3B0UX

Trna-dihydrouridine synthase from thermus thermophilus in complex with trna fragment
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
312
structure length
312
Chain Sequence
LDPRLSVAPMVDRTDRHFRFLVRQVSLGVRLYTEMTVDQAVLRGNRERLLAFRPEEHPIALQLAGSDPKSLAEAARIGEAFGYDEINLNLGCPSEKAQEGGYGACLLLDLARVREILKAMGEAVRVPVTVKMRLGLEGKETYRGLAQSVEAMAEAGVKVFVVHARSALLALSTKANREIPPLRHDWVHRLKGDFPQLTFVTNGGIRSLEEALFHLKRVDGVMLGRAVYEDPFVLEEADRRVFGLPRRPSRLEVARRMRAYLEEEVLKGTPPWAVLRHMLNLFRGRPKGRLWRRLLSEGRSLQALDRALRLME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA (5'-R(*GP*GP*(H2U)P*A)-3')
publication title Molecular basis of dihydrouridine formation on tRNA
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase/rna
total genus 126
structure length 312
sequence length 312
chains with identical sequence Y
ec nomenclature ec 1.3.1.91: tRNA-dihydrouridine(20) synthase (NAD(P)(+)).
pdb deposition date 2011-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01207 Dus Dihydrouridine synthase (Dus)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1460 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3b0uX02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3b0uX01
3NL5A 3LTYA 1WQ5A 3FA5A 5TBOA 3BG9A 4IMFA 1JCMP 5GVJA 3SGZA 5CGQA 2FJKA 2VOMA 3LHZA 5F2GA 5D30A 3Q37A 3FOKA 3SW6A 1OFDA 2BZNA 4EWND 2O7SA 1ZY9A 4O4VA 5LKYA 3NGJA 1HFBA 3MP5A 5K4XA 3QPZA 4Z0JA 5K9XA 4UCGA 1KTBA 4Q33A 3N2XA 1IXOA 1Y0EA 4R53A 3M47A 4JYDA 5LNWA 2WKJA 3SIZA 5SWUA 4UNKA 3FFSA 3HOJA 5LNRA 1JCNA 4PCFA 4OGZA 2P10A 4ZMGA 3EWWA 1QFEA 1OFRA 1W3TA 1A5CA 1TCDA 3WJZA 4RXGA 3PM6A 3C61A 3KFTA 5BRBA 8TIMA 2HSAA 5KZDA 3L0KA 1KTCA 1BWKA 1Z44A 4O4WA 4P2VA 1VPXA 4LS0A 3TAKA 4PL1A 3NEVA 3A5FA 4TU1A 1KM2A 4FX7A 4S2CA 5KZEA 1SR9A 1WDWA 3NQ2A 4GE8A 1R2SA 1F7BA 3GDTA 2VEIA 3WK2A 2A7NA 3LOTA 3N14A 1YPFA 3W7IA 3W87A 3PUDA 4O52A 3TH6A 2A7PA 4LW7A 3UYCA 3LBCA 1PL9A 4JYFA 5H91A 5HQEA 5ABTA 1AW2A 3DBPA 2Y88A 1R47A 3PR2A 1VH7A 3N73A 1K3UA 4OV4A 4WOZA 4Y96A 1YADA 3MI6A 4AHOA 1X6UA 4ADSA 4TR9A 2DZPA 2EPHA 2OT0A 2FPVA 4M7SA 2WNZA 3VFLA 2J88A 3S8HA 2NXIA 3C8FA 1EX5A 1R30A 1SFLA 3DZ1A 3HPSA 3TSBA 2V0TA 2A5HA 1J4EA 3C6CA 2DZSA 3GDLA 2A2IA 3ATYA 5LZLA 2YW4A 1FWRA 3UNDA 4JY8A 2P1FA 2RDTA 1RR2A 4GUIA 3W2NA 2X2GA 4FNSA 2B7NA 1D3HA 3WJWA 4Z1BA 4ZQNA 1IXPA 3OVRA 2DZWA 3QEZA 1XXXA 1TTIA 2J9YA 3P8IA 2QAFA 3E12A 4YXGA 1MEHA 3R13A 1O5KA 1LZOA 4AVFA 4OV9A 2GUUA 1W54A 4DPQA 3IIXA 5DY3A 5I3HA 4XTDA 2Q3OA 3RNDA 3GDRA 1ZHAA 3DI1A 1NEYA 2ZZ4A 1SFJA 3LGEA 1GTHA 1P0NA 3BW4A 1TTPA 4O17A 1K8XA 3F03K 4JEQA 1OYCA 4FX6M 4WY0F 4YLWA 3HPZA 3JR2A 2CLFA 5HWNA 2ZZ7A 1OX6A 3W72A 4DO5A 3W1LA 5EMUA 4S2BA 4Q32A 1BKSA 1THFD 5LGZA 3HJZA 4NUWA 1AW1A 3LCXA 1KM6A 2CLHA 3W2LA 1LORA 4FO4A 4DEFA 1OFPA 2OX1A 1Z48A 3PWAA 3IVUA 2V81A 1VLWA 1G6CA 1PS9A 3RF9A 3NM3A 2VFIA 3R5EA 2YR1A 3IRDA 4Z0SA 1TJPA 2EAWA 3CWNA 1SZGA 3E49A 1M7OA 1QNVA 3BARA 1ICQA 3QSRA 5BW6A 1KA9F 3W71A 1QDSA 2VFHA 1X1ZA 2R14A 1T96A 4R34A 4WXZA 4WJEA 3BK0A 3W7KA 1FWNA 5D04C 4X2RA 4MPQA 3S5OA 4GWEA 4UTMA 3P7YA 3E96A 4G1KA 2DU2A 4Y8FA 4LS2A 4DF0A 4ZVJA 5AHMA 1W31A 1PHQA 1BWLA 3N3MA 5CKSA 5DCEA 1DQXA 4K7YA 1G7UA 5EL1A 3PF3A 1OF8A 1QO2A 3W1XA 3BVJA 5DXYA 1HO4A 3PVFA 3LCHA 5D09A 5FEWA 3MP3A 4EIVA 2VXNA 3BW2A 3L5LA 1JJKA 3GXNA 4HNNA 2JGQA 3TJXA 3W7NA 3QF0A 4O0ZA 4N02A 3S1XA 4JNMA 4I7UA 5LNUA 3W7OA 1XBZA 2Y63A 2NXHA 2X16A 1DJNA 1NFBA 1VYSX 4IUOA 1VCFA 1NVMA 2F84A 2C0AA 4DO6A 3HQ1A 3IEBA 4K36A 5K9CA 1H1YA 4Q4KA 1XBVA 2E5CA 4BI5A 1TO3A 2Q8ZA 2G5WA 4IPJA 5E0KA 4QITA 3S9YA 1RQHA 3LHTA 4RZ5A 3W2KA 4JTIA 4UTHA 3FKKA 4IX2A 2O7QA 1YDVA 2GJLA 2TYSA 1L6WA 3G1AA 3BW3A 3SY5A 4UTIA 2I14A 5AYYA 2PCQA 4A2RA 4WUIA 3N19B 3GDKA 5G2WA 1X8FA 3HG2A 5A5WA 5K7JA 1TQJA 4MYXA 4WQ6A 1ICSA 3NQ8A 5AC8A 3NQMA 2NXGA 3JRKA 4HNUA 1N7KA 1LP6A 4WX2A 3BLIA 2NX9A 5BNKA 4LC6A 5EPDA 1GG1A 4JTFA 4EF9A 1GVFA 3TXZA 3T55A 3P67A 4FB7A 4YCOA 3A23A 2V5LA 3EKZA 4N9CA 4NXSA 3W9ZA 7TIMA 1H62A 1ZAHA 4UFIA 4FXSA 2HS6A 2JGYA 1OFAA 3W7LA 4WXYA 1E51A 3B03A 2WO5A 5K2ZA 2NLIA 1TRIA 5E1QA 1OX4B 1HO1A 4IGHA 4PODA 4D2JA 1KW1A 4MZ1A 3KVLA 4RZ4A 4BR1A 4WY0B 4QNEA 1F6KA 4UMCA 1LDCA 3ABQA 4UTJA 4UTUA 5TIMA 5D32A 1SO5A 3F4WA 1EWEA 1ALDA 1EEPA 3G1VA 3IIOA 3M41A 2PURA 4JXCA 5D03A 2QCCA 4JTUA 5CZJA 4ORMA 1MZHA 3BO9A 4Y90A 4FXRA 3RFAA 2W79A 4IJBA 3GNNA 3CU2A 2H8ZA 3M5VA 2E77A 3NG3A 3S1WA 2TPSA 1GZGA 3DENA 2TMDA 4QQ3A 4DBEA 3NQAA 5G4EA 3G1HA 2Y70A 3M7WA 4UFLA 2FIQA 2NWRA 4ZZ9A 1OYAA 5K4ZA 1ZENA 1VCVA 1EUAA 1YDNA 4FHAA 1AMKA 3W70A 4BK9A 1D9EA 1J2WA 1XDLA 4HSNA 3NQFA 1RQEA 1FY6A 1H1ZA 4Z1CA 4NXKA 1FXPA 5AOUA 5D05A 3WK3A 4LVDA 3WFAA 4NJKA 1F74A 3MMTA 3IIZA 1GVRA 4JIPA 3RMJA 4DPPA 4UFKA 5KZMA 3LV6A 4MLRA 1JQVA 1UUMA 4GJ1A 4RV8A 3D0CA 4FNQA 1HG3A 4JGDA 2RDUA 3HBLA 2CLMA 4C1LA 5C2XA 3ABSA 2WNQA 1TQXA 2E5DA 4NT0A 2BX7A 1OK6A 2C16A 3HIJA 3EX1A 2CLEA 3OG3A 1JCLA 4BFAA 4NJGA 3GDMA 1TTJA 1W5PA 2XN2A 4CCEA 1VS1A 4HHPA 4HT3A 1WA3A 3THQA 4O8RA 3RLUA 1VR6A 3MP4A 3NZ1A 5HWJA 4I7WA 3QW3A 4JTTA 2X1SA 5G4WA 3Q94A 3V75A 1JULA 2BTMA 5AN7A 4MKNA 5DBUA 1EP2A 1SZNA 5F4WA 1OABA 3A22A 3E02A 1JCXA 1SZEA 1SW3A 4PH6A 3GAYA 3M16A 4IMEA 3NXFA 1YPIA 3L2IA 