3B0UX

Trna-dihydrouridine synthase from thermus thermophilus in complex with trna fragment
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
312
structure length
312
Chain Sequence
LDPRLSVAPMVDRTDRHFRFLVRQVSLGVRLYTEMTVDQAVLRGNRERLLAFRPEEHPIALQLAGSDPKSLAEAARIGEAFGYDEINLNLGCPSEKAQEGGYGACLLLDLARVREILKAMGEAVRVPVTVKMRLGLEGKETYRGLAQSVEAMAEAGVKVFVVHARSALLALSTKANREIPPLRHDWVHRLKGDFPQLTFVTNGGIRSLEEALFHLKRVDGVMLGRAVYEDPFVLEEADRRVFGLPRRPSRLEVARRMRAYLEEEVLKGTPPWAVLRHMLNLFRGRPKGRLWRRLLSEGRSLQALDRALRLME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA (5'-R(*GP*GP*(H2U)P*A)-3')
publication title Molecular basis of dihydrouridine formation on tRNA
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase/rna
total genus 126
structure length 312
sequence length 312
chains with identical sequence Y
ec nomenclature ec 1.3.1.91: tRNA-dihydrouridine(20) synthase (NAD(P)(+)).
pdb deposition date 2011-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01207 Dus Dihydrouridine synthase (Dus)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1460 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3b0uX02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3b0uX01
5EMUA 4EF9A 4UMCA 5BMWA 3MWAA 4M6VA 4PEKA 4JXCA 2BX7A 4N9DA 4L4MA 1DVJA 1GZGA 3LHUA 4HNVA 1OYBA 3CC1A 3MHUA 1EP1A 1W5QA 1XBXA 3FKKA 3NQDA 5AYXA 3TSMA 4AWTA 3S1VA 1VJIA 1WYIA 3IRDA 1TRDA 1FWNA 1RZMA 1OF8A 2A6NA 3GDRA 4JYFA 3M6YA 1VYSX 4JNMA 4O0ZA 1YDOA 1OYCA 1YTKA 4MIMA 3QQ1A 1SW0A 3P82A 4GXMA 4M5PA 4NJHA 1T8XA 3LRKA 2C13A 3GIYA 5DELA 2I14A 3T40A 2C0AA 4DO5A 3HQ1A 3DHFA 1QNVA 2Q8ZA 3O07A 5DXXA 5K9XA 2J9ZA 3GZ3A 1EPXA 4WJEA 4DBDA 1GWJA 4RZ4A 2NUYA 3GLCA 1OFBA 4LRTA 4Z08A 3A5FA 4IMGA 3HG5A 1KV8A 4HPXA 2A1YA 1UUMA 3LTYA 3GKFA 2X16A 5FEZA 3EWYA 4AWUA 4O50A 4FHAA 5FEPA 2I1OA 3PM6A 2RFGA 4JDYA 4MYAA 1RQHA 4RV8A 1DOSA 4R33A 1AL8A 2C15A 4MZ8A 1HUVA 3PSVA 1GYNA 3L21A 3VKJA 2DZSA 2FPVA 3W2NA 4MYXA 4XTDA 2WQPA 3NDOA 5G2HA 3RLVA 3KVKA 2CLFA 1PIIA 3NL6A 4I7UA 3W6YA 1GVRA 2YGYA 3W1XA 3W7HA 4M6QA 3S9YA 2NXHA 1JCNA 5KSWA 3HGOA 2X1SA 3GB6A 1W3TA 2QCLA 5SWUA 4MUZA 4AB4A 3M0ZA 2TYSA 1QPNA 3NL5A 2CZDA 2GOUA 3W73A 1VYRA 2YSWA 1OFDA 1O60A 3KVMA 3LI0A 4YWIA 1JQVA 4QAIA 2QUTA 5KTLA 4UR7A 4K6AA 2AQWA 5HULA 4E2DA 2VOMA 3KHJA 3ZFHA 3MP5A 3W7JA 4XKYA 1ICSA 2Z1BA 5I3JA 1WV2A 2P1FA 1WBJA 4CCCA 4ML9A 1XBYA 3QPYA 2BLEA 1W3NA 3BW4A 2G97A 1ZHAA 2C19A 2CFFA 1VGAA 3B0UX 3PR2A 4UR8A 1OK6A 3CEPA 2GVGA 4JR5A 3STFA 2NX1A 2OX1A 4ZQPA 5H2ZA 1H7PA 4IX2A 3CT7A 4K8HA 3R89A 1B4KA 4LW7A 4UTTA 2E6YA 3S6DA 2A5HA 2Y61A 2WOQA 1AK5A 4LC8A 1G4SA 3NOEA 5E1QA 3VE7A 3O05A 2VFHA 3VCRA 3GXPA 2LLEA 2JKAA 1W5PA 4LVAA 2VEIA 3PG9A 5LHEA 2I9EA 4K37A 4QM1A 5G1YA 4JYEA 4NJGA 1OHLA 1W56A 3WK3A 3N3MA 4ZVJA 1JULA 3V75A 3P81A 2ZA1A 4UTJA 3TFXA 3W7CA 5L9FA 1WBHA 1VQTA 1G7UA 4Z1AA 1JUKA 1K7XA 2YDAA 4MKNA 4HT3A 3W07A 3QSTA 1MEIA 4O1AA 3BARA 3LXAA 4DF1A 5HWMA 1QMLA 2PE4A 2J27A 3P5ZA 2V0TA 4O11A 4GUHA 5MHBA 3Q37A 1VPXA 2ABAA 4IMCA 4O12A 3C6CA 4LVFA 4YCPA 3IGSA 2RDWA 3PC0A 4O4VA 5LNSA 1VHCA 1S3HA 5EL1A 1I2QA 1SZNA 4NJKA 1XBVA 1XXXA 2QJGA 3PWAA 3W1MA 3TAOA 1W1ZA 2CLMA 1H7RA 3ZR4A 1GTEA 2PRMA 1U83A 4PTNA 2FFCA 2VEMA 3NVTA 1R30A 3LOTA 3W83A 4WXYA 1GEQA 4O28A 3O63A 4N02A 2XFWA 1LM1A 2E6AA 1W5OA 3GAYA 1PS9A 3NQEA 4BF9A 3W85A 1IXNA 3TROA 4AXKA 1VCGA 1K8XA 5HR7A 1LP6A 4GUJA 5TBOA 1F73A 4HNTA 1X1OA 1HO1A 3F4WA 4UTMA 1IF2A 3H53A 1SO5A 2ZZ2A 4DF0A 1XC4A 4M19A 3S1WA 2PRHA 3LCIA 1GTHA 1QOQA 3WJWA 3BG3A 5T26A 3P74A 4JTTA 2NUXA 3EKZA 3MW7A 1YXCA 2H6RA 5CZ0A 3QMSA 3UPWA 3GDMA 1TSIA 1G69A 2YX0A 3I7SA 2GJNA 4PODA 4R7JA 4UTWC 3S5YA 3D0CA 4X3ZA 4PCFA 2X2GA 4GE8A 3EXSA 2QEZA 1JVNA 4NNAA 3W2LA 1AMKA 1FY6A 3CIWA 3OVRA 5C5YA 4WZHA 4K36A 4UTTC 5AB3A 4UTIA 3GNDA 1VLWA 1FXPA 3OVQA 3P8JA 5K4XA 1JRBA 3O15A 2HS6A 3TJLA 2FPYA 1WXJA 2Z0IA 3SI9A 3GK0A 4KKXA 1OX6A 3DI0A 3FIGA 3E96A 2Y88A 3DU0A 1ADOA 5CKSA 1K03A 4HPJA 4GNJA 4RK8A 1LBLA 3DAQA 3H54A 1S5VA 1T96A 1I2NA 5F2GA 3MBDA 2HMCA 1VLIA 1W8SA 1KM2A 3O6CA 3LI1A 4GUFA 5D37A 4Z1CA 2BTMA 4UMAA 2QKFA 1KA9F 1NVMA 3NEVA 3QPZA 1M6JA 5HJLA 1KFLA 2BZNA 4H6KA 4UFIA 1OX4B 2QCNA 3GDTA 4IWWA 3QM3A 4QISA 1QO2A 5G1TA 1CX9A 1FCQA 4O17A 5D30A 2AAMA 4AAJA 3NQGA 4RZ5A 2GUUA 2YR1A 1YLVA 1J4EA 1GG1A 3MHFA 5A8GA 3SGUA 4PC8A 3VNDA 1AG1O 3BG9A 1AW5A 3KFTA 2VEKA 1RQEA 2J24A 3M44A 1OFEA 2Y6ZA 4HNNA 4EIVA 1I8JA 1Z42A 4JX5A 4MZYA 1F5ZA 5BMXA 4QNEA 1SSDA 1YDNA 1QCWA 3S5ZA 2A7PA 3SJ3A 4XZ9A 1FQ0A 3LCLA 3VFLA 4M6PA 3NA8A 6TIMA 5AHFA 3UQNA 5LNVA 1SR9A 4LV9A 5D32A 3ABQA 5D2WA 3M5ZA 3MYPA 3W2MA 1O94A 2ZRYA 3CWNA 4YXGA 4KFPA 3W1NA 2BSLA 3EX2A 5EY5A 3W76A 2NX9A 1LLZA 4LS2A 3NM1A 4ZQOA 2J88A 4NX0A 2H3DA 2A21A 2ZRWA 4MJZA 2PURA 3KOFA 1LRQA 2YYTA 2DZPA 5DCEA 2Z2UA 1TMHA 1JJKA 4FNSA 3T44A 5HMSA 4Z1DA 5KITA 4X2RA 3B0VC 3NQCA 1OJXA 3LCWA 3RNDA 2ZZ6A 3R5EA 4R34A 4AF0B 3QJAA 3W1UA 1P1XA 3QMRA 2QCFA 1FBAA 4XUGA 4LS1A 3RMJA 1EIXA 1W37A 3IVTA 2H3BA 1P0NA 3L68A 4MY9A 5AHEA 5CZJA 3LRLA 3W75A 3THAA 3IGUA 2OCZA 2NWRA 7TIMA 1A5AA 3HBLA 1XL9A 3IGXA 3M47A 3EX4A 4FNTA 4DF2A 1BWLA 2RH9A 5L6UA 2PRLA 3G0SA 4K7VA 3SZ8A 3MI2A 3TE9A 3W9ZA 4C1KA 2V5LA 4KFOA 5K4ZA 5J5RA 