3B0UX

Trna-dihydrouridine synthase from thermus thermophilus in complex with trna fragment
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
312
structure length
312
Chain Sequence
LDPRLSVAPMVDRTDRHFRFLVRQVSLGVRLYTEMTVDQAVLRGNRERLLAFRPEEHPIALQLAGSDPKSLAEAARIGEAFGYDEINLNLGCPSEKAQEGGYGACLLLDLARVREILKAMGEAVRVPVTVKMRLGLEGKETYRGLAQSVEAMAEAGVKVFVVHARSALLALSTKANREIPPLRHDWVHRLKGDFPQLTFVTNGGIRSLEEALFHLKRVDGVMLGRAVYEDPFVLEEADRRVFGLPRRPSRLEVARRMRAYLEEEVLKGTPPWAVLRHMLNLFRGRPKGRLWRRLLSEGRSLQALDRALRLME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/rna
molecule keywords RNA (5'-R(*GP*GP*(H2U)P*A)-3')
publication title Molecular basis of dihydrouridine formation on tRNA
pubmed doi rcsb
source organism Thermus thermophilus
total genus 126
structure length 312
sequence length 312
chains with identical sequence Y
ec nomenclature ec 1.3.1.91: tRNA-dihydrouridine(20) synthase (NAD(P)(+)).
pdb deposition date 2011-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01207 Dus Dihydrouridine synthase (Dus)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1460 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3b0uX02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3b0uX01
1IF2A 2Y7EA 3ABRA 4JY8A 3DKJA 2FTPA 5K4XA 1E51A 3EWWA 1VH7A 3S9YA 4N9BA 5U7SA 2DZSA 4FX7A 3MBFA 1QPRA 3NQGA 4AF0A 1TPDA 5J5DA 2PRLA 4FIQA 4JNMA 4UTUA 3LHVA 3LCHA 1EEPA 3NQ8A 3TJLA 4JN6A 2OT1A 2Y7FA 2VENA 4CQAA 3O1NA 4A3UA 2E6DA 3FKRA 2WKJA 3TH6A 3WJYA 3NA8A 1TIMA 2YX0A 3F4WA 3CLMA 1THFD 5I3IA 4ZQNA 4H6KA 1B3OA 1OFRA 4DF2A 3DHFA 1XXXA 4AF0B 2E68A 1KM5A 1IXQA 5U4NA 1W5NA 2F7FA 1UJPA 4O18A 5C54A 1G7UA 3B4UA 4PCFA 2C13A 1XBVA 3NQVA 3LXCA 2EF9A 3D0CA 4O4WA 5G2IA 3L0GA 3WK2A 1QOQA 2G5WA 3G8RA 3CT7A 5C2XA 1OFOA 3TMLA 1G69A 4MYXA 1KM0A 1TYGA 3CPRA 4I7UA 2QR6A 5F1UA 2WSQA 2NX3A 3S1WA 2X1SA 3M5ZA 3W7DA 3EB2A 1J2WA 3LI1A 3TJXA 4JYDA 3E49A 1GJPA 3UWQA 3C6CA 5AOUA 1O95A 2ZTJA 2TPSA 4ONVA 4FEZA 4BR1A 4XUGA 2TRSA 4JTTA 3W1MA 5AHEA 2EAWA 2QAPA 4UFIA 3MHFA 5AHLA 3DI0A 3G24A 3FLUA 1QR7A 1Q6RA 2I14A 4UMBA 3G1VA 2XN1A 2QCHA 4R34A 1FUYA 3MP3A 5F4XA 6TIMA 1OFBA 3FKKA 3DFQA 1WBHA 5BW6A 1NAL1 3CM4A 4UMAA 2AQWA 3GK0A 1OHLA 4GWEA 3S5ZA 4DF0A 5IM51 2WJZA 3W1QA 1MEHA 1MEIA 3ABOA 5F1VA 1Z42A 4K7YA 1AK5A 1FXQA 3IGUA 3Q94A 2HSAA 1AL8A 4JX4A 5DXXA 3NEVA 3NQMA 4GUFA 4LNYA 3A23A 4LW7A 3AJXA 2ZYFA 5E0KA 3PBUA 2CLKA 1SZEA 1XL9A 2BSLA 2NLIA 4C1KA 1P5BA 3G1HA 3B0PA 2ZA1A 5G2HA 4IUOA 4DXVA 1X1OA 4XBKA 2ZRUA 3C2OA 4I7WA 1XKYA 1FXPA 5GVJA 1DORA 5AHFA 2A0NA 4E2DA 3TU9A 4PA8A 4JTGA 4OE7A 2IQTA 5HULA 2EKCA 4RZ4A 3GXPA 3M5VA 1OF6A 5MHBA 3G1AA 3WK3A 4N6FA 3BG5A 2OZ0A 4JGDA 3VE9A 5EBUA 2B7PA 4M6PA 3UQNA 2VFFA 2R14A 1B4EA 5FF7A 4HIBA 2V30A 1W3IA 3N9SA 2YR1A 2Z6IA 3FIGA 1LRQA 2BWGA 2E5DA 3NXFA 1RR2A 1T99A 2ZZ5A 2P1FA 1VS1A 3EEGA 3MI2A 4DELA 2G95A 5IBXC 1GWJA 4JTIA 1FCBA 1SU5A 3OHIA 3CIWA 1LBMA 5K9CA 3ATZA 4M7SA 4GFSA 3S6DA 4WD0A 2OJPA 5D09A 4Y90A 1ICQA 4GE8A 3PR2A 1H7RA 3KVLA 2OCZA 3P5ZA 1F6PA 3GR8A 3CC1A 4UTTA 4KWWA 1XC4A 3DHDA 4IGHA 2J6XA 4EWND 4MKNA 2A5HA 4WOQA 1TPC1 3A5VA 2YDAA 5D33A 2G97A 3SW6A 5HR7A 2G96A 3KRUA 1VGAA 4QAIA 2ZTKA 1JULA 3L21A 3IEBA 1GYNA 3PBYA 2C18A 3EWXA 1LDCA 4MLRA 3KVJA 4RXGA 1K03A 4ADUA 3BGJA 4HN4A 3M16A 1JR1A 4RKAA 4JDYA 3W2NA 5G1YA 1G67A 3W1RA 3I7QA 5KTLA 2X1UA 1HTIA 1VHNA 4O50A 1F7BA 3RMJA 5FF0A 1FCQA 1PVNA 4CCDA 3NG3A 2Y62A 2H8ZA 3LDVA 1K3UA 4MUZA 1ZAHA 1TTJA 3P5YA 4BFAA 1QAPA 3GDTA 3L9CA 4RLIA 2Z0IA 1RZMA 1TB3A 1O5KA 3PUEA 1YTKA 4O57A 1Y0EA 3HIJA 2CFFA 3QH2A 3CEPA 1G4TA 2VFIA 3W87A 3G1YA 2NX1A 1JCLA 1QOPA 1O4UA 1XI3A 4FO4A 4YWIA 4DQWA 1FCUA 4EF9A 4JD4A 1JCXA 3MYPA 1SUXA 3SECA 3W07A 2OT0A 1LLZA 4BI6A 3W1UA 4ZQRA 3N14A 4HNVA 1VR6A 3NAVA 4IX0A 3CQ0A 3O07A 4O16A 4LV9A 5HUOA 3Q2DA 4AEOA 5CSSA 3SZ8A 3W75A 2YXGA 3GDMA 4AVFA 5FI8A 2J9YA 2JKEA 1TQJA 5AYZA 4TR9A 1YTEA 1W3NA 4GUHA 3NZRA 3QC3A 1I2OA 3MJYA 2QEZA 3UWVA 1D3GA 1WQ5A 4LRSA 1OFDA 1GPWA 4B5NA 4H3DA 4TO8A 2Y70A 2YYTA 5CGQA 4ZL1A 3ANYA 2DJLA 3G1DA 5G5IA 1TPFA 3S1UA 1TQXA 2CLLA 4UFHA 2WOQA 3SY5A 4FX8A 2WSYA 1ME7A 3QYQA 5CZTA 4ZVJA 1JVNA 3HO8A 3IVTA 1JUBA 4NX0A 5DLCA 4RX0A 1LP6A 4BI7A 2VEIA 4X22A 3NO5A 2QUVA 2RFGA 3W84A 1KW1A 5D04C 1R47A 5KZDA 4PFMA 4QITA 3BO9A 1JCYA 1QNVA 2A6LA 4DO6A 4K36A 3EWYA 2EGZA 4QNEA 5DY3A 1XBZA 3KAOA 2TSYA 1KFKA 4J9JA 3DH7A 1EWEA 2Z2UA 3Q37A 4QISA 3W2UA 1N7KA 3F03K 1ZY9A 1H1ZA 4LU0A 1SFJA 3IV3A 3LHYA 1QPNA 1UUOA 3L5MA 1DQWA 3QRHA 1PE1A 3O6DA 4WXZA 1TCDA 3BLEA 1GQNA 3T4CA 3W85A 3BVJA 4E0CA 4JTJA 1VYSX 3PM6A 4NNCA 4XBSA 5D03A 3W70A 4PC8A 3W6YA 3LTPA 2QCNA 4O8RA 4FNPA 1M7PA 1TPUA 2J9XA 4UC5A 5LNSA 1HG3A 4GUIA 4K6AA 3DXIA 1DJQA 1ME8A 3UY8A 3PBVA 1IIHA 3FYOA 1QCWA 2W79A 3DGRA 5C5YA 4FXRA 2HTMA 3NVTA 2VFGA 3P81A 4N4QA 2DZXA 1WAUA 3HJZA 3QPZA 3THAA 4N4PA 2H3BA 4LT9A 1V7YA 3G3DA 2HS8A 3CB8A 2OX1A 3PUDA 3K30A 3P8IA 2E6FA 2CLHA 3I65A 1P0NA 1YLVA 1W5PA 5DN1A 2NUXA 4Z1DA 3DFOA 1KBJA 1KTCA 2J88A 4NJIA 4LOCA 3H54A 2Q3OA 4JY9A 3UWUA 3HB9A 4EOUA 1NF7A 3LB0A 4JR5A 3IGXA 4XTIA 3UYCA 4AHQA 2QF7A 3MYOA 5K3VA 1G4SA 7TIMA 1K7EA 3G8EA 1JCNA 2YFOA 3IIOA 2CZEA 4AXKA 4PL2A 2ZZ6A 2YSWA 5D2XA 1YPIA 4UUIA 2VFDA 