3B0UX

Trna-dihydrouridine synthase from thermus thermophilus in complex with trna fragment
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
312
structure length
312
Chain Sequence
LDPRLSVAPMVDRTDRHFRFLVRQVSLGVRLYTEMTVDQAVLRGNRERLLAFRPEEHPIALQLAGSDPKSLAEAARIGEAFGYDEINLNLGCPSEKAQEGGYGACLLLDLARVREILKAMGEAVRVPVTVKMRLGLEGKETYRGLAQSVEAMAEAGVKVFVVHARSALLALSTKANREIPPLRHDWVHRLKGDFPQLTFVTNGGIRSLEEALFHLKRVDGVMLGRAVYEDPFVLEEADRRVFGLPRRPSRLEVARRMRAYLEEEVLKGTPPWAVLRHMLNLFRGRPKGRLWRRLLSEGRSLQALDRALRLME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis of dihydrouridine formation on tRNA
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase/rna
molecule keywords RNA (5'-R(*GP*GP*(H2U)P*A)-3')
total genus 126
structure length 312
sequence length 312
chains with identical sequence Y
ec nomenclature ec 1.3.1.91: tRNA-dihydrouridine(20) synthase (NAD(P)(+)).
pdb deposition date 2011-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01207 Dus Dihydrouridine synthase (Dus)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1460 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3b0uX02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3b0uX01
2RFGA 3NQVA 1H1YA 4X9SA 2Q8ZA 1GVOA 2YSWA 3GDRA 1G4PA 3HJZA 1VRDA 3W9ZA 4MLRA 2I9EA 4S2CA 2AQWA 2TRSA 3QYQA 5CPNA 1LOLA 5KTLA 4DPQA 3P61A 4FF7A 1RQHA 2QCHA 2FPVA 3NPWA 3O15A 2B0MA 4N9CA 4ORMA 4WXYA 4AAJA 1G69A 3NQ6A 1GVSA 2ZRUA 1MEIA 1VQTA 5HUPA 4LNYA 1EA0A 3UQNA 2E6YA 1XI3A 4JYFA 5FEPA 4N6EA 3UWYA 5D30A 1SFJA 4A21A 2PURA 2BSLA 4KFOA 1W5PA 3ATZA 2DZWA 3WFAA 2BZNA 3ZFHA 2HS8A 1FWNA 1PCKA 4LC6A 3QPZA 3IVSA 3IVUA 1KW1A 3KOFA 1S3HA 3NL5A 3IV3A 3N9SA 2VFGA 4JY9A 3SI9A 3LBMA 3GXNA 2CLHA 4ZQCA 2O7QA 3W2MA 1R30A 4HT3A 4JTLA 4TR9A 2VOMA 2DZTA 3PBVA 3DH7A 1RZMA 4GJ1A 1VH7A 3EWUA 1GJPA 3LOTA 5TIMA 3B06A 3W7JA 4HSNA 1EWDA 3W7HA 4JTIA 1FDYA 2JBMA 1AL8A 4R53A 3GZ3A 4PH6A 4MFDA 2NV2A 4DELA 5I3JA 4R33A 4MKNA 3L5MA 3W1NA 1A5AA 3BPWA 1Q6OA 1GT8A 2CU0A 2YCEA 3C2OA 3IVTA 4POCA 4RXGA 4GUFA 4XQ6A 2TYSA 1D3HA 1O5XA 4JY8A 4OV9A 1SW3A 1PE1A 3C52A 4IX0A 3W75A 1EUNA 4AF0B 3P67A 1KM2A 1TV5A 2A6LA 3BG5A 3G1AA 2Z0IA 1W31A 3LLDA 2OT0A 4NVTA 3TQVA 2VC6A 1WDWA 3LTPA 4CLMA 1XBVA 2ZZ4A 5MHBA 3A9IA 2BX7A 3W83A 4CNNA 3PY2A 1YDNA 4R7JA 4Z0JA 3FLUA 4MZYA 4IMCA 4M6PA 3UWVA 2NXIA 3W1UA 4NUWA 2EHHA 3W88A 2QDGA 1KV5A 4LVGA 1D9EA 4C1KA 3HMJG 4O1CA 5DBTA 5FI8A 5AB3A 2E77A 4DBEA 4NNCA 3UY7A 3CEPA 1OYCA 4HSOA 1TPC1 3OVRA 1M5WA 3GXPA 3ABQA 3M5VA 4O1AA 5K4XA 1R46A 1ME7A 1WBHA 1GVQA 2VFHA 3L65A 1NF0A 1TYGA 2QJHA 1ZAHA 3NQMA 2ZA1A 4MUZA 3E02A 5L9FA 4TO8A 1TQXA 3DXIA 2VFDA 3B4UA 3TKFA 3I68A 4FX7A 3LCXA 4NJIA 3GKFA 3TSMA 1UUMA 3B03A 2FTPA 3QSTA 4XBKA 5CZJA 4RZ6A 1XXXA 3AJXA 4FX6M 1VZWA 1OYAA 1VYRA 3BV4A 3RK8A 4Q32A 3LTSA 3KHJA 1O60A 1SPQA 4ML9A 3NR0A 2ABBA 1SU5A 3TW7A 4JX6A 1SUXA 3DU0A 3LDVA 3H53A 1XUZA 1UBSA 5A8GA 1O95A 1NFBA 3NYZA 3QJAA 3HO8A 3P7YA 3W3OA 1TRIA 3N73A 2ZA3A 5E93A 4RX0A 3N19B 1YXYA 3P82A 3DGRA 3ATYA 2C1HA 1N7KA 3S1WA 5KMYA 1QPRA 1GOXA 2VELA 1ZALA 2VFFA 1ZCOA 3TDFA 3PR2A 3GVGA 4DEFA 6ALDA 1R2TA 4BFAA 5K7JA 4E2DA 2WO5A 3SW6A 1LBFA 4IMFA 1KLZA 3G1HA 4Y96A 5AYZA 1V5XA 3IIVA 3W7RA 4JTEA 5D04C 4WX2A 4HPXA 3W1AA 2CZ5A 3HPZA 1KA9F 3MBFA 4UUIA 3PWAA 2EGZA 5HNRA 2Y70A 4O19A 1J5TA 3I7SA 4K38A 2CW6A 3L66A 4YCPA 3MI6A 4PC8A 1VHCA 1IF2A 3OVPA 4UFIA 4QJ1A 1M7PA 4GE8A 4O54A 1JRCA 4KWVA 5I3GA 3L0GA 3GDKA 1F6KA 1F7BA 4UTKA 2ZYFA 1CX9A 4QNEA 1H5YA 2EF9A 2C3ZA 2F7FA 5HR7A 3W2KA 1NAL1 3M5YA 4UTTC 4N4PA 2PRLA 5F4WA 3TROA 4QSHA 3PBWA 3L0KA 3LI1A 3NQAA 5G2WA 4AVFA 3CC1A 4OHQA 4XKYA 4LUIA 3O07A 1X7FA 3DFQA 3LI0A 4EOUA 2E09A 4LVAA 5FF4A 3THAA 3TU9A 3A22A 4JEQA 1XCFA 5FF7A 3KRSA 4M19A 1GG1A 3M5XA 1IIGA 4DF1A 5F1UA 4LV9A 3LGEA 3NAVA 2CZFA 1TPVA 1PL9A 6TIMA 3GXTA 2YW4A 1ME9A 3NM1A 4HNNA 3B04A 2HMCA 4NJJA 2QDHA 2TSYA 4JTKA 3S42A 3E49A 3TXZA 5G2HA 2ZZ1A 1VYSX 3ABSA 4HHPA 3LHWA 3TSDA 1Z41A 4BI7A 4K7VA 1YTDA 5G1TA 3LHZA 3TW6A 5FF0A 1L9WA 4O53A 3C2VA 4WXZA 4JTJA 1TPDA 5DCEA 2OZ0A 1G7VA 4X22A 3BLFA 2W0UA 5D32A 1TPUA 3NQ7A 1UB3A 4K37A 4DQWA 5H2ZA 4ZZ9A 1JCJA 3N2MA 2WSRA 3QMRA 4UC5A 4MY9A 4O1BA 1W5OA 3S9YA 1TPB1 1GVRA 2GUUA 4EWND 4MLJA 1TSIA 2V2HA 1W8SA 4JX4A 3R8RA 2J27A 4YMZA 4CQAA 4IMEA 5K9XA 3S5ZA 3G8RA 1BTMA 1I2RA 2BXVA 2E5BA 3QMTA 4Z08A 3FA5A 1TTJA 4AWTA 4OT7A 2HS6A 4UTMA 2RHGA 3TX9A 4WJEA 3OHIA 3GDMA 1EB3A 4HNVA 3MMTA 2WPBA 4LOCA 2CLFA 3GNDA 4A2SA 2YR1A 3GX9A 2WSYA 1S5TA 1TCDA 3CQ0A 4O4WA 1LTDA 5D2WA 3GB6A 4YXGA 3EX6A 2F84A 1XM3A 3LX9A 5C54A 4Y8FA 2NUXA 1XBXA 4WOQA 4LW7A 4FHAA 4G1KA 2DP3A 4RJEA 5LHEA 1A53A 4EIVA 1B4EA 3CM4A 2HSAA 4NJKA 2Q3OA 4GBUA 1JUKA 