2YFOA 4KWWA 4O19A 4R53A 1TB3A 2ZBTA 1BWKA 4AH7A 2NWSA 1H7XA 2Y7GA 1GQNA 3W7LA 1TPC1 2CZFA 3QRHA 4UC5A 1GOXA 3HMJG 4DBEA 3M5YA 1VR6A 1K02A 1UBSA 2ATSA 3HGJA 4CNNA 4O53A 4TMCA 3EX1A 4N2YA 3C3NA 3CM4A 3UY8A 1TPFA 3E9AA 1SZGA 3CQ0A 3VI2A 1QO5A 1IXPA 4N6FA 2X1TA 2ZRUA 2Y89A 3HG2A 3NQ2A 3G1HA 3UZJA 4O1BA 5TIMA 3DENA 4PH6A 1UASA 3SSJA 1KW1A 3GDLA 3UY7A 3BG5A 3QC3A 4GUIA 2OZ0A 4JTIA 3DBPA 4JIPA 3JS3A 4Q32A 3KRZA 2X1RA 3NQMA 2NUWA 1ZAHA 3ZS4A 1TJRA 4Y8FA 4BI5A 4L4LA 4O1CA 4QQ3A 3O6YX 1SFJA 1TO3A 5BOOA 5C6MA 2A7NA 4RXFA 4TR9A 4U4MA 5HINA 1LTDA 3O1NA 1AL7A 5HR6A 2C6QA 1ZY9A 1FUYA 2WKJA 3MUXA 3TXVA 3KX6A 1LROA 3P8IA 4YMZA 4FXSA 5G4WA 1MO0A 1J5TA 2PC4A 4AVFA 1OFOA 3A21A 2RHGA 2DORA 1F74A 4GFSA 5AN7A 2GQ9A 4NJJA 4YLWA 3W2JA 4D2JA 4KWVA 2QJIA 1ME8A 4CCEA 3FOKA 3H55A 4PL2A 4XBSA 1DHPA 5E93A 1G4PA 3T4CA 3TR2A 2JKPA 4UNKA 1QAPA 1RPXA 5KZDA 3W1PA 4UCGA 1KFKA 2ATMA 3W87A 5I3GA 1WOBA 2VC6A 2W0UA 3I7QA 4UTKA 3HPZA 3PBUA 1YPIA 3DKJA 3LTSA 2TPSA 4ZQRA 5AC6A 3FA5A 2Y63A 2ZRXA 3FS2A 3W22A 4FNUA 4ORMA 1TPH1 2B7QA 3LRMA 2HTMA 1ZAIA 1VYPX 1KM3A 1G4EA 1DV7A 3QW3A 5FEWA 2NV2A 3G1XA 4LVDA 1YXDA 1VC4A 4JTKA 2H8XA 3ATZA 4WY0F 3N14A 4UFKA 4IXXA 4O13A 4JDBA 5K9CA 1PE1A 4WY0B 5AHNA 1S5TA 4O4WA 3B8DA 4LOCA 3M16A 4K8EA 3N2MA 2ISSA 1TPB1 2R14A 3C2OA 1TPVA 5LGZA 1O95A 2V5BA 4NVTA 2A6LA 2ISWA 1EP2A 5HUPA 1RV8A 3AO0A 2ZDRA 3C2EA 2JGYA 3M43A 3LB0A 1W0MA 3MJYA 1WX0A 2WNZA 1ZAJA 5K7JA 2NX3A 3FFSA 3B4UA 1JQXA 2FB2A 3TX9A 5GVJA 1OABA 1SW7A 1Z48A 3W7OA 1SO4A 4K39A 4A21A 1YTEA 3G1VA 4HNUA 3TAKA 1K3UA 3QW4B 3OG3A 3UZ5A 4EF8A 1NEYA 1GJPA 3TQ0A 3LLFA 3UWQA 4JEQA 3DZ1A 4O10A 3M5XA 3C61A 3N9RA 2EGZA 5FF4A 1LCOA 3MHGA 3RLUA 2QCEA 1EWEA 4O0KA 3B03A 4JTEA 1H1YA 1XBZA 4A3UA 3GXTA 2YYUA 3TC6A 2EAWA 1SZEA 4LUIA 4MFEA 3USBA 4KFNA 3FJ6A 3BGJA 4CQAA 4IGHA 3I65A 3M5VA 1NAL1 4JICA 3TU9A 3L65A 1GVQA 4RX0A 3LV6A 1KM4A 1OFQA 1XUUA 4EVZA 3HOJA 3YPIA 3NL2A 3OHIA 4G1KA 3GDKA 1HFBA 1QPOA 4JX6A 4CNPA 3C56A 1FDZA 4ZL1A 4OHQA 3DXIA 3QH2A 4ADSA 4JX4A 4LNYA 4TX9A 1WAUA 1FCBA 3IV3A 3HB9A 4OGZA 4FX8A 3W7MA 1OFAA 3JRKA 3NGJA 3PUEA 4LRSA 3W7KA 3N34A 3B0PA 1XM3A 3UXAA 1LDCA 1OF6A 5DLCA 2HSAA 3L0KA 1EB3A 1XI3A 3T55A 4CQ9A 5C54A 2QCHA 4ZZ9A 5BNKA 4MOZA 2Q3RA 2B7OA 4A2SA 3HJZA 2DU2A 4MY1A 5F1VA 2QUVA 3UYCA 1H50A 3EWBX 2NXIA 4M7SA 3BVJA 5BW6A 1VH7A 1SU5A 3W1RA 3LHTA 3GX9A 1X6UA 2C16A 1ZALA 3EWZA 3NR0A 5G2IA 1JCLA 4AMAA 5F1UA 3ATYA 1ICQA 1W54A 4O8RA 3WJXA 3W7IA 1Q6RA 3TH6A 3TK7A 1PVNA 4JTFA 1RR2A 5I3IA 5AYYA 5AHIA 1SUXA 2Y7EA 3Q58A 2XN2A 1FWWA 3E0IA 3SR7A 5D2YA 5DCDA 3DFOA 4H3DA 1QFEA 4A22A 2XN0A 1X1ZA 4LVGA 3TC7A 2YZRA 1EX5A 4LC6A 4MLJA 4JTHA 4UXDA 2G95A 5E0KA 2R91A 2ZCGA 1DORA 6ALDA 1FWTA 3W1QA 1CW2A 3L9CA 5EYWA 3NQVA 4NNCA 1P0KA 3THQA 3Q2DA 5LHFA 1H7NA 1LRNA 1LYXA 3TUUA 1HTIA 3G1FA 4OQVA 3OEXA 5HQEA 2YPIA 3G24A 4OV9A 3BLFA 5CSSA 1B4EA 1RQBA 1L6SA 1D9EA 2GJLA 4RKAA 4TMBA 3W7EA 2V2CA 1ZENA 4IPIA 4NQ1A 1Q6LA 3NQFA 1DBTA 4AHQA 3UWVA 2F7FA 3STEA 1I2RA 4HIBA 2C3ZA 1JCJA 1B57A 2CZ5A 5LNWA 5H91A 2QCMA 3GAKA 2EF9A 3TNOA 3LCXA 4ZMGA 1K7EA 2H90A 1EA0A 1L9WA 3G1AA 4Y96A 4N6EA 3TSDA 4LV4A 3W70A 4DELA 3G18A 2DZXA 3LLDA 5C55A 1LBFA 2JK2A 4JTSA 3PBYA 2IQTA 2E6FA 4IMFA 4TO8A 1H7WA 3Q94A 2WSRA 3L66A 3IIPA 4LUJA 5FEXA 4FF7A 1DQWA 1F6PA 1K7FA 1TREA 3WJSA 3DKLA 3NZ1A 3P67A 2P10A 2Y85A 3GNNA 2VENA 3LDVA 1M5WA 1LLWA 1OX5A 1DJQA 3LM7A 1QDSA 1JCYA 4DEFA 4O16A 3WK2A 5ABTA 5KZEA 1Q45A 2QDHA 3CIXA 4JY8A 3W7PA 5DN1A 1GT8A 3C2FA 4X22A 2NLIA 1LOSA 3NXFA 1KLYA 2FLIA 4PL1A 3W88A 3B04A 3FJLA 3PB2A 4JTLA 3O06A 3P5YA 3NAVA 2CLKA 4OV4A 1XUZA 4MZ1A 1Q6OA 1A53A 4JGDA 4C1LA 3C4UA 3LERA 1S5WA 4N9EA 1OX4A 3PAJA 1TQXA 5G2WA 3G8EA 3S1UA 4EOUA 4Y9AA 3LCGA 4IPJA 4OWGA 2VKZG 5C2XA 2J6XA 2E68A 4MY8A 3LGEA 4XTIA 1GYLA 1KLZA 3N2XA 1D3GA 3PVFA 1C9DA 1BKSA 4JY9A 3NQAA 1L6YA 1PCWA 1KM6A 1SFLA 3LV5A 2RDUA 3KRUA 1D3HA 3A5VA 4UUIA 4W9TA 3TW6A 1CI1A 1LOLA 5CPLA 5D04C 3W1AA 2W6RA 1VCVA 3EX3A 3A23A 4IX0A 1TRIA 1Q3NA 1T99A 2WV8A 1R46A 1P5BA 1KM1A 2QUUA 3W3OA 3BLIA 4BI7A 2J9XA 5K9DA 4NJIA 4YL2A 1YDVA 3SFKA 5CGQA 3G3MA 2E77A 3IIVA 1R2RA 1WQ5A 3G1SA 8TIMA 2TRSA 2OJPA 4QJ1A 4UFHA 5J5DA 1WDWA 1AW1A 1QOPA 3W2UA 3FEMA 2QCDB 3I7RA 4DPPA 4I7WA 1RVGA 3WK0A 5AOUA 2A7RA 1TCDA 4WX2A 1GVSA 3W2KA 5AC8A 1R2SA 5D2TA 3W7GA 3HGRA 5F4WA 3W74A 3EXRA 1Q6QA 4JTJA 3DFPA 2CW6A 1PHWA 5K3VA 1SSGA 1NF7A 2ZTJA 1BTMA 1G7VA 1R2TA 2FTPA 4WXZA 3S5NA 1Z44A 4AF0A 1N8FA 1TV5A 2QDGA 4K38A 4NXSA 2WNQA 3QYQA 2ZA2A 5BRBA 4NXKA 3LCHA 3CB8A 2DZUA 4XWUA 1B9BA 2V9DA 3FLUA 3TCEA 3TKFA 4MPQA 3BW2A 1WA3A 3K30A 3CEUA 3DI1A 5LGXA 5D09A 4O54A 1THFD 3W72A 1H7OA 4NZFA 1XKYA 2XN1A 4M7TA 5FI8A 4QSHA 5HUOA 4A2RA 1L6WA 3EX6A 1ZFJA 4UNLA 4O57A 2DP3A 2YFNA 2CU0A 3C2RA 1YYAA 4XBKA 2JGQA 1KV5A 3TQKA 1Y0EA 3EB2A 3O6DA 2EKCA 3CTLA 2WSQA 2KZHA 3BW3A 3VE9A 2F84A 3MP4A 1OG0A 4S2CA 3ABRA 1NF0A 3KVLA 2R8WA 1GVOA 4Q33A 2ALDA 3W1LA 4NNBA 1UUOA 5FF0A 1XDLA 2GVLA 3C8FA 2D73A 4QITA 2CLIA 3G3DA 4GRSA 2V2DA 5CPOA 1OFPA 1VHNA 3DH7A 2WJZA 5HWNA 3UWZA 3BO9A 5F4XA 1FWSA 1JR1A 1RD5A 2CLOA 3TSBA 3NL3A 1FCVA 3ANYA 3IEBA 3LHWA 1SO3A 3PY2A 3G0UA 1H62A 4E0CA 3G8RA 4FEZA 5DBUA 5F4SA 1E51A 3M7WA 5FESA 2WO5A 1TPDA 2DJXA 3P7YA 