1LLWA 2RDWA 3DI1A 1H7PA 5D37A 4O0KA 3W7EA 4AMAA 4EF8A 4IJBA 2V9DA 3LBMA 1TPWA 5SWUA 2JBMA 2R8WA 1XBYA 4UFMA 4RJEA 4DPQA 1F73A 3S5NA 2ZQ0A 2H3DA 1KFCA 4QQ3A 4FXSA 4FNTA 5FEPA 2NXHA 4UFKA 3QJAA 3BARA 1LYXA 3GKAA 3HPXA 4WOZA 1U83A 4PODA 2Q8ZA 3NL2A 1VZWA 3G3MA 4K8HA 3U6WA 3ZWTA 2ZA3A 1Q6QA 2DP3A 2ZZ4A 4JYFA 1FWWA 4NQ1A 5CPMA 4WXYA 3LV6A 4FF7A 1T96A 3PB0A 2QJHA 2FDSA 3WJXA 4ML9A 4X3ZA 2JK2A 3CEUA 1EP2A 1K8ZA 2YFNA 1RD5A 2V5BA 2YW4A 1OFQA 1FY6A 1W31A 1BTMA 1HL2A 5AYYA 4QIUA 3MP5A 1VCVA 3KRZA 3BLFA 5AFDA 2PRMA 3G1XA 2PURA 3I68A 3OBKA 1ZALA 4UFLA 2WNQA 4NNBA 2A85A 1AL7A 3PVFA 3NPUA 3NQDA 2NX9A 1L6WA 1TRDA 1F74A 3KFTA 3SGZA 2BX7A 4X9SA 2WV8A 4K37A 5FF2A 2QCFA 4UTIA 1FWRA 3UZ5A 2PC4A 3M5YA 3EX2A 1IIGA 1GVQA 1YYAA 3S5OA 4XZ9A 4ZZ9A 3W7RA 3GXNA 2X2GA 1T8XA 5CZSA 4AAJA 2FB2A 1S3HA 3TSMA 3KVKA 4A2RA 1VCFA 3NZ1A 3ZS4A 3WFAA 2YCEA 4YMZA 4FB7A 2NZLA 1OVDA 2WSRA 4O1AA 1DOSA 4I9AA 2PE4A 3WJSA 2GVJA 3HGOA 3P60A 1FWNA 3GNNA 4A21A 5G4WA 4A2SA 2NWSA 3F1QA 4KKXA 3KRSA 2J24A 1VPXA 4NZFA 2C19A 4RZ5A 1SSGA 2DZUA 3TDFA 2AAMA 3E96A 1WYIA 5FEZA 1FX6A 3P80A 3OVRA 2QAFA 1SO6A 4CNNA 5BMWA 1TSIA 2DZPA 1KM2A 1Z41A 2GVGA 1KM6A 1ZFJA 4A22A 4AWTA 2E5CA 1Q6OA 2ATSA 4BWLA 1JRBA 1MXSA 3KHJA 3RFAA 2WNZA 2NXGA 3UXAA 3W1AA 1PCWA 5EA9A 3TC6A 1EP1A 3HMJG 3TNOA 1LRNA 3QMTA 3GR7A 3N2XA 3W1NA 3LHZA 5HWMA 3DZ1A 1OF8A 1OX6A 4OWGA 1SW7A 3LTYA 3L67A 2O7QA 5BRBA 1LZOA 3P84A 2Z6JA 3O15A 4CLMA 3B0UX 4N6EA 1PL9A 1W37A 3W7MA 1I2QA 3EKLA 3IIPA 3I7RA 3UZJA 3MUXA 2UV8G 1Q45A 4AB4A 3LLFA 5I3KA 4ZQPA 1LOLA 3LV5A 4QJ1A 3C3NA 2V5LA 4GUGA 4LY8A 3GDLA 3EXTA 2QJGA 3GYEA 5EPDA 4MFDA 3L68A 1YXDA 3A21A 4UTLA 2RHGA 1EUNA 1LRTA 5E1QA 4UTMA 2Q3RA 2QJIA 2FB3A 3EWUA 5L9FA 3IVSA 1KFJA 1EP3A 5J5RA 2VEMA 4KFPA 3N2MA 3R8RA 4FNRA 3W74A 3A24A 3RNDA 4K39A 5LHFA 4FNSA 3NM3A 3T7VA 1FWSA 5I3GA 1R2RA 4MFEA 1TTQA 4O17A 1FDYA 3LTSA 2QCCA 5CPLA 2YW3A 2QCEA 4Y9AA 4IXXA 1F6KA 5DELA 3NQEA 1QPOA 2DZTA 2BZNA 4NXSA 3MHUA 5I3JA 1GT8A 4BK9A 2RDTA 1I2RA 1KFLA 4JIPA 1W8SA 3W7QA 2E09A 1B57A 3V75A 5HWJA 2A7RA 1WOBA 4GRSA 3W1XA 1AW1A 3SR7A 1QDSA 4YXGA 3M6YA 3SSJA 1ML1A 2Y85A 2YZRA 1OFEA 2E1DA 2V2DA 1M5WA 1SPQA 3N3MA 3CIXA 3NPXA 1ME9A 4TIMA 5EKYA 3W7IA 1GVSA 2BTMA 3CWNA 2GUUA 2ZRXA 3O6YX 4ALDA 3FJ6A 3GZ3A 1P4CA 2X1RA 1S5TA 5DY2A 2X1TA 3LRMA 1AW2A 4GXMA 3VE7A 1L6SA 3TMQA 2V82A 1ZNNA 3M1ZA 2OMAA 5EYWA 4TX9A 2A7NA 3TSBA 5D32A 4WY0A 1EUAA 4Z1BA 1YPFA 2ZCGA 4JTHA 3S8HA 2WO5A 3W7JA 3W73A 3LXBA 1H7OA 1XDMA 3TCEA 3P67A 4UTHA 5LNUA 4MIMA 4QM1A 4O4VA 4EIVA 3IIXA 4LRTA 3TW6A 2C15A 3I6RA 3LXAA 4WY0B 3OVQA 2FPTA 1IXNA 5LGXA 4HSOA 1PHQA 2H6RA 3PBWA 4K38A 2TYSA 4UNKA 3B8DA 5HR6A 4POCA 1SW0A 1K8YA 4H4IA 2Y61A 5D30A 4RK8A 3FJLA 3GX9A 1UCWA 1I45A 2JGQA 1RPXA 1H7WA 3A5FA 4HSNA 4E2BA 1ZHAA 1W5OA 3E0IA 3KXQA 3TV8A 1R46A 1K7FA 3OG3A 1JCMP 1H50A 3B03A 3WJWA 1W0MA 3QZEA 3PB2A 2ZFAA 4YLWA 5DBUA 1EWDA 2V2HA 3TX9A 1FDZA 3EX1A 4IPIA 5C55A 2JKAA 3N73A 4TMCA 3FYPA 3HOJA 5D02A 3ZFHA 3GDKA 2Y63A 1RQEA 3IVUA 3HGRA 2VFEA 4Y96A 1OG0A 4HPJA 3TE9A 1ZAJA 4UR7A 5CZ0A 4RCXA 4OU1A 4XWUA 2ZRVA 3HPZA 4JTSA 3PF3A 2VELA 3TKFA 2YGYA 3PUOA 4JEQA 1ONRA 4UMCA 3JR2A 2QDGA 1N55A 2W0UA 1SZNA 4Z0JA 3RK8A 4NU7A 3LCFA 3MBDA 1UB3A 1TJPA 3I7SA 2B7QA 1KLYA 3M0ZA 3HG3A 3DFPA 2ZRYA 3W23A 2FFCA 2FIQA 3PG8A 2WPBA 1CW2A 1B9BA 4MZYA 3ABQA 3LM7A 1BWKA 4DEFA 1QFEA 3TXZA 3NYZA 4MJZA 3B04A 5K9DA 1X6UA 4AHOA 1D3HA 3M41A 4LUIA 4UXDA 2V0TA 3OIXA 1XUZA 2Y88A 3EXRA 4MY9A 5DXYA 4O1DA 3W88A 4JTLA 3C61A 4LWWA 4BF9A 3NL6A 2B7NA 4DO5A 3W2JA 5HNRA 3NQ6A 5D05A 4NX5A 4NXKA 5F2IA 1S5WA 3GVGA 2W6RA 2YPIA 1OYBA 1F2JA 3QQ0A 1O5XA 1LM1A 3UPWA 5HINA 5F4WA 1I2NA 3OEXA 3NDOA 2YYUA 4HNUA 3GLCA 1RVGA 1V5XA 3W7PA 1BKSA 1XDLA 4X2RA 1UASA 3C2VA 1FCVA 3C2FA 3DBPA 3H53A 3JRKA 3JS3A 3NQFA 3UPBA 3N34A 5LKYA 1TV5A 3G1FA 3W7NA 1T0OA 2CLEA 3MP4A 3PSVA 4LVFA 4S2CA 5LGZA 1GVRA 1EX5A 4ZMGA 3THQA 1H51A 2QCLA 3O05A 1WV2A 5AHNA 2FPVA 1HUVA 2EPHA 2ZBTA 3FOKA 1EA0A 2FQIA 3GNDA 3HQ1A 1JJKA 4R53A 4XKYA 4PEKA 4EVZA 2Q8LA 3S5YA 1M7OA 4L4LA 4M6VA 3NPVA 3S1XA 3NQ7A 3EX4A 1OX5A 4MZ8A 2RDUA 1LOQA 5AYXA 3SGUA 2DJXA 3TAOA 3W2LA 3TFCA 5K7JA 2FLIA 4N9EA 3BW2A 4YCOA 4I7VA 2E6AA 4IWWA 3LCXA 3O8AA 4Y6GA 4OQVA 2LLEA 3BG3A 4ICNA 4UTTC 2VXNA 4GJ1A 4NJKA 2CWNA 4S1FA 1Z44A 3FA5A 2QDHA 2QKFA 1GG0A 2CLOA 1J5TA 1VYPX 4XKYB 5K2ZA 2VOMA 4DBDA 5DCEA 3GDRA 3QQ1A 1I4NA 4O28A 3BW3A 2NXIA 3ZR4A 1L9WA 1N8FA 3LHWA 4IPJA 4FHAA 1YDNA 5DBTA 1X7FA 3SJ3A 4UFJA 3N9RA 4O54A 5LNRA 1SZGA 3O06A 1LROA 1QPQA 1LOSA 3GKFA 3M5XA 4PL1A 1SO5A 3WK1A 4TU1A 1M6JA 4OV9A 2H8XA 3GXTA 5FEWA 5BOOA 3W7GA 4GC4A 1YDOA 2B4GA 1W1ZA 1MEWA 4DO4A 3OA3A 1GOXA 3M43A 3NQCA 3M7WA 4LUJA 1KV8A 3TROA 1VYRA 3FS2A 4R33A 2ZA2A 5D2YA 5AC6A 3HG2A 4WUIA 3NNTA 4RXFA 5T26A 2ISWA 3RU6A 5EL1A 4NJHA 4R7JA 1NFBA 3LBCA 2NWRA 1P1XA 3VNDA 1TV8A 1R2SA 1XCFA 4IXHA 4Z1CA 1TV7A 3P74A 4NJJA 3W86A 1JUEA 4O10A 2RH9A 3KX6A 3E9AA 4LVGA 3DENA 5CG7A 1Z48A 1TPH1 4LS2A 3O63A 2XN0A 3R12A 3LHTA 3W2MA 4E38A 3R5EA 4UTJA 3NPWA 3STCA 1W3TA 3NR0A 4M5PA 5KSWA 1SO4A 1QO5A 1OX4A 4HT3A 1H62A 4JTKA 1KLZA 2V8ZA 3NQAA 3NL3A 3L5AA 3R2GA 1VQTA 4XTDA 1VJIA 5KMYA 4W9TA 4LC6A 4D2JA 3BGGA 3W71A 1L2UA 4NUWA 1TO3A 1FDJA 1H5YA 2QUTA 