1AK5A 2WV8A 4TIMA 5FEXA 2VFIA 1QPQA 3ZS4A 1LBMA 2CLKA 3PF3A 1FXPA 5I3FA 3M43A 1H1ZA 4RV8A 5D2TA 1RQEA 2W6RA 1DJNA 3A23A 3SECA 3WJWA 3FYOA 3NGJA 3NQDA 3EX4A 3G1FA 3TH6A 2QCDA 3QF0A 4OQVA 4N2YA 1VJIA 5D38A 5D02A 4NXKA 1YXDA 2WJZA 3EWBX 1FUYA 1QNVA 5KSWA 3MBDA 2VEMA 2UV8G 1GYNA 2CLMA 2EAWA 3P5YA 2C18A 3C2RA 4H3DA 4ADSA 5ABTA 4ZQPA 4I7WA 3NZRA 1OFQA 4XUGA 5BRBA 3M5ZA 4UFMA 1V7YA 5KZMA 2Y62A 4GUIA 2FIQA 3W7DA 3DFNA 1PHWA 3R2GA 1IXPA 2ZBTA 1LLWA 4LS0A 3W2NA 2QJIA 2FB3A 2A85A 3DHDA 2VFEA 5FEZA 1SFLA 3GR7A 1F73A 1CW2A 4MJMA 3G1XA 3QPYA 2D73A 3QMSA 3JS3A 1PIIA 1MEWA 3W2JA 5LNRA 4Z1BA 1YADA 4JXCA 1IIHA 4ADUA 3IIXA 3MW7A 3NPUA 4O57A 5BMWA 3GKAA 2ISWA 4W9TA 1T99A 3HGRA 3PAJA 3S1VA 1TRDA 3L0NA 2GQ8A 3UWUA 4CNOA 3M16A 1LDCA 2NWRA 1MZHA 3M0ZA 1FBAA 3FYPA 1RQBA 1EUAA 3WK1A 4P61A 2G97A 3FOKA 2YW3A 1ZAIA 3CHVA 3IIOA 3PB0A 3B05A 2Y7FA 2B7PA 3PVFA 1LRTA 3B0UX 1OX4A 3NM3A 2GVGA 3T40A 3ZR4A 4CNPA 3W7NA 1N55A 1DQXA 2FB2A 4WOZA 2A4AA 4UIOA 1H50A 1LOQA 3PS7A 2ZRYA 2GVJA 3SSJA 5AC6A 3NQ8A 4YWIA 4UTWA 4WUIA 3USBA 5TQLA 1K3UA 5IM51 3Q2DA 5BW6A 3DFPA 1P4CA 3A5FA 1XL9A 4DXVA 4LT9A 2A1YA 1XC4A 3DFTA 4JX5A 5HQEA 3GAKA 1RPXA 2Y7EA 3B8DA 2NUWA 4QNWA 1YXCA 3NQFA 5F4XA 2E68A 4C1LA 5DXYA 5C5YA 2V2CA 3FJ6A 4IPIA 5AHMA 5D03A 4XTIA 1ONRA 2GPTA 2CWNA 2Z6IA 3QZEA 4MY8A 1GWJA 4UFKA 1W5QA 1U5JA 3N14A 2P10A 1X8FA 1ME8A 2RH9A 4FXSA 5D37A 3EXTA 3TIMA 4MJZA 2B4GA 5E0KA 3HGSA 5G4EA 3UPWA 4O14A 5D2YA 5DY3A 4IUOA 1WXJA 1JVNA 3MI2A 2ZFAA 3TFXA 4UTJA 3W2LA 5K9CA 5HMSA 5CPMA 2A0NA 2ATMA 1A5CA 1NEYA 3GK0A 3GLCA 4DBDA 1G6CA 1QR7A 2EPHA 2VXNA 2AAMA 5J5DA 1EWEA 2X1RA 3QM3A 3LLFA 1XBYA 3W22A 1KFBA 4RKAA 2FDSA 4JICA 1GQNA 3EX3A 4PL2A 1GG0A 2C13A 3BLIA 4OBTA 2NWSA 5CSRA 1A5BA 3M6YA 1OHLA 3QQ0A 4MYAA 4ORIA 3HPSA 4MOZA 2LLEA 1LRQA 1QAPA 1JCNA 2YZRA 1QOPA 5KINA 3BGGA 2CZEA 2Q8LA 3R13A 4BK9A 4FNRA 3CIWA 1TPEA 1MO0A 3NEVA 3P84A 1H62A 4A2RA 2FPTA 5DELA 3QSRA 1TPH1 1G4SA 1K8YA 2OT1A 1Z42A 3TAKA 4UR8A 5GVJA 3G3DA 4UMBA 3EXRA 5U4NA 5D2XA 4RLIA 3LRKA 4N4QA 3TC6A 1BEUA 4E2BA 3PM6A 1LCOA 3T78A 1AW2A 5SWUA 4OE7A 2H90A 1IGSA 5DLCA 3CIXA 1JUBA 3LBCA 3WJSA 4ICNA 4CQ9A 5EMUA 2KZHA 3WK3A 2NX3A 5IBXA 1YDVA 4AXKA 4LV4A 2P0OA 5F1VA 2QUTA 4CQ8A 1I2OA 3BARA 4FEZA 4QAIA 1U83A 4E0CA 3LCWA 4QQ3A 4ZVJA 4ALDA 4HN4A 3TV8A 3LM7A 4MVAA 1YYAA 3R5EA 3U6WA 1T0OA 4DO6A 3BLEA 3EWZA 1OK6A 2VKZG 2V5LA 4S2BA 5T26A 3W7MA 1I45A 4FXRA 2PRHA 4OV4A 1O4UA 2JKAA 4OGZA 4H4IA 4JTTA 5AHLA 4LTSA 3NQCA 1XDMA 4K36A 5CGQA 5LNVA 3ABOA 1DORA 1SR9A 3LV5A 3IIZA 2QCDB 2R94A 3P62A 1I2QA 3EKZA 3W1RA 1UCWA 2C6QA 5CZTA 1TQJA 3FIGA 2DU2A 4O18A 5CSSA 2V2DA 1Z48A 5F2LA 1SZNA 5IBXC 1WV2A 4HIBA 5CKSA 3KFTA 3NDOA 1QOQA 2I1OA 1SO6A 3EKLA 8TIMA 3EXSA 1G67A 1TREA 2WSQA 4PTNA 3G1SA 3LTYA 3HPXA 2C0AA 1I2PA 4RK8A 3UNDA 4B5NA 4UMCA 1DJQA 2Y88A 3TMQA 5J5RA 3QW3A 3LRMA 2FQIA 2QR6A 4EF9A 4IXXA 5EA9A 3ZWSA 3LXAA 3STEA 1TTIA 1JCLA 3NQEA 5AHNA 1KM0A 2H3BA 2H8XA 3F4WA 2ZZ3A 3IEBA 5G1YA 3C61A 2YYTA 1W3TA 3EWXA 1ZY9A 3QQ1A 3HGJA 3I7QA 1SO3A 2NZLA 4UFLA 4TMCA 4GXMA 5FESA 1TPFA 5HINA 1K03A 5F2GA 3O05A 4JR5A 1OG0A 4D2JA 2V5BA 5AHEA 1LRNA 4KFPA 3S5NA 3P60A 4N02A 4TX9A 4JNMA 1K8XA 3UZ5A 1KM1A 3W72A 3C8FA 4UFHA 4JIPA 5C6MA 3R89A 2NV1A 3EWYA 4ZQMA 3S0CA 3G22A 4CCEA 2ZRXA 3MJYA 4OU1A 4I9AA 5KZDA 3W7QA 2C14A 4QISA 3IGXA 3HQ1A 2JK2A 3MYPA 1YDOA 1SW0A 2QCNA 3C3NA 5EKYA 2C16A 3L68A 1G4TA 3L2IA 1LORA 3KAOA 4NNAA 1HFBA 3FKRA 3LB0A 2XN1A 1QPNA 2ISVA 1VCGA 2NX9A 3L9CA 3A5VA 3GAYA 1W5NA 2CFFA 4PODA 3TMLA 4O12A 5LNUA 3LCGA 2V82A 1WBJA 3Q94A 3JR2A 2R14A 4GRSA 4K6AA 1FWTA 3F1QA 3DZ1A 4O50A 1UASA 4AB4A 5AOUA 3S5YA 3TSBA 4MZ1A 5K4ZA 1H63A 1H7NA 1XBZA 3LHVA 3CEUA 5LNSA 3TC7A 3NL3A 1BWKA 4AWSA 2DZVA 1EIXA 4RCXA 2QCEA 2R91A 3UY8A 4MIMA 1QO5A 3O8AA 3FEMA 4UTIA 3DKLA 3SZ8A 2A5HA 3G0SA 1FCBA 2C19A 3RLVA 1EEPA 1ZJIA 3WK0A 1OYBA 3LHUA 3KVJA 4GWEA 4O1DA 2J9XA 4MPQA 3MYOA 5G5IA 5CG7A 2Z2UA 1DQWA 3W71A 5D33A 3RF9A 1IXNA 1JR1A 4K8EA 2AGKA 3GYEA 4DF2A 1KFEA 4ZQNA 5L6UA 4FIRA 1X1ZA 4WZHA 3W1TA 1KBIA 1ZENA 1H60A 5K3VA 2OMAA 2DZPA 3SY5A 3QW4B 4MYXA 1JCXA 1VGAA 1WYIA 4LY8A 3W76A 4N9DA 5BMXA 2A7RA 5K2ZA 5HR6A 4FX8A 2RKXA 1LM1A 3STCA 5I3IA 3SIZA 3W7OA 4KKXA 4LUJA 2E6FA 5DCBA 1DKWA 4JTHA 2B7NA 3DHFA 4IJBA 1VS1A 5DBUA 3V75A 1KM5A 1LBLA 2Y85A 1P1XA 3VFLA 2FLIA 2WOQA 2QAFA 3PBYA 3TE9A 4O28A 1X6UA 1OF8A 2J9YA 3M47A 3NL2A 3H54A 3WK2A 1SZFA 1H7PA 3HG5A 5AC8A 3HG3A 3TJXA 3KVMA 2H6RA 1KM4A 3STFA 1RV8A 3T55A 2E5CA 1FWWA 2GJLA 4FNSA 1JCYA 1PHQA 3MUXA 1JQVA 3LV6A 3L67A 3ELFA 3HGOA 1KTCA 4JTUA 1B57A 2JGQA 4K7YA 4JIQA 3Q58A 1JRBA 5F2MA 2X2GA 3NPVA 4IPJA 1MXSA 4FO4A 1EX5A 3B0PA 4O4VA 1YPFA 1F76A 3UWQA 2V30A 2Y7GA 3CPRA 1I8JA 