3LXCA 2B7NA 3NO5A 1XFBA 4JIQA 3BK0A 4HHPA 1B3OA 2Y62A 4CLMA 3FYPA 1ZCOA 5CZTA 4IJBA 3DFSA 4FB7A 2VFFA 5CZSA 3BGGA 2QJHA 2P0OA 3UPBA 4LT9A 5F2IA 1IXOA 4AEOA 2RKXA 3WFAA 2QF7A 1JCMP 2C14A 3PG8A 4LWWA 1GVFA 5DCBA 1OFRA 2Y70A 5D05A 1EUNA 3G1YA 4JTUA 1TTQA 3WJYA 3FYOA 5FF2A 4HN4A 3W7NA 4DO6A 3PUDA 1JRCA 2NXGA 5EPDA 2Y7DA 1I2PA 3ZWSA 4BK9A 1PCKA 1GPWA 4FNRA 2R94A 1VRDA 3W23A 4MLRA 2C18A 3TDFA 2TMDA 1TV7A 2E5DA 4N4QA 4ADTA 3CU2A 4POCA 3STGA 1TTJA 4Z0JA 2VEPA 2ZZ3A 3EWUA 4UTUA 3TMLA 2VFGA 3B05A 1I4NA 1YXYA 1V7YA 4GWEA 3GKAA 4O52A 3ABOA 2ZZ4A 3I6RA 2YCEA 3SW6A 1KM0A 2Z6JA 5DY2A 3S42A 3G1DA 5AHMA 1MSSA 4XKYB 4U28A 4WY0A 1ME7A 4OE7A 3M1ZA 5CPNA 1KTBA 3EXTA 1KFBA 3QQ0A 4Z1BA 2EHHA 3ABSA 3DGRA 4CCDA 1MEWA 3JR2A 1IXQA 4RCXA 2FIQA 3IIZA 3S5OA 3UD6A 1TPUA 4JN6A 4XQ6A 1SPQA 1ZNNA 1JUEA 4LS0A 4K7YA 1F2JA 3NQ6A 2CZEA 1H63A 2B4GA 2FQIA 3PBVA 3NG3A 2QAFA 5D33A 1VCFA 3UWUA 3L0NA 4WQ6A 3RFAA 1KTNA 1H61A 3BLEA 4RZ6A 5LZLA 3MYOA 4UTWA 2E5BA 1LBMA 2CLHA 4DXVA 2V82A 3DFNA 2VFIA 3PF3A 3MI6A 1H1ZA 5CG7A 3C2VA 5D02A 3N73A 2ZZ5A 1TTIA 2ZQ0A 2V2HA 3TMQA 2CLEA 3HG3A 3P62A 2YXGA 2VFEA 1HO4A 5DBTA 4ZQCA 5EKYA 4MFDA 3B06A 3LTPA 5LNUA 4H4IA 2O7SA 1HG3A 2JKEA 3DFQA 4FNQA 2A85A 1IGSA 3LBCA 3G0XA 2YW3A 1ML1A 2JBMA 3R2GA 1FX6A 4BWLA 2Q3OA 3SECA 4BFAA 4FXRA 3O16A 1A50A 3W7RA 5LKYA 5KINA 4HKPA 1F6KA 3W84A 4NZJA 1ONRA 2Y7FA 3F4NA 4ZQNA 1SQ7A 4I7VA 5G4EA 3QFEA 1ZJIA 4FX7A 5IM51 3BV4A 2DZWA 1A5BA 5KMYA 2E6DA 2DZVA 3GR8A 3NQ7A 4OBTA 2Q8LA 5I3FA 4IMEA 3PBWA 4UIOA 5K2ZA 2ZZ7A 4QIUA 1W5MA 3NPUA 1QPQA 1LZOA 5CPMA 1KFCA 3UWWA 3P60A 1DL3A 3U8GA 3PS7A 4GUGA 3TFCA 1EP3A 1UCWA 3L5MA 4O1DA 5DY3A 4FO4A 3A24A 1K8ZA 4RXGA 2FB3A 3NZRA 4JTGA 1SW3A 5FF7A 5AHLA 1IIHA 2BXVA 1NSJA 3I68A 2QCGA 1DKWA 2ABBA 5AC7A 2Z6IA 3QSRA 2FPTA 5IBXA 2X1UA 1YPFA 2UV8G 2O7QA 3MI3A 1YADA 2PCQA 4FIRA 4P2VA 3QMTA 4ALDA 3PB0A 2DZTA 2VFDA 4LU0A 1PHQA 4ORIA 3E02A 4N9CA 1UJPA 1KBIA 2WPBA 4P61A 3LX9A 1F7BA 2NZLA 3ZWTA 3ELFA 3MO7A 1R47A 4Z0SA 4LTSA 4EWND 3W1TA 1FWRA 5A5WA 4TIMA 1NFBA 4X9SA 4Y6GA 4MVAA 4AHOA 3NNTA 2W79A 3OA3A 1EEPA 5EA9A 2C1HA 1Z41A 1TQJA 1HL2A 3DFTA 3TA6A 1LORA 2ZFAA 4YCOA 3UWYA 3HPXA 3O8AA 1PV8A 2B0MA 4FIQA 4OT7A 4LVBA 1ME9A 1UB3A 1X8FA 4UMBA 3WK1A 3A9IA 1N55A 3QZEA 3W7DA 3FKRA 2BWGA 4FX6M 1GG0A 3SY5A 4HSOA 3CPRA 4S1FA 1I2OA 1KM5A 5TQLA 3HO8A 1MEHA 4N9BA 4WUIA 3P61A 3RF9A 3L67A 3MMTA 1C8VA 3IIOA 1TIMA 1KBJA 1XDMA 3BPWA 2GQ8A 1IIGA 3EWWA 2FDSA 2WSYA 3N19B 5DXYA 1KFJA 1W31A 1O5KA 1SO6A 4UTHA 4GC4A 4OU1A 1VS1A 3CLMA 2OMAA 3LHYA 2E09A 1TPEA 3LCFA 3QEZA 3PULA 3HGSA 1H5YA 4MJMA 1FDJA 4AWSA 3NQ8A 2G96A 1M7PA 1VZWA 3EEGA 2ISVA 4BWLC 3A22A 4IXHA 3T7VA 3HIJA 3LHVA 1AW2A 3L2IA 4IOTA 1L2UA 4NX5A 4O14A 5I3KA 4HSNA 3PSWA 5CSRA 3KVJA 2V30A 3UXDA 2CWNA 1TPWA 4S2BA 2ZTKA 3OIXA 1EWDA 3TJXA 5D03A 4NUWA 4WOQA 2QCCA 5G5IA 1F05A 3OBKA 5F2LA 2FJKA 1FDYA 2EPHA 1I45A 3R13A 1QR7A 1LOQA 3M41A 4RLIA 1MZHA 2QAPA 4IQLA 1H60A 2A0NA 3F1QA 3IVSA 4ADUA 1T0OA 2E1DA 2V8ZA 3LBMA 2TSYA 1QPRA 3MP3A 1G4TA 2VELA 2WNNA 2J9YA 4RJEA 1OYAA 3GYEA 3MBFA 3KXQA 3AJXA 4RR4A 3E49A 1KFEA 5I3HA 1K8YA 4IUOA 3EKLA 1OK4A 4CQ8A 5IBXC 3QF0A 5KZMA 1PL9A 3G22A 3R12A 3HPSA 2GQAA 1TTPA 3TXZA 4E2BA 1U5JA 3NPXA 3CHVA 4UFMA 1XCFA 2V81A 3W71A 4QNWA 3CWOX 1EUAA 4N4PA 1TYGA 1MXSA 1OVDA 4NU7A 3KAOA 1V5XA 5D2VA 3L0GA 1FCUA 2GPTA 3SIZA 2YW4A 3S1XA 3LHZA 1YTDA 4PFMA 2B7PA 1W3IA 2X30A 2ZRVA 3NPWA 1JCXA 4GBUA 5HNRA 4WD0A 5AYZA 3TIMA 4BI6A 3E12A 3RK8A 2ZZ1A 3TQVA 5F2MA 4JYDA 1FXQA 3W7QA 3IIXA 5LNRA 4O15A 1DQXA 2ZYFA 4DQWA 3INPA 4JS3A 1QWGA 3OVPA 5U4NA 4FNPA 3R8RA 1G6CA 2OT1A 3T78A 3GXNA 4GJ1A 3S0CA 4IMDA 3RU6A 4TU1A 3F03K 2CLLA 3DHDA 3IVUA 1O4UA 2A4AA 4DPQA 1J2WA 3GVGA 3L5AA 3WJZA 3P84A 1TV8A 2AGKA 3HF3A 1F76A 1JUBA 1M7OA 3SGZA 2QCDA 5HWJA 1C29A 1BEUA 3V1PA 1G67A 4UFLA 4CNOA 2NV1A 3U6WA 3PUOA 1TJPA 3NYZA 4B5NA 1ALDA 3EWXA 4DO4A 1DJNA 1SZFA 4LY8A 2QR6A 2ZA3A 4AHPA 3UNDA 5U7SA 1O5XA 2OT0A 3M9YA 3C52A 1W5NA 3S8HA 2GVJA 3N9SA 2E5CA 4J9JA 2DJLA 3KRSA 3P80A 3L5LA 4I9AA 5D2XA 4ICNA 5EBUA 3GR7A 4JD4A 2G5WA 3LXBA 4BR1A 1LRTA 1A5SA 2ZRZA 3HG4A 3TV8A 4Y90A 3U2OA 4PA8A 1A5CA 3W86A 4WOZA 4UTLA 2A2IA 1N7KA 2VXNA 1WOAA 3C0JA 5AFDA 2H8ZA 4UFJA 1X7FA 1ICPA 4O18A 4ZQMA 4E38A 3STCA 1P4CA 3NPVA 1H51A 4NT0A 4ONVA 3TW7A 5D38A 5FF3A 1KTCA 3NM3A 2HS8A 4Q4KA 5LSMA 2RDTA 4A29A
chains in the Genus database with same CATH superfamily
5EMUA 4EF9A 4PGLA 3OBEA 4M6VA 3E5PA 4JXCA 3SP1A 3CO8A 4L4MA 3MHUA 2H8AA 1Q7QA 1XBXA 3LA4A 1RA5A 1WYIA 4JIRA 3PNUA 4Y2WA 1TRDA 3ABLC 1SMYF 3RX3A 2A6NA 1XG4A 1E4MM 4KT2A 1TX0A 1UPPA 3AXHA 1OYCA 3LEOA 1CCWB 4MIMA 1EJXC 3QQ1A 1LUCB 3P82A 1CPQA 2YEVA 3MDWA 2UY3A 1LE2A 3M64A 4NJHA 3TYUA 1KFWA 3NTYA 1DJWA 3SUWA 1OCNA 2C13A 2VNCA 3T2OA 2PODA 1TR1A 3T40A 1JGMA 3N2CA 3O07A 5DXXA 3QGAC 2J78A 3B8UA 1EPXA 3E0LA 1ZHZA 4RZ4A 4AY8A 1EA8A 1CB7B 2Q9BA 2R7OA 2XM4A 3O3RA 1GKQA 1UUMA 3GKFA 3AMGA 4DAFA 2ESCA 3EWYA 3F47A 2ZXQA 3VIJA 4GJIA 4B3KA 2Z7GA 2I1OA 4A05A 1EZ2A 1I75A 1KCZA 4GYPC 5B80A 1NZEA 3T8QA 1H9TA 4MG4A 2GVEA 1QI3A 1UW9A 2LQGA 3OZYA 3W2NA 4XTDA 3FHQA 3NDOA 3RLVA 4XV0A 2CLFA 4B15A 5AYBA 3W1XA 3RXZA 4AL0A 4M6QA 2X1SA 3GB6A 5CSUA 1BXNA 4H1ZA 4W5ZA 1QPNA 2GOUA 