1B4KA 3DI0A 2YXGA 1WYIA 3W84A 4LC8A 1TPEA 4DELA 4FF7A 3TU9A 5IBXC 1ME9A 3KOFA 3TNOA 4YCPA 3I6RA 1X1OA 4RR4A 4AWSA 5H2ZA 2C18A 2A4AA 2ZFAA 4AMAA 3B06A 3T44A 3W1QA 1KTNA 2VKZG 3UXDA 2ZA3A 1DV7A 3S6DA 3NQCA 1W0MA 4AF0A 3AO0A 1UASA 4GUJA 5G1YA 3DXIA 4O15A 1A50A 1GG0A 2HTMA 1C8VA 3FS2A 1ML1A 1SO3A 1QAPA 2DORA 5LGXA 4OU1A 2CU0A 5CSSA 4CNNA 4XUGA 2ZZ5A 3G1DA 5I3IA 3LCGA 4KKXA 2ATMA 3CC1A 3WJXA 4RK8A 2J24A 3DU0A 3M0ZA 1VJIA 3LERA 3L68A 2PE4A 5CPLA 4BF9A 5G2IA 1FXQA 3NO5A 4BWLA 3LCWA 2FPTA 4KWVA 3RK8A 3SR7A 4EOUA 3LV5A 3C52A 1YXDA 3PY2A 4YWIA 2CLKA 1KLYA 1DQWA 4QNWA 2Y89A 3S5ZA 3U2OA 1GOXA 1YXCA 1GYNA 2E6AA 1OFQA 3NA8A 4NU7A 3TMLA 2ZRXA 3I7RA 4TIMA 1NF0A 1SUXA 3BPWA 4ZQMA 4LWWA 3TAOA 4A2SA 2FQIA 2ZZ2A 4GNJA 2F7FA 2JK2A 4O53A 5A8GA 2VEPA 3L0NA 4IOTA 4L4MA 4Y9AA 3QPYA 1Q6RA 3W3OA 3TR2A 1GVOA 1VHCA 3U8GA 1VCGA 4WZHA 3L5MA 4FNRA 1YYAA 4XWUA 4CQ8A 1G69A 3NM1A 1TSIA 4N6EA 2H90A 5KMYA 1IGSA 4LVGA 2ZYFA 3QQ1A 1R2TA 5HMSA 4B5NA 3CPRA 2QUTA 3QC3A 5CSRA 1PHWA 3DFOA 4CQ9A 2ZDRA 4KFNA 1L6SA 2X1UA 1LBMA 4O28A 3KRSA 2ABBA 1EWDA 4MY8A 2VEKA 3W7EA 3O6DA 3BGGA 1YTEA 2B7OA 3C2OA 4LVBA 3L65A 1IIHA 2VELA 2QCMA 1LYXA 1JRBA 1OK4A 3NQEA 3TXVA 1CW2A 2YYTA 3DHDA 2Y7FA 2KZHA 3R2GA 5L6UA 5FESA 2Y7GA 4NNCA 3YPIA 5K3VA 3SZ8A 3C2VA 2Y7EA 3ANYA 2V8ZA 4KWWA 3WJSA 3M5XA 1AG1O 2ISWA 3BV4A 3S5YA 1O94A 1FCVA 3HG3A 2A21A 4GXMA 4JDYA 4OE7A 2Z6IA 2YGYA 4TX9A 6ALDA 2QJHA 2NV1A 3QM3A 3LRLA 2OJPA 5AYXA 3W23A 3P8JA 2DZXA 1G4TA 3A21A 1H61A 4OBTA 1GT8A 3PSVA 1OX5A 1ZAIA 2QCLA 4P61A 2DJXA 5DN1A 1QPOA 3CT7A 1JCJA 2R8WA 1H7XA 4N9BA 2NX3A 5AB3A 1XC4A 2ZZ6A 4PA8A 3MYPA 2H3BA 1B3OA 3BGJA 2GQ9A 3VE7A 3SSJA 1EUNA 2RDWA 3LCFA 4J9JA 5AHLA 5KTLA 3PSWA 5LNVA 1IXNA 4MZYA 3QMTA 2WSQA 1M5WA 3KHJA 3P74A 5DCBA 1OF6A 1GWJA 3MHGA 4UTLA 3LHUA 3HGOA 5FF0A 1I2PA 3CM4A 1L9WA 3N2MA 4ADUA 1YXYA 4XBSA 1LLZA 1WBHA 4KFOA 1RZMA 3G24A 1QO5A 3C0JA 1IIGA 3GYEA 3EWYA 4O1AA 4LT9A 5J5RA 1K8YA 3SFKA 4HPXA 4UTWA 1VC4A 4JX4A 4HNTA 3M43A 1MXSA 3W1PA 3DFSA 1F6PA 2BWGA 5FEXA 5MHBA 1KFEA 3CTLA 3PAJA 4UTKA 1FWSA 1W56A 1TYGA 5EA9A 3P80A 1I2OA 1KM5A 2E1DA 4X3ZA 1DKWA 4MVAA 1R2RA 1MEIA 3W1NA 3CHVA 2DJLA 3JS3A 3MJYA 3THAA 1TPB1 1IF2A 3E0IA 4XKYB 4JICA 3R12A 2A0NA 4I7VA 2YFNA 3LXCA 4AAJA 3I7QA 3UWYA 2H6RA 2Z1BA 5IM51 2E6YA 3W1RA 1PCWA 1XDMA 3ZFHA 5DCDA 1S5WA 4E2BA 3NR0A 5CZSA 4S1FA 4IXHA 1HL2A 3W1TA 4LUIA 5CPOA 4CNPA 3EXRA 1ME7A 2VENA 1MSSA 2WPBA 3ATZA 4O10A 4UNLA 3UWWA 3IGXA 4ICNA 2A1YA 4FEZA 3CLMA 1KM0A 4LTSA 4UIOA 3R89A 2V82A 4MLJA 3DH7A 2XN0A 4UR8A 3FJ6A 2NUXA 3NAVA 3O63A 1K8ZA 1BTMA 3E9AA 4LU0A 2BSLA 3W73A 1TPC1 1EPXA 1WOAA 2G97A 3B0PA 1ONRA 4JN6A 4MIMA 4PL2A 5HR7A 4DO4A 1LRTA 4YMZA 1EP1A 3Q2DA 4E2DA 2RFGA 3PB0A 1LTDA 5HR6A 4K7VA 5CZ0A 5D2YA 4ML9A 4BI6A 3USBA 4LUJA 1ZNNA 3K30A 4UFHA 4JDBA 4XKYA 5BMWA 2C15A 5F2MA 4HSOA 1W3NA 2R91A 4JD4A 5TQLA 1OHLA 3S0CA 1TV5A 3S42A 3P82A 5FF4A 3NQGA 4FX8A 2FLIA 3NDOA 2CLOA 2EKCA 5T26A 2CZFA 3G0XA 1LM1A 3NPUA 1UUOA 1YDOA 2YPIA 4L4LA 1XUZA 2NUYA 3CIXA 3NZRA 5FF3A 4X9SA 3GIYA 3H54A 3MBDA 4R7JA 2RH9A 4N4PA 3G8RA 3I68A 1LCOA 3OHIA 2OZ0A 3PG8A 3LHYA 2V2DA 3GNDA 3SJ3A 4R33A 5I3JA 1FDJA 5HULA 5CPNA 1OFOA 1QOQA 3Q58A 1XI3A 1H7NA 3KX6A 4N4QA 3W2JA 2FB3A 3NYZA 2EHHA 1VYPX 5C5YA 3LLFA 1RPXA 1T99A 4ZQRA 1LRNA 3LCIA 4N9EA 3HG5A 1UCWA 4IMDA 1LROA 4UTTC 4UMAA 2WV8A 4Z1DA 3W2UA 3VE9A 4YL2A 3EX4A 3O07A 4U4MA 2QUUA 3TK7A 3UWQA 3DKLA 3ZS4A 5LHEA 3QSTA 3NL2A 1GVQA 4Y6GA 4BI7A 5AHNA 5G2HA 2QJGA 4GUGA 1LLWA 3TSMA 4JTJA 3W6YA 2QCGA 2C1HA 3IIVA 2HS8A 1GTEA 1SW0A 3PS7A 2V30A 1V5XA 3W7DA 3VKJA 5LHFA 2BXVA 4RCXA 4LRTA 1RV8A 4PTNA 3T4CA 5D2VA 4RLIA 3GLCA 3IV3A 2GQ8A 3W1AA 2OT1A 2E5BA 5HUOA 3LCLA 3FIGA 3FEMA 4NNAA 3QZEA 3G22A 3LHVA 4JIQA 4JTKA 3W7QA 3ABRA 4IMCA 1O4UA 1EA0A 2J6XA 3QRHA 1O5XA 1I45A 3P61A 3DFTA 5KITA 5I3FA 1F5ZA 4QAIA 3NOEA 5HWMA 3GKAA 4JY9A 1N55A 2WJZA 4LY8A 3EX3A 4A3UA 1KFLA 4AXKA 3TC6A 4MY1A 4O1BA 3TFCA 3UQNA 3O1NA 1UJPA 1K7FA 4O1CA 1TPVA 3L5AA 2VFEA 4CLMA 3IIPA 2A6LA 4OHQA 3GKFA 1I2QA 1WBJA 5EY5A 3GZ3A 3TX9A 1AK5A 4AF0B 3NVTA 1JQXA 5F4SA 2NWSA 4LS1A 1B9BA 3W2MA 2ZQ0A 1L6YA 5AC7A 5U4NA 4NZFA 1AL7A 3HF3A 1SPQA 3NL3A 4HIBA 1S5VA 4H4IA 3W7JA 3LB0A 1C9DA 3VCRA 4GUHA 1FCUA 4ZQPA 1DHPA 1PE1A 2GQAA 3ZR4A 2VFFA 4JR5A 3V1PA 3G1YA 4JTSA 1M7PA 3G1XA 3TW7A 3LHWA 2ATSA 1Q6LA 3SECA 4ZQOA 4AH7A 1W5QA 2PRHA 4RXFA 3W74A 1Q3NA 2PC4A 1GJPA 2E09A 1ZAJA 2ZZ1A 4E38A 4RZ6A 3CEUA 1JVNA 4UUIA 4GFSA 5D02A 5D2XA 1YLVA 1HTIA 3DHFA 4XQ6A 3WJYA 1P0KA 4A21A 3MUXA 4UR7A 3GAKA 3CB8A 1H60A 3LTPA 4PEKA 3VI2A 2Y7DA 3OBKA 3PUOA 1AW5A 3LI1A 3MWAA 1VHNA 1Q45A 5BMXA 4CNOA 5I3GA 2QDHA 2NZLA 2IQTA 3P84A 3STGA 1WV2A 3KVKA 1O60A 1QMLA 4AHQA 4AHPA 4AWTA 2FTPA 3W7CA 2G96A 3BG3A 3EXSA 3ELFA 1FCBA 1LOLA 3EX2A 1X7FA 3QQ0A 1U83A 2QR6A 1I2RA 5F2LA 1SO4A 1KFKA 1FQ0A 1DVJA 1H7RA 3LRKA 4M6VA 4O14A 5D38A 3W75A 5HNRA 3EWUA 1QPRA 4A29A 4CCDA 2ZRYA 3UWVA 5FI8A 3F4NA 2ZTKA 3CWOX 1B4EA 3TE9A 1OJXA 4HPJA 4MFDA 3DKJA 3PC0A 3KVMA 1OYBA 4OWGA 1W5OA 2Z0IA 3WK1A 4NX0A 3G8EA 1XBYA 2YZRA 1H7OA 3QMRA 3HO8A 4JTLA 3LRMA 3NNTA 3PUEA 3HGSA 2X1TA 3RU6A 3W22A 3C56A 3TC7A 2CLLA 3QJAA 4UTTA 2Z6JA 3LLDA 2QCNA 2HMCA 2V2HA 3PULA 5C6MA 1J5TA 1F76A 4MFEA 