1W5MA 3LCLA 4OBTA 3PULA 3LHUA 5CSRA 5AHMA 4UR8A 2PRHA 2NV2A 3HPSA 4GUJA 2Z1BA 3ZWSA 3KVMA 1S5VA 1VHCA 1WXJA 4WZHA 4WQ6A 2HS6A 2ISSA 1KM3A 1VCGA 3VFLA 3UXDA 1B4KA 4JYEA 3NL5A 4FNQA 1SZFA 1X1ZA 1KBIA 3W1TA 3G0XA 2DZVA 5EMUA 1X8FA 4JXCA 3RF9A 1NF0A 3DFSA 3QF0A 1GTEA 3E02A 3U8GA 4FNUA 3NGJA 3QSRA 4JTFA 1H7NA 4CCEA 2DORA 3UD6A 3G1SA 3HGJA 2GQ8A 1TREA 5K9XA 1H60A 1MSSA 3BPWA 4UCGA 2BLEA 4C1LA 4L4MA 1OJXA 3QEZA 3LRLA 3MW7A 3QPYA 3PAJA 1PS9A 1DHPA 4M6QA 1TMHA 4HNNA 3W83A 3G0SA 3W2KA 3STEA 1ICSA 4LVDA 3M9YA 5F2GA 3T40A 3PWAA 2RKXA 4Q32A 1RV8A 3IIZA 3B0VC 1WBJA 4Z1AA 1KA9F 3L5LA 5E93A 1WX0A 2AGKA 2I1OA 2CLMA 1A5SA 4TMBA 2P10A 1AG1O 4RV8A 3PG9A 3TW7A 2B7OA 2Y89A 3LI0A 3ABSA 1XUUA 2CW6A 3W7HA 2JGYA 3G18A 5TBOA 4UIOA 3TIMA 3DFTA 4IMGA 5ABTA 1LCOA 2NUYA 4IMDA 1PHWA 2QCMA 5D38A 4DBEA 1EPXA 3B06A 3L0NA 3SFKA 1HO1A 3C56A 3EX3A 4IQLA 4JX6A 4U28A 4CNPA 3S42A 1DVJA 1DKWA 1NSJA 3CHVA 1J4EA 4Q33A 1OABA 3BV4A 3E12A 3W72A 2ZRWA 1YADA 3PSWA 5KZMA 4O19A 3NQ2A 4LVAA 3W76A 4OV4A 1OFAA 5CPNA 4DF1A 1FWTA 2A21A 1JRCA 4LS0A 4N2YA 4O13A 5D2VA 3C0JA 3W7CA 1UUMA 2EHHA 3RLVA 1G7VA 3ELFA 1KM4A 5HMSA 1DL3A 2CU0A 5BNKA 2CZDA 4P2VA 4U4MA 3W9ZA 2ABBA 4OGZA 1VRDA 1ALDA 3NM1A 3OVPA 3V1PA 1H61A 3QW3A 3R89A 3DFNA 3UNDA 1KTBA 3S0CA 4HKPA 1PCKA 3UWWA 5AC8A 4P61A 3R13A 5AC7A 1G6CA 5FF3A 2ALDA 4MYAA 4NJGA 5TIMA 2ZRZA 1I8JA 1H7XA 1HO4A 1SFLA 3IGSA 4KFOA 1GTHA 3USBA 4IOTA 3IRDA 1OYCA 5F2MA 2ZDRA 3G22A 4O11A 3T78A 3SI9A 1SR9A 4QNWA 1AW5A 2X30A 1CI1A 3T55A 4A29A 1F5ZA 1A5BA 2ISVA 1MO0A 3TQ0A 3W1PA 3TXVA 1SO3A 2VEKA 1JUKA 1SSDA 1ZJIA 3C2EA 2GJNA 3KOFA 3QM3A 3BW4A 4AWUA 4K8EA 3HF3A 3LOTA 3B05A 3UWYA 2ZZ2A 5AN7A 3VI2A 5EY5A 3LLDA 3EWBX 3O6CA 1ZAIA 4PTNA 6ALDA 4ZQCA 3PC0A 3W22A 2F84A 1BWLA 1I2PA 3CU2A 3YPIA 5F4SA 1H63A 4JDBA 2D73A 2VFHA 3WJZA 1QMLA 4WY0F 4AH7A 1FBAA 2V2CA 5DCDA 3A9IA 4OHQA 2R91A 1TJRA 4JIQA 3Q58A 4LVBA 3UWZA 1F76A 1VC4A 1O60A 3QSTA 2C0AA 4ZQMA 1RQBA 1KTNA 2DU2A 3LGEA 1W5QA 1GVFA 2GVLA 8TIMA 3C2RA 3WK0A 1H1YA 3W7OA 5I3HA 1YDVA 5HUPA 1PIIA 4OT7A 2NV1A 2BXVA 5D2TA 2B0MA 5D2WA 3W3OA 3TAKA 5F2LA 2FJKA 1IXOA 4BWLC 5BMXA 2E77A 3EKZA 1CX9A 2P0OA 4FIRA 4UTWA 4YCPA 2E5BA 5HQEA 2HMCA 1NVMA 5C6MA 2C6QA 3QMSA 1YXYA 3GAYA 3BK0A 3MMTA 2A1YA 1KM1A 4G1KA 1EB3A 4Z0SA 3GIYA 4GNJA 1VLWA 1G4PA 4MJMA 3NOEA 5LZLA 3TC7A 3STFA 4UNLA 1C9DA 3BLIA 2Y7GA 1R30A 4CQ8A 4IX2A 3C52A 5FESA 4MOZA 4NT0A 3RLUA 3GAKA 4FX6M 4HNTA 1Q6LA 3DU0A 1SW3A 4O0ZA 3LCIA 4JX5A 4O1BA 1K02A 5L6UA 3MI6A 3TQKA 4NNAA 3C8FA 4GBUA 2ATMA 5KINA 2X16A 3P8JA 1LBLA 3L2IA 3VCRA 1Q3NA 1KFBA 3MHGA 3C4UA 4M19A 1XFBA 3UY7A 5KZEA 4PH6A 5FEXA 3QMRA 5G4EA 4O12A 3T44A 5H91A 3AO0A 1KV5A 4MVAA 4LC8A 2GJLA 3MWAA 2GQAA 3HG4A 1A5AA 5LSMA 1AMKA 2ZZ7A 2GPTA 4KWVA 3U2OA 1NEYA 1LBFA 4ORIA 3EXSA 3FEMA 2A6NA 3MI3A 1XM3A 2C16A 4MLJA 5LNVA 4O1CA 1GVOA 1SQ7A 4HHPA 1D9EA 2WQPA 5AHIA 4CNOA 1DJNA 2NUWA 4AHPA 3LERA 3TK7A 3P62A 1GG1A 1QWGA 1JQVA 1A53A 4O52A 4ADSA 1JQXA 1UBSA 3P61A 4ORMA 4WX2A 2VEPA 2QCGA 1GEQA 1TRIA 3L0KA 2J9ZA 3CTLA 1W54A 2XFWA 1OYAA 3N19B 4LS1A 4BI5A 4YL2A 4RR4A 3G0UA 3LCWA 2ABAA 5AB3A 2CLIA 4LV4A 4XQ6A 1GYLA 4N9DA 1BEUA 3MO7A 3QFEA 4Y8FA 2DZWA 2C14A 3QW4B 1LORA 1P0KA 2C1HA 4KFNA 3TA6A 2O7SA 5K4ZA 4IMCA 4JS3A 3INPA 1ADOA 3W7KA 1R2TA 3M44A 3BG9A 1F05A 1TPEA 5A8GA 1A5CA 3HBLA 1K8XA 2A2IA 4QSHA 1DV7A 2CZ5A 4LTSA 2H90A 2GQ9A 1TPB1 3IIVA 3LCGA 3L65A 3O16A 4MY1A 2V81A 1A50A 2VC6A 2J27A 5HWNA 3EWZA 2I9EA 3STGA 1L6YA 3H55A 1WOAA 5G2WA 2Y7DA 4JTEA 1VLIA 1IGSA 4O53A 4RZ6A 1OK4A 2PCQA 2ZZ1A 4N02A 1XBXA 2XN2A 1OFPA 5CPOA 4O14A 2QCDA 4IMEA 3S1VA 1WA3A 3LRKA 1YTDA 1O94A 2FPYA 1HFBA 3ATYA 4JICA 2E6YA 1K7XA 3TFXA 4UTKA 2JKPA 2R94A 3LX9A 3W1LA 4ZQOA 2GOUA 3P7YA 1KFEA 1ZENA 1DBTA 2A4AA 4K7VA 4CCCA 3P82A 3TSDA 2CLFA 3CWOX 4WJEA 1OK6A 2C3ZA 1FQ0A 3PS7A 3F4NA 1G4EA 4NZJA 1ZCOA 4CQ9A 3GB6A 2QCDB 1RQHA 1EIXA 3EX6A 4UTWC 4DPPA 4IMFA 5TQLA 4NVTA 5H2ZA 3TUUA 4Z08A 2WNNA 1ICPA 5G1TA 5LNWA 1TTIA 4M7TA 4MPQA 3HGSA 1MZHA 3DKLA 3HG5A 3TR2A 3TQVA 4N9CA 3M47A 1C29A 1JCJA 3L66A 4HPXA 1YXCA 3FFSA 4MY8A 2KZHA 4O15A 3PY2A 5FF4A 4AWSA 3DAQA 5A5WA 5IBXA 5LHEA 5HJLA 1U5JA 1TPVA 1PV8A 2A7PA 1QO2A 4ADTA 1W56A 5KITA 3A22A 3W7LA 3VKJA 5I3FA 4JTUA 2CZFA 2VKZG 2QUUA 1TTPA 5CZJA 3SIZA 1LTDA 2Y6ZA 5DCBA 1GZGA 4S2BA 1IXPA 1WDWA 4Q4KA 2ZZ3A 4MZ1A 1OX4B 1DQXA 2TMDA 1C8VA 5CKSA
chains in the Genus database with same CATH superfamily
1IF2A 4JY8A 1KCXA 3CMFA 4TOQA 4H9VA 2W4MA 3S9YA 3WUGA 4FX7A 3W2WA 1QPRA 4N0RA 4GVGA 4BG0A 2DB4A 2PRLA 4FIQA 4UTUA 1FH8A 3APTA 1EEPA 1A0BA 3KS5A 2CCYA 3Q6NA 4J35A 4AMCA 4CU7A 1OGSA 2PLMA 4PZVA 2H7VC 1KXTA 3PZGA 1TWSA 4NAEA 3GBEA 1QKRA 3FOOA 2WKJA 3B71A 1QJWA 1BYBA 2D4UA 4H9TA 3PMRA 2YX0A 1EQ1A 3WG6A 1RAKA 5I3IA 4QE5A 1OFRA 4DJFA 2PWEA 1MUMA 1PWLA 4PEEA 4LCQA 4PMVA 2VB6A 3KM8A 5CLTA 4NAEB 5G2IA 1W2PA 1IW7F 4HQVA 2FGLA 3WBYA 3UZXA 1QOQA 5L0DA 1RP9A 1P43A 4YL3A 1G69A 2ZX8A 3CPRA 2QR6A 3E38A 1GKRA 4FXJA 3UU0A 1ZTVA 3AXMA 3V5XA 4YIWA 4JZ5A 2QIWA 5AOUA 5CH9A 2TPSA 3LS9A 4ONVA 2TRSA 4JTTA 1V0MA 1H0GA 3MHFA 1QNRA 2Y24A 4UMBA 4OOUA 1FUYA 2ICSA 2CESA 2XVLA 1WASA 1FP9A 3WH6A 2IKIA 3FA3A 3FKKA 1WBHA 4UMAA 1CBGA 1VOMA 2AQWA 4C91A 3DYPA 3W1QA 2VCAA 