4Q4MA 1ZCCA 2M64A 4YWIA 4QAIA 4K6AA 3GEEA 3CO4A 4HPNA 4JKLA 3W7JA 4XKYA 1Y6DA 4C91A 4DJDC 1WV2A 3QPYA 2BLEA 3L2MA 4PTVA 3BCDA 2Z27A 3GWQA 2G97A 2PC8A 5BWAA 1VGAA 3WLLA 3EKGA 3AQUA 2PDMA 3QY6A 3N6QA 4JR5A 2YL7A 5IDIA 5FAGA 4ZQPA 3WQFA 1C9WA 1B4KA 3TLLA 4UTTA 2OG9A 2GGHA 4B16A 4EPKA 3SCQA 2Y61A 2WOQA 4JW1A 1P0DA 1JD9A 2WC7A 1G4SA 2QUPA 2HBXA 4FLRA 3ZYZA 3CLWA 3D3FA 4DJDD 5E1QA 1W1B1 3O05A 2VFHA 3IACA 3UCCA 1ZS2A 1UP3A 2P3ZA 2NVAA 3FDKA 3QMKA 2GDCA 3RVZA 5L0DA 2WMFA 2VDGA 3T6JA 1GONA 2I9EA 3E6EA 2P76A 7CGTA 5A8QA 4JYEA 1A5LC 3RUBL 3T4WA 1RKEA 1D7FA 1Q7MA 1SZRA 1ZLPA 5D91A 4EACA 1QI2A 4B6IA 3CIVA 4HT3A 2G41A 1BLIA 1J8YF 5CH9A 2PE4A 3VIPA 3TOLA 3APYA 3C86A 1GVEA 3Q37A 1VPXA 2CYDA 4O12A 4YCPA 4LVFA 2RDWA 2IQDA 8XIMA 5PTDA 5LNSA 3I3DA 2YWAA 3NEHA 2BGSA 3EHNA 4NJKA 3TCSA 1DWGM 3GBEA 4EK7A 3TAOA 3AHTA 1R30A 2NQHA 5FAJA 2HDJA 4W85A 3WFZA 4WXYA 1GEQA 2PWDA 1LM1A 4W84A 2PDQA 4M6UA 3TA9A 2E9LA 4UQBA 5CC3A 4HMNA 2PDBA 1EDQA 1ORYA 4AXKA 3TROA 5HR7A 4HTBA 3VGGA 3K1IA 1NU5A 4GPNA 1GOKA 4NTAA 3ZT7A 4UTMA 2BE5F 2ZZ2A 1EJTC 1PBGA 3CMGA 4YT8A 1E1CA 3D5HA 256BA 2X7WA 4W4QA 8CGTA 4P7OA 1LT8A 3WJWA 4GGBA 3N15A 3AS1A 4B9YA 2NUXA 3EKZA 1YXCA 2H6RA 3ZSUA 2WVTA 5CZ0A 2NW0A 3UPWA 2E7FA 3GDMA 1FHLA 5ABFB 3SO7A 3MUIA 3I7SA 4CDVA 2VR2A 4XWJA 3ZLGA 4UTWC 1JDCA 1MQQA 1IZMA 4X3ZA 3BOFA 2X2GA 3SUSA 4YPJA 4ATLA 3KMIA 4GIEA 1JVNA 1NSGB 3VTRA 5I02A 4NNAA 3QW0A 1RY8A 4K8GA 3R58A 1RBLA 1T7LA 4DRHB 7A3HA 3GWNA 3Q67A 2JEPA 4K36A 4UTTC 1H11A 5HPOA 3DN5A 2NQLA 2MNRA 3O15A 1JAEA 4R9OA 3TJLA 2FPYA 1Q2RA 3GU1A 3IAQA 4KKXA 7REQB 3DI0A 3CZEA 5EB8A 4V15A 1V3HA 4RK8A 4URIA 1LBLA 4A3HA 3DAQA 5I0DA 1T96A 1YHTA 3GTNA 3DECA 4DUOA 3F5LA 2WC4A 4B5TA 5F2GA 2HMCA 1VLIA 1BDJB 5CC5A 3O6AA 2KSFA 4WSKA 1R4TA 1G0CA 4Q7NA 5E6YA 2P5NA 4JJFA 1S1RA 1M6JA 1KFLA 4GQ0A 1S7ZA 3H2VA 4FK9A 2HZ8A 2QCNA 3OZMA 4IWWA 1XFCA 4S3FA 2GSEA 5KYYB 2KQ9A 2GJXA 1CX9A 2R1NA 3LSCA 3ABMC 2KGOA 4AAJA 3DUGA 4OINF 3VGDA 1A3HA 2YR1A 1J4EA 3SGUA 1UR4A 3SFWA 4GLEA 2W67A 4PC8A 2PP0A 1BSIA 2EEXA 5FACA 1BYDA 2R1KA 1KCKA 3B9NA 2XTKA 1TVLA 2VEKA 3SYNA 2JF6A 1K6AA 4HNNA 3M44A 3ZVIA 4I44A 4G5DA 1I8JA 3N0TA 4ZO6A 3T8LA 3II1A 5E9XA 4JX5A 4BQ4A 4MZYA 5BMXA 3VMNA 4S3AA 1QCWA 1YE4A 4GO8A 3VNKA 3SJ3A 3VMPA 4HCDA 4P8VA 1IEXA 2IXPA 3QR0A 4IIHA 1NFNA 1NU7D 5AHFA 3VAVA 5KYWB 4GYFA 4H9MA 3QV6A 3TW9A 2I56A 3ABQA 4ICCX 1JF6A 1CBGA 3MYPA 3B8WA 1ODZA 1O94A 3K1IC 2ZRYA 3O2LA 1Q63A 3SCVA 3BOXA 3PTKA 3CSKA 4EX4A 1KQZA 4KMQA 2VRQA 1RPKA 3KS6A 2J88A 2MWQA 1JDFA 2H3DA 2WM1A 1SVDA 4LF2A 2DZPA 2Z2UA 1PTGA 4GYTA 4DJ9A 4B5SA 3HQOA 3PZ9A 3EOUA 3GC2A 3LPOA 3NQCA 3LCWA 3QHNA 1VENA 3WUFA 4MJ2A 2DSUA 1U22A 5T9CE 4TX6A 3QMRA 3GUWA 1Q6GA 4H83A 2QCFA 4ULVA 1C8QA 4LS1A 1EIXA 1V0NA 5AZ0A 1MMFA 4ZTXA 5AHEA 3LRLA 3THAA 2NWRA 3BSHA 3IRSA 4XAZA 4AYSA 3KS5A 3M47A 2HV6A 3DC8A 1BWLA 2RH9A 2DVTA 2PTYA 2D20A 3BSMA 3VM7A 2YKZA 2D23A 3MTWA 5JU6A 3TE9A 1EDTA 4MSSA 5JMUA 2HS5A 4KWWA 3GZAA 5DMLA 2WZLA 1UIOA 3QTPA 1V74B 4E4PA 2BDQA 3P0XA 3OLGA 3VC5A 3HMJG 3O10A 3APGA 1E40A 2ATSA 2I5GA 4N42A 4PMVA 3V35A 3BGAA 5T91A 3C3NA 3UY8A 2ZC8A 1TPFA 1Q6CA 3WQDA 3E9AA 1SZGA 2WL8A 1WKDA 4GYKA 2X1TA 1FH9A 3IK2A 3EGDB 4D9PA 3V36A 2PDCA 3WLSA 3BZJA 4GGHA 1EJWC 3DENA 1UASA 2D4UA 4INFA 5B7YA 2OYMA 4Z2HA 4ZA0A 3QC3A 2YCKX 2OZ0A 3DBPA 4Q32A 3K2GA 3KRZA 2X1RA 4Q4ZF 2PP1A 4P7QA 1ELSA 3RMEA 3VMOA 4D6GA 3FMSA 4L4LA 8RUCA 2TAAA 2PNOA 5BOOA 5C6MA 2PGWA 4RXFA 4TR9A 1NDYA 3O1NA 1YYXA 1AL7A 5HR6A 1ZY9A 2G3FA 3MUXA 4GX8A 4UQCA 1GQAA 1E83A 3P8IA 2OYKA 2IPGA 2FDMA 4H9XA 2FZ9A 1YVIA 2BNJA 2WCSA 3OVGA 4JZ5A 4P7RA 4DWSC 3A21A 1B31A 2QIWA 2RHGA 1DIKA 2DORA 4EE9A 2GQ9A 4NJJA 4HZ7A 1MYRA 1WCGA 4RW3A 1SR2A 3BLDA 1KKOA 5M1TA 4JHOA 3E0VA 1DHPA 5E93A 1G4PA 3TR2A 4UZUA 2OWCA 1E55A 2FTYA 4JFSA 1F6YA 3POHA 1XW8A 3S6TA 1WOBA 2W0UA 5I3GA 5IY5C 2TPSA 5AC6A 2QIIA 4RNHA 2JQXA 3EMZA 5F5HA 4MNMA 2Y63A 4DWSD 1TPH1 3BUVA 2E40A 4HGXA 2HTMA 1VYPX 2VRJA 1DV7A 3ARSA 2NV2A 3G1XA 5LIWX 1YXDA 4JTKA 5I78A 1F61A 1KXHA 4UFKA 4IXXA 2FAPB 4ASTA 1PE1A 3FN9A 5AHNA 4O4WA 3ZSTA 2GSJA 1YMYA 1XLCA 4PMXA 3TZFA 2ISSA 3L4WA 1VFOA 1TPVA 3M4CA 4TQTA 5LGZA 3JVAA 3RIKA 2V5BA 2A6LA 1NWSA 3M0XA 5HUPA 1RV8A 3AO0A 2YRFA 2V3DA 2VHLA 2VC9A 3ONCA 3QY8A 3CV1A 1WX0A 4F8XA 5K7JA 3FFSA 1S2UA 5CAKA 1XD1A 1K9DA 2W4BA 5H8MA 4LDKA 2O55A 1APCA 3TX9A 1Z48A 4K39A 1FTXA 5TNVA 3SCSA 3EGJA 2XLDA 4HHLA 2CETA 3TTSA 4RE4A 5C70A 3DX5A 2D22A 3MV11 3TYEA 4LDQA 4JEQA 2HJPA 3CL6A 4O10A 3M5XA 1XQKA 4N7QA 5C2CA 2PD9A 1W2PA 4AC1X 1ESWA 1L8PA 3BRJA 4EBJA 4DLFA 4A3UA 3UETA 2QUNA 4AZHA 4U9EA 4NTFA 3BANA 1V3MA 2XGBA 1MMDA 2PFDA 3FJ6A 5EU9A 3VX0A 4CQAA 2FGYA 5I07A 3VZXA 4J30B 3CYJA 3I65A 1U33A 4RX0A 4OBRA 4EPBC 1R3WA 1HW2A 1DIOA 1QPOA 3C56A 4YHGA 1O12A 4TX9A 2GOKA 1FCBA 4C6KA 4EWCA 1CNVA 3HNJA 1OFAA 3NGJA 3BXWA 3V5CA 3B0PA 2R82A 5GPRA 3UXAA 2WNWA 1LDCA 4GBDA 1EB3A 4CQ9A 1UMYA 4CN6A 1U89A 4ZZ9A 1NQ6A 5BNKA 3VCCA 3Q4DA 1BVWA 3AROA 4A2SA 1O5RA 1QI0A 1AZ2A 4MY1A 3UYCA 2D1ZA 1ISZA 1JPKA 3R43A 1KGXA 3VX1A 1LT7A 2V3CC 2VVSA 3BVJA 5DT7A 3IJIA 4GQBA 1MI3A 4H9VA 3CHFA 3JRMO 2C16A 3KLLA 4NL1A 4A8IA 3CYVA 4YJWA 3NR0A 1NWRA 3T05A 5GJMA 3P2VA 2DH2A 4PCNA 1ICQA 1W54A 4O8RA 1Q6RA 9CGTA 