4H6KA 1EB3A 3LTSA 5J5DA 1VLIA 3UD6A 4N2YA 3HPXA 5U7SA 3A24A 1XKYA 2V9DA 4MJMA 4NJIA 2A7RA 3TQKA 4PC8A 3I7SA 3OIXA 1VZWA 2J9XA 3CIWA 3B8DA 1PVNA 2A85A 4LRSA 3QMSA 2V2CA 3HGJA 5F1UA 4XTIA 4H3DA 4N9DA 5AYZA 1ME8A 4W9TA 4DQWA 1D3GA 3B04A 1RD5A 3PBVA 4U28A 4FIQA 3OEXA 4JTGA 3TKFA 5HJLA 1I8JA 1S5TA 2FB2A 2LLEA 3OVQA 5F2IA 1S3HA 2QDGA 1XBXA 1EIXA 4K8HA 5HINA 1I4NA 4MY9A 3W7HA 3W7PA 1VYRA 4DF1A 4KFPA 2Q3RA 1MEWA 3O6CA 2QCFA 3FYPA 5FEPA 3O8AA 3TFXA 3L9CA 4LV9A 3FKRA 3M9YA 3KRUA 1ZALA 2WSYA 2W6RA 3O16A 3MBFA 1SZFA 3LXBA 2QCEA 1BEUA 4NVTA 5DLCA 3GK0A 4PFMA 1GPWA 4CCCA 4TMCA 3SI9A 3N34A 4HKPA 5C54A 1JUEA 2YX0A 4IPIA 4O0KA 1GVSA 1W8SA 3G1SA 3IGSA 1W5MA 3RLVA 2C14A 3W76A 2YCEA 1F05A 1KLZA 3AJXA 3W1MA 2I1OA 2A6NA 3UPBA 3R8RA 5BOOA 2AAMA 2JKAA 3QH2A 4WOQA 3B05A 3LXAA 2AQWA 3EXTA 4AWUA 4O16A 1L2UA 5AHIA 3IVSA 2CZDA 2H8XA 2ZCGA 3GR7A 1JUBA 3L66A 1KBJA 1TREA 3UY7A 1SO6A 4IWWA 1LOSA 1LOQA 3MI3A 1W37A 3PBWA 3HGRA 1TMHA 2RHGA 5IBXA 1U5JA 4LVAA 3KXQA 4JTHA 2ZRUA 5EKYA 3CQ0A 4MYAA 3PBYA 4ONVA 3TW6A 4LVFA 1KV8A 3NQVA 4JS3A 3LDVA 3B0VC 4XZ9A 4DBDA 1NAL1 3W86A 3MI2A 1FUYA 4E0CA 2ZA1A 3W7GA 1KM3A 4GC4A 5CZTA 2VFGA 1Q6QA 3UY8A 2PRMA 4K37A 4N6FA 4O11A 3EB2A 3UXAA 2OMAA 4JTEA 1JUKA 2CLIA 1R46A 2V5BA 4MOZA 3EEGA 1P5BA 1OG0A 3PB2A 1KBIA 1QPNA 3MYOA 1TPFA 4QM1A 2R94A 3GR8A 1H5YA 2WQPA 1SQ7A 5HUPA 1PV8A 4O57A 3ZWTA 1TIMA 1LBLA 4FNUA 5CG7A 3TQ0A 4K38A 3ABOA 1MO0A 3GXPA 3H53A 5KINA 3HB9A 1UBSA 3I65A 1QPQA 2Y85A 1RQBA 5D2TA 3G1FA 4ALDA 2G95A 5FEZA 3O06A 2GVGA 2ABAA 2C19A 4QJ1A 4UFMA 2D73A 4OQVA 1B57A 2C3ZA 1T8XA 3G0SA 2GVLA 3W7MA 3TSDA 5F1VA 5DY2A 4DF2A 1FWTA 4Z1AA 4AB4A 4JX6A 3G3DA 3W1UA 4FIRA 3TUUA 2E68A 3BG5A 4ADTA 4DXVA 4IX0A 4WD0A 3DFNA 4LV4A 3G18A 1EP3A 2YDAA 4TMBA 1ICPA 3O6YX 5AC6A 3PG9A 5DXXA 1DJQA 2Q8LA 1DL3A 2YFOA 3DGRA 3S1UA 1W5NA 1XUUA 2NUWA 2FDSA 3IGUA 1M6JA 2W0UA 2FPYA 5G5IA 1SU5A 3N9SA 3UWZA 5FF2A 1KFBA 3MHFA 4HN4A 4M7TA 3L21A 1TV8A 5AFDA 5LSMA 3OVPA 4QIUA 2YYUA 2Y6ZA 1H7WA 3T78A 1P1XA 2QCHA 5LNSA 3KRZA 1CI1A 4K8EA 1YTDA 3NPWA 2DP3A 4IMGA 1G4EA 1FWWA 4JYEA 3TMQA 3S1VA 3BLEA 1Z41A 1W3IA 4QSHA 3S5NA 1KM1A 4GUFA 2ZZ3A 2YW3A 3NQ6A 2QEZA 5F4XA 4FNTA 1PCKA 3TJLA 3EWZA 1ADOA 4O19A 3BLFA 3STCA 4LOCA 3C2FA 3EKLA 1H50A 1T0OA 3M6YA 4A22A 2NV2A 4JX5A 4K39A 1K7XA 1JCYA 2CW6A 4GRSA 5FF7A 3EX6A 4FNPA 5DBTA 1KFJA 2ZRZA 2PRLA 4BWLC 3DFQA 1CX9A 3N9RA 3M1ZA 1F73A 4CQAA 3T40A 2YSWA 5K9DA 1Q6OA 2X30A 1ZJIA 2ISSA 4UC5A 3DAQA 3G0UA 4AEOA 4NNBA 3TA6A 4EVZA 4ZQCA 2ALDA 3LI0A 1GEQA 1RVGA 1NSJA 3QW4B 1DOSA 2TSYA 4IXXA 4OT7A 3TQVA 2DZTA 2E6DA 5D37A 2CZ5A 3IVTA 4POCA 4NJJA 4O18A 1W1ZA 5C55A 3T7VA 2ZTJA 4LNYA 1SSGA 1QWGA 5E93A 2WSRA 2QCDB 3LM7A 1IXQA 4O50A 4M6PA 3B0UX 3M5YA 4TO8A 2ISVA 3SGUA 5KSWA 3P5ZA 3TDFA 3HMJG 2JKEA 2DZVA 2CWNA 4QISA 2BLEA 2ZRWA 2RKXA 4M5PA 1N8FA 1WOBA 2OCZA 1WXJA 4RX0A 1TB3A 1XL9A 1ZCOA 1NF7A 1GQNA 5L9FA 3M5ZA 1K7EA 1VRDA 3NPXA 1O95A 2P0OA 4NX5A 1P4CA 2Z2UA 1A5AA 2H3DA 2XFWA 3NPVA 4MZ8A 2JKPA 3HG4A 2B7PA 2VEMA 1QR7A 1H7PA 2DZUA 1GYLA 4NZJA 2GVJA 3W7RA 3O15A 2TRSA 2B4GA 2I9EA 3VNDA 5DELA 1K02A 2JBMA 3B4UA 2J9ZA 2X1RA 4MJZA 3QFEA 1TTQA 3GXTA 1JRCA 4ZL1A 1K03A 1OX4A 1YTKA 3P62A 5AHEA 3A5VA 2GOUA 1TPWA 1TV7A 4C1KA 1XFBA 4WY0A 3MHUA 3C2RA 3C4UA 2QCDA 1TJRA 1A5SA 1TPUA 4O54A 1VQTA 4ORIA 1TPH1 4NQ1A 3NQDA 1G67A 1ZFJA 2QUVA 3LX9A 3TROA 1SW7A 3FLUA 4UMBA 4K6AA 2C6QA 3O05A 1HUVA 2ZA2A 3PBUA 3L67A 3G3MA 3INPA 3P5YA 2Y61A 2UV8G 3GVGA 5D2WA 2GPTA 2WOQA 1A53A 1KV5A 4RKAA 1XCFA 1QOPA 1OFEA 2QF7A 4Z08A 3L0GA 3W83A 1FBAA 1WX0A 1WAUA 4UFJA 3W07A 4RJEA 3TV8A 1TRDA 4IQLA 6TIMA 1A5BA 3ZWSA 1V7YA 4NJHA 2GJNA 4X22A 2ZBTA 3P60A 3KAOA 2B0MA 1LBFA 2VC6A 1PIIA 4M19A 1FDYA 1G4PA 3U6WA 1OVDA 3NQ7A 2AGKA 3STFA 2CZEA 4UTWC 1FDZA 3H55A 3MO7A 3MW7A 4M6QA 2FFCA 2QKFA 3UZJA 4EF8A 3QYQA 1C29A 4I9AA 3GX9A 3W85A 5D33A 4O13A 3F1QA 1VGAA 4O12A 1H51A 3C2EA 1H63A 3UZ5A 4XBKA 1F2JA 2CFFA 2C13A 2Y62A 2ZRVA 3C3NA 5G1TA 1G7VA 5AHFA 1Z42A 4O1DA 2VFDA 3GB6A 3A9IA 4MUZA 3STEA 3LBMA 2EF9A 1JR1A 2WNNA 1DORA 2NX1A 1FCQA 1I2NA 3EWXA 5CPMA 1UB3A 3UWUA 2B7QA 1FX6A 1QCWA 1XM3A 3EWBX 1LRQA 4HNVA 2J27A 1TPDA 2XN1A 3TIMA 1SSDA 1DBTA 3WK0A 2QJIA 3FJLA 2EGZA 1KM4A 3DFPA 3KVJA 3W88A 5EBUA 3UPWA 1OFBA 4UXDA 3OA3A 3M44A 2E6FA 4GBUA 1G4SA 3FYOA 3P81A 5EYWA 3CEPA 5I3KA 1AL8A 1KFCA 3TCEA 3NL6A 2QAPA
chains in the Genus database with same CATH superfamily
4KEMA 1P0BA 1WZLA 5L3VA 1KR1A 5GVJA 4G7ZF 3OZYA 2NPUA 5CGQA 1YARO 2QF8A 3LHZA 1TMQA 1GQJA 5F2GA 1DWAM 4XAFA 4MF4A 4I9MA 4D71A 3S5SA 1HQTA 3WUFA 3MP5A 5K4XA 1ESWA 4PB3A 3QXBA 3S0XA 3P93A 4Q33A 2PX0A 3EMCA 5E6ZA 3GG1A 1U1JA 2ZX6A 5F7UA 1TWWA 4JYDA 1G1YA 3DMDA 3SIZA 3ZIBA 1FHVA 1JCNA 4X61A 4U2YA 2P10A 4ZMGA 4DXXA 1OFRA 1G0CA 4J4KA 3BLPX 4AMCA 1A5CA 5TF0A 5L0FA 4RXGA 4AE4A 8TIMA 4B2DA 1MW2A 1TUFA 2HSAA 1H49A 3ARPA 1Z44A 4O4WA 3KL5A 1E43A 4P2VA 4PL1A 1XCXA 2FVLA 4TU1A 3RVYA 5DANA 4QDMA 3JRMO 4Q5SF 4B9ZA 2NUTB 1F7BA 2VEIA 3SJNA 3WK2A 4E4UA 3GH5A 3PUDA 3LEOA 1FTSA 3UZXA 2HNHA 3LBCA 3LMYA 1EEXA 2G3FA 3UJRA 1ZBWA 1JDAA 4TVDA 3PR2A 2BBFA 4RDAA 3EGDB 2L6GA 4AHOA 3TVAA 5XIAA 1UQYA 4AZCB 3TZFA 1EQCA 1KXQA 4I3MA 3LZ3A 4EXAA 1EX5A 5A6LA 3S4TA 3HPSA 4Q7BA 3M0JA 