1T96A 4O15A 1LROA 5FF3A 1TJPA 2X1TA 4KFNA 1PVNA 3DI1A 4IMDA 4BI5A 3G1DA 3NA8A 3M9YA 3LCHA 1VYPX 3F4NA 4AWUA 3LRLA 3MP4A 1F5ZA 2J88A 3N34A 3RU6A 5E1QA 3W7PA 4JDYA 3O6YX 1GTHA 1KBJA 4IWWA 1HL2A 1LP6A 1VLIA 3F03K 1C9DA 1Z44A 2GQAA 5EPDA 3SGUA 1OFDA 3QEZA 3PC0A 5LKYA 4ZL1A 1R47A 3DFOA 1OK4A 1A5SA 3OG3A 1D3GA 4IMGA 4A29A 1UUOA 5C2XA 5BOOA 3TA6A 2BTMA 4YLWA 3R12A 1VHNA 3TQ0A 4CCDA 4K39A 3U8GA 1HUVA 2G96A 2X1UA 4PEKA 5LNWA 2PRMA 4O10A 2PE4A 3ABRA 2FFCA 4UNLA 1KFJA 1LYXA 5EBUA 1WX0A 1ADOA 1OFOA 3WJXA 3L21A 1VR6A 1OFRA 1PCWA 3A24A 3PB2A 2A2IA 2H8ZA 1OFAA 5BNKA 2QCGA 2WKJA 1RVGA 2JGYA 3NNTA 2I14A 5LGZA 5AFDA 3O6CA 3STGA 1LOSA 4XZ9A 4JTGA 4U4MA 2OCZA 3PSWA 1SQ7A 1P0KA 4RZ4A 2ISSA 4IXHA 2ZTJA 4AHOA 4RZ5A 3EEGA 3HG4A 1HG3A 1HO1A 1R2SA 3MHFA 2VEKA 4EVZA 3O1NA 2JKPA 3QH2A 2DZXA 4EF8A 1TB3A 3ZWTA 3OVQA 4FB7A 4I7UA 3HOJA 5FF2A 1K02A 4UXDA 1H7WA 1W56A 4Y6GA 1GPWA 5AYXA 1THFD 2G5WA 4XTDA 3QRHA 3PULA 1M7OA 3GR8A 3IRDA 4O17A 3EB2A 4CCCA 2E5DA 3PBUA 2VENA 3W73A 4Z0SA 3W85A 3L5LA 1P5BA 3W7CA 4UTWC 1CI1A 1DVJA 3OA3A 1YTEA 5EY5A 3HBLA 3CWNA 3M41A 3W7GA 3VE9A 3W7KA 5LGXA 3IIPA 4AHQA 1E51A 3P80A 4UTLA 1O5KA 1LZOA 4NU7A 1KM3A 2XN0A 4QM1A 2HTMA 3G8EA 1RR2A 1ZHAA 1KTBA 3EX2A 3PUOA 4XWUA 3MWAA 3UXAA 3EWWA 3RFAA 4JYDA 1W3IA 4DPPA 2P1FA 3DFSA 1MSSA 1YLVA 3MHUA 4P2VA 1TTQA 2G95A 4K8HA 2ZTKA 4KWWA 3W23A 2ABAA 3IGSA 3TJLA 2BWGA 4BWLA 4JYEA 3FS2A 1W1ZA 1B9BA 2XFWA 3QC3A 2V81A 3THQA 3BK0A 5LHFA 4O52A 4O8RA 3NPXA 1K7XA 1QWGA 3S1UA 1EP1A 1L6SA 1ICPA 4UTTA 2E1DA 5EYWA 1C29A 4NJHA 4FNUA 4UCGA 4WD0A 3VCRA 4NT0A 1B4KA 2NLIA 5DN1A 4ONVA 2DORA 2ZZ2A 3NVTA 4H6KA 5A5WA 1ZNNA 1Q3NA 3DAQA 4LRTA 4WQ6A 4I7VA 3BGJA 3K30A 5LSMA 4GUHA 3BG9A 4U28A 1XFBA 1BWLA 3UWWA 2OX1A 3W86A 5HWMA 4UTHA 3HF3A 1OFBA 1XDLA 1XUUA 1Y0EA 3BW4A 3NZ1A 1EP3A 2QJGA 4AH7A 4JGDA 1K7EA 3NL6A 3HIJA 3S6DA 2Y89A 2DJXA 1OVDA 1K8ZA 4N6FA 4BI6A 3D0CA 1LLZA 5KITA 3O06A 2QF7A 4TMBA 4NX5A 3TK7A 1ICQA 3G0UA 4IGHA 1KFLA 3PG9A 3OEXA 4NNBA 3KX6A 1S5WA 1KV8A 4O0KA 4WY0F 7TIMA 1Q6LA 4AHPA 4GC4A 5CZSA 1N8FA 1IXQA 1X1OA 1O94A 5H91A 3LCLA 1JQXA 3ANYA 3LHTA 1OF6A 4LS2A 3S8HA 1AG1O 1TTPA 3MI3A 3W1QA 3M1ZA 5DXXA 2CLOA 3GIYA 3E12A 2QKFA 2ZZ6A 3BW3A 3E9AA 2B7QA 2QUVA 2NX1A 3UZJA 1QDSA 3W1XA 4BR1A 1J2WA 3T44A 3DI0A 1JULA 2R8WA 4M7SA 1H61A 2EKCA 1AMKA 3B0VC 4UNKA 3RLUA 2VEPA 3S1XA 4LC8A 1SW7A 1OX6A 3LCFA 4LWWA 3VKJA 2A21A 5KZEA 4DF0A 5G2IA 2V9DA 2NXGA 4HKPA 4R34A 2RDTA 2YXGA 4Z1AA 1TV7A 1ALDA 2WNQA 3OBKA 4A3UA 1JUEA 1ML1A 2ZQ0A 5LZLA 2CZDA 1ZAJA 5D09A 4ADTA 1PS9A 3TAOA 2ZZ5A 3VI2A 1VLWA 2YDAA 4NQ1A 1SO4A 1WAUA 2IQTA 3M7WA 4LVDA 5AC7A 3KXQA 1Q6RA 3NO5A 4NZFA 1J4EA 4M6VA 3P81A 2Q3RA 4RXFA 1H7OA 2WNZA 4Z1CA 4J9JA 2CLEA 2A7NA 2X1SA 4O0ZA 5U7SA 4PFMA 3GDLA 1FX6A 3MP3A 1SZEA 3U2OA 3AO0A 4HNUA 2YFOA 4NZJA 4NJGA 3W2UA 1VCVA 4QITA 4TU1A 1DBTA 2RDUA 4JTFA 3S5OA 2J6XA 3T7VA 1KLYA 3NQGA 2RDWA 3P5ZA 1DOSA 3UD6A 4PA8A 2W79A 3C2EA 1T8XA 1FCQA 2Y6ZA 1SSDA 4X2RA 3CLMA 1VPXA 3KRUA 4WY0B 1H7XA 3I65A 4FNPA 4X3ZA 5AN7A 3TNOA 1I4NA 4JS3A 2YPIA 3VE7A 1FCUA 4E38A 3G1VA 1OFEA 4Q4KA 4Z1DA 1W5MA 4MZ8A 3DBPA 1NVMA 2QAPA 2E6AA 2DJLA 1GVFA 3O63A 4OWGA 1TPWA 3BG3A 4FNQA 4BWLC 1EP2A 3DKJA 3W70A 4LRSA 4GFSA 3O6DA 4LVFA 2V0TA 3SGZA 3A21A 2CLLA 3C4UA 4GUJA 4HPJA 4UTUA 5F4SA 4A22A 1FY6A 2ATSA 1HO4A 4Y9AA 1OJXA 1H51A 3CU2A 2WNNA 1TV8A 3MO7A 1DL3A 4N9BA 3KRZA 3BW2A 2ZRVA 4HNTA 1TJRA 2V8ZA 1FDZA 2ZRZA 2E6DA 3W7EA 4UMAA 3W1LA 4JD4A 4Y90A 4FNTA 2QCMA 5I3KA 1P0NA 2CLIA 4LVBA 3GDTA 5AYYA 1DHPA 2QCLA 2Y7DA 1SO5A 2O7SA 3MP5A 1H7RA 4NX0A 2X16A 3PUEA 3UPBA 5CZ0A 1GEQA 2TPSA 1JJKA 1F05A 1OFPA 3SR7A 3P8IA 3PSVA 4FIQA 2PCQA 3W1PA 5D05A 4LU0A 1FWSA 3SJ3A 5AHIA 4L4LA 3W84A 1W37A 1YTKA 4WY0A 1OX4B 3MHGA 5HULA 3LERA 2Y63A 1G7UA 3N2XA 1VCFA 3TR2A 2ZDRA 4S1FA 3CT7A 4MY1A 5K9DA 3G18A 3TFCA 3G24A 3VNDA 2DZSA 2YFNA 1Q6QA 3L5AA 3V1PA 2A6NA 4UR7A 4GNJA 3W7IA 1C8VA 3N9RA 4IQLA 4Q33A 1WA3A 4O16A 3LHYA 2ZA2A 5I3HA 4UFJA 2H3DA 2QEZA 2A7PA 5HWNA 3W87A 3BO9A 1ICSA 3YPIA 1TIMA 3W74A 1L6WA 2YYUA 4NXSA 1QPOA 2GVLA 2ZCGA 3TUUA 3UWZA 3C6CA 1G4EA 1F74A 1I2NA 1KM6A 3O16A 2FPYA 4AF0A 1DV7A 4AEOA 4LS1A 1FQ0A 2QUUA 5HJLA 1B3OA 5F2IA 1MEHA 2DZUA 1K7FA 3PG8A 5G4WA 2GJNA 3TQKA 1AL7A 3RNDA 5DCDA 3EX1A 5EL1A 2OJPA 1F2JA 4YCOA 3DENA 4JDBA 3I7RA 3NQ2A 1A50A 1AW1A 2GOUA 4MFEA 1RD5A 2NUYA 1FDJA 3GNNA 4PCFA 4ZQOA 3M44A 2NXHA 3BVJA 2VEIA 5TBOA 3P74A 2ALDA 1NF7A 3RMJA 4ZQRA 2QCFA 3LCIA 4L4MA 2PC4A 3TXVA 1TMHA 3CWOX 1WQ5A 1KFKA 4DO4A 1WOAA 4JTSA 3IGUA 1L2UA 1L6YA 1M6JA 2BLEA 1PV8A 5HUOA 5CPOA 2ZRWA 3C2FA 5FEWA 4M6QA 2TMDA 3E96A 1YPIA 2FJKA 4PL1A 1QMLA 3QFEA 5HWJA 1JCMP 3I6RA 3W07A 1IXOA 2Y61A 3T4CA 2WQPA 1KTNA 1NSJA 1Q45A 3WJYA 2GQ9A 2JKEA 1W0MA 5AHFA 3P8JA 4XKYB 5D2VA 3HB9A 4ZMGA 3FJLA 5CPLA 1W3NA 3HG2A 3INPA 3PUDA 1BKSA 2Z6JA 1EPXA 2B7OA 1SZGA 4IX2A 3E0IA 5C55A 2C15A 1QFEA 4BF9A 2X30A 3WJZA 3C0JA 3LXCA 3G3MA 4DO5A 1FXQA 1QCWA 2ZZ7A 3NG3A 1GZGA 4GUGA 3OIXA 1FWRA 3KVKA 4QIUA 3JRKA 4RR4A 4AMAA 3W1MA 3NOEA 3FKKA 1F6PA 1TO3A 3W7LA 3SFKA 1XKYA 1R2RA 2YGYA 4YL2A 4XBSA 1WOBA 2YX0A 3Q37A 1OX5A 3W6YA 1KFCA 2XN2A 1W54A 3NXFA 4N9EA 4O13A 3FFSA 1ZFJA 3H55A 1HTIA 1S5VA 1SSGA 3UXDA 4JN6A 3KVLA 3CTLA 3TCEA 1UJPA 2QCCA 1GTEA 1GYLA 4O11A 3G1YA 1AW5A 2Z1BA 3LXBA 4IOTA 5DY2A 2J24A 3N3MA 1QO2A 3C56A 3CB8A 3UYCA 2J9ZA 1OABA 1FCVA 4M7TA 1VC4A 3G0XA 4M5PA
