG3A 1ZUAX 4JFUA 3LTPA 5FL0A 5E0FA 2P8BA 3SJNA 3AXMA 3LM7A 1E83A 3U8PA 5D92A 2W0UA 4CSAC 3NYJA 4CVWA 3EXSA 4IIDA 2XISA 3QKEA 3NYZA 2YXOA 4LVAA 4MB5A 4MY9A 3WAQA 1XRFA 2J4GA 2ZWZA 3VA8A 1IWBA 3MP3A 1GQKA 1VS1A 1R9YA 4A4AA 1YYJA 3GHRA 4S3BA 1FFHA 1C93A 1FY6A 2DUZA 2GUUA 4JTLA 4Z9JA 1XC6A 3RFAA 1XIMA 2FZ8A 2AP3A 4GZEA 3M46A 3VZXA 3W2LA 1XBVA 4W7VA 3WL0A 5HINA 3ZR5A 4IGMA 4AQLA 4US6A 2YW3A 2Y62A 4HT3A 3GXPA 4KRZA 3VM5A 2JK2A 1XDLA 1EPVA 4WUIA 1SF8A 1N82A 3WLHA 2VI0A 5TBOA 4KFPA 3VGFA 2CNCA 3B97A 2Y2WA 3GYCA 5L3QA 1XBYA 4Y9MA 1FCBA 3RLUA 1DE6A 1DJGA 1Y5WA 3SUVA 3RNDA 4PR9A 3QTHA 1LLOA 4J2PA 1BG9A 4KWWA 2KGOA 3FGCB 2NV9A 1M2OA 3EMCA 2EPOA 2OSYA 3IQTA 3E0VA 4PBGA 1EBGA 2GK1B 3T8QA 3WKZA 3DEQA 4HNVA 4LACB 1X1ZA 3CUIA 1VYIA 5KITA 1JYWA 2BY3A 1RVGA 3B0XA 1TA3A 1XD1A 4DPQA 2YZ5A 2QAPA 3VFCA 2I5GA 1NU5A 3CXOA 1ODZA 3A5FA 3C2VA 3S83A 4JQAA 1EJSC 1OT2A 2DU2A 3EWXA 2IQDA 4W8LA 3DJUB 1H2JA 4X61A 3E0IA 3D3AA 2XVNA 1I45A 3REQB 2GUYA 3OEOA 1Q0MA 4LBSA 4PEKA 1D2KA 1Q8JA 1F3WA 1I75A 1XLIA 3QTGA 2CLPA 3TH6A 5EFFA 3N2CA 5H8UA 2OCCC 1IXQA 3ITOA 3VDBA 2OX4A 1UUOA 3OB8A 4PJLA 2WPGA 4FWVA 1ELSA 1GGOA 3WUGA 1OYBA 3M5ZA 4W86A 1DJXA 3PUOA 3AQBA 4H9YA 1GOWA 3MV11 1SJDA 5CPOA 5ABFA 3G18A 4OTKA 4A8NA 3SECA 1JDFA 1MXGA 4IGGA 3P2VA 5HXMA 4YHGA 1W3JA 3JW7A 1FWNA 3M47A 4AD1A 3T0TA 1XV8A 3SO7A 4GUIA 3W7LA 4EOUA 1PZ3A 2JQXA 3S2NA 4H8NA 3KP0A 2MYSA 4J5NA 5I3HA 3L4XA 3T0DA 3MUIA 4FR6A 3M0VA 5LKYA 2Z6JA 2ZRXA 3DGBA 4A05A 2Y3GA 3WJWA 1B4KA 5CQ1A 3RIKA 4J30B 5CG0A 1J0JA 4O8AA 1R3QA 2GZXA 4Y9AA 1TTJA 3J7HA 1F3XA 4P61A 2P8CA 3CT2A 4LUSA 4PODA 3EOEA 2BL2A 2DZWA 4KWUA 4ZOEA 3HPZA 1TPH1 4KRTA 3W37A 4GJIA 2GAQA 4YL2A 2XIJA 1K9FA 4EWND 4D71A 3EWWA 2YLIA 3F03K 2C15A 3EEGA 3R7CA 3EMQA 2PTDA 1W9BM 1QMLA 5JBFA 4AZ6A 4PN2A 1E1FA 1PEZA 5C70A 2OVLA 4FX6M 2E3ZA 3ZT7A 1JIBA 2JIWA 1LROA 1H0IA 5BOFA 3C0LA 3C18A 4TX6A 3WMLA 3PJXA 4MW8A 3LLIA 2BMBA 3AJ7A 4XKYA 3OO2A 1RBOB 2DPEA 1ZP4A 4K7VA 2V5BA 1JYXA 2WCSA 1Q13A 1B1YA 1KCZA 4O79A 1O7AA 3QRHA 5GPRA 4S3JA 2IXMA 5AC4A 4BQ5A 5CC7A 2WB7A 2BSLA 1ZHYA 2E6FA 3AIBA 4AF0A 2WCAA 5U7SA 2H90A 3NZRA 3CPRA 4JXCA 1DWAM 1E4IA 2E1WA 4CU6A 3DKLA 3AYRA 3OIHA 5D2WA 3MO4A 2PC8A 3TXVA 4MSSA 256BA 1VMAA 3S9OA 5CSRA 1BF2A 4DJDC 4DQWA 2KAUC 3RM8A 3WD2A 2VUYA 4U4MA 1JCXA 3S6DA 1TV4A 1UD8A 2YFNA 2OWXA 4PYSA 3ZTZA 2ALRA 2A6EF 3EEZA 4AC1X 2YEVA 5E3CA 5A6JA 3G0UA 2PDQA 3W7NA 1KFJA 4TV5A 1GPWA 