2R6OA 3ANUA 4M1RA 3K4WA 4GJIA 3ZR6A 4U3CA 2FJUB 1NJJA 3ZT5A 1Z42A 4X0RA 1AL8A 2NT0A 1E4MM 1D3CA 3W82A 3A3WA 2BHYA 2HRWA 3NQMA 4TV6A 4ZOAA 1D1CA 1NP0A 3BMVA 2BB0A 2J74A 1A0DA 4S3KA 3GTIA 5ABFA 4C1KA 1J6PA 3DAGA 3GTXA 2ZA1A 4Q5SF 1CTNA 2R05A 3C2OA 2WLYA 3IEEA 5I5RA 2YWAA 2WHMA 4BQ4A 1DORA 3SP1A 4WEVX 5FSDC 4R7OA 1TVLA 3S0XA 4JTGA 4OE7A 4PE8A 3MMWA 4NKCA 5HULA 4YWSA 2P88A 2L81A 3GUWA 2GWNA 3AWOA 2FVMA 1ZP4A 5MHBA 5ABFB 1KRMA 1QPUA 1VEOA 4JGDA 1UQZA 1H5VA 2P61A 2Z2AA 1TMLA 2VFFA 1QOXA 3NYJA 1UWUA 2ZXPA 4LEQA 4MKSA 3ITGA 3WD3A 3WODF 5FF7A 1QZXA 4QROA 1EOMA 1MQQA 2VR4A 4YPJA 1UC5A 3UFYA 2V30A 1W3IA 1BVNP 3RPTA 4C1NA 1I0BA 3A4AA 4U5KA 3MI2A 1UHVA 4F40A 4M24A 3TOYA 5IBXC 4JTIA 3OHIA 5DQZA 3TTYA 3CIWA 5K9CA 1ISYA 4XO6A 4HA1A 3FHQA 2LP4A 6XIAA 4Y90A 3UZZA 4GE8A 3N4FA 3PR2A 3V3WA 2R1MA 1JL8A 3PNUA 4KWWA 2VWSA 1Q65A 1V6XA 2CHNA 2J6XA 4MKNA 1TPC1 2VX7A 4TTGA 4M82A 2G97A 2VUYA 4Q4QA 1VGAA 4C1NB 3WEOA 1Q0GA 2PCEA 1GYNA 4JBRA 3DG6A 3KVJA 2WJFA 1Y6DA 1JR1A 4RKAA 1ZP3A 1HP5A 4JDYA 4WCJA 3W1RA 3QZCA 2J9UA 1NLXA 3HNLA 3Q67A 1H1NA 1F7BA 5FF0A 3FOPA 2Q9AA 4P7LA 3D6NA 1FTXA 4R9XA 4D6IA 1YARO 4PMUA 2HSQA 3GDTA 3M6DA 3SUUA 1UKPA 3HIJA 3MVTA 3ARUA 4MWAC 3QH2A 4U5BE 1G4TA 2VFIA 1CB2A 1JCLA 3BLLA 1TR2A 4EF9A 1C8XA 4GY1A 2Z25A 4JD4A 3MYPA 5I3DA 1O3UA 3ARVA 3SECA 3W07A 2OT0A 2BY2A 4BI6A 1JZ4A 1FR0A 2UY5A 3N14A 4Q22A 5LIUX 1VR6A 2A68F 2XIMA 3CQ0A 4O16A 1HKIA 1PO9A 4AEOA 3O10A 4G0HA 1B5TA 1KR0A 3M0KA 1QASA 3GDMA 3FNDA 1J0JA 3N17A 4OFCA 1DOWA 1UJQA 4TR9A 2BE5F 3V7PA 3NZRA 3QC3A 3MCMA 1G5AA 3GTHA 1E85A 1F07A 1WQ5A 2ZX9A 4LRSA 1XD1A 4V33A 1GPWA 3L4TA 2ZADA 2W91A 3WNLA 4H3DA 4TO8A 2YYTA 5CGQA 4ZL1A 2NG1A 5G5IA 3S1UA 1TQXA 4UFHA 2WOQA 4FX8A 1PIFA 3EWCA 4ZVJA 2R7VA 1JVNA 3HO8A 3IVTA 4ZXLA 3UESA 4NX0A 1KC7A 5DLCA 5JUVA 3PFMA 4RX0A 4GZJA 4F48A 4BI7A 2VEIA 3NO5A 1F61A 5D04C 5KZDA 5ECUA 4QITA 3BO9A 1JCYA 1QNVA 1XSIA 4DO6A 2V67A 4K36A 3NO3A 3RCNA 3G77A 4REQA 3S4TA 1OT2A 2CC0A 4J9JA 1E9LA 2P53A 2QPUA 4QISA 3W2UA 4DXKA 4E4PA 1N7KA 2ONEA 1ZY9A 3ZTMA 1SFJA 3GBDA 3IV3A 2VGBA 3W28A 1UUOA 3ITCA 1DQWA 3MKCA 6A3HA 2W3ZA 1HIZA 1TCDA 1V0KA 2XM1A 3C5QA 2W9MA 3BVJA 4D6GA 2XSBA 1VYSX 1LS4A 2IUZA 4REQB 4GI4A 4XBSA 2Y3HA 4PC8A 3VOCA 3LS0A 3LTPA 4O8RA 7PTDA 1BFNA 4W89A 1LLOA 4UC5A 1OGBA 1PTAA 4E4FA 2R03A 4ANJA 4GY0A 4XIAA 1DJQA 3FCPA 4KRUA 1H9GA 2C7FA 2GGJA 1IIHA 3C18A 4O79A 4BQ3A 3ITLA 3FYOA 3DGRA 3THDA 4FXRA 3EYPA 4HZ8A 5IOBA 2VCBA 2YXXA 3A3HA 2PBEA 2DZXA 3QPZA 3H22A 1MRQA 3RLHA 4PMXA 3O6AA 3UGVA 2OX1A 3ALGA 3P8IA 3JYHA 3I65A 1P0NA 1FWJC 3UCQA 3QW1A 5EMLA 5EB8A 3L12A 2NUXA 3U0HA 4AD1A 3KH2A 3DFOA 1JNEA 3MANA 2J88A 3H54A 2P6VA 2Q3OA 5HPOA 3O7UA 3GVRA 4KPLA 2CW0F 1NU9C 4K8GA 2WKGA 4XTIA 3MYOA 3CH0A 2O4MA 5K3VA 1G4SA 4A8RA 1B9ZA 1JCNA 2YFOA 1QUMA 2CZEA 4IGMA 3ISIX 2DYSC 4AXKA 3VKCA 5EFFA 1LE4A 3GD6A 2QVNA 1APCA 3BZJA 4F79A 4UZSA 3KZPA 2WMHA 3WQPA 1M41A 5L0IA 2OZ3A 3ONBA 4GYPC 3U48A 3KPHA 4AYGA 3LBMA 1NOWA 3UZYA 4UFMA 1ZVZA 4RJEA 4W8AA 1L6FA 3K1GA 3BL3A 2EPLX 2Q01A 3TK0A 4FXSA 4K1WA 4FNTA 2IXVA 1RLDA 5I03A 2D1ZA 3O0FA 1UR2A 4CNUA 3DFHA 3NDZA 4OINF 4D1IA 3UG3A 4C5YA 1QNSA 3N6QA 1A3WA 2VI0A 1UOZA 2DIEA 3ZWTA 4H6RA 4I1OB 2DP3A 2ZZ4A 4QE1A 1QTWA 5CPMA 3FAJA 2R1PA 4WXYA 4FF7A 1JAKA 1YAUO 4X3ZA 4AX7A 3UCCA 3CEUA 1S2WA 3IJIA 1T6IA 1V6YA 5M1TA 1RALA 5FACA 1W31A 1T6QA 1V55C 5AYYA 3LK6A 2NSXA 3SFWA 2XFRA 2G4JA 4Z17A 3I68A 5EMYA 1AQHA 1XIHA 1TWIA 5DEZA 3M4HA 3L2MA 1AL7A 1W6TA 4ML4A 1TRDA 4DAFA 1AD4A 3SGZA 3TYEA 2QCFA 4XZBA 2OB3A 3W38A 1X6NA 3PCVA 2O9RA 1V3HA 3M5YA 5CJMA 1KRCC 1E40A 5I78A 2WNWA 3EX2A 2DH3A 4JJFA 1YYAA 3S5OA 5CSUA 3F5LA 4ZZ9A 2XGBA 3W7RA 1HY5A 1T8XA 5DF0A 4A2RA 1VCFA 2VR2A 3WFAA 3KBWA 4IP7A 4WJ8A 3I4UA 4PYSA 1NSGB 1OVDA 3MY9A 3AYTA 2GGEA 4O1AA 1DWIM 1XSKA 2YBUA 5CGTA 4A21A 3GWLA 3F1QA 4F9JA 4CSAA 4KKXA 5DT7A 3KRSA 1VPXA 3ANVA 3GEEA 2C19A 1F3EA 1RKCA 1FHVA 1WATA 1WYIA 5FEZA 2I9UA 5BU6A 3URBA 4Y9PA 4CNNA 1MDLA 1TSIA 4H7VA 1Z41A 4P6IC 1KM6A 5TD4A 2ATSA 4LERA 1J8MF 2WNZA 2NXGA 3Q7LA 1CXEA 3H70A 1OCJA 3W1AA 5EA9A 4U5GA 4CS8C 2F6XA 1EP1A 3TC6A 3TNOA 4ZOBA 3G5EA 5BQGA 4XG1A 1OF8A 3GXIA 1OX6A 4NI8A 4XAPA 1SW7A 3LTYA 3XINA 2O7QA 5BRBA 3VIPA 1Q8AA 3O15A 3B0UX 3S83A 3UEQA 3DXJF 1W37A 1FHDA 1PAMA 3EKLA 2Z4GA 1K77A 3CWHA 3IIPA 1JYXA 1Q45A 4AB4A 2WZGA 3AS3A 4ZQPA 2KX9A 4YN5A 2V5LA 2V6AA 1GOIA 2A3CA 3EXTA 1UA7A 2PFDA 3GYEA 4HFFB 1KQYA 4MFDA 2VTFA 4H2CA 1NOFA 2QXWA 1LQ2A 4QEHA 5E1QA 3EOLA 5L9FA 1KFJA 1GVIA 5BQIA 4FNRA 3W74A 4KS0A 3JU2A 1NZEA 5TJ5E 4C6BA 2QS8A 1FWSA 3AGTA 1BYAA 3CAQA 4QR6A 2Z24A 1BXNA 3BCDA 3LTSA 2O9TA 2QCCA 1PJ9A 5CI8A 1J0KA 4IXXA 2EQDA 2QYGA 2XGZA 5JXQA 4F2TA 3EGDA 3CL8A 3NQEA 4LB3A 3EOSA 3LAYA 3EZ4A 5I3JA 4BK9A 3LSBA 4AY7A 4ZGYA 1WDSA 3H4XA 4M80A 1I2RA 1FOBA 1DIKA 2PX0A 2E09A 4WR3A 2AKZA 1AW1A 3SR7A 3GM8A 2Y85A 2Y8UA 2VC9A 2GJRA 3RKOF 1F8MA 3DM9B 1M5WA 1PBGA 2BASA 3N3MA 4IIDA 3M0XA 3CWNA 3EGDB 2JF6A 2HNEA 8XIMA 5D8ZA 4GYFA 3N24A 3LYEA 2X42A 3FHAA 4GZ7A 3FJ6A 4HA3A 2I57A 1P4CA 1V3JA 1K9TA 1A49A 2DUZA 1MXDA 4GXMA 2QGYA 3SQLA 3HNIA 3VM7A 3VUPA 4A4AA 4TX9A 2Z1KA 5IHRA 1CYGA 2ESCA 4EAYA 1HJQA 4WY0A 3ARWA 3K8MA 5CBJA 1OIMA 1RK5A 4KEZA 4QJ5B 4W8PA 1E4LA 3LLXA 2PFHA 