1J0YA 4ZO6A 2HDJA 3HZ3A 1Z8AA 4CS9C 5LZLA 3UNDA 3BOXA 2GOKA 3PTQA 2P1FA 1ITQA 2FMNA 4FNSA 4GLEA 3RITA 3WJWA 5AC5A 3OVRA 1WZKA 1V55C 3WLHA 5CLWA 2WLYA 3W37A 1Q0DA 5C8BB 4YXGA 2ICWG 3W4RA 3KBVA 2XFFA 2ZXAA 1O5KA 4AZGA 4AVFA 3FJ4A 2KJGA 2O0TA 1W54A 3OPSA 3WD4A 3SCRA 2HNEA 5DY3A 1FWAC 4IRUA 2PDLA 2Q3OA 2Z1XA 3RNDA 4PBFA 4MVMA 1NEYA 4ZO7A 2ZZ4A 1GTHA 4EE9A 4I9JA 2E67A 2IXNA 3KS6A 3LENA 2KGOA 4HFFB 1K8XA 3WMCA 3BLKA 4DRIB 1OYCA 4FX6M 4JEQA 4WY0F 1H4PA 3IJDA 5HWNA 1RH9A 1OX6A 2Y5EA 3WELA 3SB0A 4NAFB 3W1LA 1GHSA 1B54A 1YIXA 4ULWA 4Q32A 2VCCA 5M3WA 4NUWA 1KM6A 2QYGA 1YE4A 2PTDA 4DEFA 2OX1A 3S2CA 1LI5A 3PWAA 3IVUA 1VLWA 1G6CA 1PS9A 4R88A 3R5EA 4Z0SA 3VIOA 3U7VA 3CWNA 5EMLA 3BARA 2DH2A 1EA9C 1QUMA 2UY2A 4PSRA 1E1CB 3DCPA 2VFHA 3L2LA 3WQ4A 2PLKA 3CUZA 3IK4A 1FWNA 1FH8A 4H7CA 4GWEA 2XM0A 4L9XA 1HJSA 2FGLA 1WNOA 2DI3A 3QFWA 4MNLA 4MVOA 5CG0A 3IQTA 4HYWA 2WCSA 1W31A 2OPJA 5CKSA 1G7UA 3COTA 1T6MA 1HW1A 1QK2A 3W1XA 3FXHA 3BVJA 2C71A 2V3GA 2A79A 2WMIB 1HO4A 3O9NA 3HV9A 2Y0FA 1OWQA 3PVFA 3RXZA 5B7YA 5D09A 1V3MA 1WN0A 1S39A 2VXNA 3L5LA 5HMDA 4N02A 2VX6A 4JNMA 4KH2A 2PX3A 4QLKA 1E3XA 2I9UA 1XBZA 4CNTA 1DJNA 2GYIA 4MTVA 2XLEA 1ZHTA 1OC5A 1TFVA 4GQHA 4QAWA 5DX7A 4Q4KA 4BI5A 1NOFA 1U1UA 2Q8ZA 2G5WA 3ANUA 1RQHA 3U4AA 3UESA 2ACSA 1H9TA 4Y7EA 4UTHA 3N1AA 2OO6A 3A47A 4PFOA 5D4YA 2PDJA 1K6AA 3VKBA 1KQZA 3VK5A 3FAJA 1AD1A 2I14A 3ITVA 1PIGA 1RLCL 3V5FA 4YNGA 1BR4A 5G2WA 3O0KA 4MYXA 2UUHA 3WZ0E 1VENA 5AC8A 3JRKA 4U5CE 2EG8A 1SFTA 5LIXX 3EQLF 2JE8A 4YT2A 2ADAA 5BNKA 3USZA 3WMLA 3DJUB 5JSLA 4S3EA 1XYCA 4OBSA 4PR4A 3TXZA 3T55A 4IJJA 1E86A 2OLAA 4NXSA 3SRDA 3W9ZA 4PGLA 1EC8A 1SJBA 4FXSA 4Q8OA 2JGYA 1F3TA 3BCJA 1TZ9A 4WXYA 4IGNA 3UWEA 1ISVA 3WDQA 4DZAA 3B03A 4IGHA 4D2JA 4LUSB 1XQLA 4MZ1A 4NG3A 3IJ9A 1GQAA 4J5NA 1UZ1A 4BR1A 4KWOA 3M0LA 1HGWA 3FSTA 3MCNA 4UTJA 5TIMA 1P7TB 1WGWA 1SO5A 3F4WA 3M41A 1EEPA 4FF5A 1XYBA 2QGHA 4Y90A 4ATDA 1FFQA 5GNXA 1E40A 2P6VA 3W00A 1IZCA 4BPMA 1MQRA 1M56C 1SMDA 2E77A 4EX4A 2TPSA 1GZGA 2P61A 1T6QA 1XIIA 4DBEA 2J13A 2QDEA 1NFNA 3NQAA 4PMVA 3H8AA 1BXBA 3IJ6A 2M64A 1FWBC 2VURA 3KDOA 2HROA 1AJ2A 1AMKA 3DN5A 4KT2A 2V5KA 1CLKA 2OU4A 3FX4A 1XDLA 2C91A 3NQFA 3TN4A 2HJPA 3QN3A 2DEPA 1O68A 2YDRA 3WK3A 2XGIA 2VC7A 3MMTA 3UW6A 4AL0A 1JQVA 3WF2A 1UUMA 2XWEA 2Z24A 1G8XA 4HEAJ 4CBEA 4BKNA 4DLFA 1J79A 2CDQA 3IV8A 4C1LA 3T4RA 1TQXA 4L80A 5CPQA 3HIJA 4X60A 3SQLA 2CLEA 2ZUNA 4RNHA 4NJGA 1EJTC 4UNIA 2YL9A 4PJMA 1RJRA 1R5YA 4GX8A 1RALA 1Q6GA 2FJUB 5GJPA 5A6AA 2E9LA 3FMSA 4JTTA 5G4WA 3VYLA 3U57A 5M17A 1JULA 5AN7A 4U9DA 3SSZA 2XVNA 4MKNA 4HNCA 1NZEA 1W1YA 3OLDA 1EP2A 4NRSA 1DTNA 3DECA 3TYCA 4AZBA 2J6VA 2XDFA 4Q22A 3A22A 3E02A 1JCXA 4US5D 5HNNA 4LLEA 3GAYA 3QR1A 3CQJA 4DZ5A 3NURA 4LXFA 3VD9A 3K6BA 3DI0A 4WIWA 3JW7A 3I6TA 4LC8A 4DELA 2OZ3A 4ZLDA 5IBXC 3KOFA 3S83A 4RR4A 4C7DA 2WCAA 4AWSA 5H2ZA 2WMHA 3O6XA 3ZSSA 4AMAA 2C1IA 4KEUA 4RD9A 4NY2A 3VIGA 3SIMA 3B06A 1CECA 1P0EA 3ITLA 4NZ3A 3WNMA 1R3RA 3GEEA 2GGIA 1EDGA 2VKZG 3UXDA 4C7OA 3S6DA 4M6UA 1QK0A 4RV3A 4MB5A 4O15A 1A50A 3GU9A 4XPWA 3GH7A 4MNJA 3AOFA 2BHUA 1QAPA 1PUDA 5LGXA 2W91A 1W9UA 1ZYRF 1QNQA 4GGBA 4BF9A 4HA4A 3ZT5A 3LCWA 4L6HA 3RK8A 3O6AA 1OD0A 1RPKA 3PY2A 4YWIA 4UBPC 1KLYA 3PZVA 2XL8A 4QR6A 3FVMA 4W8AA 4QNWA 3S5ZA 3VVGA 2VH3A 1TIWA 2E0PA 1GQIA 3BCDA 2E4TA 3NA8A 3TMLA 1K40A 1NF0A 2JIWA 1MDLA 3V35A 2CERA 3MCMA 1SUXA 2FQIA 5DS5A 2XPKA 2ZZ2A 4GNJA 2GLKA 2JK2A 5A8GA 1JYVA 2WB5A 3TN6A 1CPUA 3H26A 4IOTA 3B0XA 1EL3A 1GQKA 2WVQA 4QEHA 4FNRA 3OW1A 1DIDA 4XWUA 1G69A 5D8ZA 3TEVA 2QUPA 2XM4A 4N6EA 5KMYA 3OBEA 3MJMA 1P6WA 3TN5A 4LVGA 3H24A 1C17M 5EBAA 5HMSA 4YWSA 3PJTA 2PBOA 1PZ1A 2VEKA 4AD3A 2PDKA 3L65A 2ZOXA 4H19A 4B5SA 3TXVA 1EJUC 2YYTA 3DHDA 3LNMB 1ODZA 4W5UA 1B0IA 1JD9A 1J8VA 4RDWA 3TC3A 6TAAA 4NNCA 4HMEA 3SZ8A 3EOUA 2V8ZA 5HNUA 2WK2A 5I5RA 2GWWA 4AFYA 3MYFA 3HG3A 2A21A 1U2YA 1E3ZA 3N0TA 3PDMP 1LWIA 3SRHA 2NV1A 4X0RA 1XSIA 3LRLA 4AW7A 3S1GA 4DN1A 2Y3DA 2DZXA 1G4TA 1H61A 4H9YA 1MUMA 2OB3A 2QPUA 3UJSA 1OX5A 4EPEC 1RAKA 4M8UA 3N12A 2QCLA 1C7SA 1OSEA 2IKGA 3MC5A 2INEA 1K4GA 3WDPP 5I3DA 3M4BA 1JCJA 2R8WA 3QR3A 4E6MA 1J93A 1LE2A 2D69A 4YHGA 6REQA 2VX4A 2RSEB 2VR2A 2FFHA 1UROA 4XZLX 3VE7A 4DVOA 3SSJA 3WFZA 1XLEA 1EUNA 3PSWA 1I5NA 5LNVA 4JCMA 1HJXA 1EXPA 4MZYA 3S46A 4W86A 4IF2A 3P74A 3AROA 5CLTA 2NV9A 1JXJA 1UWQA 2BODX 3ZMRA 5BXTA 4OIPF 3VDBA 2H9AB 3KWXA 3LHUA 5FF0A 2C79A 3SO7A 1XIDA 4ADUA 4QJ4B 1B31A 2XZ7A 1YXYA 3BZGA 3OTRA 1HN1A 1LLZA 4WABA 1EFZA 1QOXA 3EPVA 4LAUA 3G24A 4NAEA 1QO5A 4Y9MA 1IEIA 3C0JA 3EWYA 4LT9A 4XVDA 1L8PA 5J5RA 4LLCA 3KHDA 3M43A 1HKVA 3W4YA 1RBAA 3DESA 2CC0A 3S29A 4UTKA 1FNTc 1W56A 3AC0A 3F2CA 4FA3A 4X3ZA 1DKWA 1DJZA 2CESA 3OGVA 3LPFA 1FVPA 2FZNA 1BF2A 3VUPA 3CJPA 1MEIA 4QEEA 4BQ5A 3OGRA 2JALA 4HJFA 3CHVA 1U0BB 3V5YA 1B9ZA 1TPB1 4I1OB 3GBDA 3E0IA 3AHVA 4O1FA 3R12A 3C86A 1CGVA 3V5ZA 3T6GB 4H8VA 2DH3A 1UZHA 1CPRA 2Z1BA 5HAOA 4Q7NA 3C7JA 4Q8VA 1CPQA 3W1RA 3W81A 4JTRA 2PLCA 4ZCWA 1S5WA 2G4FA 3NR0A 1JCTA 4WJ0A 4CNPA 2R7OA 4HNLA 1R9XA 3GTNA 3RYSA 2ESCA 3UWWA 1Z5ZA 3WUBA 2D4UA 2A1YA 1QASA 1GVYA 3SNHA 2BP1A 2WMKA 5C2GA 4UIOA 3R43A 3DH7A 3KLKA 3AIEA 3JUGA 4UR8A 1L0PA 3FVYA 2UBPC 2GDQA 5T8GA 