2QGYA 5CIVA 3ONBA 4JZAA 1RP9A 2VMFA 4JTFA 5I3IA 4GQGA 1VFMA 3NYLA 2BV9A 1R3SA 5AHIA 3CL7A 4Q6XA 3RX2A 4CD7A 1OXKA 4BA0A 4LPCA 1QQ3A 4LDRA 3N1AA 2FZDA 4H3DA 1PZ2A 1EYWA 2XN0A 3AJ7A 3TC7A 2YZRA 4LC6A 4DBSA 4MLJA 3QHMA 3VDHA 2HNHA 4Q8NA 4Z2GA 2INEA 4XZBA 3ITLA 4HNOA 3JSEO 1FHUA 1J11A 6ALDA 4PN2A 4GVHA 4KCUA 1CW2A 4MNDA 4AIBA 3R79A 3RLHA 1P0KA 2QV4A 5C9ZA 2X05A 5D9MA 1WUEA 4OQVA 3BLFA 1B4EA 5HDRA 1D9EA 3CQJA 4TMBA 4EP8C 1BPLB 1DBTA 1E84A 2AWCA 3U48A 4G0HA 2IYLD 4HIBA 1R9XA 1B57A 1AVOB 2QCMA 2EF9A 3V5XA 4ZMGA 2VL4A 4LAZA 4CX9A 2PI6A 4Y96A 1XINA 1KKRA 1B2YA 5I00A 3W70A 1GOQA 3G18A 6A3HA 3OGVA 3FY1A 2DZXA 3LGGA 4PUUA 3T42A 4NAEA 3PBYA 3H4GA 2CNWA 4NIRA 2E6FA 4IMFA 4XAGA 4IHCA 1XIMA 4CIPA 4CBEA 3EEZA 5A95A 3TNBA 1DQWA 3N24A 3TLQA 7TAAA 2YDSA 2YL6A 4F2BA 3RVYA 3DKLA 3W81A 3NZ1A 1QJWA 4G6CA 2YLDA 2R7UA 2F6UA 1VKFA 1EXBA 1E3ZA 5G1MA 1LWIA 4O16A 5B1BC 1KWGA 4IIGA 3ZIBA 4PJMA 3N9KA 1J79A 1GT8A 3C8GB 3BCFA 4EXBA 4XD4A 3W88A 4QLJA 2PDLA 3FJLA 3H2EA 3PTQA 3O06A 1PTDA 4CQBA 2FHCA 3TWBA 1XUZA 4S23A 3SXYA 4E5TA 1Q6OA 1JZ2A 4MVSA 3MKKA 2PS2A 1XJBA 4JGDA 3C4UA 3AS0A 3WNPA 1NH6A 3ZG1A 1S5WA 2YB4A 3L7RA 2YBVA 3ASOC 3SQLA 3PAJA 2A69F 4IG2B 4F0HA 3G8EA 1NTHA 3S1UA 1YAUO 3L4UA 3CBWA 3LGEA 3RHGA 4DLMA 1CGYA 4KGLA 4DWSB 1GYLA 2IUZA 1D3GA 3PVFA 1W2WA 2DT2A 3NQAA 1PCWA 3LV5A 1SFLA 4JL2A 4DRIB 1D3HA 3A5VA 3N2ZB 4UUIA 2RUSA 1CI1A 1LOLA 2YL8A 3RR4A 3CQIA 4ZLCA 2G4FA 2HK1A 4QCFA 5DLJA 3EX3A 3J7HA 4S3GA 5H8UA 4HEAJ 3P93A 4DBUA 1DP0A 3F2CA 1GPFA 1K05A 3A47A 2GWGA 4YL2A 5CGQA 1MXGA 4YT5A 1R2RA 3N3TA 4Q4OA 5KYXA 1VRXA 4WGHA 5BROA 3VKKA 5ECUA 3C0QA 1AW1A 4EWJA 3I3BA 3FEMA 2QCDB 4M81A 4NKCA 3B9DA 4HU3A 4LCSA 1A3WA 1FA2A 2VZOA 3V5OA 1DWIM 1GVSA 1EYEA 5AC8A 1R2SA 5D2TA 5F4WA 4PEEA 1DIDA 2X0HA 1GM5A 4U31A 1QKRA 3WZ0E 4CUCA 3TK0A 2FTPA 3K1DA 3S5NA 2HRWA 3GRIA 1LQ2A 3L4YA 1M1BA 4AF0A 2YCLB 4FWVA 3VCNA 5M17A 4LEQA 2FZMA 5D9PA 4D72A 4EPDC 5H1WA 3ES8A 4QG6A 2R7RA 4NXKA 5DF0A 1BZ4A 2WVVA 2V9DA 3CH0A 2UBPC 3KTCA 4PSRA 1AD1A 1S3TC 3ZVRA 4JQ2A 1EH9A 4RNJA 3VIGA 2OGJA 1WA3A 3DI1A 1QBBA 3L4XA 1IHIA 5A94A 4CS8A 4YTRA 1XKYA 2QYGA 2XN1A 4QSHA 1A0DA 4NZ1A 3RAOA 1HQTA 3UW6A 1L6WA 2HXTA 1DTUA 1UG7A 4O57A 4GISA 4MM1A 2CNWD 4XBKA 2JGQA 3U9MA 3TQKA 4PK4A 9RUBA 3O6DA 4H8HA 2WSQA 1M9HA 2ZC1A 1OG0A 3CT2A 1NF0A 3EJNA 2R8WA 5EFDA 2OQMA 1GVOA 2O0TA 1NOFA 5A1AA 1NBBA 3EH1A 1E9ZB 2W63A 2LP4A 5FF0A 2YQYA 2JIEA 2CEQA 3RYLA 1VJSA 1UHVA 2V2DA 3TZNA 1OFPA 1VHNA 3KHDA 1MW1A 4O0QA 3D6NA 4OTKA 3BO9A 5F4XA 3OU8A 4GIAA 5KYUA 1JR1A 4LUSA 4AZ5A 1XYAA 1P6BA 1H62A 2CBIA 1IE7C 4JQ3A 1OWQA 4NZCA 4MAZA 1XCWA 2WBGA 3G6LA 4R3UA 1MW3A 1XIGA 3TONA 4H9ZA 4WF7A 2DJXA 3LXCA 3NO5A 1XFBA 1TA3A 4JIQA 4JEAA 1Z23A 3EWDA 2HKVA 3DAGA 4F79A 3S28A 3FYPA 1ZCOA 3WMSA 4IJBA 1XKJA 2QJHA 2XUCA 4RPQA 2VQTA 4W8KA 4LT9A 4NG3A 2NUPA 4N4WA 2RKXA 1TFOB 2QF7A 3U0HA 3FOOA 4ZSTA 2C14A 4K7BA 5DCBA 3UJ2A 1SMDA 5B1AC 1M3UA 4GA8A 4IFKA 4QDWA 5B3SC 1TTQA 1Q0FA 3WJYA 1G1YA 2IW0A 4GI9A 3AMCA 1TV2A 5FF2A 3UU0A 4HN4A 1FHDA 5L3QA 1JRCA 2NXGA 4FR6A 4BK9A 2ZIDA 4I8YA 4FNRA 2R94A 3W23A 1JPJA 2C18A 4NP7A 3LPFA 3TDFA 3ITXA 3AZSA 1ZHYA 2OTDA 3MZNA 3WAQA 1R0MA 1S46A 4QFUA 4Z0JA 2VEPA 2ZADA 4L6OA 4UTUA 3TMLA 4GHRA 2QLYA 4JAWA 3EFOB 1VOMA 4GWEA 5TD4A 3GKAA 4ULWA 2ZZ4A 3I6RA 1A7VA 1S5NA 1ITUA 4GVFA 2YL5A 1XWJA 2AU5A 1GUVA 5CEWA 3LD5A 3UESA 1O6IA 3CEXA 4OE7A 5CPNA 1OG6A 1W9UA 4E18A 3EXTA 4CS8C 3QQ0A 3S2LA 2EHHA 3ABSA 2CHOA 2XVNA 4I90A 4GZEA 3S5OA 3WSUA 3BV7A 4JN6A 4XQ6A 2X8RA 1GZ1A 3CHDA 4GABA 4K7YA 2BBFA 1GJWA 2OLAA 1H63A 2FQIA 2GSHA 3NG3A 1O5QA 4US5A 2YKKA 1KTNA 3BLEA 4RZ6A 4NILA 4REQA 3MANA 1UPMB 1FMVA 2CLHA 2V82A 1OSEA 3TVAA 2ZZ5A 4IH3A 2I5QA 1JZ7A 3RRAA 2PBOA 3TTYA 2F6KA 2YXGA 4ZQCA 3K46A 3NZPA 4MFDA 3WQEA 5LNUA 2ACUA 1XGEA 3DFQA 4LUTB 4FNQA 3LBCA 4E7ZA 3B9EA 2ACSA 1EQCA 4W88A 2J9BA 4FXRA 1AMYA 1A41A 2EIJC 1NY1A 4F48A 1A50A 4I9JA 5I24A 2QPSA 3H7RA 4GX9A 4HKPA 5KINA 1TQGA 3MT1A 2EO7A 3UR3C 2Y7FA 4PMNA 1SQ7A 3WD0A 5LIXX 5H8PA 3SEOA 5M5DA 3MUAA 5BCAA 5IM51 4TOQA 3VUSA 3SDOA 4AD4A 1A5BA 2E6DA 3GR8A 3NQ7A 3PZMA 4PB4A 3Q7GA 4JNZA 4IT1A 3B71A 3PBWA 1QPQA 1NDZA 4HCLA 5CPMA 4DUWA 2AAAA 2Y3DA 1GGOA 1IYXA 2WYSA 4MHBA 1FWCC 4R32A 1UCWA 4HNCA 3L5MA 5CGMA 4PTMA 1DJYA 2VC7A 3FGCB 3NZRA 5FF7A 2YLIA 1HVQA 1NSJA 2WHKA 2QCGA 3GXDA 4ZSUA 1HMOA 3RN6A 1J96A 3V3WA 1MZRA 5IBXA 2UV8G 3WG7C 3AGUA 1JDAA 1U30A 2JEQA 3MI3A 2IKHA 4P2VA 3QMTA 4HU8A 4F2UA 1YZAA 2VFDA 1PHQA 4WKAA 4ORIA 1W1VA 2VI0A 1IR2A 4UQDA 4P61A 2GAQA 1F7BA 3H8AA 1UWQA 3ZWTA 3MO7A 1V54C 1TMLA 3LAYA 1JXKA 1M6TA 1MDRA 2DUAA 2C03A 3CZLA 4GG9A 4LTSA 2QVNA 1RK6A 2WZHA 5GNXA 2HSQA 3W1TA 5HATA 1F3TA 4MTFA 3AG3C 4CN1A 4MVAA 2W79A 4D6FA 3WDJA 3NWRA 2YCJA 4YCOA 3PZNA 3HPXA 2GGEA 2X2YA 3K1HA 4OT7A 4LVBA 3WK1A 3M15A 2WC3A 1N55A 1XICA 1XIEA 2VX7A 1EBGA 1UD6A 6TAAA 3R11A 3QTGA 4C65A 3RJXA 1I2OA 2NVDA 5TQLA 4LB3A 4QRNA 1XIDA 1PKNA 4LSBA 2ZUWA 1HXJA 2HISA 3ITTA 2VDIA 4LLEA 1TIMA 4A3YA 2XVLA 2NT0A 3FOPA 3EWWA 2FDSA 1IWBA 4E6MA 5DXYA 1KCLA 1SO6A 2X40A 4GC4A 2ZD9A 5DQZA 4JURI 3V0SA 1R8LA 2OMAA 2PGEA 2XL4A 5HV9A 2E09A 4GXPA 2KYHA 3ME3A 1TPEA 3LCFA 3WQ5A 2YB1A 2YLLA 4C7OA 3NQ8A 1Q6DA 1P43A 4V33A 1AODA 4US5D 3ARRA 