chains in the Genus database with same CATH superfamily
3O0FA 2ZWZA 3H21A 4AUBA 4X9SA 1QBBA 4XD4A 1GVOA 1G4PA 2L9JA 2Z1XA 1UH3A 4V15A 2TRSA 5E9AA 1LOLA 3ABMC 1O87A 1EQPA 3P61A 4XB3A 3LD5A 2QCHA 2Y1HA 3H2AA 4AAJA 3ZJKA 1G69A 1GVSA 2WHLA 4FALA 1EA0A 3UQNA 2ODOA 2IPJA 3WQ4A 4JYFA 5FEPA 1JEZA 3U4AA 1IR2A 3PUGA 4JVSA 2WSPA 4PSPA 4W85A 2WHJA 1R3TA 1SFJA 3MX3A 4KFOA 1EJ7L 5A95A 3ATZA 1RA0A 3WFAA 4IGSA 2XIBA 1OD8A 1T41A 2PDJA 1FWNA 3R58A 3WO8A 1AVAA 1PIFA 3IVUA 2YDRA 3IJ9A 2G0WA 5REQB 3F5LA 2VFGA 5HPOA 4Q7IA 2XDFA 4ZQCA 1R30A 1R3VA 5DVWA 1WZKA 4JTLA 2UY4A 3QTGA 4TR9A 1OCRC 5JVEA 2POZA 4I9MA 1M01A 3S27A 1R3SA 3SM0A 2XL8A 3LOTA 3G2GA 3W7HA 2Q8XA 4XV0A 3T2OA 1VFHA 4R53A 3RQGA 4MFDA 4PH6A 4J40A 2EINC 4MKNA 4FLSA 4XTKA 3VNYA 1XSJA 2XVNA 3LGGA 4DAFA 3CGTA 3UMHA 3C2OA 3IVTA 3WBYA 1O5XA 3EOUA 1K4HA 2XLVA 1CXKA 4D6DA 1YJGA 4L56A 4F3HA 1OWQA 1TV5A 2UZ9A 1Q65A 1GKQA 3G1AA 3GE7A 2I5GA 2OT0A 3J7HA 2VRQA 2F6KA 2PDHA 3UJEA 2PPGA 4Z2JA 3A9IA 3W83A 3OOQA 4Q8TA 4I6VA 1YDNA 4P9FA 4Z0JA 1WOLA 3KP1A 4MZYA 1I1WA 4U5GA 3A3WA 4M6PA 3UWVA 2RJGA 3W88A 2QDGA 4WDTA 3WDJA 1A4LA 4CD5A 1CXLA 2R6OA 1D1BA 5DBTA 2DZAA 5GJPA 5AB3A 5B1AC 1WDPA 4JAWA 2YQYA 3Q6NA 4XLNF 1KKRA 2DEPA 4HSHA 1PD1A 3OVRA 3WQWA 3FXHA 2SFPA 4O1AA 1WBHA 6REQA 1GVQA 4MB5A 3GVQA 2WK2A 4N0RA 5REQA 3WLRA 4MUZA 5D8WA 1UYQA 1TKKA 2AMGA 3B4UA 1P0BA 2H8AA 4NJIA 4HOZA 1FFTC 3TSMA 3WLHA 1A0DA 1XQKA 3S9ZA 3ZSUA 3TYEA 9RUBA 3DERA 2G8ZA 3R1ZA 1ODUA 2BS9A 4F48A 1O66A 5I2UA 3ICJA 3BV4A 1RCPA 4Q32A 3LTSA 1SPQA 3MLGA 3QV7A 2GGIA 4M6UA 3TW7A 2XL4A 3LDVA 4XWJA 4XQ1A 3P7YA 3FXGA 1TRIA 2V38A 3BLKA 2ZA3A 3WDHA 3N19B 1FWIC 3GEHA 3A3HA 1QW9A 4DYJA 2C1HA 5A8NA 5KMYA 2XU2A 4D6CA 1JPIA 1IV8A 1GOXA 1JXKA 2GSHA 4AK9A 4AFYA 4QROA 3MKKA 1XZPA 2VTFA 1CT5A 2PWUA 4MNJA 1Y65A 4GD0A 3SW6A 1KKOA 3AHXA 4A4AA 4WABA 1SMDA 3HMCA 3W1AA 3QQWA 2CZ5A 3EDKA 4G7OF 5ECVA 4G2DA 2UUIA 4JCZA 1MYRA 4ZBCA 4Z2KA 1MW1A 4K38A 2CW6A 1EA8A 5CC6A 4XAGA 4P7QA 1K77A 2BY1A 3H6OA 5EHHA 2ASHA 3LK6A 1MUMA 2F6XA 1OT1A 3OVPA 4LUSB 1M7PA 1L6GA 4IRUA 4O54A 3W01A 3T6JA 5I3GA 2J9WA 3KWSA 3LPPA 4D1JA 2ZD9A 1ZZMA 3M4BA 2MNRA 1F7BA 2ZYFA 1KU2A 4PUKA 3EWCA 4JQAA 2CBJA 2C3ZA 1Z6AA 4E4FA 1NAL1 1S1RA 1RH9A 4NG3A 4N4PA 3GM1A 5F4WA 3TROA 3N04A 3ECSA 1LLOA 2VDHA 2WCSA 3WH8A 3LI1A 4IP7A 1MRAA 4F9JA 3QY7A 1OCBA 3SNHA 4M1RA 2GGHA 3PWGA 1RCOB 2QPUA 2DI3A 1OY0A 1SM9A 3THAA 2V5DA 1WDDA 3A22A 2E40A 4JEQA 4F8XA 3CO8A 3KRSA 4M19A 3WKZA 1SMAA 1UC4A 3NAVA 1LS1A 2IBFA 5EMJA 4AD0A 2AQOA 2GWGA 1ME9A 4HU0A 3B04A 2IKGA 4NJJA 2QDHA 5ABGA 3L4TA 5JRAA 5CZKA 4TXEA 1R38A 3ABSA 3VIGA 2BVYA 4INFA 3T09A 1QXLA 3TSDA 1Z41A 1YTDA 4WR3A 2X0HA 3C2VA 2CHOA 1UFBA 3EH1A 4WXZA 1VFFA 2GDQA 4JTDB 4QG8A 2OZ0A 3WD2A 2PMQA 3N25A 1JDEA 2W0UA 1KQYA 5D32A 4JHOA 5XINA 1GOIA 1TPUA 2FMOA 4RV3A 1BXNA 2EG8A 4GPNA 4HFKB 4CS8C 3KKBA 3QMRA 4LUSA 4HK5A 3RN6A 3JTLO 1OXKA 4O1BA 5LA2A 4URIA 1JAKA 2QULA 4JX4A 3BJFA 4BJHA 3HM7A 1UD6A 2HWGA 3KCJA 3S5ZA 3DXJF 1I2RA 3U0CA 3T8QA 2V3CC 3OHMB 1C3FA 2V3FA 1TTJA 3BOFA 1V0LA 2VO5A 2IXPA 4OT7A 2HS6A 3HN3A 1E4IA 5M3WA 3BGAA 4WJEA 4CX9A 5BQHA 3GDMA 1EB3A 1LG2A 4K2SA 3WF2A 3HKKA 1PDZA 2GQ3A 3PNUA 4ACYA 4A2SA 2FYMA 3E5BA 3GX9A 2DUZA 3CQ0A 4O4WA 1LTDA 5D2WA 3GB6A 2R24A 4CU8A 2BY3A 3MKVA 2Z2BA 4WOQA 2LIGA 2DP3A 3ARUA 3CHCA 4EWJA 4HNOA 1B4EA 2HSAA 4NJKA 2QUMA 4GBUA 5CBJA 1AK5A 3MMWA 1JYWA 4ZXOA 3L2MA 3KBJA 1LBMA 1A0BA 3PF3A 4HCHA 1YZCA 2D1ZA 1J9YA 4B5UA 5D2TA 3SECA 3A23A 3WODF 3DG3A 2E7FA 3FYOA 2HMZA 4V1YA 2OO6A 4MUPA 4PUMA 1OCCC 2QJJA 1J6PA 4N2YA 4J7TA 1KCXA 4U5DE 1VJIA 4YTUA 1LIHA 3I4UA 5D02A 4MW8A 3EWBX 4L7ZA 1NQKA 2VEMA 1GYNA 4RZBA 3B9AA 5T8GA 5I78A 1UZDA 3E6EA 2O92A 1P7TB 3P5YA 2C18A 4H3DA 3TLQA 3OQ8A 4I7WA 1OFQA 4UFMA 4CIPA 2Y62A 5KZMA 4XO7A 1MW3A 2FIQA 3B9DA 1IYXA 1PHWA 1IXPA 3BSGA 3R2GA 1WWPA 1RA5A 4LS0A 3W2NA 1RY0A 2FB3A 3HJCA 4PN2A 3CUGA 4C6NA 5I02A 2VFEA 1SFLA 1UR8A 1CW2A 1KGXA 1ITCA 4G5DA 4MJMA 2D73A 4Q4ZF 4S3AA 4DJDD 3RJYA 3QMSA 4LYRA 1KQZA 3W2JA 1IIHA 1V3MA 4ADUA 3MW7A 1ZHXA 