2YCKX 1RHCA 3QLDA 4WKFA 4J7RA 3KTCA 5KYUA 3AIVA 1YBQB 3RG6A 4M24A 5C9RA 3RGTA 4GFIA 5J8LA 5HR7A 2P1AA 4YMZA 4JTQA 1LTDA 1RLDA 4C6QA 4K7VA 4ML9A 3AYVA 1M7JA 4LUJA 1ZNNA 4UFHA 4KRUA 1V3HA 1DEDA 3D3FA 3H2OA 3TA9A 1OHLA 3PPFA 1A7EA 3M0VA 3CH0A 2FLIA 3NDOA 2H8AA 1JYXA 2EKCA 1PO9A 1LM1A 3WLQA 1PYMA 4MWAE 3NPUA 4HZMA 4W4QA 4L4LA 3EA2A 3CIXA 3H54A 1K8CA 3ZJ7A 2G3VA 2OZ0A 3N6HA 4IJCA 2X0SA 3UG3A 4UCFA 2FFIA 4E0IA 5CBIA 1Q66A 3AZTA 3VOJA 5I2UA 3XISA 5HULA 4HA3A 4U5DE 5CPNA 1XI3A 3M0XA 2QHAA 3KX6A 4N4QA 1REQA 1V74B 2EHHA 5D9OA 1VYPX 2PTWA 4EBBA 5C5YA 2RD9A 1RPXA 2XLDA 4ER9A 1QHOA 4C91A 1JYWA 1LRNA 3M4HA 4HBKA 2NQ9A 4N9EA 1N8WA 2GZXA 4Z1DA 3LLKA 1RP8A 3VIFA 2LFDA 1H7IA 3WBAA 2XZ9A 2IBFA 3DKLA 3WD2A 3ZS4A 3QHNA 2X1IA 5LHEA 3QSTA 3MSGA 1W9DM 3WDRA 4KNWA 4BI7A 5CAKA 3P2VA 1QHPA 4CIHA 3W6YA 3MSYA 1V54C 2QCGA 4W5ZA 4MG4A 3KUMA 4E18A 3MO4A 2C1HA 2HS8A 1CBGA 3B9OA 3UXLA 3MQTA 3CQZA 3W7DA 2BXVA 4LCSA 4RCXA 4JJGA 4I44A 3UNTA 2DSVA 2HVMA 3KBSA 1TA3A 3ECQA 3IV3A 1NDVA 5J04A 2OT1A 2I17A 4GI6A 4HCHA 3QLLA 4JTKA 3AZSA 1W2VA 3IJQA 1PD1A 4O8AA 1YMYA 4QGCA 4IMCA 1O4UA 3WQVA 3NYJA 4WSKA 1EDQA 3RN6A 4PCTA 2BFGA 3DFTA 4EK7A 5T1DB 4C6DA 4IAQA 4EAYA 3VNKA 4Z2KA 3NOEA 2NVAA 2D0HA 4PB4A 4AXKA 3TC6A 1OT2A 4MY1A 2ACQA 3UQNA 4PN2A 3VZYA 1IR1A 1YEYA 3VNIA 4GKLA 4CS8A 1VTMP 4ULVA 3TX9A 3MVIA 4AF0B 2Q8XA 5F4SA 1YQ2A 3C8GD 2NWSA 5M1TA 2R7XA 1QNSA 3AS3A 3B4YA 3OWTA 3HF3A 3L23A 3DIPA 4HIBA 1V0KA 2FDMA 1S5VA 1ECEA 4H4IA 3WD1A 1C9DA 3M1CB 3WD3A 3BLLA 1J0JA 4MJ2A 1P6BA 2WXDM 4JTSA 3RM8A 2CYDA 2NG1A 1KWKA 3L7RA 4NF7A 1EJXC 4AH7A 5DT7A 4ZQOA 2V69A 1UG7A 2Y5SA 2DYSC 4I9TA 3T05A 2PRHA 4RXFA 4GABA 4IICA 2PDWA 3G1RA 2AMXA 1GJPA 3GORA 3MVTA 4HP5A 2E09A 1ZAJA 1OCCC 1W91A 4JCLA 2ZZ1A 4G5DA 4RZ6A 4XO7A 3URAA 4YVXA 1JVNA 4GFSA 2ZUTA 1YLVA 3MCOA 1HTIA 4AK9A 3DHFA 1BPLB 2W27A 1DIOA 4YK5A 2PBEA 4XQ6A 4D6EA 3WJYA 1T8QA 3BXWA 4A21A 2OQLA 1E9LA 3ECSA 3ABMC 2Y3GA 1JRAA 1QPUA 3NKEA 4U33A 4PEKA 3VI2A 3PZIA 1YW1A 2Y7DA 5FD0A 1VHNA 3RPTA 5BMXA 4CNOA 2QDHA 4LF1A 1XSJA 3Q45A 2LP4A 4QJ3B 4IFKB 1XYFA 3KVKA 1TV3A 1VFOA 2FTPA 3AIBA 2VCAA 4ZBCA 4GQ0A 2SFPA 4MTGA 5HMFA 3GG0A 3CV1A 3PPCA 4JTCA 3LZ5A 1M6TA 2PTZA 4M6VA 3W75A 5HNRA 5FKYA 1XPGA 2RJHA 1OCZC 4CCDA 4DVZA 3D46A 3TYZA 2ZTKA 3TE9A 1UKPA 3HPAA 5BQHA 3PC0A 1L6GA 1B3YA 3VIPA 3KVMA 3WUEA 3HJCA 2OLHA 3GHRA 2ZXOA 1RKEA 3WK1A 4JC7A 1K4HA 1VFHA 2D2JA 1H7OA 2GK1A 3NNTA 1PDZA 3U7BA 3S9ZA 4K7BA 4YL3A 1IWAA 4MFEA 1ZVZA 3AYSA 4J2PA 4UTFA 1JFHA 1K1DA 1ZSXA 3HPXA 1DJWA 2V9DA 1WPCA 2VYOA 3TQKA 4JQ2A 5G1MA 3I7SA 3OIXA 3K8MA 3EAUA 4I8YA 2CKRA 2W4BA 2Z25A 1KNWA 3F47A 3QMSA 4EIYA 4XTIA 1WDQA 5AYZA 2HE8A 1RD5A 4CX9A 4Q8MA 2PWVA 3FGCB 3TKFA 2WJEA 1I8JA 1S5TA 4WDWA 2LLEA 1EJWC 3PFMA 4MTOA 1GUVA 4WRHA 4R7OA 1EPVA 1I4NA 2VMFA 3QGVA 3W7PA 2QIIA 3SFWA 3T09A 4DF1A 3CGTA 3KZPA 3ES8A 4L4PA 3RO6A 3PCVA 1Y8BA 3O8AA 5FEPA 1Q8JA 3L9CA 1E85A 2NQ5A 1M41A 1R7AA 3M9YA 3KRUA 1ZALA 2W6RA 3O16A 1SZFA 1O66A 2QCEA 4Q7CA 4Q8TA 1OR2A 3C62A 3N34A 4MNKA 3HM7A 1DYSA 4M1RA 3ZG1A 3R0UA 2OELA 2YX0A 4DWSB 5ABFA 3L34A 2PI6A 2VWTA 4CSAC 3VDAA 2XFRA 2C14A 2WHJA 4BCEA 1JGIA 1C93A 3P3BA 3R1ZA 2DSWA 4H9VA 4CJOA 2W4MA 1XLFA 1S2CA 3AOUA 1OADA 3U9JA 3VXGA 1LF1A 1VLTA 2YCLA 3EXTA 2Q7RA 3GVWA 1NTHA 2OX4A 4LYKA 3HPFA 3GR7A 4JFSA 4EANA 1O87A 2XL4A 1KBJA 1TREA 2YCJA 3UZWA 1LOSA 2I5IA 1W1B1 3PBWA 2DIEA 1AQ0A 4A35A 3W25A 1GOKA 3KXQA 4JTHA 3WQFA 1JI1A 3CQ0A 3TWAA 3SCOA 3TW6A 2QGYA 4LVFA 4JS3A 3IGHX 3LDVA 3W86A 1V02A 3UXKA 5CZTA 1MUCA 2VFGA 1NWRA 1C3FA 1EIBA 4IT1A 4O11A 2ZVIA 2V5BA 4S3FA 2W63A 1NOWA 3VF0A 1QPNA 4IISA 2OWXA 4U5BE 4BEQA 2R94A 3GR8A 1FWIC 1H5YA 1SQ7A 5HUPA 3PZGA 5C9ZA 1TIMA 1LBLA 2ZVRA 4QROA 2YLAA 4K38A 3WG6A 1MO0A 4DYKA 1RCOB 3HB9A 4D72A 5M5DA 5D2TA 5I7GA 1GNXA 1Z7AA 1FFHA 3DG7A 3G1FA 2MANA 1XIBA 4Q4SA 2IPGA 4ES4A 1SFSA 4LNCA 4MDPA 3VTRA 1U5VA 2D73A 4G6CA 1E9IA 4OQVA 4HTBA 1CGOA 4MJ4A 1OC6A 2GVLA 3SY1A 4HU8A 1LG2A 5DY2A 1G4US 2HK1A 5A6TC 2P53A 4DF2A 1FWTA 1VLSA 1UPMB 4JX6A 3W1UA 2CETA 3UERA 3SN1A 4IX0A 1RKCA 3MY9A 4IFOA 3PWIA 1BG4A 3SXMA 1XRTA 1ICPA 3BJTA 4HTYA 5DXXA 1M2OA 1DJQA 3FDGA 2Q8LA 1DL3A 1ZJAA 3N2TA 1J10A 4D8AA 1D8WA 3IGUA 1FHUA 2VWSA 2W0UA 5G5IA 5A6JA 1S2WA 3TOYA 1UP2A 1J8MF 2QXWA 3DYOA 3GNRA 1KFBA 3PJWA 4L5ZA 1TV8A 5AFDA 3OVPA 4INFA 4G78A 4QIUA 3CQIA 3VKKA 2O56A 2QCHA 1XINA 4JHZA 1RP9A 1XIJA 2OWCA 2PF0A 3NPWA 4NZ4A 5FA5A 4IMGA 1YA7O 1G4EA 1FWWA 1R6WA 1A41A 2A0UA 3PZNA 3TMQA 2E8YA 3BLEA 3FEQA 1U30A 4QSHA 2ZZ3A 2XWDA 1PCKA 3WQDA 1ZHXA 3CZKA 5CJMA 2FVMA 2VVNA 3STCA 3S9OA 4DRJB 3E70C 3LLXA 3C2FA 3NMIA 1Z89A 5COFA 3EKLA 1XZPA 3BAWA 4A22A 4H2CA 2BGQA 3CUFA 3C0QA 4RW5A 4JX5A 2CW6A 1OGSA 4OUIA 3EX6A 5DBTA 3S3GA 1S46A 1L2QA 9RUBA 3GG7A 5IFTA 2R7QA 1J0HA 3MKCA 1W1PA 3ORWA 3M46A 3N9RA 1OEPA 3EFOA 3ASOC 3WLSA 3ERPA 3T1GA 4CUCA 4U9EA 1ZJIA 4UC5A 3DAQA 3QR0A 3TA6A 4EVZA 5FJJA 2VGFA 1B3ZA 2ALDA 1RSCA 4QRNA 3SCSA 3HQOA 3EZHA 4TV5A 1QTWA 5HMEA 1Y4CA 4IXXA 4HN8A 5A6BD 4ACYA 1V0LA 4O18A 5C55A 1EQPA 2ZTJA 4BF5A 4YL1A 4LDQA 1E1EA 1TELA 3AHYA 4MVZA 3TOMA 1OKKA 3ABZA 4MQ9F 3DKAA 1VD6A 2DY3A 4JIHA 3SP1A 2GVYA 3EDDA 2DT1A 1XJBA 2GQ3A 1K77A 1UD3A 4M5PA 3NSMA 2ZPAA 2IPJA 1WOBA 2QMJA 2OCZA 