4HE8D 4IOTA 1L2UA 1ITCA 4NX5A 3VGHA 2PX3A 4ERIA 3PSWA 2KNHA 4JTAB 3BLKA 3PZIA 2OWXA 3M1CB 1TPWA 3K8KA 4ROPA 4S2BA 2BMBA 1OBAA 1VYIA 1EWDA 3TJXA 1V0KA 1AUEA 3HV8A 3UVAA 1F05A 1OGBA 1SJBA 2E9MA 3OBKA 2J46A 1G4WR 1FDYA 1OW8A 2REQA 1X96A 1XS2A 1HE1A 4A2NB 3FDGA 4PBGA 3MFNA 1Q5MA 1CPRA 3IVSA 2P6VA 1I5NA 1U0BB 1SFSA 1NFGA 2J9YA 4RJEA 1A47A 1R3VA 3ARPA 1FWFC 4W7WA 1XYFA 3AJXA 4UDVA 5I3HA 3GXMA 3UGOA 4CQ8A 4U9DA 2QF8A 3VDGA 5IBXC 3QF0A 3U0CA 1U1HA 1JZ4A 4E2BA 1U5JA 4KEMA 1P0BA 3NPXA 5DANA 3WNMA 3URNA 1SMAA 8XIAA 1FFRA 1EUAA 1TWSA 2Y2WA 4LGXA 1WB0A 3KCLA 3ZR5A 3KAOA 2LCHA 5D2VA 3LM3A 3PAOA 3M79A 4D1JA 2DY3A 3OTRA 4UR9A 5EFFA 3FX4A 4AY1A 2ASRA 1UJQA 4HA0A 2ZRVA 4Z2LA 1LIHA 3NPWA 1JCXA 4HYVA 4BI6A 3E12A 3CAVA 3REQA 2WM0A 4JQ4A 3C2YA 1D8WA 4JHMA 4JYDA 3K1GA 1A3XA 4JTCB 4BCEA 2DW7A 4DQWA 1OY0A 3INPA 4ERAA 4ZXLA 1N2VA 4V27A 4HZMA 2X09A 4GJ1A 4WK9A 2Q8XA 2NV9A 3C8ZA 1LF1A 2VD9A 4LCRA 3IVUA 1O4UA 2A4AA 1IZKA 1J2WA 1E6XM 1WKEA 3EMCA 4YT2A 3LN3A 4WDWA 1BRLB 3KE0A 3L5AA 2I5IA 2AGKA 3SCTA 2HMZA 1F76A 1M7OA 1V4YA 2ZXOA 1C91A 2DT1A 1XLGA 2GDVA 5HWJA 2YL0A 3WG6A 3TD7A 4UFLA 1KGUA 2VVNA 1HKWA 1TJPA 3A11A 3W8HA 1SZFA 3GU2A 4LY8A 4JL1A 1U5VA 1HP5A 2IS7A 2PU1A 4YNGA 3AIRA 1FWJC 3BAXA 4OIOF 1UD8A 1V0LA 1YA7O 1C92A 2O9XA 5AECA 5U7SA 1B68A 3FW6A 3B8VA 2CKRA 2KAUC 1RXQA 5E09A 4QE5A 3WLMA 2GVJA 3N25A 4LUYA 3DJUB 5D2XA 2NQ9A 1Y5VA 3LUTB 2G5WA 4HTYA 4ZO9A 5F28E 4V28A 1AEPA 4D8AA 3AHXA 3NSNA 3TV8A 3U2OA 1M7JA 1NELA 3WF3A 3ES7A 5C71A 2ALRA 1TWWA 1EJSC 3BQ6A 1WOAA 3C0JA 5AFDA 3FJ4A 2G3KA 1J0KA 1WDSA 1XRFA 5D38A 1W1YA 5FF3A 3VFCA 3N29A 1CTNA 2PFHA 5JQ9A 3NM3A 2HS8A 2TODA 5LSMA 2RDTA 2HSBA 4ANJA 4UMCA 1NOWA 1A7DA 2HMQA 4HK7A 3MWAA 1BVNP 1QHZA 3JZUA 2BVTA 2AVKA 4N9DA 3H2OA 1R87A 3LHUA 2DGJA 1OZMA 2WZFA 2GL5A 5DT5A 3CC1A 4I8DA 4O1FA 1TKNA 4C3EA 4QROA 3UZXA 2IBFA 3FKKA 3NQDA 3VM6A 2Q01A 3TSMA 4AWTA 3U5YA 3CHCA 4DBQA 4GK8A 2ICWG 4BEJA 3VD4A 2J0WA 2OU4A 2LSEA 1OF8A 1RZMA 2P61A 4U5DE 3AIEA 3EHMA 4H6QA 4S3KA 3THUA 1E6SM 4QGCA 3WD2A 3LBOA 4LQ1A 3RQEA 2JD3A 3S9IA 2I14A 1E15A 2C0AA 5REQA 2V68A 5JSLA 3GZ3A 3ZT6A 5I3DA 1DXEA 4WJEA 2NUYA 1OCOC 4LRTA 4Z08A 4IMGA 3KWSA 4HPXA 2NQZA 4IQEA 2A1YA 3LTYA 5C9RA 1IT7A 4ROQA 5BUOA 4WDXA 2D5RB 5FEPA 4S3CA 5JP7A 3N6JA 1I1WA 2XLHA 1V3LA 3CV7A 3MY9A 3EPVA 4LYQA 4KNWA 1RQHA 5HA7A 3OLIA 4RV8A 3GD6A 4MZ8A 3PSVA 1GYNA 5FCZA 1UR8A 2DZSA 4J7TA 2VEFA 4I7UA 4QJ4B 3W6YA 2YGYA 2NXHA 5KSWA 2C91A 1W3TA 1OT1A 1TE1A 1V6WA 2HJ3A 3PBMA 5T3TA 3M0ZA 2CZDA 4BQ5A 3APTA 3AWOA 3NMKA 1ZGDA 3KVMA 3TYDA 1JQVA 1MMAA 2WMGA 3H24A 5HULA 4KCTA 3GBDA 3OYZA 2YLAA 4GIYA 1PB0A 3MP5A 1EO7A 4JQAA 2Z1VA 1ICSA 3IUDA 4JTDA 4Y9NA 5I3JA 2E25A 2P1FA 3KWXA 4PMJA 3RGTA 1YLMA 3QLLA 2GQ3A 2PPGA 3QV7A 2ZVRA 3OQEA 1OK6A 3CEPA 4IJCA 3UP8A 2G50A 3M4HA 4ZOEA 3STFA 4WDTA 3MPGA 4AD0A 3CT7A 3R89A 3TR9A 2A5HA 3RRXA 1SM9A 1AK5A 1DXFA 3FNDA 1NU9C 4G7EA 1SR0A 4AK9A 2Y5JA 1NFPA 1FHVA 3SCRA 3SUVA 2XZ9A 1BVZA 3CZGA 3DJNB 1RJRA 4UBPC 1MMNA 4NJGA 4L80A 3LQGA 2FJUB 3WK3A 1JYVA 5HAOA 4ZVJA 2XXAA 3TFXA 2VQUA 1W3KA 3GNXA 4EPEC 1M2VA 1X8CA 1AH3A 3CUFA 4O1AA 1MUMA 3UNTA 5HWMA 1MNSA 3LXAA 1QMLA 1NOUA 2ZX7A 3C0LA 3P5ZA 1MQPA 2V0TA 1EJ7L 1ZZMA 3TTQA 4LANA 3E2SA 4CGTA 4FOKA 4ICMA 4O4VA 5EL1A 3W26A 1I2QA 2WJEA 2FYMA 4WRHA 1XBVA 2OOGA 1W1ZA 3WD3A 1KXTA 3ZR4A 1GTEA 1NWTA 1U83A 4PTNA 2XIIA 5JH1A 1J0HA 4DXWA 5FD0A 3I6TA 3U5SA 2FHFA 2Z2BA 3O63A 1GQLA 1W5OA 4FF5A 1UKOA 2BASA 3WLHA 1DEDA 2VZTA 2FKPA 3K13A 4BF9A 1IXNA 2E9BA 4DBWA 4XZLX 3URBA 3JUGA 1GZJA 1E1EA 5TBOA 5DEZA 3T4RA 3JU2A 5A6SA 5D9OA 3E0WA 1C90A 2FGZA 3CASA 1G9HA 5HNTA 2WPGA 1ECQA 1BXCA 4M19A 3QV9A 2PRHA 3WEMA 1LM3B 3Q6MA 3WLOA 2OR2A 3LMYA 4EBKA 5T26A 4F0RA 3MW7A 2R25A 1MRAA 3UA3A 4I9TA 3SCOA 5RUBA 1TSIA 4NYUA 4JCZA 3OHMB 3B0XA 4DIAA 1DWFM 3S5YA 1XPGA 3S2NA 2P8CA 3CGTA 4PCFA 2R6OA 2R7VA 5CBBA 2AWYA 1B1YA 4B4FA 1JD7A 1FY6A 1VYKA 3UNGC 4IFRA 4X63A 3Q45A 1XPYA 2ZUMA 4GH3A 3GNDA 5BYWA 1AZ1A 5DRIA 4C6OA 1OC5A 3QPEA 3WUBA 4JQ1A 4YTQA 1XIBA 3GK0A 1D1CA 2NSXA 3DU0A 1ADOA 1XISA 1ZZPA 4V2XA 3M0LA 4GNJA 2ACRA 3DDMA 3H54A 3S5SA 3N2TA 4DVYP 3LI1A 2MANA 2ZUVA 4M1BA 3RX4A 1ZTVA 1NVMA 4RDYA 4CU6A 4N0RA 3GEIA 4H6KA 1WPCA 1QATA 1OX4B 3DFYA 1D8CA 1QO2A 5G1TA 3ASNC 3PANA 1E6PA 1FH8A 5D30A 2AAMA 1ZJAA 1Q6FA 1R7OA 2WLZA 2QDDA 5A8GA 3NDBB 1XSJA 3GU9A 1AG1O 1SJAA 5FJJA 4Z42C 3KFTA 5FOOA 1QHPA 1CGTA 1FMWA 3PCVA 2Y6ZA 4EIVA 2XVGA 1IT8A 2OZ8A 1EOKA 2PTDA 1CGUA 1GNXA 1F5ZA 1SSDA 4GYJA 1YDNA 1O1ZA 1ZHXA 3S5ZA 5L0HA 3G1RA 5TF0A 4XZ9A 1IEVA 1FQ0A 3NA8A 6TIMA 1P1MA 5LNVA 5M2FX 1T6MA 2WMIB 4KWOA 1E6ZA 1M01A 4FS9A 1SR9A 1B3ZA 4AIOA 3M5ZA 3W2MA 2YA0A 2AL2A 2J13A 2VB6A 1XRTA 3UGVA 1JDEA 1ZP4A 4KFPA 2BFGA 4LB4A 2BSLA 3EX2A 4JBRA 1CGNA 1CIUA 4PMUA 1LLZA 4OIQF 2WVSA 5DRCA 2WWCA 4MJZA 4I1MA 2PURA 3NDZA 2DGAA 3F5JA 5DCEA 2QPXA 3GM8A 1JJKA 4UOJA 1TFVA 1UMLA 1T9KA 1CENA 1EBHA 3LNPA 3NSXA 3R5EA 3QJAA 3ZOAA 1E6NA 2PAJA 1FBAA 3ICJA 5XIAA 1W37A 1XLKA 3WDRA 3IVTA 2H3BA 1R3TA 1SYTA 2HXUA 7TIMA 3S29A 2AMXA 4NYYA 4JIEA 3LQLA 1A5AA 4DZ5A 2V38A 5L6UA 4F0KA 3G0SA 4K7VA 3WDPP 3WL1A 1TV4A 3N4FA 4C1KA 2A1DD 2WAGA 3M7SA 1DHKA 4G2DA 5K4ZA 1R3RA 5BU6A 5J5RA 3NZQA 5E33A 2GK1A 2POTA 3E0FA 1TB3A 