2ISWA 4W9TA 3HGRA 4PSRA 3ZDLA 4PB5A 5JVLA 1D0ZA 2XHYA 3UETA 3TK0A 4MM1A 1P43A 1MZHA 3FYPA 1RQBA 4P61A 2VR4A 1YNQA 2R03A 3T42A 3CHVA 3IIOA 4XD5A 2B7PA 3PVFA 1LRTA 1OX4A 3NM3A 1XLMA 4WSKA 3ZR4A 1OBAA 2FB2A 2J8WA 1WCGA 3V5CA 1FP8A 2O56A 2ZRYA 4YWIA 3P3BA 4UOZA 3CUZA 4IAQA 4JIRA 1P4CA 3R11A 1V6TA 4XVDA 4A05A 4NZCA 2AL1A 4QLJA 3GAKA 3B8DA 2NUWA 4AZ7A 1W6TA 3GW3A 4FOJA 4QNWA 4ZB5A 1XINA 4G0HA 1Z69A 2E68A 5DXYA 3PZIA 2V2CA 3V7OA 3FJ6A 2VI0A 5AHMA 4FX5A 3VDGA 1OCNA 1ONRA 1EEXA 2CWXA 2ZUTA 1GWJA 2OSWA 1BYBA 1U5JA 2P10A 1I1XA 2RH9A 3UVAA 3TIMA 3GTIA 4L4OA 5KYYA 1E2XA 3UVIA 4D6IA 1HW2A 5CPTA 3VZZA 3A11A 1WXJA 4A8LA 3TFXA 4UTJA 5K9CA 2EO7A 5CPMA 1OB0A 1JDCA 1NEYA 1OW8A 1HZYA 3V0TA 4EBBA 2EPHA 4MB3A 2WYSA 1IEQA 3VD3A 1VTMP 2JF6A 2X1RA 3AG3C 1G9HA 3CTTA 1W9VA 4M0XA 1XBYA 1TZ7A 2FDSA 3EX3A 1JNDA 2D22A 2GK1B 2BHYA 3ITYA 3H12A 3QR1A 4ATDA 4GCAA 3VD5A 4EXBA 5BXTA 1ITQA 1OHLA 3WSUA 4CJOA 1LRQA 3NDYA 3CV6A 2CZEA 1V54C 2Q8LA 4WKFA 1T6QA 5EGYA 1TPEA 1MO0A 5HJXA 2IPWA 1CGOA 3FSUA 5DELA 1QI3A 2GLKA 1K8YA 2OT1A 3ONCA 3TAKA 3K1HA 4E0IA 3N29A 2ZX6A 4OUEA 3G3DA 3M7SA 5U4NA 4B3KA 5D2XA 3LEOA 2MWQA 1ZLPA 2GJRA 3LRKA 3PTMA 4GH1A 4Y2WA 2WCGA 2ONEA 3BAKA 1E73M 1LCOA 4YS1A 3A47A 4LY4A 1IGSA 5DLCA 1JUBA 1W3LA 4GYTA 5EMUA 3E0LA 1TUFA 1D3CA 3AMDA 3EBVA 2X41A 2QUTA 3R8GA 3IUHA 2OOGA 2GYIA 4E0CA 2VZOA 3GWQA 2PEVA 1B3VA 4QQ3A 4ZVJA 3E0WA 3CQZA 3AG4C 1WATA 1O12A 1PTAA 3F2CA 1A80A 1JOGA 2NVDA 4DO6A 3PZMA 2V5LA 4S2BA 5T26A 1I45A 4DXWA 4OV4A 1PUDA 5FJJA 3N12A 1O4UA 5H8UA 4CS9C 4LCSA 4H4IA 4JTTA 1UROA 1Q7ZA 4K36A 3R7MA 4QI0A 3EG9A 2QCDB 3P62A 2R02A 5E2QA 1I2QA 4Y9OA 3H2VA 4D8ZA 3KBMA 2FKPA 1UG7A 3O6XA 3M4CA 2V2DA 4H8HA 2G50A 3MT1A 4NSBA 1SZNA 5IBXC 3MUIA 1E0WA 1XIFA 3WUFA 1LE4A 2QVNA 1UW9A 2OKTA 1G67A 4R27A 4F0MA 2WSQA 1EZWA 3LTYA 3HPXA 2DSWA 1I4ZA 4ROPA 4LAKA 4RK8A 5IHRA 4B5NA 1DJQA 2I5IA 1E84A 2FQIA 2QR6A 3FNDA 1YPXA 5ABHA 5COFA 1W9PA 1AA1B 4CU7A 4J3SA 1TCMA 2WZIA 5AHNA 1DJGA 2H3BA 2H8XA 3NYMA 3C61A 1ZY9A 3QQ1A 3UZYA 4CEXC 4TMCA 3GANA 1XICA 1F6YA 1K03A 4W87A 1C8QA 1OG0A 1VFTA 5AHEA 3V5ZA 1RBAA 5C2CA 2J78A 4G7ZF 1O6IA 4TX9A 1VBJA 1UPMB 3UZ5A 4AISA 2FVKA 2NV1A 3W02A 1OCOC 3GXFA 4JTCB 1E1CA 4M63A 1Z63A 2WBGA 3GIPA 3HLZA 2D24A 4I9AA 1FH7A 2R1MA 3SEPA 4ZTXA 1JL8A 5AGFA 4QISA 4KNVA 4YL1A 4J30B 3MYPA 1YDOA 1SW0A 3C3NA 2ZXDA 3EA2A 1XGEA 1LORA 1JF5A 4NNAA 3GTNA 1XLEA 3VIFA 3TTOA 3W28A 4I44A 2A6HF 4B5TA 4PMZA 5LNUA 4O12A 3LCGA 1M41A 4NI3A 4DRIB 4C5YA 4HZ8A 4BQ2A 4PJLA 3KUMA 5AOUA 4PULA 3S5YA 4F2TA 1H09A 2NQLA 1H63A 1SVDA 1R85A 1KCKA 3CEUA 2DYSC 4MVOA 3CAVA 4AU0A 3SUVA 2R91A 2WC3A 3UY8A 1VFLA 1QO5A 4IARA 2WMIA 3G0SA 3TTQA 1LG1A 3PTKA 2C19A 1EEPA 1B3YA 1OYBA 3PPGA 2D0FA 3KVJA 3LHUA 4O1DA 4ZXLA 3L4YA 4MPQA 1G8XA 3MV01 1UR1A 1SF8A 4AX7A 1PTGA 1VKFA 2QGHA 5D33A 1YDYA 4C7OA 1IXNA 4AC7C 3LA4A 1TWAA 1C9WA 1MFUA 3GYEA 4XEVA 1HQTA 1KFEA 4ZQNA 3STPA 1UOZA 2VUNA 4FIRA 1X1ZA 1KBIA 3PCVA 3K8KA 1NZEA 3P6LA 1CGVA 4REQA 4KH2A 3THDA 4QLLA 4LF1A 2EEXA 3IK4A 3W76A 2JD3A 1K1DA 4B4HA 1W2WA 4Y9PA 4DVOA 5I3IA 3MSRA 3AMKA 4DYKA 4LUJA 2HSQA 4K1WA 1DKWA 4JTHA 2B7NA 3DHFA 3CZ8A 4H00A 4RW5A 4BQ4A 2BE5F 1KM5A 2CW0F 5A6BD 2QAFA 2XG9A 3PBYA 4O28A 3FVYA 3M47A 3CLWA 3CAQA 3MZNA 3TA9A 2Y5EA 1H5VA 3PPCA 3RILA 4IGMA 3TJXA 4DWSB 3N24A 1KM4A 3STFA 3NTYA 3T55A 1QNSA 6XIAA 4OOZA 1FWWA 3W4YA 1AMYA 3UZZA 4LANA 1TWDA 4C60A 1GKRA 1PHQA 1JQVA 4OKDA 1IQ8A 2PGRA 5JP7A 2YB4A 4E5TA 4O8AA 4H9YA 3C86A 5ENLA 3VIOA 4I90A 5F2MA 4HYVA 3ABXA 4MTOA 3CZLA 3VKCA 3UWQA 2XXAB 2X42A 2V30A 4PMJA 4C5ZA 1UD3A 3WQ6A 1LROA 1TJPA 5DS4A 2PD9A 4XSLA 1R7AA 3F4NA 3LRLA 2QS8A 1F5ZA 1W3JA 2D2OA 4FR1A 5E1QA 5C0QA 3DYPA 1KBJA 1DIEA 4PJJA 3EAUA 2KC3A 1OFDA 4LNCA 2DZBA 3W00A 2R7WA 2B81A 3BWWA 3OG3A 4PMRA 1Z23A 1NSGB 4IMGA 2ZKMX 5C2XA 1VENA 1XCXA 4U5FE 3VIJA 3UG4A 2OZ3A 3M0HA 4GI9A 3U9JA 2WQDA 4GHRA 1VHNA 3TQ0A 4CCDA 3OW1A 1CLXA 4PEKA 2X05A 3P14A 2PRMA 4GCXA 5T1DB 3AIUA 2UWFA 3BSHA 3URBA 3MFNA 1XLCA 3VKKA 5HOSA 1PCWA 3QGVA 2VL4A 3A24A 3CO4A 3IAQA 3PB2A 2IKJA 2H8ZA 4YJ5A 5BNKA 4UB9A 1PPIA 1RVGA 4PR4A 4FOUA 2XH7A 3IJLA 3STGA 4XZ9A 1XV8A 3GXMA 2CGEA 2PX0A 2X7WA 1SQ7A 2ISSA 4IXHA 1BWVA 3ZO9A 1W9BM 2NQ5A 4WKHA 1MRQA 2XSEA 3RF3A 2VC7A 4P8XA 4EVZA 1CLKA 1ESWA 2JKPA 4EE9A 1HGYA 1UD2A 3U0HA 2DSVA 2DUAA 3HOJA 1VYIA 2J7GA 4UXDA 2DH2A 1M2VB 1GPWA 3SBFA 1MNZA 2G5WA 3QLLA 3TTYA 1M7OA 1HXJA 3IANA 3UPMA 3CPUA 1Q66A 4NZ1A 2W4BA 2VENA 3RM8A 2DSKA 4HU8A 4WSJA 2RDXA 3CUFA 3L5LA 4UTWC 2R7VA 1HP5A 4EPBC 3HV9A 2AWCA 1BR4A 5JIWA 4MWAD 2E4TA 2L81A 3VE9A 4LGXA 5LGXA 4R3UA 3GG0A 1XIGA 3N4FA 4AHQA 1KM3A 2HV7A 5TF0A 2XN0A 3ONBA 4QM1A 3G8EA 2E28A 2GWWA 1ZHAA 3PUOA 3RCNA 1VMAA 1MI3A 2DVUA 