3VYWA 1HKMA 2Q71A 3C86A 4AX2A 4YN0B 2WANA 4KEMA 3EZ4A 2Z2BA 3KOFA 2XL6A 3SUWA 2FZDA 1PWMA 3UWUA 3UXLA 1LQ0A 2YJQA 3LAYA 3EKZA 3U8GA 5JIWA 4X22A 3VX0A 5D2TA 1P6BA 1QW8A 1DIEA 3B04A 4D8LA 4PB4A 4QNWA 5TD4A 2C18A 5F2MA 3MO7A 5JH2A 2UBPC 3HKKA 4ZFMA 4AVNA 3IVSA 1XGDA 5I00A 1NOUA 5D9NA 4JTCB 3A9CA 4DF2A 3JSZA 2X1IA 2ZDRA 2PS2A 3FAXA 1OVDA 4GI4A 5AC5A 3QMTA 2QCGA 5BMXA 4JQ3A 4FESA 2JBMA 1EJXC 1YE6A 4F66A 2ATSA 1JPKA 3V1PA 2DZUA 4UTTA 3F47A 3ZS4A 3KOYA 3NM1A 4GGBA 5G1TA 4JKVA 1TX2A 1AL8A 2TMDA 1RP9A 2P1FA 1HN1A 1XRTA 4O6NA 4R32A 3OGSA 3LPFA 4FI4A 3DBPA 2PDHA 3T6BA 2VWSA 4OKDA 4TX8A 1F7BA 3RIPA 1FWWA 4NAEB 2I15A 5FSEC 3WQ5A 3DOPA 1WATA 3MB9A 1BRLB 4B15A 3M0LA 1KM2A 3FLUA 3K6BA 4IMGA 4N4QA 4JCMA 2OQMA 1J0YA 1K1DA 2J7HA 1OYCA 1CPRA 2V68A 2CW0F 1C7TA 3GTHA 1V6XA 3VDCA 3WF0A 2WL8A 3DZ1A 1FAPB 3BVJA 3L5AA 2B0HA 2VEMA 3CEUA 2J6VA 2UV8G 5M17A 3TC3A 4K36A 4FNUA 2J8GA 1PAMA 1R85A 2W9YA 5LIKX 1YXDA 2DH2A 1IT8A 3K4WA 4JY8A 3N2ZB 5D9OA 4UTMA 4S3DA 3HG3A 2P88A 4LAZA 4B6IA 3ZVHB 2IXNA 4GACA 3E70C 1WAWA 3GHUA 2MANA 4J3TA 4DYKA 1IIHA 2BHYA 2OOFA 4JCLA 5A6LA 2YGYA 2BY2A 5G5IA 1UMYA 2PF8A 2Q01A 3FVDA 1SVDA 2ETSA 3M5YA 3TTYA 4E2BA 1VAHA 4AZGA 4REQA 3W2VA 3R5EA 2V82A 4Q4ZF 5LHFA 4N6HA 2FB3A 3BW3A 4IMEA 3WELA 2IKGA 4NTFA 4P9FA 3POVA 3UD6A 4N9CA 3DFSA 1RHCA 4C7OB 1WDQA 1WO2A 3KE0A 3L2IA 5A95A 2GA0A 2R82A 1M6TA 4L64A 3QEZA 1TV8A 2GVEA 4WXYA 4JEQA 1FWGC 2YRFA 4WEVX 1TVNA 1UFBA 4MZYA 4IXXA 3CL7A 2QF8A 2A3BA 3QSTA 1US3A 3ZQVA 2OZ3A 3T07A 1R7OA 1KGXA 1RALA 2PWUA 3UJSA 2EJAA 3KTXA 3ZSUA 2VVSA 4JCHA 3R1ZA 3FKKA 3OIXA 3BOFA 3JYHA 2R7VA 4MDPA 3SFKA 1YE4A 1UWUA 1CGME 4QE4A 3SCWA 4KNWA 1R30A 1RJQA 1Q6GA 1XFCA 4E4FA 1OCOC 3DHPA 2ICSA 4YN5A 4BJHA 4YJWA 2V5JA 4GVGA 1Q8AA 5BZAA 5G2HA 2CCRA 3LLDA 2ZXAA 5D9MA 3SZ8A 3UCDA 4XBSA 3NDBB 1H62A 1B3XA 4CEXC 3S2LA 3LTYA 3I7SA 3NQDA 2YSWA 4A22A 1IZCA 1IEIA 3ARWA 2VQUA 4PGLA 1GG0A 2DSVA 3VE7A 3W38A 2XN1A 4ZB0A 1I4ZA 5IOBA 4I9TA 4XZNX 2PAJA 2W27A 1TMLA 1TX0A 1Q2RA 2HZGA 3UWWA 4L1WA 5I3DA 1TR1A 1QWGA 5C2XA 2EKGA 3CH0A 4EKWA 4CSAA 2BLEA 2XVLA 1UPPA 2F6UA 4H04A 5KINA 2H8AA 1F07A 2C71A 4YVVA 3C7JA 2QGHA 2OLHA 1FUYA 1IYXA 1D3HA 4Y96A 1BYDA 1TKKA 2QULA 3UQNA 1PIIA 3N4FA 3HGOA 2I17A 3ABQA 1JAKA 2HFIA 4YNGA 3WUBA 3OVPA 1KRBC 5HWMA 2ZQ0A 1DEDA 1P0KA 4RUBA 1PJ9A 3EAUA 4B5VA 1PV3A 4AZ5A 3FGCA 3A64A 5FACA 3W07A 3EG9B 1SW7A 2ZUNA 1V6YA 2OR2A 1KTBA 3KH2A 4NKCA 4ANJA</