2RGLA 2DW6A 1WXJA 3NPXA 3OQEA 2Z29A 1A5AA 2H3DA 3N2CA 2JKPA 3NSXA 1KBLA 1LG1A 1H7PA 3E1F1 4DI8A 2GVJA 4AVNA 3O15A 3HV8A 2H7BA 1W17A 4TV6A 3SUUA 1GKQA 4DJDC 4IQEA 3I3BA 1RA0A 4H8NA 4BJHA 3WF4A 4WGXA 4GI4A 1QPKA 2O9TA 2BDQA 1K03A 3OLIA 3A5VA 2GOUA 4AD0A 4C1KA 1W9XA 2XSAA 3C2RA 3VD5A 3C4UA 2QCDA 5REQB 4KIEA 2R05A 3BH4A 4FWVA 3J7HA 4PMXA 1VQTA 4ORIA 3ZVHB 1TPH1 3NQDA 4JL2A 4NYYA 2UZ9A 5CEWA 3GW0A 7ENLA 5I24A 3LX9A 3TROA 3FLUA 1KU2A 1HUVA 2ZA2A 1AH3A 3PBUA 3G3MA 4E3TA 4OIRF 1ZL1A 3BOLA 4IJRA 5D2WA 1ZBVA 2VX7A 2PD5A 4D6GA 3KCOA 4XIMA 3DM5A 2D24A 1ZJHA 2YDSA 5JLIA 1WAUA 4UFJA 1QNOA 2WW5A 5BU6A 2W66A 4RJEA 4RPPA 4LY4A 4HK6A 1TRDA 1B68A 4IQLA 3E0VA 2BG5A 4HA0A 3C8ZA 3WQ5A 2A3CA 1T6UA 4H9TA 2ZBTA 4J3XA 3KAOA 5RUBA 2VC6A 1PIIA 3BAIA 3MMWA 1MNSA 4K1GA 2WZMA 5HSWA 3U6WA 1OVDA 1ORJA 3NQ7A 2CZEA 1ADSA 1C91A 3H4GA 3CH9A 2X05A 5CCZA 3E2SA 4ZODA 1GOQA 2FFCA 2NSOA 3QYQA 4LYRA 4I9AA 4D4NA 3J06A 1W2WA 4Z9JA 1ITXA 3F1QA 1VGAA 2JFEX 4LBRA 4ZOAA 4HSHA 4KI2A 1V6TA 4L6RA 1F4AA 2PDCA 5G1TA 4LUYA 1NFGA 5AHFA 3KOWA 1RXOB 3W6LA 1UWIA 1Z42A 4JNYA 5I0DA 5JUAA 3U3HA 2NX1A 1I2NA 3EWXA 5CPMA 1UB3A 4HNVA 4U2ZA 1TKKA 4KCWA 1TPDA 4ZXOA 4HOZA 1T40A 1T01A 4MWAC 2J7DA 5H6HA 4RUBA 4UXDA 1R85A 1B3XA 3G4XA 1UMYA 3P81A 1JPJA 2XS8A 3TCEA 4H83A 2J7GA 3LTYA 2FZMA 4GIAA 3BG9A 1QVXA 5D8WA 3V0TA 3QW1A 2FJKA 3B8WA 4L1GA 2WQDA 1CXHA 4QCFA 5D30A 2E9MA 4YTQA 4EWND 2PWFA 1TQGA 1KO0A 3NGJA 1HFBA 1G5ZA 1KTBA 1OW8A 4WJXA 3TTOA 2VDIA 3N2XA 3I5QA 3VGGA 2OKTA 2XM2A 3HTWA 2XJ7A 1TJ0A 2ACRA 3KL3A 1J0ZA 1TWCA 3HOJA 2QIWA 3OJGA 4U10A 4HOWA 3LK6A 1ZHWA 2W92A 2UWFA 2A3LA 4Q8QA 4XZIA 4UDVA 2HISA 2R1LA 2ZE0A 2OZ8A 3W24A 2IXOA 3VRCA 3KFTA 1ZHZA 4XD6A 4UQAA 1X98A 4C5YA 5KZDA 2J62A 3L0KA 1Q0GA 1MMAA 1BWKA 3WDIA 1UKQA 4UQEA 4XTKA 3P14A 4P9TA 3GM8A 4G7EB 3A5FA 4LBUA 4FX7A 4S2CA 3QY6A 1UOKA 1SR9A 3VGFA 2NLYA 3NQ2A 1BQCA 2NT0A 4ZR8A 4HQVA 4AIBA 3CLWA 4O52A 4AY8A 3CL6A 2UY5A 2A7PA 3UYCA 3NG1A 2XSEA 3UMKA 3ISIX 4EWJA 3MU7A 1EO7A 3B3DA 3SCWA 3UA3A 1PTAA 3MI6A 1UKOA 2DZPA 1MDRA 2FPVA 4MPKA 4D6FA 3FJNA 2WNZA 3VFLA 1YNPA 2E7FA 2IKHA 1JAKA 3WQPA 1SFLA 3DZ1A 1A7VA 1AQMA 2IYLD 2A5HA 2DZSA 3S6OA 3GM1A 4JIOA 1XKJA 3G5EA 5AVHA 2YW4A 5C71A 3POVA 3A3HA 3OZOA 5B1BC 1CGME 2X2GA 1QW8A 4Z1BA 1IXPA 2DZWA 3B8UA 2J9YA 3V0UA 1HMOA 4MWAB 1MEHA 3R13A 3RVZA 3TYDA 1LZOA 3O7UA 2WZIA 1CENA 2GUUA 2WMGA 4HU4A 3VAVA 4DPQA 2NUTA 3IIXA 2E3ZA 1CIUA 4EXBA 2J8GA 4I6KA 3F2BA 3BSMA 3DI1A 3CB3A 3VCNA 4O0QA 4E3VA 3ZYZA 1P0NA 3JSZA 3GQYA 3TW9A 4Q6JA 3L4UA 3HPZA 4KBLA 3JR2A 2CLFA 3GTFA 2PSNA 2ZZ7A 3ZQYA 4OUEA 1N2VA 2BHYA 3W72A 3AG3C 1EYEA 3VIKA 3K1IA 4AZCA 3CHEA 1TVNA 4S2BA 3FSUA 1BKSA 1THFD 5LGZA 3HJZA 1AW1A 4KMQA 1LORA 4XAGA 1E4MM 1LL6A 4CS8C 3R7MA 1VFFA 5CBJA 3KCLA 2V81A 3AICA 3NM3A 2VFIA 2XGBA 2YR1A 3IRDA 2GJXB 1TJPA 1AEPA 2R7SA 5HQLA 1MNEA 2OFJA 1M7OA 2VTFA 2YXOA 1KA9F 3MZNA 4B5XA 3ANVA 2HS5A 1KTMA 3M6DA 1WZAA 2YCIX 1T96A 4WXZA 4WJEA 1TX2A 1CB7B 4MPQA 2YKZA 1GCYA 1Q0KA 4XZBA 3WNNA 2F8QA 1YLMA 4NTAA 4LS2A 3W6MA 3OOQA 3MYIA 2CKSA 5IFPA 1PHQA 2EJAA 3N3MA 4MVRA 1GGOA 1DQXA 3PF3A 1OF8A 1OXBA 3VX1A 4EWCA 1BQGA 3LCHA 2L5HA 3VDHA 3OZPA 5CXPA 4QHRA 4XLNF 2VM8A 3WLJA 1JJKA 5A2AA 3TJXA 4G56A 5E0CA 4I7UA 2PNOA 3IPWA 3WH7A 3BMVA 4N0RA 4ZB2A 2Y63A 4NAFA 1NFBA 1VYSX 4IUOA 1VCFA 2ZE3A 1NVMA 4TX8A 4WDUA 3CPGA 2X0HA 2C0AA 3B97A 3UT0A 3MPGA 4K36A 2WC7A 1XBVA 1Y5WA 1TO3A 3ARRA 4B9YA 3VC5A 2A1DD 3LQGA 5IOBA 1NJJA 5E0KA 1BHGA 1UP3A 2Z00A 1FFRA 1WDDA 1S2AA 4Z9HA 2WC3A 1TJ1A 2AOSA 1YDVA 4W8PA 4TVUA 2TYSA 3FDKA 1L6WA 3G1AA 5HPCA 5JUVA 1BGGA 4F9JA 5DEZA 4ICMA 3S9IA 2LQGA 4P5UA 3TTEA 5AYYA 4U31A 4I5RA 2QW5A 3N19B 3GDKA 1TV2A 1VPYA 2G3IA 5K7JA 1TQJA 1HJQA 3WSUA 3DZAA 3W0KA 2PCEA 4A8RA 2WVNA 2F6UA 3R10A 4KERA 4RDVA 3RUBL 2BVTA 3BLIA 3T07A 5CJNA 4LC6A 5EPDA 4GH1A 2WKGA 2WMIA 4YCOA 2V5LA 7TIMA 1UWTA 3H7VA 1PD0A 5BU9A 1O5RA 1OCQA 1G9HA 2B31A 2WO5A 2PTXA 2CZVA 5E1QA 1OX4B 1HO1A 5AGFA 2EPMX 3VGEA 3GC4A 2D0GA 4XAZA 1I9CB 1OC7A 2HVOA 4UMCA 4J3WA 2R03A 1MNDA 4UTUA 1RJ9B 3IQ5A 3GG8A 1ALDA 3WDHA 3EGXB 3OVGA 5D03A 1F3XA 4JTUA 3E38A 4ORMA 1MZHA 4NI3A 3A4WA 3CU2A 4EKJA 2INFA 3WBXA 2VQTA 3NG3A 3S1WA 5A6KA 3QHOA 2Y5JA 2TMDA 3B9EA 1GZJA 4FOKA 4CNSA 2OYKA 4H9UA 2V26A 3L8IA 2Y70A 4UFLA 4H7VA 1QXLA 1CYGA 3A3XA 4A3HA 4LDKA 3BMXA 2PS2A 2EG7A 1AQHA 3PPHA 1YDNA 4MW3A 2PLJA 3TLQA 3MS8A 1OCJA 4HPHA 1NDZA 1NWUA 1Q2SA 4BK9A 1J2WA 3VMPA 4HSNA 3MUZ1 1RQEA 3K1GA 1R7OA 1FY6A 4GPNA 4ZE4A 4Z1CA 4XV0A 2ZD9A 3U9MA 4NXKA 1FXPA 5AOUA 4LVDA 3WFAA 4NJKA 1MRAA 2YLGA 4F0SA 5I78A 4DPPA 4JAWA 5KZMA 4IL2A 2WYSA 3LV6A 4MLRA 4W89A 3A64A 4LUSA 1Q6EA 2OJQA 1JD7A 3SXKA 5PTDA 3AGUA 2FTWA 3HBLA 2CLMA 5C2XA 2WZHA 4GISA 2F9RA 4DYJA 4NT0A 4Y9NA 1OK6A 1ZPTA 5KYXB 1P7TA 1HX0A 3RR4A 3OG3A 4BFAA 2VUYA 3V5XA 2OEKA 3LEVA 4LYPA 3F5LA 3GDMA 4CCEA 1IZJA 2IKIA 3WNKA 1V4YA 5MF5A 1WA3A 4IPPA 4O8RA 1TE1A 2YZ5A 3QW3A 4DNHA 3Q94A 2DDXA 1XH0A 3ICJA 4CVWA 2BTMA 2L6FA 4AIOA 4X0NA 5DBUA 1GW9A 3G77A 3K1DA 1ZHYA 4J3ZA 4CD8A 1E55A 1OABA 1SZEA 4PH6A 2C0HA 3L2IA 3GRIA 4PMYA 2H7OA 1SMYF 3HNIA 3NWRA 1WYIA 2F61A 2ZUSA 3QZ6A 3W84A 2O9PA 5L0CA 3GSMA 4QDLA 4ZB5A 2ASRA 3P0XA 3QY7A 5B7ZA 4ZB0A 3KL4A 1SJDA 2WZLA 4WEVX 4P7OA 