2G3IA 3KZSA 1J10A 4IMAA 2CNCA 4GIRA 4WLCA 1XQLA 3A3HA 3VD5A 3N18A 5CCZA 1BF2A 3HGJA 4FP1A 3VGFA 1OCJA 4O53A 1Z3IX 3CM4A 1SJDA 1ITQA 2QE9A 3CQ0A 4TV5A 1IXPA 2YIHA 4QG9A 4AIUA 3PHF2 3FSTA 4H7CA 4K1WA 3G1HA 1UWIA 5TIMA 3WH9A 3PJXA 3GVWA 1KW1A 4D6DA 1W9DM 4GUIA 4JTIA 3FJNA 1W3LA 1E5NA 3NDYA 5C8BB 3NQMA 4ES4A 3Q65A 3ZS4A 4Z2IA 2IM8A 1TVPA 5A6AA 4BI5A 4O1CA 5A2CA 4QQ3A 3O6YX 2NPUA 4U4MA 1RBAA 3W6MA 3ALGA 3T0CA 1YNYA 2C6QA 5CGTA 3EPMA 1TWAA 4QS6A 1JPDX 5COMA 3IGHX 5G4WA 4DYKA 2AKZA 2J7PA 3QVYA 2PC4A 4HHHA 2OSYA 1OFOA 1PCXA 1OC7A 3BC9A 3WUEA 5DS6A 4AVFA 4P5UA 1F74A 4GFSA 5C9WA 3W2JA 4IP7A 2WKGA 2QJIA 3B9AA 4CJGA 4CCEA 3FOKA 1DWAM 3MVTA 2JKPA 4UNKA 4BJ5C 4IWBA 1RPXA 2PWUA 1YDYA 3T0BA 2BHZA 1TCMA 3K4WA 3SCWA 3RO8A 1T01A 2ATMA 4AFYA 3U3BA 3W87A 4YK5A 3H65A 3I7QA 3HPZA 3MCNA 1VIZA 3LTSA 2QVHA 4G7OF 4ZQRA 1T6IA 2L6HA 1M53A 1LUCA 2PUZA 4TX8A 5HQLA 2ACQA 2Z7KA 1JFHA 1F8MA 3LSBA 3KL4A 5FEWA 3E9VA 2EG6A 3H7UA 1VC4A 4LALA 1KO0A 1M56C 3ATZA 3CJPA 1BAGA 5K9CA 1S5TA 4YIWA 3TTEA 2LFFA 3B8DA 4LOCA 3N2MA 1TPB1 4HN8A 4W8PA 1H4PA 3ZLHA 3W38A 1J6OA 3B40A 1SGJA 3IJLA 1Z7AA 2ISWA 2A3LA 3NKDA 4GZJA 5C0QA 3AXKA 1TFKB 3AYTA 3AHZA 1YQ2A 3MMWA 4D8LA 1XLEA 3EG9B 1ZAJA 2J79A 2PDXA 1MDLA 4FESA 3UYIA 1JQXA 3CPUA 1EA9C 4PUDA 2WKLA 1EFZA 3POCA 1SW7A 3VOGA 5L3VA 3W7OA 4DN1A 3I6EA 1YTEA 4X0VA 3TAKA 4K3ZA 1NLXA 3EGXB 1QOXA 4ENLA 1GJPA 3BZGA 4MB5A 4UNIA 3TQ0A 3UJEA 3Q6NA 1LG2A 2ISFA 3FAJA 2ASHA 4ZCWA 3V4BA 2EGZA 1LCOA 6ENLA 3RLUA 4JTEA 1I1XA 4FZIA 4LEFA 3DD7A 2PDPA 2EAWA 2A6EF 4LUIA 4KFNA 3BGJA 4IGHA 2CXEA 4PUWA 4JICA 3E1F1 4W8LA 3LV6A 4V1YA 1KM4A 3THCA 1AUSL 1OFQA 3VO0A 4EVZA 3R0UA 3HOJA 3YPIA 1B5TA 3GDKA 1FDZA 4PTXA 2IPJA 4OHQA 4ZL1A 3DXIA 4ADSA 3GWLA 2QXWA 3B9OA 4E8DA 1BSLA 1WAUA 3HB9A 4FX8A 2VR4A 4NAFB 4LAKA 2PTWA 3S9ZA 3V1HA 2CESA 2VM8A 3VZZA 4AD3A 4MB4A 1YIXA 3TULA 3IEEA 2NSFA 4CD4A 3L4ZA 2FVLA 5ENLA 3N11A 4LAMA 4TXEA 3HJZA 2A0BA 2DU2A 5F1VA 2QUVA 1H50A 2DH3A 3AZTA 3U9IA 2VGBA 2NXIA 2QY9A 1IWAA 4WDUA 3EYPA 4G9PA 4XVEA 1Y7VA 3QC0A 4HPHA 4IZGA 1ZALA 1H5VA 3EWZA 3LMZA 1QW8A 4PB3A 1CEOA 3GSMA 2VZVA 5G2IA 4AMAA 5F1UA 3W7IA 4I9MA 3U2EA 4OOUA 1J0YA 1K9TA 2R9RB 4N06A 1BG9A 3DHPA 3K66A 1SUXA 3K5XA 1ZL1A 1ST6A 3GHRA 5DCDA 1T6UA 4ZENA 1QI5A 5BRPA 4WJ8A 1EX5A 2G4JA 1A4MA 3RDKA 2D2JA 3H2AA 1FWIC 2FH6A 4UXDA 2ZX5A 1VBHA 5E0KA 1PKYA 1XX1A 3GM1A 1DORA 4IJRA 2HK0A 2ONEA 2GJRA 2J74A 3PUGA 3NYMA 3L9CA 3U4AA 3RPMA 4AZBA 1O7AA 5MKGB 1H7NA 4IIBA 3WQPA 4YU1A 2FGBA 3G1FA 3OEXA 3JSZA 5HQEA 2YPIA 4Q8MA 3G24A 2HJMA 3WNNA 5CSSA 4RKAA 3R94A 3KRBA 1S1PA 3W7EA 4IPIA 1ZENA 4NQ1A 4AHQA 3UWVA 3STEA 3W28A 1ZW3A 1I2RA 4QS5A 1Q6EA 2C3ZA 3COTA 4AVNA 3PJWA 3GAKA 1K7EA 2P8BA 3RW0A 4O6MA 2H90A 1EA0A 4GI4A 2Z1KA 4S3JA 3E3HA 3BLOA 1HJWA 4C6DA 4L7ZA 1EHNA 5ABFA 5C55A 4JTSA 4Y7EA 4E0IA 1ODUA 2M4EA 1UZ1A 2Q02A 3M07A 3T2PA 4TO8A 3Q94A 2WSRA 4BJHA 1WN0A 3L66A 3IIPA 5FEXA 3IHUA 4IISA 1K7FA 4U5IA 4QP0A 1ZJHA 2IXMA 3GNNA 2VENA 3H26A 5B7ZA 3BH4A 1LLWA 3WQGA 4LLCA 2J7CA 2EJAA 1QDSA 4UOQA 1JCYA 4DEFA 1XP3A 2YL9A 3CHEA 5ABTA 5KZEA 4JY8A 3W7PA 2GGIA 1U5HA 2W9YA 4GY1A 3BSGA 4X22A 2NLIA 7REQA 3AG4C 2V5CA 5CSYA 4XISA 4WGYA 1JEZA 1AJ0A 1EC9A 2L81A 3B04A 3JTLO 1RD6A 4PUJA 4ZXOA 4EAYA 1UOZA 4JTLA 3P5YA 2CLKA 2L9JA 1D0XA 3EQLF 1WZMA 3DM9B 3TYBA 1A53A 4JEBA 1HKIA 1PSCA 1XSIA 5KYNA 2EG7A 4HOZA 4YWQA 1TQXA 5G2WA 3SY1A 1UWAA 4NZ5A 4OWGA 2J6XA 3HN3A 5KYYA 4C7GA 5FA5A 5HQMA 4XTIA 3EOOA 4WR3A 4CD8A 4AIEA 2V6AA 4C6PA 3URQA 2A3HA 3JCUQ 1V03A 2WQDA 4NRSA 4W9TA 2X41A 5D04C 3R6IA 3W1AA 4C7DA 2W6RA 1AQHA 5CAHA 1OD0A 1VCVA 2P3EA 3GH7A 3DC0A 2FVMA 1POKA 1R46A 2P1AA 3WLPA 1BF6A 1E71M 1KM1A 3RITA 3BLIA 2J9XA 2WB5A 4JFTA 3GEHA 4PMDA 4NZ3A 5KYWA 2E77A 4JTRA 1WQ5A 3O7UA 1CWYA 4QJ1A 5IXEA 4HU0A 2W92A 2P0IA 3NMIA 1E5JA 1QOPA 3IJDA 3PTMA 3KYJA 1FWBC 3M6DA 2E4TA 4DPPA 3VOFA 3WK0A 3VIKA 4PRRA 1TCDA 4WX2A 2BY2A 4IF2A 3EXRA 1CXLA 1TUXA 1TUFA 3EZIA 3DFPA 4PB5A 2CW6A 5K3VA 2DIKA 2HNEA 2L6FA 1OD8A 2P50A 3C5QA 2AGTA 3EDFA 1R2TA 4WXZA 1Z44A 1AQ0A 3US6A 3DE8A 1TV5A 2QJJA 4UWMA 4K38A 4GYPA 4BG0A 4MW3A 1TWGA 4U5KA 3QYQA 5BRBA 3P14A 1UBPC 1Y5XA 2O9PA 1J18A 1B9BA 4XWUA 2CXGA 2Q9CA 4J7RA 3AMKA 4FLSA 2XPKA 1RXOB 4QBXA 1CLVA 3MDUA 3UG3A 4DZAA 5GNYA 5CJNA 4AC7C 2F8QA 3QLDA 1J9YA 2CDQA 3LK6A 4YYCA 4CKQA 2Y3HA 1W1PA 2BGQA 5FI8A 3DG7A 4E4UA 1HE9A 2OPJA 2I8BA 4Z2KA 1QNRA 1ONXA 3EX6A 3SEPA 3VYLA 1ZFJA 2XFFA 1HF6A 1RHCA 2IKJA 2DP3A 2IMRA 4Q8UA 1KV5A 3RKOF 2G3JA 1R9YA 3CAWA 3EB2A 3MU7A 4OJYA 2R1MA 4KF1A 3BW3A 3GXIA 4L9XA 3W01A 2INFA 3ABRA 4GC3A 2GDUA 4L65A 4LXFA 3W1LA 4NNBA 4I6VA 5M3WA 1IQ8A 3HQPA 3GHSA 1XDLA 3ZR6A 2EXOA 3NJ3A 3GE7A 3FHDA 1Q65A 6CGTA 3G3DA 4GRSA 5CPOA 3MB9A 5BQGA 3EGDA 2WJZA 4Y9MA 5HWNA 1V93A 4KGJA 3UMIA 3UWZA 4JVSA 2DSVA 3BICA 3KCOA 1L3PA 2CKSA 1PAMA 1CGVA 4GQQA 2CLOA 3NL3A 3AXMA 3B8IA 1SO3A 4GINA 1PZ3A 5JVLA 3D47A 3KPHA 3KBVA 2JALA 4PUMA 3QOKA 5GJNA 3DXJF 3HPFA 4BJ1A 3M7WA 1ZSXA 3L34A 5ABGA 2CC0A 2WO5A 1E9YB 2J45A 3IQ5A 4LJ3A 4GXWA 2RGMA 4IFKB 3BK0A 4XPXA 1PX3A 1UP2A 4FB7A 5CZSA 2XVKA 4E17A 3W24A 2VP8A 6XIAA 2P0OA 3ZVHB 3PZTA 3IUIA 1IXOA 2ZOXA 2X7VA 4K0DA 1JCMP 1VB9A 4RE2A 3QY7A 4MMWA 3SUUA 2UUHA 1KNYA 3W7NA 2PWFA 1TE6A 2Y7DA 1FP9A 