3W73A 3LXBA 4DRJB 5ABEA 3QTPA 4UTHA 4IMAA 3CHDA 3H2VA 3VNJA 3IIXA 4LRTA 3I6RA 3LXAA 1WO2A 4A6GA 4WY0B 3CB3A 3OVQA 1IXNA 5HR6A 1UUQA 1K8YA 2Y61A 2F2HA 2PDPA 2J0WA 1TCMA 1EEXA 1RPXA 5KEZA 1AJ2A 1E55A 4CN4A 2XL6A 3KXQA 3FXGA 1Z32X 3PHAA 4IRUA 1AQ0A 5FOOA 1X1NA 1JFHA 3QZEA 4L4OA 4PMJA 3TX9A 4IPIA 2JKAA 4TMCA 2XRHA 3FYPA 3ITXA 4U3AA 3W53A 5HA7A 4JPGA 1RUSA 3T6JA 2VFEA 3FXYA 1OG0A 4UR7A 1HVXA 4AZHA 4RCXA 1GZ1A 2J78A 5JT4A 4Q7IA 4MVMA 1NG1A 1LUCA 3II1A 2XH0A 3VM6A 2ZRVA 3TKFA 2YGYA 1ZBKA 3EDKA 3WAQA 3RYLA 2QDGA 1N55A 2W0UA 3VTRA 4BZYA 2BBFA 2C8NA 5EGRA 1QVXA 3BDKA 1PKNA 1UB3A 1TJPA 2B7QA 4CN1A 2XM2A 1TWDA 4L5ZA 4KCWA 5BXPA 2IXPA 3AUJA 1CGNA 4DLMA 5LIXX 5KYWA 2FFCA 1KBLA 3TTSA 4FOJA 1LUCB 1B9BA 2GK1A 2W63A 3W4RA 4AIEA 5CPQA 3LM7A 3TWBA 4DEFA 2HE8A 1VKFA 3TXZA 4EACA 3N3TA 5K9DA 4D6DA 1D3HA 4LUIA 4UXDA 3K66A 4N4WA 4MY9A 2D3NA 4FX5A 2MWQA 3M15A 4JTLA 1I9CB 1W17A 3IJLA 1XHGA 5CAHA 1B1YA 4DO5A 4EKJA 1V6WA 1BKHA 4WDTA 5KYWB 2WL8A 4NXKA 3A6OA 2GK1B 3M4CA 1OXKA 4UQ9A 4NAFA 4IHCA 5CQ1A 3QQ0A 4PCSA 5HINA 3ITYA 4KBXA 4MWAD 3VOIA 3OEXA 4L9ZA 1AH4A 1BXCA 4HNUA 3L8IA 3GLCA 3S84A 1EZWA 1BKSA 1NM9A 2W4BA 2Q02A 4JEJA 1NWTA 4LAZA 3VNYA 3NSMA 4LALA 3AXIA 4IL2A 1GKPA 1L2QA 5ABHA 4IQJA 3OLIA 3VK5A 9CGTA 3MP4A 4TXEA 4LVFA 4S2CA 5LGZA 1ZQ5A 4NAFB 5DO8A 4ZMGA 1MI3A 4ATLA 5B80A 2VZTA 5AHNA 4K1OA 5DMNA 4GMEA 4R53A 1JJKA 1NDWA 2ZC1A 1B68A 2XTKA 1E5JA 4XKYA 4PEKA 2FYMA 2GDUA 4ICMA 2W5FA 5LXEA 1OX5A 2DVXA 4Y8EA 3I6TA 4GHRA 4XVDA 3SGUA 2DJXA 5M3WA 4LSBA 3TFCA 3NG1A 3D47A 1J6OA 2ZE3A 2HK0A 1UIPA 3VIJA 3LCXA 3I4KA 3O8AA 4Y6GA 3ITFA 4FF5A 1TV3A 3ZVHA 3I4EA 1OGGA 1Z44A 3CQJA 4DRHB 2QDHA 2AWCA 4XKYB 4WLCA 5K2ZA 4DBDA 3OZMA 3AZTA 5AGFA 2G37A 4E2OA 4FHAA 1YDNA 5DBTA 1SR2A 1XZQA 4DJ9A 5B3SC 1ZCCA 1XLEA 1RSCA 1SZGA 1QPQA 3L2LA 3CPUA 3S1GA 1XGDA 4PL1A 3MYFA 3HA1A 3EJNA 3N0TA 3WK1A 4OV9A 4BEJA 3WLNA 3ZVHB 2OU6A 2IKGA 4GC4A 1MFVA 1W1ZA 2BXYA 1D8WA 1TZ7A 4QS5A 3UERA 3VIMA 2CETA 1RK6A 1UWTA 5C2CA 5DRIA 1VYRA 3PUGA 5D2YA 4ZSUA 3ZQYA 1QWKA 1DPMA 4NJHA 3KWXA 1LT7A 4KC9A 3IV8A 1NFBA 3LBCA 5LIKX 1S5MA 1MYRA 1TV8A 1XCFA 1RLCL 4Z1CA 3RM9A 4IM4A 3GG7A 1Q7QA 1K70A 4W85A 4LVGA 5D9NA 2PF8A 3BSMA 5CG7A 2BGNE 3UBPC 1Z48A 3QC0A 1TPH1 1H9TA 3WUBA 3O63A 3R1ZA 1JXKA 2XN0A 1QRQA 3ZG1A 4S3DA 2ZXAA 3W2MA 2ZE0A 1HN1A 4TX6A 3NPWA 4Y7EA 3SN4A 4FESA 1XLAA 5KSWA 1SO4A 4H4KC 2NQHA 2V8ZA 2AQOA 1I60A 4ASTA 3L5AA 1Z8AA 3DJUB 1RHCA 3GVVA 2GGGA 1VJIA 4JIRA 4LAUA 4D2JA 3S9IA 3BOFA 3BGGA 3SM0A 3C86A 1KCZA 3SY1A 5FL1A 2CHOA 1NQKA 5C9XA 1TO3A 1R5YA 1HXJA 4UWMA 3UR3C 1HJXA 1TFKB 4XZMX 1EOKA 4OBTA 3V0UA 2AU5A 1BG9A 3LHUA 3T42A 4W8LA 2PRHA 1S5VA 3NDBB 5A2AA 5T9BG 4CCZA 3KCLA 1EJWC 2ZUUA 1AH3A 4IT1A 1ZHTA 1BYCA 3H7UA 3RVZA 4JYEA 5JBDA 1UWAA 4CIPA 1W9XA 1KGUA 2C1GA 4D6CA 3FDQA 1E4IA 3U2ZA 2DZVA 4F2UA 3TW9A 3EOEA 1NF0A 4FNUA 1XIDA 4JTFA 3ZLFA 2DORA 3K33A 2DT1A 1TREA 1V74B 4XZWA 3QMKA 3QOMA 4DLFA 3MBGA 5CBIA 3VO0A 1H60A 4MWAA 4B15A 4UCGA 2BLEA 4UOJA 3LRLA 2PP1A 4AE4A 4BJ6C 2QIIA 4M6QA 2V3GA 4AZIA 5J04A 1ICSA 2ZXQA 3T40A 3U7VA 4X2PA 4KEUA 2NT1A 2F6KA 1ITCA 2WMJA 3T08A 1B31A 3FVDA 2WYSA 3T0TA 3L5LA 5E93A 4JIOA 3RLGA 4MWAB 1C91A 3N6JA 1LL6A 5F5FA 3TR9A 2PI6A 3PG9A 4AE4B 2L6GA 4Q8QA 3LI0A 2Y89A 1FHLA 3LJBA 2ZXBA 3W7HA 2JGYA 3EMZA 3G18A 4J7RA 3TIMA 4LXFA 1F6YA 3LD5A 5ABTA 2YL6A 1PHWA 2QCMA 4BHYA 1KBKA 3EH1A 1D0YA 1EPXA 3NYLA 3L0NA 4DJDC 3AISA 3ZJ7A 2CDQA 3HPAA 3GWQA 2D3LA 2PDLA 1M2OA 1XDJA 3CHVA 5C70A 3SN1A 3E12A 4PK4A 3L23A 5KZMA 3G6MA 4LVAA 1TX2A 4EX4A 1JRCA 3AHZA 4LS0A 5A8PA 4EP8C 3AS1A 3RILA 1UUMA 2G3FA 3HKKA 1CT5A 3OIHA 5HMSA 2IXMA 4U4MA 4Q8MA 2XLHA 2WZFA 3OVPA 3H4GA 3Q7GA 3HJEA 1H61A 1R8LA 3F47A 1AD1A 3CZ8A 1KTBA 2Y2WA 3VGFA 3B0YA 1PCKA 3BJFA 2Q7RA 2W45A 2OTDA 5AC8A 3OOQA 1ZW2A 1VJSA 5FF3A 4MYAA 4G7FA 1UROA 4KFOA 4D72A 1M53A 4LAKA 4NSBA 4XKMA 1CGWA 4DI8A 5F2MA 3T78A 1EA8A 4QNWA 1WOLA 2X30A 5CPTA 2WWCA 3BOXA 4DNHA 1F5ZA 2ZXWC 3GH7A 4AZ5A 3TXVA 4MF4A 5JBFA 2VEKA 1ZJIA 4Q4RA 3LOTA 3B05A 3AIVA 1XGZA 4LAOA 2UUHA 3VI2A 5A94A 3LLDA 1XWJA 2D23A 4PTNA 1E6SM 6ALDA 2PDKA 3KL3A 4WK9A 3H7RA 3CU2A 3NCOA 1XG4A 4DZHA 3LLKA 4GXWA 4DM1A 3YPIA 3SAZA 2WBKA 2C0HA 1CNVA 4CEUC 4WY0F 1FFRA 1FBAA 1KKRA 3U2EA 5JUAA 3CYVA 1EYWA 1TFVA 2R91A 3BANA 1TJRA 1EHNA 4JIQA 3S2NA 3C62A 3WMSA 3VOJA 1S2CA 1O60A 5T91A 1ISZA 3L4UA 4PBGA 3MCOA 4MADA 2Y8KA 2GVLA 3T8QA 3MX3A 4UR9A 3ITVA 4JFUA 4CD8A 3J7HA 3F5KA 2OYLA 4GYPA 3TN5A 4AX2A 1YDVA 5HUPA 1PIIA 2NV1A 4S3AA 5IHSA 4GCXA 1R87A 1RXQA 3W3OA 3TAKA 1IXOA 4BWLC 1IQ8A 2E77A 5BMXA 3SRDA 2WW5A 1JPMA 3GU1A 2VZSA 1NVMA 1OY0A 4I44A 3QMSA 1YXYA 2KW3C 3GAYA 3MMTA 4MNMA 4DBUA 2DDXA 3K1IC 1TWWA 4Z0SA 1JAFA 3RH3A 3SCNA 3AU6A 2FH8A 3QR0A 4E8DA 3TA9A 3T2QA 1V3KA 4XD4A 2OEXA 5KYYA 3STFA 4IFRA 3IGHX 2O4QA 1C9DA 5BXSA 3KP0A 3BOLA 3EA1A 4Y9OA 4H9UA 1YA7O 1Q6LA 3DU0A 4HJWA 4O0ZA 2J25A 4OJYA 1U0BB 1G94A 3C7JA 4Z42C 3B8SA 4URIA 1DE6A 3JVAA 2CXEA 2WBGA 4H9ZA 5KYYB 1OT1A 3MHGA 4GBDA 5HSWA 1BRLA 5E70A 3VC6A 4XK2A 4ONSA 3MWAA 1HKJA 2GQAA 4C6CA 1SZIA 1UD4A 1A5AA 2JEPA 4CJGA 4J3VA 4KESA 2DSZA 5HQLA 2DEPA 1XQLA 2GPTA 3NEHA 3QBUA 4KWVA 5HNNA 1W1A1 3L1MA 1LBFA 3EXSA 1C3FA 3M0JA 4IQDA 4QJ4B 5JMUA 4HMEA 4BY3A 1BRLB 3W27A 