4QE1A 4ZOEA 3H23A 2C18A 2OOFA 4MVSA 2VRQA 1MFVA 2ON3A 1Z9AA 1VAHA 3LLIA 1EHAA 1K9TA 2XS1A 1KTNA 4V27A 1DV7A 2YWAA 5E6YA 3NQCA 1W0MA 1UIOA 3HLZA 4FLSA 1QI0A 5G1YA 3C0SA 1WO2A 4F3HA 1E0TA 1GG0A 2Q9AA 1JNEA 3R4IA 1SO3A 3L4TA 4OU1A 3ABKC 5AY7A 2WPGA 3CUHA 2XSBA 4CNNA 3NXLA 5HA7A 4QDWA 1HL8A 1SVDA 3CNYA 4Q6XA 2PDYA 2FGZA 3WJXA 2VJXA 2DZBA 3DU0A 2ZUMA 3M0ZA 1LQ0A 5CPLA 2W61A 4DJFA 3B8TA 3LV5A 3WKZA 3EH2A 1VYKA 3A9BA 2CLKA 4RL3A 1J01A 1V7AA 3H12A 1A49A 3OGSA 5XINA 3GE7A 1XYLA 1GOXA 4ILSA 1PEZA 3CPUA 1UIPA 3GC2A 1OFQA 2IPWA 3FXGA 4A2SA 4ZQMA 4LWWA 3M0HA 3M0MA 2WHKA 4O53A 3T0DA 3DOPA 3ALFA 3CZ8A 4L4MA 1BR1A 3QPYA 4OBRA 4P8VA 1KCXA 3W3OA 1DHKA 1KFWA 1JPMA 1PKMA 4JQ3A 1VCGA 3TR2A 3U8GA 4WZHA 2W4XA 1JFXA 2X0YA 1YYAA 1XF0A 4DBRA 1UA7A 3QQ1A 1R2TA 2J8WA 4I1MA 1VBJA 2VCBA 3PN8A 3QC3A 5CSRA 2ZDRA 4KFNA 2X1UA 4OD4A 1EWDA 4AX2A 1VFUA 3VZXA 3BE7A 3W7EA 3C2OA 4LVBA 2FYMA 3U2MA 2QCMA 1LYXA 4ZSTA 1J0IA 3FNDA 3NQEA 3W2WA 1UH2A 3RO8A 3WEOA 2J66A 1CW2A 4KW2A 1XWYA 3T2QA 3W26A 3VDGA 1LQAA 1TFKB 3R2GA 5FESA 2I5GA 4B92A 5K3VA 3N9KA 5DS6A 4KWWA 3WJSA 5LIWX 3ZDLA 3M5XA 1AG1O 2ISWA 3BV4A 1W1VA 3S5YA 4GJIA 3IACA 1SR2A 5AYIA 2PDXA 1VEOA 3WUGA 4LCRA 2ZUVA 2QLAA 3AI0A 1UD2A 4GQRA 3CXOA 3QM3A 3BCFA 2X0CA 5AYXA 1GT8A 4WLCA 3O3RA 3OP2A 3WLIA 2J45A 3OB8A 4G8TA 4QLLA 4P61A 4DJEC 5DN1A 2JX0A 1MW1A 3CT7A 4RE0A 4N7QA 3RHGA 5DT5A 4EUKB 2H3BA 3AMDA 1B3OA 1Y7VA 3UGPA 2YL8A 2BB0A 3CL8A 4KC9A 4AL1A 5AHLA 7XIMA 1S1PA 4B2DD 3KP0A 1BXNA 3E6EA 2W67A 3OZMA 1M5WA 4Y9PA 1GWJA 3DJNB 1OY0A 4DRSA 3MHGA 4C6KA 2BXZA 3B8VA 2WZTA 1XPYA 3RYLA 3HGOA 3LNMA 2PTYA 3CM4A 4Q4RA 2XU2A 3MKKA 2WB7A 4XBSA 4UWMA 1YRRA 2WVVB 1JPNA 4S23A 3VMNA 2BVDA 3GYEA 1ZUAX 5I07A 3MDWA 3W1PA 3DFSA 1F6PA 2PC8A 5MHBA 1KFEA 4EKWA 2WNWA 5EA9A 3LEPA 3GXFA 5XIMA 3U8VA 5DMNA 5JVLA 3WX7A 2VD9A 1L3PA 3GWNA 3WH8A 3W1NA 2LFFA 3JS3A 4H8HA 2JEQA 2D0FA 1Z23A 4C6OA 1IF2A 4XKYB 4H8UA 3ASNC 2A0NA 3EDJA 1NQKA 1BVNP 3UWYA 3VOCA 4GVFA 2XISA 4L1WA 4NTBA 4IZGA 1RVKA 3NIYA 1PCWA 1XDMA 2HMQA 2R1MA 2OYLA 4E2BA 2H9AA 4IXHA 1HL2A 3WF3A 5F5HA 2I56A 1ME7A 2VENA 3LA4A 2J7PD 2WPBA 3IGXA 4ICNA 4FEZA 2XVKA 3KKBA 1Q6FA 2LD6A 4CD4A 2XN0A 1CXEA 3KS5A 1C8QA 4FR6A 3FJ6A 4HK7A 1VPQA 3DM9B 4EBJA 4PUEA 1Y65A 1UG6A 1N8IA 1HJWA 1IW7F 3SCTA 1FHLA 5ECVA 4PMQA 2BSLA 1BG9A 1KCKA 1OZMA 3CYVA 4QG9A 4TXEA 2G97A 3NVDA 1J8YF 3B0PA 1ONRA 4BF7A 4JN6A 4PL2A 2PFDA 1LRTA 3SZRA 5HR6A 3USBA 1L7CA 3K30A 4QTGA 2C15A 2WSKA 5F2MA 4HSOA 7A3HA 5JIPA 3STPA 2R91A 5TQLA 4J3TA 2TMVP 3S42A 2G3NA 3P82A 5FF4A 1YX1A 1H0GA 3IEEA 2GGGA 2YPIA 1YDOA 4DI9A 1XUZA 2WMJA 4X9SA 4JEAA 3G8RA 4IG2B 3I68A 1LCOA 3ITFA 2VD8A 3AUJA 1EJ7L 3OHIA 3LHYA 4XAPA 2V2DA 4KS0A 4A8NA 4C90A 5BXPA 3SJ3A 4R33A 4OINF 4E8CA 3I5PA 3S90A 5CH9A 3H65A 4CU8A 1UH3A 3BGAA 3QC0A 2J7EA 1GZ1A 5C7HA 1OM0A 4JKMA 4ZE5A 1NLXA 3EJNA 3CUGA 1QI4A 4S3KA 3FK4A 3HG5A 1DJGA 4IMDA 3UG5A 1LROA 4GNKB 4UMAA 4YTTA 1BYDA 2HVNA 3CHFA 3WLMA 3VE9A 4U5IA 2M4EA 3VCCA 3TK7A 4XX6A 1ZLPA 1AH0A 2QZRA 2AKZA 2I5QA 4MB3A 1J2BA 4Y6GA 3BC9A 4ZOBA 4CEXC 1GHRA 2TODA 5AHNA 3C2YA 1WE5A 3GU1A 1D1BA 3TSMA 4JTJA 4GZJA 4ROPA 3ZZ1A 2V5CA 3FA4A 1IEWA 4ZLCA 2V30A 3G50A 1QVBA 1QJWA 3VKJA 1A7DA 2B0HA 3JU2A 1FMWA 3T2PA 1Q4WA 4PTNA 1IT7A 3SDOA 1HMDA 2P5NA 3ARSA 3BAXA 2V5DA 3W1AA 4A4AA 1SZRA 4GVGA 3RH3A 1UWSA 1ZBCA 4NNAA 3G22A 4JIQA 4H9ZA 2E1WA 1DE5A 1LUCA 4CDYA 2VZSA 2P8BA 4BEMJ 4YU1A 4QXIA 4RNFA 3P61A 4GYJA 3CBWA 4OOUA 3B8SA 1NFOA 3WQGA 3HJEA 3GKAA 1N55A 3W8IA 5JP7A 1X6LA 2UY4A 5D91A 2WVUA 3VNLA 1UJPA 1E6QM 3QQWA 1K7FA 4BG0A 3LMZA 1XIFA 4LQ1A 1ZU8A 2A6LA 3IIPA 1DOWA 4OHQA 3GKFA 4FAMA 4FLOA 4LF2A 1AK5A 4ZA0A 3EWDA 3NVTA 3AXIA 3A4JA 4LS1A 3X1OA 4MMWA 5M03A 1SPQA 4P9FA 3NL3A 4ZEPA 4FXJA 1UR3M 4FX5A 1CZ1A 3DAGA 2DVXA 3VCRA 4GUHA 3APYA 3HU7A 3SCUA 2Z27A 1I75A 3AWNA 5HOSA 3V1PA 3OG2A 5E70A 3TJ5A 1M7PA 3M07A 3TW7A 3LHWA 3HNJA 3SECA 4PUUA 5HJYA 4NQFA 4Y2WA 4CDAA 4NC3A 2QULA 3OA1A 1W5QA 2KW3C 5L0JA 4F2TA 3W74A 1YNYA 1J6OA 2PC4A 3I6EA 2PZNA 2GFTA 1DWJM 4Z2GA 4D8LA 1UFBA 2CCRA 5HANA 4E2VA 4F0LA 5LIYX 1J18A 2F22A 5D02A 5D2XA 2XLHA 3VNYA 3NTYA 4AIEA 3UNGC 2YBUA 4B5VA 1P0KA 4V33A 3MUXA 4UR7A 2XIMA 3ZLGA 3CV6A 3CB8A 3SAZA 1H60A 4LCQA 4AD2A 5I06A 3PUOA 1R3QA 3LI1A 1NELA 1Q45A 3NEHA 3RIPA 2OEJA 3GTHA 1O60A 1QMLA 4XSLA 4AHPA 1QBBA 4AHQA 3W7CA 2D2OA 3QTPA 3UU0A 3FDQA 3BG3A 2CPUA 1FCBA 3NZGA 1LOLA 3EX2A 4OFCA 3SQMA 5DMMA 3K1IC 1X7FA 3BOFA 4KF1A 3TONA 5F2LA 1SO4A 1FQ0A 3BURA 1R3VA 1XW8A 3A11A 1DVJA 1KNYA 1A47A 3U2CA 4O14A 1WKYA 3EWUA 1I60A 1QPRA 1HE9A 3D47A 3BDKA 3UWVA 3F4NA 4MUPA 4HPJA 4GJJA 3DKJA 2CHOA 4D1JA 1S7ZA 4MAZA 2JPUA 4OWGA 1NQ6A 1W5OA 2PMQA 4YT4A 3MFNA 3QGAC 3VNJA 2G0WA 1PX8A 2Z0IA 1BLIA 2XG9A 1XBYA 2YZRA 3D3AA 4W93A 3NO3A 1E5NA 2ZIDA 2A3AA 4QJ5B 3LRMA 1PAMA 2X1TA 3PANA 3RU6A 5LA0A 3TC7A 4W87A 5T3TA 3U5UA 3VGBA 4QDPA 2QCNA 1VB9A 3N18A 2EXOA 4H6KA 1EB3A 1I1WA 3LGGA 4N2YA 4WJ8A 1YHTA 3A24A 4CQDA 4MJMA 2VDGA 1DWHM 1UYQA 3TD7A 3MLGA 4IFKA 1MI3A 3B8DA 5JXQA 3APTA 2P0NA 3R94A 1M3UA 5CGTA 3PBMA 2A85A 1CGTA 4LRSA 3FXYA 4N9DA 4CD5A 4DQWA 1D3GA 1RD6A 3B04A 3KH2A 4FIQA 4JTGA 4LFYA 2GVEA 4PTVA 1V51A 3MT1A 2OYMA 2FB2A 2PPGA 2VC5A 3OVQA 1NWTA 3VGHA 2EIMC 4GACA 3WLOA 3VO0A 