1PCKA 1GPWA 1PZ0A 1BQGA 4UOZA 1OXBA 3RQGA 3QZ6A 4MLRA 3VOIA 3VUPA 2E5DA 4H8VA 4N4QA 4AE4B 2NSGA 4E3TA 3CU2A 4AX2A 1JPNA 1TTJA 4B91A 5A8OA 2X42A 3NYJA 5I6SA 4FPSA 1YXYA 1V7YA 3ABOA 2Z1XA 1E4LA 3L8IA 3T09A 2I15A 2G3VA 3SW6A 3AFBA 3I5QA 2G0WA 4QLKA 4MVRA 2PGFA 1MSSA 1VTMP 2H9AB 2ON3A 4U28A 1WP6A 3VOCA 3M1ZA 3NXLA 4HYRA 4W8AA 1KFBA 5AZ1A 3OZOA 1OB0A 1DJIA 4HD5A 4B2DA 1MEWA 3JR2A 1IXQA 2E1WA 2Y0FA 5JIPA 3IIZA 2LD6A 3RLGA 1ZNNA 3WNOA 1UQYA 1XGZA 5HJYA 5CC7A 4YT4A 4LS0A 3L2LA 4DY1A 2YA1A 1XF0A 4JKMA 3TN6A 3KZPA 5CJMA 4ZGYA 1M7XA 5D33A 4R85A 2HZGA 3L0NA 4B5UA 1GW1A 5DMNA 4AD5A 3V18A 4PSPA 4UTWA 4DXVA 3DFNA 2VFIA 3KBSA 3PF3A 4JN8A 1H1ZA 5CG7A 4KBXA 4A35A 3PWIA 5D02A 5C9UA 2DT0A 3SN0A 3IS4A 3V5ZA 2V2HA 4CVUA 4IPLA 1WKYA 4WJ0A 1EQ1A 3HG3A 5K0IA 3P62A 2B0HA 3EB3A 1RCOB 2XVPA 1A5UA 1US3A 2O7SA 2JKEA 5FKYA 1DTNA 2A85A 4HYWA 3DGBA 2XZ7A 3G0XA 2B0JA 3WBXA 1X98A 4XPWA 2JBMA 3R2GA 5I23A 3S4TA 4RDVA 4B5WA 4K1OA 1ONEA 3W7RA 3H4XA 5LKYA 4KIRA 2OEJA 3W84A 4NZJA 4ZOBA 4ZQNA 1I60A 5JBFA 3EDJA 2WZEA 3FDQA 1XH2A 2J8WA 4GY7A 2DZVA 4IMEA 1S39A 5K2ZA 1W5MA 2G62A 3HNKA 3HTWA 1KFCA 4EKJA 3KOZA 1OCZC 2JX0A 1RA0A 3BEHA 1MMGA 1B30A 2HVMA 1EP3A 4O1DA 5DY3A 2OO6A 4FO4A 3A24A 5COFA 1CB2A 4A8NA 4MS2A 4JTGA 2OGYA 4TTUA 1KRAC 1JZ3A 5AHLA 2BXVA 3OEOA 3S90A 3I68A 1DKWA 2ABBA 4YJ5A 3QSRA 5L0IA 2FPTA 4RE0A 4KS0A 2W9MA 3T9OA 2OZTA 4ALDA 4ZODA 3WNKA 1A7EA 3E02A 4HB7A 1KBIA 2QW5A 5CBIA 3LX9A 4H9UA 4F0MA 1OINA 1LWJA 3OO2A 3OW1A 3L4TA 4YVPA 3BJFA 4EWND 4XPYA 4WKHA 3VNYA 3GIQA 3WLNA 1E6RA 3MZ2A 5BOFA 5EA9A 3CZKA 5EHHA 2BXZA 2ZFAA 3SURA 4FIQA 4RPPA 4AISA 3ARTA 1UB3A 4RV3A 3KP0A 3MA8A 2HV7A 3RM8A 4BZYA 1F4HA 1LL7A 1GG0A 3EOLA 4HSOA 4TUFA 4U2ZA 4H7ZA 2D2HA 5EK0A 3S84A 3C63A 3HO8A 1MEHA 2YJQA 1K1DA 3EDEA 2V3GA 3MMTA 1C8VA 3IIOA 3MSDA 4Y9OA 3GR4A 2D69A 1JYWA 1KFJA 4Q4QA 4B2DD 4NI8A 1ZBWA 4HZ6A 4PTDA 4ZO7A 3WENA 2XIMA 3AYVA 3WQOA 4HBKA 3QEZA 1RLDA 1TZ7A 3PULA 1FDJA 2YZSA 1WE5A 2G96A 1G5AA 4GKLA 4GNVA 1VZWA 1WXZA 5M03A 3T7VA 3HIJA 2EPLX 1JIBA 4ONSA 2PWEA 1S2CA 1XWYA 5CSRA 2V30A 4W87A 1Y8BA 5D8WA 7XIMA 3BAKA 1PWMA 3IPMO 2QCCA 4IGNA 1UWSA 4LYKA 3IANA 3VD9A 2EPHA 4L5ZA 1PWLA 1QR7A 3N4AA 2ICSA 3AIWA 1MZHA 3OGRA 4IQLA 1H60A 2A0NA 3G4ZA 1AQFA 4DAIA 4M0XA 3LBMA 1AVAA 4MWAB 2VELA 2J25A 1OYAA 3DG3A 4RR4A 2ZUTA 4Z1YA 3PPGA 1U2YA 4W89A 3F46A 2OB3A 3C8GA 4IUOA 4F66A 3EKLA 4G56A 5KZMA 4W86A 2DZBA 5BQIA 2R7TA 4E4FA 2ISDA 1LWHA 2FZNA 3HPSA 3H4WA 3CTTA 2CYGA 4DVZA 3CHVA 3G5EA 2DZAA 4UFMA 4Z2JA 1XCFA 3W71A 3WNLA 3CWOX 1YARO 1TYGA 4IG2A 4KCWA 1OVDA 4NU7A 1VFSA 4J5NA 3CWHA 1FCUA 1T6QA 2GPTA 2WXDM 3CZ8A 2YW4A 1VFHA 4PR4A 1UH2A 5CQ1A 4DWSA 4PFMA 2B7PA 2VC5A 1W3IA 1F8IA 4JOMA 2G8ZA 3GFXA 5KZ6A 1JGIA 3TIMA 1VLSA 5GNZA 1JYXA 2OOCA 4J40A 4FOJA 1XYMA 3AQCA 3W7QA 2HWGA 5LNRA 1P48A 2Y5SA 1UH4A 2XIQA 3MS8A 3H21A 4XD5A 2DSKA 4FNPA 2J8FA 2ZX6A 1G6CA 3BAIA 3T78A 1NWUA 4LY4A 3RU6A 2EIKC 2CLLA 4J32B 4CNUA 4U3AA 1JDDA 2XG9A 4JFUA 2RD9A 4PACA 3NSMA 3WQ6A 4JE9A 1E73M 3AYRA 5AC5A 2PD5A 1JUBA 4QEEA 2QCDA 1TX2A 1ZUAX 2WANA 2WVQA 5C7VA 3UG8A 1G67A 1RP8A 4CNOA 3U6WA 3QZAA 2GUBA 4XZIA 4DNHA 3EWXA 4DO4A 4I5RA 3SZRA 2ZE3A 2ZA3A 4Q8OA 1D0YA 4C90A 1O5XA 2OT0A 3CNYA 1Z63A 2YCLA 2Y8VA 3B9QA 1W5NA 2XU2A 3AYSA 2E5CA 4ER9A 2QS8A 2H7BA 3P80A 5CPSA 1L6GA 1TV3A 4LBUA 2F9RA 4BR1A 1LRTA 3HJEA 4Q4RA 3AHVA 2J7DA 3H7VA 3HG4A 1QTWA 4Y90A 4PA8A 3W86A 4WOZA 1JR8A 4UTLA 3OGSA 4A4AA 3ARXA 5CLTA 3DZAA 2VXNA 3FAXA 3GTXA 3IQTA 3SXKA 3BDKA 1U1JA 1S2WA 2H8ZA 4UFJA 4O18A 4ZQMA 2O9TA 2Q9AA 4NT0A 1D2KA 3LLKA 4D1IA 2PDIA 2PDWA 4D4XA 4P8XA 2Z24A 3T0AA 2R02A 4ZR8A 4XEVA 4UZSA 3GANA 4OOZA 3RYSA 1EQPA 1DVJA 1GZGA 1HJSA 2ZXPA 1OYBA 3N6HA 1V79A 1VEPA 4MNKA 5IOBA 1PD0A 1W5QA 5AYXA 2NG1A 2INZA 3S1VA 3K8LA 5DS4A 1W6TA 4RL3A 1YYJA 4DB7A 1FWNA 3M6YA 1KQYA 2GLKA 4JNMA 4L6HA 4O0ZA 1FWDC 3C8GD 4ZFMA 3VINA 2V3FA 4FA3A 1VBRA 3KBMA 4M5PA 1HMDA 4L64A 2Q7RA 1TWIA 1E3XA 1EEXA 4KRZA 2CERA 3ZC4A 4DO5A 1GVYA 3HQ1A 1QNVA 3W82A 3WH6A 4XK2A 3AQBA 2J9ZA 1UZHA 3VVGA 2PDYA 3L12A 3ITOA 5EMYA 5KETA 4NY2A 4DBDA 1GWJA 5BZAA 3A5FA 3OB8A 2YLGA 3TJ6A 2FMNA 3SUTA 4AWUA 4O50A 4FHAA 4CQDA 3B29A 2J4GA 2PX0A 4KCVA 4AG0A 3PM6A 5XIMA 4K2SA 3TJIA 2ADAA 2RFGA 4JDYA 5AY7A 3VD7A 1FWEC 4PRWA 3BLLA 4C6BA 3L0IA 1ADSA 4U5BE 1AL8A 3VIFA 1HUVA 4C3DA 3L21A 3VKJA 9XIAA 2A79A 1MNEA 2CZVA 3GW0A 1ECEA 5G2HA 4U33A 4WHBA 3KVKA 3NL6A 1PIIA 3VKDA 1GVRA 2DUZA 3W7HA 3WQ4A 2I7GA 1HVXA 4H41A 5FZTA 2XISA 3WODF 4D6IA 4AB4A 3N17A 2TYSA 1A49A 3NL5A 3EFOA 3TQOA 1B3WA 5T1DB 3OWTA 3W73A 4HMDA 1VYRA 3LI0A 1OFDA 1O60A 1QSPA 2QUTA 4UR7A 2AQWA 4E2DA 2NUTB 1WWPA 3KHJA 2V5DA 4F0SA 3AIUA 2Z1BA 3WQ8A 4MTOA 1WNOA 1K4HA 2D24A 1WBJA 4LH8A 1XHGA 4ML9A 1XBYA 3IK4A 2J7BA 4XEFA 1W3NA 3BW4A 3F4CA 5L0JA 3AS2A 1RALA 3IJ9A 4E2VA 2CFFA 2VUNA 3PR2A 4HMEA 4UR8A 4S3DA 3KBJA 1HY5A 1R85A 2GVGA 3KTSA 3FYYA 1W1A1 2NX1A 2OX1A 3LGDA 5HBFA 5H2ZA 1H7PA 4PJJA 5E5CA 4K8HA 1CGWA 2VUYA 5A3HA 3JZEA 3S6DA 2Z2AA 2IPWA 1KNWA 4LC8A 2C04A 2BXYA 3R7CA 3NOEA 3VCRA 3S2MA 3MO4A 3GXPA 1LG1A 3KL5A 3IQ6A 3AI0A 4LVAA 2VEIA 1PV3A 5LHEA 1ISXA 4K37A 1YEYA 1R38A 3RCMA 5CC6A 1OHLA 1W56A 1K04A 4W8BA 3NO1A 1JULA 4LUTA 2GGGA 3ZIZA 4IGGA 3EPOA 5DQTA 3P81A <