4RE4A 1TQGA 4MUPA 3DKAA 1D9EA 4JTRA 2EPOA 4JCLA 4QCFA 5FJPA 4L6HA 1U1UA 3KZSA 3BE7A 3QQWA 1KQZA 3X2QC 2NUWA 4AHPA 2OVLA 3P62A 3WFLA 5A2CA 1Y7VA 3PTMA 4O52A 4JIIX 4XAYA 1BSLA 2DT3A 2ICWG 3BRJA 4W7WA 3C3UA 3SCOA 1F4AA 1OYAA 1W9PA 4LCSA 4CS8A 2ABAA 5AB3A 2ACRA 2OO0A 1XPYA 2VRJA 1MUCA 4LQ1A 2DQXA 1CGYA 3QW4B 3WFZA 4GOAA 2C1HA 4AFYA 2X7WA 5K4ZA 4JS3A 1ADOA 3WD0A 3R11A 1NBBA 2IXUA 4US6A 1R2TA 4RD9A 3BG9A 1F05A 4GPNA 3HBLA 5BZAA 1BBHA 1W2WA 2I17A 4ULWA 2OWXA 3UCDA 1E4NA 4L56A 4IFOA 2HSBA 1J9YA 3IIVA 3M79A 2BFGA 3LCGA 3GW0A 1A50A 4D4NA 1VIWA 2QZRA 2EJ1A 3H55A 5G2WA 4LDRA 4C6PA 1VLIA 4HTYA 4RZ6A 3DHUA 1OINA 3NKEA 2I8BA 3CAWA 4HSHA 4YL1A 1GONA 2J77A 3VCNA 1Z7Qc 5CPOA 2XIIA 4HNLA 4C6QA 3E9VA 4MVUA 1IEWA 3P2VA 1VFSA 4UTKA 2E6YA 1K7XA 4UB9A 2JKPA 2OLHA 2DUAA 3P7YA 1KFEA 3ZLHA 4JN8A 1YBQA 2QUNA 4K7VA 3LQGA 1X6LA 2O56A 2CERA 2CLFA 3CWOX 4HYRA 1PX3A 4TVCA 4PULA 4K3ZA 2AL1A 1RQHA 5B1BC 1EIXA 3SXMA 4UTWC 2VRKA 4DPPA 5I00A 4NVTA 3R79A 1NFGA 3VOGA 3TUUA 2WNNA 4EBBA 3AMGA 5JU6A 5D9PA 1EFZA 1YBQB 1QHOA 4M7TA 2J8FA 4MPQA 1PXGA 3HGSA 4IGNA 1MZHA 2J0XA 1TE1A 3TQVA 1UG6A 3GC2A 1U30A 1Q2RA 1CGUA 3JRTA 4UDVA 2YHSA 2ASHA 3WNNA 2PTWA 5A5WA 4LCRA 2A7PA 2G62A 3F2DA 3B9QA 5KITA 3A22A 3W7LA 3BAJA 1N82A 3VKJA 2QUUA 3CUGA 3SIZA 4QTGA 2ZPAA 3JCUQ 3LZ5A 1OX4B 2TMDA 3UMIA 2Y7EA 3SZRA 4OVXA 2FTPA 3RITA 1PV3A 1KNYA 3MDWA 3UGRA 1X7IA 4N9BA 1LWJA 2DZSA 4V1XA 4XAGA 2IW0A 3MBFA 4H8UA 2OYMA 1TPDA 3LHVA 2OODA 5C9ZA 3LCHA 3NQ8A 3ZVRA 4JN6A 1H11A 4DUWA 4EWJA 2Y7FA 1CPQA 2WHKA 2PLKA 1J96A 3KLKA 4CQAA 2UWFA 1CLKA 3O1NA 4A3UA 2E6DA 3FKRA 3IJ9A 4H6EA 2VR5A 2J75A 3VZZA 2VD9A 1KWGA 1DTNA 3CLMA 3VX0A 5T8GA 4PMOA 2QJJA 1RBLA 3PPFA 4EHPA 3R25A 4HCLA 3KP1A 3DHFA 5CAKA 1XXXA 3G6LA 1ZHWA 1XIGA 3TOPA 3KHDA 3EAUA 2D2OA 3SCUA 1JOGA 4X0NA 1XBVA 3LXCA 5A6AA 4WJ0A 5CG0A 5CCZA 4BJ5A 1VBUA 4PRTA 3RO6A 4AC7C 3VCCA 4R5EA 3GC4A 4J5NA 3TMLA 1B0IA 1KM0A 4RL3A 4I7UA 4V2XA 5F1UA 3PZOA 3ZLGA 3WN6A 2NX3A 3WEZA 2P0NA 4JQ3A 1D7KA 3W7DA 3CS2A 8CGTA 3EB2A 2GWGA 2PNOA 3TYAA 2VT0A 3ITTA 3GM2A 1HW6A 4JYDA 3E49A 3D5HA 3UWQA 4GH3A 4U31A 1XLLA 1ZHZA 2RJGA 4MSSA 4FEZA 4ROQA 3OJGA 1W1B1 5AHEA 2J7GA 2EAWA 5AHLA 1WZMA 1WKDA 4PUJA 5B3IA 2XU2A 4R34A 4H7ZA 2IBFA 3MP3A 1OD0A 2XXAA 6TIMA 1OFBA 1TIWA 2GSJA 3S5ZA 1W32A 1EXPA 4MJ2A 4DYKA 2FTYA 3EOUA 4ZODA 2QTVA 6ENLA 3U4FA 5HJYA 1MQPA 4LY4A 1WZKA 1AK5A 3IGUA 3Q94A 4AG0A 2OOGA 2HSAA 3NXLA 3QLLA 4JX4A 3NEVA 4DNMA 2F38A 4LNYA 5EBAA 4LW7A 2ZYFA 3PBUA 5IY5C 1M9HA 2WZTA 4V28A 1XYFA 2XXAB 1XL9A 1Q6EA 4AZ7A 3RQFA 3NJ3A 1P5BA 3VMNA 3B0PA 1G0CA 2W67A 1F3XA 2ZRUA 4OTKA 1XKYA 4I5XA 3JZUA 2FHBA 1FHUA 3TEVA 3ASNC 4BF7A 3TU9A 3P14A 4W87A 3UJFA 4A35A 4NTFA 5A69A 4JC7A 4LYPA 1FWCC 1OF6A 3G1AA 3WK3A 4N6FA 4F3HA 2BY0A 4PRRA 3MUAA 5GQBA 4M6PA 4QI0A 4A3RA 4EPEC 2VC5A 1EL3A 5T1DB 2Z6IA 3FIGA 1LRQA 4J3TA 1RR2A 1T99A 3EEGA 4DELA 1OCNA 1UD8A 2G95A 1SU5A 3SURA 1UKSA 3F7JA 5DMMA 4DJDD 3Q4DA 1W1IE 1ICQA 2J7PD 3KVLA 3NZPA 1Y5XA 1A0EA 3CC1A 1XC4A 4EWND 2VVSA 1AUSL 4Q7CA 2A5HA 9RUBA 2PF4E 1NTHA 5D33A 3MS8A 3EDJA 4YVVA 4H2HA 1JULA 2WQDA 2XS8A 3IEBA 1G8XA 2IPJA 1Z23A 2C18A 3EWXA 3PBYA 1I5NA 4MLRA 4RXGA 3I5PA 3LEPA 5BWAA 4ADUA 4E8GA 4DVZA 1AVAA 5G1YA 1G67A 2X1UA 1XCXA 5COMA 5ABGA 1HTIA 3ASOC 4RW3A 2HXTA 1FCQA 4PMNA 2Y62A 4JNZA 4HOZA 4C6FA 2XHYA 1RD6A 4M63A 2BVWA 1PKMA 4JZAA 3GNXA 3MWCA 2Z0IA 2KGOA 1TB3A 4WGHA 2JF7A 3DUGA 2P3ZA 1BPLB 3CEPA 4Q3MA 3M4BA 1V0LA 3W87A 4LB4A 4DQWA 2J47A 1NU7D 1JCXA 2IS7A 4GO8A 3VFCA 2XPKA 1GW1A 1LLZA 2JX0A 3RRXA 2P76A 4ZQRA 3AHTA 4IGSA 4NY2A 3KOZA 3EDEA 5HUOA 3Q2DA 1DJYA 4GIYA 2WANA 1UH3A 2YXGA 4CJOA 5CZKA 1QI5A 4U5FE 5FI8A 6XIMA 2ZDSA 1W3NA 3SCQA 2YA0A 1I2OA 3C0QA 4J3WA 3BH4A 5E6YA 2BVDA 4LLEA 3I3BA 4R3UA 4B5NA 2XM0A 1E3XA 2D2JA 1YQ2A 2DYRC 2PDBA 3AIBA 3ANYA 1TPFA 3SY5A 4US5D 3QYQA 3H4WA 3RQGA 3EDFA 1M56C 1VTMP 4TUFA 1LP6A 3RCYA 5EFDA 1FWIC 2QUVA 2WMFA 1R47A 3LY0A 4CGTA 3H2MA 2O9PA 3G4XA 2GGIA 4FP1A 4D9PA 3U3FA 5DY3A 3PWGA 2GWWA 3AIRA 4KCUA 1KFKA 2R1LA 4GQBA 1EWEA 2Z2UA 3Q37A 2QLYA 1CZ1A 1H1ZA 4LU0A 4AK9A 1KRBC 1MFUA 3LENA 2X8RA 5GPGB 1XIJA 1YIXA 3W81A 3H7VA 3B8VA 2BOFX 3BLEA 1GQNA 1J79A 1OCRC 3T4CA 1OSEA 3MTWA 3ECSA 3T2OA 2PUZA 3ZJ6A 1FTSA 1DIEA 5D03A 3PHF2 2CBUA 3W70A 4FNPA 2ZOXA 3THUA 2PDCA 2DSKA 5LNSA 3U8VA 3FK4A 4GUIA 4Q4PA 4MTVA 1ME8A 1MW1A 1G01A 3QGAC 2H9AA 2GUYA 4BF5A 3CUXA 3AQCA 5BU9A 2HZ8A 3A4XA 2VFGA 3P81A 5HOSA 5E0CA 4LDKA 1WAUA 3HJZA 3LNRA 3R0UA 1EPVA 2H3BA 1V7YA 3G3DA 2V38A 4J3UA 3PUDA 3LESA 3O9NA 5D92A 2EPMX 2FTWA 3ABZA 5DN1A 1Z9AA 5XINA 4D8LA 2H9AB 2NUPA 1KTCA 4NJIA 4LOCA 3WF2A 1GQJA 3GEHA 1LWHA 4JY9A 3UWUA 3HB9A 1V93A 4EOUA 4UQBA 1Q66A 4JR5A 3IGXA 3SXKA 4AHQA 4YTSA 4DJDA 5AVHA 2J7PA 3IPMO 3TONA 4YTUA 3AC0A 1UWIA 4PL2A 2GVEA 7ODCA 2E87A 4W86A 1HZYA 1B3VA 3TTEA 2NUPB 1K40A 1R3SA 1KU2A 1VLTA 4DM2A 3H2UA 2WHJA 4PACA 2QJNA 2V9DA 3CBWA 3IACA 2PDHA 2HS5A 2JBMA 1OKKD 2CITA 4HOWA 3WQ8A 1XINA 4V27A 3S5NA 4PUDA 5BROA 3N13A 1KFCA 3WMLA 3SYNA 2NXHA 3Q45A 5JH2A 3QZ6A 1LYXA 1U83A 4PODA 1CWYA 1Q6QA 2DI3A 5FJIA 4A8IA 4CUCA 5I0DA 1XIFA 4MQ9F 4NQ1A 3FAPB 1HW2A 1SMDA 1Q0FA 1E1EA 1ITQA 2FDSA 3PB0A 2D0GA 4I5RA 3WJXA 1D0ZA 5EHHA 5E0FA 2BODX 1EP2A 4CD5A 3B40A 