4OECA 3DKAA 4JYDA 5C9XA 2OKUA 3SP1A 3DFSA 1REQB 1YLVA 3V4BA 3KEHA 1QZXA 2ZTKA 3W23A 2NLYA 2O9OA 1F4AA 1V3HA 1UP2A 1ORJA 1OC6A 2J13A 3FDQA 2FZMA 3WLNA 2HK0A 3ZXWA 4O52A 4O8RA 1XQLA 3V3WA 1XLKA 4XZMX 3NPXA 4G9PA 2J0WA 1K7XA 3VUSA 2DV0A 3SY1A 1L6SA 1AVOB 4U10A 1ICPA 4PMXA 3BLLA 1C29A 4NJHA 2YZ5A 1JZ5A 3LSBA 4C6PA 3VCRA 4NT0A 1YYXA 1CBGA 4ONVA 3EPMA 2NT0A 4W4QA 5A5WA 2FZNA 1WKYA 3DAQA 1ONEA 4N6HA 5E6YA 5E3CA 1GQKA 3K30A 4Z42C 4HN8A 1XFBA 1B90A 1A7DA 2PDBA 2GJXB 4X0RA 5T3TA 3U4FA 1YBQA 4EUKB 2VR2A 5JH1A 4MWAE 3HF3A 1D8CA 3EMQA 3B71A 1Y0EA 2O9RA 3QVZA 2QJGA 1EC9A 4AH7A 5A6LA 4N6FA 1AJ0A 3O06A 4RD9A 2QF8A 5IHSA 2QF7A 3R0UA 2PWHA 3GORA 4NF7A 3VM5A 2L6GA 3M46A 3PG9A 4TVCA 4NNBA 3KX6A 3BMVA 4J2MA 3ME3A 4M8UA 1UKTA 3UNTA 1KV8A 4O0KA 1GPFA 4AQLA 7TIMA 4ANJA 4MWAB 4Z2LA 3M0KA 4IIBA 4GC4A 5CZSA 1N8FA 1IXQA 1C7TA 1X1OA 2P3EA 4TVUA 5FSDC 3LCLA 1IEVA 2FVMA 2XTKA 3WQ8A 2TMVP 3LHTA 4IFKB 1AG1O 3M0MA 4K7BA 5DXXA 2CLOA 3E12A 4JW1A 2ZXWC 4EKJA 3B8VA 3E9AA 1HX0A 5E6ZA 2B7QA 5H8PA 4ZFCA 3HU7A 3W1XA 4BJTA 4GK8A 3FVDA 4BR1A 4AX6A 2R8WA 2EKCA 1N1CA 1AMKA 3PTQA 4GQ0A 3RLUA 3EGDA 1YVIA 1OX6A 5KZEA 3FXYA 4DF0A 3W26A 5G2IA 3SRKA 1R7OA 3FAXA 3RR4A 1Q6CA 1ONXA 1RXOB 4A3UA 1V08A 4N7QA 2C7FA 4FSAA 1W3HA 1Q2RA 3SJNA 5M5DA 1ZAJA 2J9VA 1PS9A 3U2CA 4A8RA 4NRRA 3VI2A 2UUHA 1Q85A 4KPLA 5JUAA 2XM0A 1PKMA 1GORA 3W8HA 4K8GA 1J4EA 2Z28A 4W7VA 4M6VA 1UH2A 3P81A 1XIJA 3EMCA 1EC7A 4GO9A 4RXFA 4Z1CA 2R7UA 1R3QA 2X1SA 2AKZA 4QQUA 3MP3A 4IICA 2OJED 3RQEA 3AO0A 4GIAA 3U2OA 4HNUA 3S9OA 1Y5VA 2XM4A 3OGVA 4TU1A 4WVXA 5DEZA 5FSEC 1XH0A 4JJGA 2XVLA 3OU8A 1RK6A 3C2EA 3EOLA 2HISA 3CHFA 1GJUA 2BV9A 2Y6ZA 1SSDA 3TR9A 2KGOA 4AZIA 4MVRA 3KBVA 1I4NA 4JS3A 3VE7A 1FCUA 4XPWA 3G1VA 1GVYA 1OFEA 4Q4KA 4Z1DA 4MZ8A 3ITCA 1RJ9A 4AD4A 4JEBA 4YTSA 2QAPA 1SMYF 2KJGA 4PMQA 3ITFA 4GIYA 3H26A 4BWLC 1EP2A 2TODA 4XZHA 3UERA 1GOOA 2I56A 2E9BA 2VD9A 3A21A 3UJFA 1FTSA 4PMNA 4IIDA 4S39A 1E9YB 1QNOA 2R7OA 3GO2A 5DQZA 3FJ4A 1FY6A 2PLCA 1UZHA 3C8GD 3CU2A 3KOYA 4UZUA 2GA0A 3OGSA 1UR9A 4QLKA 1DL3A 4N9BA 1FR0A 2ZXOA 3KRZA 1J6OA 4AX2A 4FR6A 1TA3A 4HNTA 2A69F 4YN0B 2ZRZA 3GWNA 3N2ZB 3H2EA 3W7EA 5AZ0A 3M64A 4F0RA 3ARYA 4IGGA 2J0XA 2IOQA 2VVSA 1KBLA 2WKLA 1UWTA 4H19A 2EIMC 3GDTA 3PWIA 1MQRA 2Y7DA 3SYNA 1QHPA 1EJUC 1H7RA 3CZ6A 3AMGA 4FIQA 5A6TC 2JEPA 2C1GA 1KR1A 5D05A 4KMQA 4BS0A 1ZTVA 4L4LA 1W37A 2WCAA 1YTKA 2WW5A 4B92A 1OX4B 3BZJA 2Y63A 1ST6A 3FOPA 3N2XA 4P7OA 3PFRA 3EDJA 4CN1A 3AMLA 5DMLA 1BQGA 2A79A 3CT7A 3G18A 5I06A 3EEZA 2AU5A 3UR5A 1Q6QA 3WQ5A 3VNJA 2ISDA 3N9RA 4IQLA 4M51A 2XFYA 1WA3A 4IQEA 2ZA2A 1E5JA 3QW1A 5HWNA 3W87A 1CPUA 3YPIA 5FOOA 3D3AA 2G37A 2OELA 3K33A 1L6WA 2GVLA 2ZCGA 1TFKB 1TZ9A 3C6CA 5JBDA 2NQZA 3AS1A 3VPLA 2OQYA 4H8VA 4AEOA 4DI8A 4Z9JA 3N17A 4LS1A 3CZJA 3QVQA 2J7PA 1RKEB 2PDFA 2J9UA 3TQKA 4GEHA 2GJNA 5G4WA 3USZA 4BEJA 3EX1A 2OJPA 4YCOA 3AYTA 2RGLA 4UZSA 3G50A 1OINA 4AEEA 1ZUAX 1A50A 4OIPF 1FHLA 4RE3A 3SCRA 2NUYA 5IFPA 3UA3A 4PCFA 3A9CA 4WEVX 1XKJA 3BVJA 3K46A 5FJTA 2VH3A 2ALDA 2YL9A 1KXQA 4BPMA 2PC4A 1EQCA 4QE1A 1KFKA 3CL6A 1WOAA 4OOUA 1JZ4A 3AXHA 4DZ5A 3QV6A 3FOOA 1RHCA 3BLOA 4DVZA 1JDAA 3V0SA 4IFRA 4TX8A 1LUCA 5CLWA 3PJUA 3GFXA 1AUSL 4GVFA 7PTDA 3QFEA 4RDWA 1V51A 3I6RA 4TQTA 3W07A 1IXOA 3AWNA 3A4XA 3P8JA 1BBHA 3ZTZA 1EGMA 4HBKA 3UG5A 4H4KC 3KZPA 5ABEA 1UUQA 3KWXA 1E70M 1EPXA 2B7OA 2D3NA 4Q7BA 5C2GA 2ZX7A 3H8AA 1V6WA 1JR8A 1UWAA 1HKIA 3G3MA 3DAGA 2Y69C 1FXQA 3NG3A 3W25A 5HJYA 4AMAA 4RR4A 3H7RA 4OINF 5BWAA 1QWKA 2JIEA 1F4HA 1XKYA 2YBTA 4DM2A 1R2RA 2YGYA 2CPUA 4AEFA 4YL2A 5JSLA 1LQAA 4IF2A 3VDHA 2XN2A 3T9OA 3JU2A 3EFOA 1BYDA 2XVPA 3NRHA 1S5VA 3AALA 2P6VA 2ZUSA 3TCEA 1BRLB 1UJPA 1KWGA 1GYLA 1OC7A 3K8MA 1XIEA 4JTRA 1AW5A 2OOFA 2ZDSA 2Y4SA 1NELA 3LNRA 1HW1A 2CYDA 3BAJA 4FXFA 3RXZA 5CI8A 3PBMA 1IWAA 3C56A 4PYSA 2CDQA 1UR2A 3TOPA 4IPNB 1VC4A 4N4WA 1Q5MA 2RFGA 4PRRA 3NQVA 1H1YA 3E0VA 4MQ9F 3IPMO 3HJZA 4Q8QA 3MJMA 3W9ZA 4F0LA 3UMIA 3FAPB 3EOEA 5BWFA 5CPNA 2DSUA 4V1XA 2YLAA 5GNXA 1LUCB 2X1IA 1RQHA 2WC4A 1KRMA 1OT2A 3HJEA 1ORYA 3W0KA 3RQFA 3O15A 4F2BA 4N9CA 3VGEA 4UOJA 5BZAA 5I09A 4LNYA 4ASTA 3LQGA 4NQFA 2H9AA 4PK4A 4L64A 4N6EA 1HJXA 3UWYA 5D30A 2ZPAA 1AFSA 4GIEA 2PURA 2BSLA 1ZBKA 3LLKA 1XLJA 3ZFHA 1DQUA 3QPZA 3QY8A 3KOFA 3ZZ1A 2P0NA 1HF6A 4JY9A 4TTGA 1XSKA 1RJ9B 2A3BA 3GXNA 4PMVA 4AG0A 3GODA 1E1CB 1JIBA 4J3XA 2VOMA 3PBVA 3DH7A 2I8BA 1FAPB 2W62A 1AH3A 3KRBA 5HNTA 2XH0A 3EWUA 5GNZA 2BVWA 4HHLA 2X51A 3B06A 5TIMA 3W7JA 3WAQA 4S3BA 1YW1A 5I0DA 4HZMA 1AL8A 1OIMA 3CZGA 6A3HA 3GZ3A 3TWAA 3ATPA 1E4MM 4R33A 1A5AA 1BSIA 3AU2A 3CJPA 3CZKA 4Q8PA 3VO0A 1QTWA 4RXGA 4GUFA 4JY8A 1RLDA 4E2VA 3LUTA 1SW3A 1BD0A 4NL1A 2DGAA 4O79A 