1D3CA 3CAXA 3WQWA 3EOLA 2ZX7A 1W1A1 1VYRA 3MMDA 4KFPA 4OECA 1W9PA 4HU0A 3FYPA 2HRWA 1KWGA 4NAEB 4I90A 4LV9A 9XIMA 3ZIZA 4MGGA 1BEUA 4NVTA 4ATWA 1XIGA 4DAIA 4A3YA 3APGA 1JL8A 4CCCA 3GFZA 1NP0A 4TMCA 4FMVA 1UWRA 2HQAA 5C54A 4ZO8A 3PMRA 3X2QC 4O0KA 1W8SA 4AX6A 4AG0A 4DWDA 1A3HA 3U2EA 5FJUA 4CN1A 3N04A 4IIFA 3VFCA 1E1FA 1GS9A 7TAAA 3KTXA 3DG6A 4K1OA 1M1BA 1XG3A 3LD5A 1E6NA 3N4FA 2YEVA 1I0DA 3B05A 4KRZA 1H1NA 3TLLA 4RDYA 3FGCA 3CZGA 2O9RA 1HP4A 4O16A 2H8XA 2ZCGA 5MKGB 1MWOA 1VEMA 2HBXA 3L66A 1ZZMA 3LG3A 3TYAA 1HW6A 1SO6A 1UOZA 4DJDD 1XX1A 1UKSA 1BBHA 1BWVA 2W3ZA 3Q6NA 4DIAA 2ZRUA 2VEGA 4XPXA 3PBYA 1Q7QA 3KEHA 5E33A 2YOCA 3IJLA 4XZ9A 2O55A 2IS7A 1TUXA 5JBFA 2J7PA 1UD4A 4JVSA 4E0CA 1U33A 3LPPA 2YKKA 2YL7A 5C70A 4ZOCA 3UY8A 4K37A 4DWSA 2NSGA 4NP7A 2PDPA 2OCCC 3SEPA 1R46A 4MOZA 3EEGA 1P5BA 4Q8NA 1IE7C 4REQB 4C65A 3IAPA 2DSUA 1OG0A 3WODF 3PB2A 2LK4A 3BLOA 1QHZA 3PWGA 5ENLA 2FZ8A 3UETA 5JT4A 1TPFA 3WQCA 4QM1A 3UEQA 1E70M 2WQPA 4FNUA 5CG7A 3NMKA 2WBKA 5FAGA 3TQ0A 5CC3A 4WDXA 5KINA 5CPTA 3UCQA 2ZXBA 2LSEA 3LAYA 4ALDA 4DUVA 5FEZA 5EK0A 4O6MA 3SCPA 4BS0A 2GVGA 1E0UA 4KWSA 1KR0A 1Y5VA 2C19A 4QJ1A 1U6HA 1POKA 1T8XA 4C60A 1E0WA 3DBNA 4FOJA 3RX4A 1OG6A 5E2QA 5F1VA 1US2A 4Z1YA 4YN5A 2BXYA 5EMYA 3IRSA 1C02A 1EP3A 2X41A 4TMBA 1ZS2A 4HZ6A 3ZLHA 3O6YX 5E3AA 4ONSA 4MSSA 1F8MA 1KKRA 4H01A 2YFOA 1A5LC 2VVSA 3DGRA 2P0IA 2PFHA 3WLPA 2AQOA 3SADA 2FDSA 4QS5A 5LIKX 2FPYA 5HXMA 1SU5A 3QMKA 2CHNA 1PX4A 5BRQA 1WP6A 3WAQA 3Q7GA 3CZEA 5LSMA 1VB5A 1FWGC 4XZWA 4J1OA 2Y6ZA 1FOBA 4C1NB 2GJPA 1RJPA 2DP3A 3AS1A 3S1VA 4HPNA 1W3IA 4NSBA 4LJ3A 5F4XA 3TJLA 2C04A 5EU9A 3EWZA 1WKFA 4YS1A 4O19A 3H4XA 1TA3B 3BLFA 1XLKA 4C5ZA 1V79A 3XIMA 1H50A 4U3CA 5FIPA 1EDTA 3T08A 2BY0A 4K39A 3OHMB 2X09A 4FNPA 2YL6A 1KFJA 2PRLA 5E0FA 2EG6A 4F0HA 4QG6A 1Q5MA 1L6FA 4DJFC 1CX9A 3M1ZA 1O5HA 2DV0A 3C0LA 1E6SM 3T40A 1IGWA 5K9DA 1Q6OA 4EPBC 2X30A 2ISSA 1VIWA 1RCXB 1ITCA 4CSAA 3KLLA 4NNBA 1HT6A 1AJ0A 1CXLA 2XLWA 2ZXQA 4CKQA 1E56A 3LI0A 4P7LA 5I79A 1GEQA 4MS2A 4GIRA 4BY3A 3QW4B 1MUWA 3DE9A 4OT7A 3TQVA 3ITCA 2OKOA 2E6DA 3GZAA 5D37A 3VKCA 5EMKA 4YN0B 3T7VA 4U5FE 4LNYA 1SSGA 1IWBA 1QWGA 2ACUA 1CCWB 1MNZA 2WSRA 2R7TA 5T91A 1R4TA 4ANJA 3B0UX 2CNCA 3HMCA 4TO8A 4M0XA 2Y24A 2JKEA 3N13A 2DZVA 4NZCA 5I09A 2CWNA 4QISA 3IWPA 2ZRWA 2EJ1A 1SGJA 2P50A 1XL9A 1ZCOA 4YHEA 5L9FA 1GGQA 4QI0A 3KTSA 4NX5A 1YAUO 2Z2UA 3K4DA 2XFWA 4RW3A 3T0BA 3HG4A 1K05A 1Z32X 1A5NC 4E7ZA 1O3UA 3QBUA 3SGGA 3L0IA 2V3EA 2TRSA 2B4GA 4JZ5A 4DBSA 1HE1A 2YDQA 1PZ3A 5DELA 1QATA 3EG9A 2L9JA 1OCNA 3K7DA 2L7AA 2X1RA 1EF2A 2R1NA 1JRCA 3DUGA 4XISA 3VM5A 1RY0A 1R0MA 1TV7A 1MQVA 2FGBA 4JEJA 1TR2A 3MHUA 4WY0A 2W62A 3TTQA 3B9NA 2GA0A 1LLOA 1TJRA 2DT3A 4IAOA 1W6TA 1Q6DA 3VIHA 2G3KA 5EGYA 4HB7A 1ZFJA 1E4IA 2C6QA 1YKWA 3O05A 5FCLA 4GXWA 1E5JA 3QTGA 2Y61A 1XRVA 4WR3A 2UV8G 3K5XA 1DWFM 3UZZA 1W9VA 1JXKA 2GPTA 2HXTA 2BOEX 1A53A 4LANA 4PTWA 2VRJA 3AMKA 3AQBA 4B3LA 6XIMA 4NYUA 1NDYA 1OFEA 1L8NA 2OODA 3VILA 1PZ2A 3RR1A 5L0IA 4JN8A 3AJ7A 3VUSA 2HV5A 4IIEA 2G3JA 1D8CA 1QQ3A 3EOEA 4GD0A 1EH9A 1M68A 1TR9A 2VDHA 3QVYA 4GYTA 1D2KA 2UY3A 4WKHA 1IQ8A 1XR2A 3K46A 4HD5A 1G4PA 1EQ1A 4B90A 5E09A 4AYGA 1NARA 3N2BA 2AGKA 3STFA 3IPMO 4K8GA 2OOGA 1E0XA 3MO7A 3RRAA 2QKFA 4XEFA 3UZJA 1OT1A 5REQA 2OR2A 3A13A 4EP8C 1JIBA 4N06A 1AZ2A 4X2PA 5HK4A 4C6IA 1C8XA 4O12A 5JIWA 4A8IA 3CYJA 2Q4FA 2CFFA 2C13A 1XLGA 2Y62A 4QE5A 2ZRVA 1JGMA 4MTFA 3WD0A 2OU6A 4CN4A 1G7VA 2QE9A 3WN6A 4UQBA 4O1DA 3GB6A 3STEA 4MUZA 3LBMA 3UYIA 4DAFA 3POCA 1JR1A 5E3CA 2BOGX 1ZJBA 3E0FA 1MMGA 3UWUA 2B7QA 3V5CA 2Q3TA 1SSDA 2QJIA 2ZX5A 2EGZA 1WB0A 3W88A 4NIRA 7REQA 2CNWA 1DQUA 4PMDA 2J74A 4DX3A 4U5GA 4GBUA 1QZXA 2G3MA 1KFCA 3ZOAA 1YA9A 1PWMA 3NL6A 4XB3A 5AC6A 2EPKX 5LXEA 2WZEA 3NL5A 3FA5A 4OOZA 1EF3A 4IMFA 3VNMA 4BHYA 2VOMA 2QNLA 1IYXA 1LWHA 5ABFB 1F6YA 2C7FA 1OFDA 2BZNA 2Q71A 5ABGA 4NRRA 3WQ6A 1ZY9A 2YBTA 4O4VA 3QPZA 4Z0JA 2X7WA 1OGGA 2B0JA 2Z2BA 3DI5A 1Y0EA 3O39A 1LQ2A 4LEQA 3M47A 4XD5A 2WKJA 3HA1A 3THDA 3FFSA 3GODA 4OIOF 1ZU4A 1XLBA 4IIHA 4KGJA 1K6WA 2GUBA 4LPCA 4LAOA 1QFEA 2PGEA 1W3TA 2V3FA 2EIJC 4KQNA 4PUKA 3MKVA 4IM4A 3GEIA 3WJZA 1LT8A 5BRBA 1VF8A 5DMLA 1I1XA 4LB4A 1J12A 2A3HA 1KRAC 1N1CA 4FS9A 3TAKA 1LT7A 3NEVA 4GZ7A 4TQTA 1AUEA 2INZA 3K8KA 2GGEA 5KZEA 4FAPB 4LYQA 2J77A 4DJDA 1WDWA 3AMCA 1UHVA 4S3JA 3RMEA 1R2SA 3GDTA 3T42A 1HW2A 1ONEA 3LOTA 1YPFA 1FWEC 1V93A 4RZBA 1PZ0A 3FV9A 4LEFA 1H41A 3VINA 2QJMA 4JFWA 1XIHA 3NDYA 3I3DA 4JYFA 1PL9A 3N2OA 5ABTA 3DBPA 5JH2A 1OW6A 3PZMA 1V3LA 3CO8A 1R47A 3N73A 3W38A 3BLDA 4WOZA 4Y96A 1X6UA 4ADSA 3PTMA 3H4WA 3AG1C 4M7SA 3AWOA 3S8HA 2NXIA 3C8FA 4XQ1A 1Q13A 3TSBA 3LNRA 1TCMA 4LERA 1J4EA 3C6CA 3HNKA 3ATYA 1FWRA 2PU0A 1KGUA 2DPEA 1U22A 4GUIA 1GVEA 3TJ6A 2B7NA 1D3HA 2ASHA 4HHHA 4V1XA 5A2BA 1I4YA 1TWGA 3PK7A 4KEVA 3QEZA 1DTUA 4QSFA 1JZ8A 3VKDA 3P8IA 2QAFA 3RX3A 1ZTVA 4G7EA 4K3ZA 4UZSA 1SR0A 1CB2A 3ITYA 4QE4A 3VAYA 1UH4A 1V6UA 3LS9A 4NZ5A 3WEMA 3S6TA 4XTDA 3ABLC 4AISA 4B15A 3GDRA 1JPDX 2AWYA 2J9WA 6CGTA 4PRWA 1SFJA 3ONCA 3LGEA 3ZJ6A 5B1AC 3EWCA 5BXSA 1GJUA 2O92A 4FR1A 3H2NA 1TTPA 2V67A 2IM8A 2J7HA 3WIJA 3EA1A 4DO5A 3QV7A 1F3EA 4W85A 2HUJA 5FAJA 3R6IA 1JZ7A 1FP9A <