2YFNA 2G8ZA 3GIPA 1WKFA 4NQFA 1E86A 1CB7B 4V15A 3KRZA 4J4KA 1TKNA 3E5BA 1BXBA 2PRMA 3HQPA 4UFLA 4NNBA 1HKKA 2DW7A 4EE9A 3UA4A 1HJVA 3PVFA 3NQDA 2NX9A 2GDCA 3W4YA 4ZFCA 1F74A 1BQGA 2BX7A 4C7GA 4MDPA 2WV8A 1TWCA 4MVZA 4K37A 5D8WA 2PDFA 3UZ5A 2WCSA 2ZUTA 2IKJA 1CIUA 3QKZA 2X2GA 2AGTA 3CUJA 1DQUA 3QXBA 3U3BA 1S3HA 4DBRA 4US5A 2CPUA 2PDIA 3V5YA 4YMZA 1OADA 1UIOA 1I4YA 4GKLA 3SCWA 2WSRA 1C93A 2YCJA 1CGVA 4L9XA 5F5HA 1J0YA 3GNNA 4A2SA 2NV9A 1EBHA 1AVOB 4P7OA 4K7BA 4NZFA 2WMGA 1J5SA 3ZIBA 2DZUA 3E96A 3URQA 3QHMA 3P80A 2QAFA 2DZPA 1ZFJA 4BWLA 1EXBA 3KHJA 4FI4A 1AEPA 3AOUA 4Y2WA 4GA8A 3B8WA 2LSEA 4DXWA 1JZ2A 1OCBA 1EDTA 1US2A 3GR7A 2W4XA 1SJBA 3W1NA 2XLDA 1M01A 3DZ1A 2PDYA 3FW6A 1RP8A 4C60A 3L67A 1LZOA 5CXPA 3UNGC 4HU8A 2D69A 3W7MA 2XVKA 5HMDA 3T9PA 3AHYA 1DXIA 4FZIA 2R02A 4QJ1A 2YBVA 3M7SA 4ZE4A 2DIKA 2QDEA 2G3JA 3SCPA 4IP4A 3L68A 5JP7A 3H2CA 3MQTA 4UTLA 1RJRA 4EK7A 4WKHA 3RR1A 2V3EA 2GVYA 2OZ8A 3CSKA 4EAMA 2Q8XA 3MSYA 3IVSA 2JE8A 2PF0A 5J5RA 2VEMA 3ZR5A 4J1OA 4KFPA 3R8RA 3V0TA 2JD3A 4U5DE 3CH9A 3T7VA 2J9VA 1VENA 4XPWA 2YLGA 2HBVA 3JYYA 1AA1B 1Q6CA 1FDYA 1WB0A 2VJXA 1XGEA 1UMYA 5CPLA 2QCEA 1RCOB 3CUZA 3K2GA 3SUVA 1LWIA 3GANA 1JZ3A 2WVSA 4MVQA 4KWSA 2NPUA 1F8IA 4DUOA 3NVDA 3N04A 4OUIA 3CZEA 4FLQA 3RX4A 3W7QA 1MMFA 3V75A 4ER9A 2ZWZA 2A7RA 2YCLA 2QMJA 1QU4A 4YXGA 2OJED 3SSJA 3SRHA 1HE9A 1OD8A 2V2DA 4ULVA 3NPXA 1ME9A 1L8PA 3BAYA 1IT7A 1PD1A 2ALRA 2J7DA 4GD0A 2GGHA 1X39A 1FMWA 2R7QA 3RPMA 1OKKA 1PX8A 2REQA 3VGGA 4KBLA 4I9JA 1S5TA 1QQ3A 2BL2A 2YCLB 1L6SA 3PTKA 1A5OC 2V82A 5REQA 2OMAA 5EYWA 2A7NA 1S1RA 2XZ9A 3TTQA 1PZ0A 3WQEA 1YDIA 4HMDA 4Z1BA 1YPFA 5EMKA 4G7HF 3S2LA 1ISVA 1EH9A 4JTHA 3W24A 5FSEC 3W7JA 1EYEA 1Q6GA 2REQB 1BD0A 1WZLA 2VD8A 1XDMA 2DQWA 4RDYA 4AQLA 1RJ9A 5KYUA 3OP2A 5REQB 2C15A 4LPCA 3EA2A 4NCQA 4HB7A 4B90A 2QLAA 4U9EA 4BEMJ 3PZIA 2A6EF 3GVQA 1R86A 1VFHA 2Q71A 4HSOA 4DN1A 1PHQA 1Z6AA 2PB1A 2H6RA 3PBWA 4K38A 2XISA 3B8DA 2FGYA 3DM5A 1SW0A 4NZ1A 3GORA 2WVTA 3ALFA 3RUBL 3TZNA 4HU4A 3FJLA 1EA9C 1I45A 2ZX6A 4JKKA 3DX5A 1RJ9B 5KYUB 4H9YA 4M1BA 2HJ3A 4HSNA 3AQUA 1G4WR 4CSAC 3TV8A 1R46A 3UR2A 4ZXOA 1K7FA 1OXBA 3BQ6A 3KOYA 3SGGA 1MNEA 3QHOA 2GZXA 4A2NB 2XH2A 3B03A 3WJWA 1WNOA 3WQWA 3VIFA 4YLWA 2A3AA 5DBUA 1EWDA 3MU7A 1FDZA 4HYWA 4I6KA 3N73A 2XWEA 1EI7A 5JIWA 1E6XM 2QF8A 1B2YA 2L6FA 1MNDA 2WC4A 4Y96A 3TE9A 2PTXA 3BICA 4GGBA 4AIOA 1E6QM 4OU1A 2CNWD 1W9BM 5GJPA 3UYIA 3N11A 2AKMA 4JTSA 1PWMA 1W1VA 5AZ0A 4A05A 2OLSA 1PSCA 3LCFA 1DJHA 4YK5A 1WUEA 4IP5A 2Z29A 4JCMA 4JEAA 1KLYA 3HG3A 4PRWA 1LKXA 2VHLA 3DFPA 1C92A 1DHKA 2ZRYA 3PG8A 2WPBA 4DRSA 3GE7A 4KIEA 4TQTA 3IUDA 1BWKA 1ZW3A 3RM4A 1O87A 3IHUA 4H8HA 3VYLA 1IV8A 1E9YB 1X6UA 3TOMA 3OIXA 5DXYA 4YTRA 2XUCA 2VGGA 3W88A 3O6XA 4LWWA 1ST6A 4BF9A 2GA0A 2B7NA 3H21A 1FAPB 5A8NA 4IB4A 3NQ6A 4NX5A 5F2IA 3L4VA 2W6RA 1H6GA 2YPIA 1RA5A 3DC0A 1O5XA 2XH4A 3XIMA 1VMAA 4GVIA 2OCCC 1RVGA 2L7AA 4HE8D 1XDLA 2BP1A 3W7PA 2RUSA 5A6KA 4RBNA 1V08A 4L1GA 3DBPA 3NQFA 1GOWA 3N34A 5DMYA 3W7NA 3W8HA 2O92A 3CAKA 3PSVA 2XG9A 4MB1A 3TN6A 1EX5A 1E9IA 1UWQA 3V16A 5CC6A 1J01A 1W3HA 1J0IA 5DS6A 1HUVA 5CIVA 1YEYA 3HQ1A 3V35A 4YL0A 3HNKA 3S3GA 4HCHA 1QK2A 2RAGA 3WO8A 3HLZA 3N29A 3S5YA 1UC4A 2KAUC 2WK2A 4M6VA 3NPVA 4ACZB 1BAGA 3ME3A 4MAVA 3CMJA 4N9EA 4AD0A 3AYSA 4YCOA 2BVTA 2WXDM 1GVEA 4HU0A 3WUFA 1XLHA 1FA2A 5DQTA 4XUYA 4OQVA 4ICNA 4NJKA 4S1FA 3FA5A 4F0HA 5IRPA 2QKFA 1UA3A 5PTDA 3VDCA 1VYPX 2FH6A 2RSEB 3GDRA 3TYUA 3BW3A 2NXIA 1ITXA 2PDUA 4IJRA 3T05A 1Y8BA 3SJ3A 1VB5A 4UFJA 1KCLA 1LROA 2CKRA 1ZU8A 1IYXA 4OIQF 1LOSA 2OGJA 3GKFA 1HKVA 2EINC 3M5XA 5M17A 1OCOC 1CPRA 2A3LA 1SO5A 2YL3A 3W0KA 4S3CA 3FAWA 1YDOA 2B4GA 2HV6A 4DO4A 7XIMA 2OQYA 3OA1A 3NQCA 2FGZA 3M7WA 3WDPP 3A9BA 1SMAA 3U3HA 4P8XA 3GWNA 3FS2A 3U9MA 3VPLA 3UW6A 3EG9A 5T26A 3RU6A 2YB4A 4EIYA 5E6ZA 5A6JA 3QY6A 4I8DA 1XLIA 3P0XA 4PTVA 1C02A 2GOKA 3C8NA 3DBNA 2YCKX 4IXHA 1J8YF 2E0PA 3W86A 2YL7A 3E9AA 3PK7A 4UQAA 4D1JA 5A2BA 1OQFA 2OEVA 1E71M 3R12A 3EG9B 4UTJA 3WQVA 1W3TA 3NR0A 4M5PA 2JFEX 1ZYRF 4C3EA 1H62A 1KGXA 4JTKA 3F2BA 2PZ0A 3NL3A 4X0VA 5BRQA 2YL8A 1YNPA 4XTDA 4E7SA 1LI7A 2CNWA 5KMYA 2J13A 2XM4A 4JNYA 3CUFA 1CXIA 3W71A 1ODZA 3EB4A 3UNTA 3WIJA 1JD7A 2CNCA 1RBOB 1OBAA 3PULA 1VP5A 2R7OA 1UZDA 1GK8A 5FJRA 4LUSA 5AHMA 5CSRA 3A12A 2X0HA 1YA9A 3HPSA 3AUOA 3ZWIA 4GQHA 1UMLA 1LS1A 3PZQA 1VIZA 4C6JA 2DZAA 3TN3A 4WZHA 4GQGA 4KWOA 4U10A 1MVYA 1GJWA 1B4KA 2POZA 3F4DA 3SSZA 1SZFA 3ORWA 1S2TA 1TMQA 4CS9A 4WHBA 4LUSB 2PWGA 5A3HA 1X38A 4B9ZA 5KETA 3BZGA 2FZ8A 1VEMA 2ISDA 2PD5A 4WJXA 5FAJA 1H7NA 4CCEA 1N8WA 3UD6A 1NARA 1QW7A 3HGJA 3KTSA 4XBJA 3WDHA 5K9XA 4AXNA 2M4EA 4PTMA 1TZZA 4QHRA 2E28A 2MHRA 1MSSA 1X97A 2Y8VA 1Q0MA 1OJXA 3USZA 3MW7A 8A3HA 1PS9A 3NQBA 4CU8A 2A79A 4HNNA 4QDPA 4HP5A 5F28E 3G0SA 5CPSA 3W2KA 3STEA 4UZUA 1AQFA 3ZTZA 3H2AA 4LVDA 4W7UA 5FA5A 1WUFA 2OSYA 3L7RA 1EF3A 1RV8A 1S2UA 3B0VC 2AMXA 2AMGA 3N2ZB 1XR2A 3AU2A 3GU9A 3NYMA 2I1OA 1NFPA 3MA8A 1A5SA 1YW1A 3CPGA 1AG1O 3BMWA 2YEVA 3SUSA 4E3TA 1XUUA 3AXKA 2Q00A 4JHOA 2CW6A 2FZMA 3MDUA 4UIOA 3DFTA 4IMGA 4YYFA 1LCOA 2NUYA 3N6HA 4IMDA 2WZLA 1JD9A 3I3DA 4DBEA 3SFKA 3C56A 2FAPB 1C17M 5E9AA 1A5NC 4ENLA 4JX6A 4CNPA 3BLKA 3S42A 