3NSMA 1Q0MA 2Z0IA 1W31A 2VOTA 3MUAA 4C6KA 3ZSTA 2VC6A 1WDWA 3SN4A 1XBVA 2ZZ4A 4AIBA 2C04A 3APTA 4CBEA 3VK5A 4B4FA 5C7VA 3W1UA 5TAOA 2EHHA 4NASA 1LI5A 1KV5A 4LVGA 3HMJG 3H2MA 4O1CA 2E77A 2CBUA 3JVAA 4DBEA 2BG5A 4JFTA 3DUGA 2VCCA 4NNCA 4W84A 3SRDA 3M0YA 1FP9A 3CEPA 4C7OB 3E2RA 4HOXA 3KTSA 1R46A 2WZMA 1F3EA 1D7FA 1Q4WA 3RRXA 1EJWC 2VD8A 3NQMA 4GYPC 3E02A 1TWCA 1TQXA 1B3WA 3TKFA 2FTPA 1EOKA 3H2OA 1F8IA 3AJXA 4UQDA 3K1IA 4FX6M 1UWUA 4HMDA 1OYAA 3T0BA 3HTWA 1G5ZA 2OJQA 1E3XA 3RK8A 1OEPA 3ARWA 4W5ZA 2G41A 4AZGA 3B8TA 1W1B1 2V5JA 2V69A 1UBSA 1C17M 1O95A 3V5FA 3QJAA 3N73A 1RCXB 4ZGYA 4DI9A 4C3EA 1NOWA 1YXYA 4LDKA 3P82A 3AROA 3L4WA 3S1WA 3LUTB 3O6AA 3AC0A 2DIJA 4DRHB 1ZALA 5BUOA 3RAOA 4UQCA 3H4WA 4BFAA 2GDUA 5K7JA 4L1XA 1GHRA 2QVHA 3T81A 1UQYA 4IMFA 1KLZA 5AYZA 4NIRA 3IIVA 1EJRC 2IXVA 3W7RA 4EPEC 4QDLA 1E6ZA 1YZAA 3J06A 5D9PA 1E0VA 3CQKA 4CN4A 3AS0A 3IJ8A 2XZ9A 2OPJA 2EGZA 1P6WA 2Y8UA 1VFOA 4O19A 3ZJ7A 2WVSA 1B3ZA 2DY3A 4X0NA 4RW3A 3I7SA 4YCPA 3LMZA 4PC8A 1S2WA 1OM0A 1IF2A 3Q65A 4UFIA 3VGFA 5FL0A 4Q22A 3TP4A 4J3WA 1JXJA 3CUHA 3IPWA 1K05A 3SSZA 3NCOA 1CZ1A 1UMYA 1TV2A 4MGGA 2Q3TA 3W53A 5B80A 1Z89A 3UXLA 4FZIA 1B1YA 5HR7A 2W92A 1PSCA 3W2KA 1NFGA 4E6MA 1E9IA 2FJUB 4QSHA 3PZGA 2LP4A 3TWBA 3VOFA 1X96A 3KBSA 2VM8A 5G2WA 1CNVA 3NWRA 4LUIA 4Y7EA 1K9FA 4KBXA 2E09A 4LVAA 3TU9A 1HJVA 4D71A 1XCFA 3PZOA 1GG1A 4NZ4A 1PL9A 3WL1A 4PACA 3NM1A 2HMQA 3IAPA 5HK4A 1A5NC 4JTKA 1WDRA 3RPMA 4D8LA 5CPSA 1ZB5A 5G2HA 4QFUA 3NYJA 4P8UA 1UKQA 3VU2A 3LHZA 3BCJA 3GH5A 3TW6A 5AVHA 3EGXB 4S23A 4YTTA 4MB1A 1EC8A 4JTJA 3RW0A 2X0SA 1TPDA 2QPSA 2NG1A 4X22A 3LNMA 1NOUA 1X38A 4DUOA 4C6JA 4MADA 5LXEA 3V16A 5JBEA 4DZHA 5FCZA 5H2ZA 5T91A 1E3ZA 1JCJA 3N2MA 6PTDA 4A3HA 3W29A 2X0CA 1RCQA 3BOLA 4MF4A 1TPB1 1A3XA 3RPDA 3V36A 1OCJA 3R8RA 2YL6A 3FYYA 1OKKD 4RPQA 1BTMA 2BXVA 3WDQA 2Q9AA 4MNLA 1YAUO 4A6GA 1L3PA 2OODA 1VIZA 3FA5A 4MVQA 1OKKA 1RSCA 1US0A 1NBBA 2HXUA 3H2FA 3TX9A 3VM7A 4HNVA 2XVKA 3RVYA 4LOCA 1ECQA 2C0HA 3KTCA 3BJTA 1KXHA 2YR1A 3VYWA 4XISA 3KS6A 4YXGA 5HATA 3EX6A 3LX9A 1XM3A 4G7FA 3CXOA 5C54A 1PX8A 3DAFA 2NUXA 4LW7A 4WDUA 3QFWA 4CS8A 1XGZA 3E3HA 4FLRA 1U1UA 2Q3OA 2YA0A 3H7UA 4LB3A 4JOMA 5FEXA 2VFIA 5D8ZA 3M43A 4G78A 3BQ5A 2OKOA 4KCUA 4RV8A 2BODX 2W6RA 4YYCA 5CG0A 3CUXA 2LCHA 3NGJA 1ZGDA 1NFNA 1OADA 3TH6A 4ZA0A 2H7OA 2QCDA 4OQVA 1EJSC 4QS6A 3H2UA 5D38A 1ZHWA 1ZHZA 4RUBA 3OBAA 1K04A 3SCVA 5JU6A 2CLMA 2E8YA 2EAWA 5DQTA 2J8GA 3C2RA 4TV5A 4ZQPA 4GYFA 3G4ZA 2NVCA 1DWIM 4XUGA 1GKPA 3AYSA 3M5ZA 1V7YA 5EGRA 4GUIA 1RJRA 3UW6A 1TVPA 5A94A 3OLEA 3ID7A 2B31A 4LUYA 3DFNA 1BAGA 4JNZA 5DMNA 2QJIA 3TYCA 2G3KA 3DHDA 3GM2A 3GR7A 3OLGA 2NSOA 1NG1A 1I6NA 2J7EA 4EXAA 1EGZA 2VNCA 3T0DA 2DH3A 1PIIA 1MEWA 5LNRA 3TULA 1YADA 2ZC8A 3SN1A 1VPYA 5BMWA 3NZGA 4O57A 3LEVA 1ITXA 1M53A 1T99A 1EQ1A 3WL0A 4EP8C 3ALGA 3VYLA 3QMKA 3GY1A 5BXRA 2QY9A 3S1VA 1TRDA 3L0NA 3S2MA 1DJXA 3M16A 1FBAA 3B29A 3BDKA 3SQLA 3FOKA 8XIAA 1ZAIA 2YBUA 2Y7FA 1DXEA 5BCAA 5FKYA 4H01A 3FHDA 3R79A 4WOZA 2A4AA 4UIOA 3CWHA 5A6BA 1M9HA 1WNOA 5AC6A 1JGIA 3E9VA 3NQ8A 5CC5A 2FH6A 4UTWA 3USBA 3VNKA 1K3UA 3FCPA 4C7FA 2A3AA 4BF7A 1KCZA 3T0TA 1NP2A 2GWNA 3DFTA 4JX5A 2XLDA 1R9ZA 1ADSA 2XIQA 3GUWA 3II1A 1YXCA 5F4XA 2XM2A 4PUUA 1U30A 4XTIA 2GFTA 4GKLA 1CPRA 2GPTA 2JEQA 2YJQA 3QZEA 4MY8A 5F5HA 4GQQA 4D9PA 4CJGA 1X8FA 1ME8A 1NDYA 1XIBA 3U5YA 4AL0A 4MJZA 3LZ3A 1AODA 2XYLA 4EBJA 1PWMA 3GR4A 4J3ZA 5E0KA 3HGSA 1H0GA 4YT4A 3UPWA 4O14A 4KRZA 3CUJA 1JPJA 3K1IC 4IUOA 3MI2A 4MNDA 3ZG1A 2ATMA 3HTKC 1FWCC 1BQCA 3COTA 4DBDA 4Y9MA 4MTFA 4EKWA 1RAKA 3FDKA 4XIMA 4U5KA 4D4NA 1NDZA 7XIMA 2HSBA 8CGTA 3LLFA 1KFBA 5FJOA 3HNKA 2PTZA 2WPGA 3SFWA 4YTRA 3KCOA 3M6YA 1CPQA 2VZVA 3QQ0A 1CGUA 2KX9A 3HPSA 4I9JA 3WEOA 4QBXA 2DT3A 4NILA 3WH6A 1QKRA 2PAJA 4A3QA 5KINA 3BGGA 3IJ7A 3R13A 4NRSA 2FHCA 3TN6A 4BK9A 4FNRA 3S5SA 2WLZA 2A1DD 2CCRA 4F79A 1EDGA 1GW1A 2FPTA 1TPH1 3QSRA 4EPKA 4HU4A 1E6QM 2R9RB 3NXLA 4UR8A 5GVJA 4MS2A 4UMBA 4L6DA 3EXRA 1LWHA 1ZU8A 2HNEA 1NM9A 1P0DA 2B0JA 2ESCA 3ENLA 3OPSA 3JT1A 2BHUA 3UJRA 1G01A 3U7VA 1BEUA 1XLIA 1ZHYA 3PM6A 4A3RA 1V55C 4OE7A 3U2EA 2F6UA 5E0CA 4B5VA 1TZZA 3POVA 3GVWA 4CQ9A 2CESA 2LK4A 5IBXA 4YT2A 4AXKA 3B8UA 4LV4A 3VNMA 4CQ8A 1I2OA 1BXBA 3BARA 3LCWA 2V6AA 4ALDA 4HN4A 4I1OB 3LZ5A 1U6HA 4C7GA 5COGA 4FXRA 2PRHA 3N13A 3DC8A 4BHYA 1HIZA 2GL5A 4OGZA 3EGXA 4KRUA 5D4YA 3GTHA 4EANA 2HBVA 5LIWX 2XWDA 4C7DA 3ABOA 1M57C 1GOQA 1R6WA 2KK1A 2WB7A 2XS8A 3GNOA 4PB4A 4XSMA 3EKZA 1N2VA 2BY0A 3MUCA 1JNEA 3P0XA 4AZ6A 2WHMA 1VF8A 4O18A 1GGQA 3LENA 2CIPA 1SJCA 2OEVA 4YHEA 1VEPA 3B0XA 4Q4SA 2DQWA 3AG2C 1H41A 4HIBA 2C1IA 2BOGX 2L6FA 3ES7A 5CKSA 3NDOA 1QOQA 2I1OA 3EKLA 