1JCTA 1KRAC 1DKWA 1NSJA 2KNHA 1OABA 2OKTA 1YYJA 4AL1A 5JH1A 1YADA 4X63A 4XD3A 1DWJM 3W76A 2IPWA 4AD3A 4DF1A 5D2VA 4C6IA 2XFYA 2EHHA 2ANUA 5HANA 1KM4A 2QQ6A 4DZAA 1GEHA 3SCVA 1VRDA 1ALDA 1UP2A 1K1DA 3HJCA 1OEPA 3QW3A 2ZWYA 3R89A 3CO4A 3VIIA 4WSKA 1W3KA 1E72M 1S3TC 4JHZA 4RNJA 3KS6A 5TNVA 3UNDA 1GQKA 3OWTA 4JQAA 4S3EA 1PPIA 4P8VA 2FFHA 3REQA 5DMLA 3VZXA 1XICA 3R13A 5AC7A 2WSPA 3A3XA 4NJGA 3MT1A 2FVKA 4B5XA 2WC3A 1XX1A 2ZDRA 3G22A 2YL9A 3SI9A 4QE4A 1AW5A 2VYOA 1JDFA 4D8AA 1CI1A 4RNHA 2EG8A 5GPRA 4A29A 3GTFA 3MSGA 1KO0A 1ZBCA 4MAZA 1MO0A 2VEGA 3OEOA 3REQB 2CWXA 1GW9A 1SO3A 1JUKA 4XLPF 3C2YA 4GEHA 3QV8A 3QM3A 1EQCA 4AWUA 3AHXA 2ASRA 5AN7A 1OZQA 1J12A 1AH0A 5ENLA 1R9ZA 1UR8A 4ZQCA 3PC0A 2FKPA 2F84A 3L4XA 2TODA 5EGYA 4MHBA 2P5NA 4BKNA 2VFHA 1AQMA 3RAOA 1XKJA 2ZKMX 3KRBA 3EKGA 1C8QA 1UFBA 4XTKA 3VNMA 3EDDA 3Q58A 4LVBA 4PUEA 3UWZA 4P5UA 4IG2A 1D8CA 3QSTA 1TJ0A 1P0BA 1L7CA 3LGEA 1JPNA 1LT8A 1GVFA 2VWTA 3IJ7A 4HPNA 2Y0FA 1IR1A 1H1YA 4W8KA 4CQBA 4K2SA 1TR9A 3UXLA 4OT7A 4H9MA 3LS1A 5D2TA 5D2WA 3TYCA 1VFLA 4JJGA 2JPUA 2A3BA 2FJKA 5C9RA 4P8WA 3EKZA 1CX9A 4IG2B 5MKGA 2XLVA 3U5YA 1EQPA 2E40A 2E5BA 4LNCA 1SJAA 2HMCA 3AG1C 1GKQA 2XWDA 4C6KA 4MNKA 3BK0A 2A1YA 5C0QA 3W37A 5I2UA 4G1KA 4D6EA 1EB3A 4U5IA 1PUDA 3VGEA 1ONWA 4J3ZA 1E70M 5AY7A 3NOEA 1CGOA 1ZB5A 4NIRA 2D22A 3GRIA 3C0SA 2WVQA 4DRIB 4UNLA 5EMMA 2BVYA 5MKGB 3CIVA 1KGWA 1R30A 3WYZA 4CQ8A 3C52A 4BJ1A 4MOZA 5HXMA 4NT0A 2Z1VA 3GAKA 4FX6M 4HZMA 4KGLA 3LCIA 4JX5A 4O1BA 3NRHA 4TX8A 4EPBC 5CGMA 1J0HA 5L6UA 2AL2A 5DVWA 5MF5A 2HWGA 2HK1A 1W9DM 2WVVA 4EUKB 4RUBA 3A9CA 2VZOA 3S29A 3QHNA 1HVQA 1XRFA 1Q3NA 1YX1A 3RDKA 2UBPC 5KZEA 5G4EA 4GG9A 3WH5A 4ZOEA 5A6BA 1J10A 1MNZA 1R9YA 4FAMA 3MKKA 1VPYA 1FFTC 4C65A 5LSMA 3F4VA 2XL4A 1AMKA 1BHGA 2AL2B 1YKWA 1XLCA 3NGFA 2PGWA 4MTGA 2WVVB 3U2OA 3TULA 5JLIA 3FVYA 3UMKA 3MI3A 4KF1A 4Z9IA 2UY3A 2C16A 4O1CA 4YT5A 2W62A 1Q13A 4GNVA 4K1GA 4GO9A 3GUGA 3E6EA 4L61A 4CNOA 5F7UA 1M04A 1JF6A 1DJNA 3K13A 1C8YA 5EMJA 5CBBA 3TK7A 1XISA 1GG1A 1QWGA 1A53A 2TMVP 4YU1A 1UBSA 3VOFA 2A3HA 2WSKA 2ZUNA 1GEQA 1Q4NX 1TRIA 2J9ZA 3N19B 1J93A 4LS1A 4BI5A 2E1WA 4YL2A 3A47A 1EJTC 3LCWA 4WIWA 1V6VA 4XQ6A 1GYLA 2G3MA 4B5UA 4Z2IA 1V4AA 1VYKA 4LF2A 1C7TA 1M7XA 3RX3A 4CVWA 2HEJA 4WKFA 1U5VA 2O0TA 3INPA 4J32B 3W7KA 4N6CA 1XLGA 3BAWA 2OJQA 3M44A 5A8GA 4XEVA 2OU4A 1XYZA 4AVOA 4YHGA 1LPEA 2CZ5A 4LF1A 4LTSA 2I5QA 4J27A 4GFIA 4BQ5A 3IAQA 3M0HA 3AIUA 5XIAA 4MY1A 5EK0A 3SQMA 2E9LA 4WRHA 2Q3TA 4ZTYA 1TWHA 2I9EA 1KFWA 1L6YA 3I3EA 4GI8A 4LAMA 2Y7DA 3AG3C 3TP4A 1KB3A 2PCQA 2CBVA 5L0JA 4N02A 2VDHA 3MKVA 2CXGA 1OFPA 2BMBA 5BXTA 4O14A 2X40A 1E0XA 4IMEA 3LPGA 4NZ5A 1O94A 3ATYA 3HV8A 3TFXA 3GM1A 2CIPA 2IQDA 1ZZPA 2R94A 3E5PA 1ZL1A 3W1LA 1HQTA 1ZENA 3T07A 1MW2A 4HU3A 4P9TA 4CCCA 3TSDA 3TYBA 2R7SA 4I5UA 3ARRA 3F4NA 5GNZA 1G4EA 1HKMA 4NZJA 1XCWA 1ZCOA 3LGDA 5D9MA 2DSWA 4RE2A 3EX6A 4ATDA 1FH7A 3GNPA 5HPCA 2VQUA 5G1TA 5AYBA 4WGYA 3GIQA 2W27A 1NDVA 4ICCX 1ZGDA 4MNDA 4HPXA 4FS9A 4MY8A 3OB8A 4U5HA 1ONXA 4AWSA 4MJ4A 5IXEA 5HJLA 1U5JA 2Z1XA 1PV8A 4RNFA 4RDWA 2QUPA 3NUKA 4ADTA 5I3FA 5HNTA 3E2VA 3GH4A 1M65A 2JIEA 4RV3A 4F2BA 4XLNF 3GODA 1GZGA 4IAOA 4Q4KA 2KYHA 2WLZA 1OZMA 5BYWA 3K1HA 4PFOA 4E18A 5K4XA 4JW1A 5T3WA 1CGME 2RDXA 4C5ZA 2VX5A 3NQGA 2XFFA 5LA0A 4AF0A 2CYGA 4MTFA 1S05A 4GLEA 2J62A 3AAMA 5AVNA 3URNA 2VENA 3DJNB 2OKUA 3T09A 5T9CE 3TJ5A 1N8IA 1S39A 1DXEA 3ARPA 3WEMA 3E70C 3WJYA 3NA8A 1TIMA 2J7EA 3F4WA 1CECA 3CYJA 2Y3BA 2OX4A 4JL1A 4JIEA 4H6KA 1B3OA 3FMSA 3W6LA 4I9TA 4AF0B 5A1AA 2GDVA 5U4NA 3WHNA 5D9OA 4BJTA 2AWYA 3BGAA 4O18A 5C54A 1XRSA 1G7UA 3LNMA 1IWBA 3B4UA 2C13A 4PCNA 3NQVA 1PB0A 1V7AA 4NYUA 3D0CA 4O4WA 2CZVA 3L0GA 3WK2A 3APGA 1YNQA 2RJHA 2B0HA 5C2XA 3AFBA 1TYGA 4ZO7A 3L0IA 1JZ8A 2E7FA 4IJCA 2NUTA 4W4QA 1TUFA 4E17A 3T6BA 1K8CA 2X1SA 1XQKA 3KMIA 2PBGA 2E8YA 3UA3A 1J2WA 1MMGA 3AQBA 3LI1A 4PGLA 3LNMB 2EIJC 4E5TA 3DESA 4XUGA 2P50A 3PBMA 1V0NA 2J7FA 1UPPA 2QAPA 3WQFA 3AG2C 3H8AA 4G7ZF 4ZE5A 1KCKA 4OOZA 3IK2A 3SBFA 2L9JA 2NUTB 5BWFA 2YQYA 4KRTA 2BGQA 1A7VA 1Q6DA 3DFQA 5BW6A 4JOMA 2Q09A 4F8XA 2G3IA 4B2DD 3KL0A 2AOSA 5IM51 3KTXA 1MEIA 3ABOA 4KI2A 5F1VA 3WUEA 1FXQA 2YL0A 3KL5A 1CXHA 1IZCA 1EIBA 2VDIA 2IQ0A 1K6AA 2F6UA 1XYLA 3GS6A 3UZWA 4GUFA 3BCJA 4MVSA 3A23A 3AJXA 4CDVA 1HGYA 4AU0A 3H65A 2FMNA 2VX4A 2BSLA 3FYYA 1XPGA 3V5CA 3KDOA 2HROA 2YXOA 4IUOA 1X1OA 4XBKA 1B3YA 4NHVA 1EC7A 3E0FA 4AD2A 4E2VA 1ZUAX 2A0NA 2INEA 3BLPX 3LPPA 2CYDA 4XEFA 3U0CA 5DFAA 2VGIA 3WF3A 2YJQA 1K4GA 2IQTA 2YLLA 4HFKB 4RZ4A 3GXPA 3PANA 4QBXA 3WELA 3BG5A 3ZZ1A 1L0PA 3VE9A 2B7PA 4QJ3B 5FJTA 1O1HA 3T6CA 2CLPA 4B16A 3UQNA 3M0LA 1B4EA 4DO7A 3V0SA 5HDRA 4HHHA 2YR1A 2P1AA 3ERPA 2P1FA 2PDGA 4H04A 4PB5A 3ATZA 1WXZA 3H2OA 4WD0A 2J79A 5D09A 3WBAA 2C03A 1H7RA 1BWVA 2OCZA 2Z28A 4PUNA 3DHDA 4IGHA 4GNKB 5A95A 5FJUA 4DWDA 2R1NA 3A5VA 2YDAA 5HR7A 2CCRA 3ENLA 4GYJA 3KRUA 5DT5A 4QAIA 2OQLA 3P93A 2R7RA 3S46A 5LYRA 4M56A 3CQZA 1K03A 3KOXA 3BGJA 3OLGA 3WCZA 3M16A 3BSHA 3W2NA 4L9YA 3I7QA 3CO8A 5KTLA 1A4MA 1CGXA 3FSTA 2WAGA 4IPNB 4O50A 4OIOF 1JNDA 4C90A 4CCDA 3NG3A 2PWUA 5JSLA 1ZPTA 2H8ZA 3C0LA 3SUTA 4IARA 1K3UA 1PKYA 3QPEA 1ZAHA 4MUZA 1TTJA 3P5YA 2EEXA 1QAPA