5KYXA 5D9NA 4F0SA 3FMSA 4US6A 4ZENA 3G1SA 2G3NA 1H0IA 3OODA 4B15A 4Q8UA 4RE4A 3QW3A 2OEKA 4B91A 1GNXA 1XF0A 2QUPA 5EA9A 4H7VA 3ZWSA 2YL0A 1US3A 1TTIA 6TAAA 2AOSA 4QRNA 5A69A 1OC5A 3LPGA 3PP7A 3PZQA 3MWCA 5G1YA 3U3HA 2YYTA 3ZLFA 2I15A 1MWOA 3EWXA 3S3GA 3KLLA 1SO3A 4XPYA 3UR7A 2HCVA 1TKNA 2QE9A 3G6MA 1CWYA 4GYPA 1VK5A 5F2GA 3VA8A 5HA7A 3O05A 4D2JA 2BB0A 2V5BA 4GABA 4IIFA 3EDFA 3N15A 4AD1A 4MVMA 1H6GA 1FFQA 1XLLA 3LPOA 4JNMA 3M79A 2VP8A 1K8XA 3E1F1 3QLDA 4GGHA 2WSKA 3R89A 1JZ3A 4MG4A 2FFHA 5IXEA 4ERGA 2RJHA 3OZYA 3NQBA 4CDAA 2W66A 4NTAA 3RJXA 3FV9A 1QU4A 4KI2A 2XLMA 1CB7B 2XISA 3HQ1A 1GCYA 1V3LA 4MJ4A 3WNNA 3QOMA 3OLIA 1EPVA 3LYEA 1P48A 3L68A 1G4TA 1PD0A 1HE1A 1K9DA 3NZPA 3VMPA 4US5A 2ZXAA 2QGYA 4EPDC 2I16A 2ISVA 4YYFA 1B5TA 1JCTA 3A5VA 3VIPA 2ZXPA 4L80A 1J8YF 3ZQYA 3GAYA 2NSGA 1W5NA 4M81A 2E87A 2WNWA 2E25A 2KAUC 3WNOA 2Q4FA 1HVQA 4DWDA 4IIEA 3TMLA 1WBJA 3JR2A 2PDUA 3VOHA 1FWTA 3F1QA 3N11A 3QHNA 1V6VA 2RD9A 3NEHA 2W4XA 5HXMA 1YEYA 1DIDA 3LHVA 5LNSA 1FHVA 3TC7A 3R25A 1MMGA 2DZVA 256BA 1EIXA 2QCEA 5EMYA 4YVVA 3E2QA 3CH0A 2JE8A 1CLVA 4UTIA 3F4DA 1XLBA 1YX1A 3LN3A 4AE4B 2A5HA 1BYCA 1ZBVA 3OGRA 1FWEC 3PPHA 1ZJIA 2GK1A 4S3KA 2J9XA 3VMOA 1V4AA 2LFDA 4LUTA 4PUNA 1KNYA 2R7XA 5I23A 1JR1A 4K8EA 4F40A 4DF2A 1T5AA 3N1AA 4Z2IA 4N6CA 5K3VA 2OMAA 2DZPA 2CNCA 2VRKA 1WXYA 4MYXA 1ZRQA 1KGWA 3EJNA 3H7VA 4LY8A 5BXPA 1GS9A 2VX6A 2XFFA 3U3BA 1S7ZA 2A7RA 3WG7C 1ZHTA 3LPFA 3ZMRA 4FX8A 5HR6A 3TZNA 2RKXA 3STCA 3SUWA 3WDIA 2GJXA 3SIZA 4KKXA 4LFYA 2E6FA 3TJ5A 4GYKA 2OVLA 2PSNA 1QHOA 4ZO7A 4L9ZA 3NL2A 3WLPA 1X39A 2ZVIA 1DJIA 3UWEA 4X0VA 3V5YA 1W1PA 2Q9BA 3SCSA 3GC5A 1XG4A 4PUEA 3RYLA 4QEEA 3U7BA 2PTWA 4KETA 5C8BB 2ACRA 1YHTA 4FNSA 1BF6A 1I0BA 3L67A 1HY5A 3ELFA 1KTCA 4FOKA 4JTUA 4K7YA 4NY3A 1L8PA 5KEZA 4KC9A 1JRBA 1DJYA 2FGYA 2YLGA 2X2GA 4IPJA 4RNHA 3PPFA 3PZUA 4W8BA 3VNLA 5CAKA 3ZT5A 4FO4A 3OBEA 4O4VA 3IWPA 4J2PA 2Y7GA 2VURA 1I8JA 5A8OA 7ENLA 1T96A 4O15A 1R5ID 5D9OA 2Q02A 2UY2A 3AG1C 4KFNA 1ONWA 4AE4A 3DI1A 4IMDA 3F5JA 1IEIA 5HBFA 2IPGA 1NARA 1TE6A 3OQEA 3LCHA 4JL1A 3ZR5A 3OEOA 3L8JA 1ZL1A 4KGLA 1R9YA 1VYKA 1EF3A 2PGWA 2WZTA 5BROA 4LUTB 3SO7A 3AUJA 3CV1A 4X61A 4JDYA 5EBAA 1EA9C 3O6YX 1GTHA 4XAPA 1HL2A 1L0PA 5KYWA 1LP6A 1VLIA 1RVKA 2GQAA 4HMEA 4PZVA 1DTNA 3AQCA 3QEZA 3PC0A 3AIEA 5RUBA 2Z25A 3QPEA 4U5BE 1OK4A 3DFOA 4DJFD 2FZ8A 1ZP3A 2R1LA 1O5RA 1A3HA 1BFNA 2I9UA 3RM9A 5BOOA 3TA6A 1TWSA 2RUSA 2BTMA 3R12A 2IS7A 2G96A 1DEDA 4MSSA 3WHNA 2PE4A 4UNLA 3VDCA 1M7XA 1ADOA 3AJ7A 4ER9A 2INZA 4M29A 1TWIA 1T40A 5PTDA 4KERA 4HNCA 4KCWA 3MV11 3VKDA 4O7GA 1VOMA 1TQGA 3ZVRA 4V27A 2JGYA 2I14A 3AS3A 4L65A 5AFDA 3O6CA 1TJ1A 4DXXA 2J8FA 4JTGA 4U4MA 1P0KA 4RZ4A 2ZTJA 3BCFA 4G8TA 3SCQA 4RZ5A 3HG4A 3MHFA 5D91A 3M0VA 2ZX5A 1B2YA 3I3DA 3DFHA 3T6GB 2Z1WA 4QCFA 4EF8A 1TB3A 3MS8A 5EU9A 3RX2A 1FMWA 4XO6A 4I7UA 5FF2A 4CIHA 1K02A 4Q4MA 4CD7A 3UZXA 2VEGA 2Z4GA 2R1PA 5AYXA 3QRHA 3PULA 4ZR8A 1MVYA 1F8MA 1MDLA 4O17A 2E5DA 4GZIA 2OQLA 1M6TA 5A8MA 2OEMA 3MY9A 3W73A 2PDQA 1DVJA 5EK0A 4B9YA 3UGRA 3CWNA 5H6HA 4AD5A 2J9BA 1E51A 4UTLA 1O5KA 1LZOA 4Z1YA 3NKEA 4CGTA 2HTMA 2Z2AA 1RR2A 3EX2A 2PD5A 4LLCA 4CS9A 4DIAA 3UXAA 2QQ6A 3RFAA 1EDQA 3MMUA 4DPPA 4PBEA 2Q09A 3MHUA 4KWWA 2ABAA 3IGSA 3TJLA 2GFHA 4IWBA 4JYEA 1DJHA 4O0QA 1XIHA 2XSXA 4PRTA 3QC3A 5IRPA 3OTRA 5LHFA 1UPPA 3CPGA 3EA1A 3XINA 3CMFA 4Q3MA 4D1IA 3S1UA 1MQVA 3SIMA 5C70A 4WJ8A 1EP1A 3MBGA 2DYRC 5LYRA 1J0JA 4UTTA 1V79A 4ZB0A 1D1CA 2F2KA 2INEA 3SCTA 2IKIA 1VD6A 4KIRA 2NLIA 4H9UA 3IV8A 5DN1A 3GTXA 5AKQA 1U1HA 3DD7A 1ZNNA 4C6DA 1W9XA 5L0JA 3BGJA 1H11A 3BG9A 1CENA 4R9XA 1L7CA 4C3BA 1BWLA 4DBQA 3QGAC 3PDMP 1VP5A 1XYFA 4GBDA 4E8DA 3M15A 2BP1A 2EJAA 2OX1A 3W86A 4CCZA 1Q0KA 1XUUA 3V35A 3DM5A 3OYZA 5BOEA 1ISZA 3IQTA 1VFMA 1K7EA 3NL6A 3HIJA 1BPLB 3CB3A 1TVLA 1K8ZA 1Q63A 2WVUA 4ICCX 4V28A 2XSBA 3LS1A 4GO8A 4NX5A 4P7LA 2IQDA 3UGOA 2PODA 2YRFA 1ICQA 3G0UA 4IGHA 4DRJB 3B8IA 3OEXA 5B7ZA 4S3GA 2VGGA 3H2NA 1VBHA 1C8XA 1O94A 5H91A 3NDZA 4LS2A 1TTPA 2HVNA 1IZJA 3BW3A 4LBSA 4AZCB 1HMOA 4JQ4A 5JBFA 3T07A 3UZJA 4GJJA 1QDSA 4O6MA 1VLSA 1J2WA 4M7SA 3ARTA 1B30A 3NSNA 3QKZA 4IZGA 2R1KA 2VC9A 4UNKA 2VEPA 3S1XA 1SW7A 3AUOA 1MMDA 1E40A 3VKJA 1H4PA 2NXGA 2PDYA 2E1WA 4Z1AA 5CC7A 4HMCA 3VRCA 3EZ4A 1ZU5A 1CGYA 3RDKA 1F9CA 4C1NA 1OD0A 1XLHA 2HDJA 3RIKA 2CZDA 1OGGA 1TWZA 2YDQA 1KC7A 4AVOA 2IQTA 1EBHA 5AC7A 1A7EA 5I79A 1Q6RA 3C8ZA 2LD6A 5HAOA 3GSMA 1J10A 3BV7A 2KYHA 3WYZA 2AGTA 2CEQA 1T01A 4GZJA 5DLJA 2WNZA 5FJPA 4J9JA 2CLEA 3U5SA 3UGPA 2A7NA 1KFWA 3LGDA 2INFA 2OWCA 3F4CA 3URAA 1ZU4A 1VIWA 4YT8A 3IGHX 1DOWA 1V6XA 4NZJA 1CGXA 4L9YA 3WIJA 3KE0A 4QITA 3BSMA 3AMCA 4BZYA 1OR3A 3S9IA 2J6XA 1C8YA 1KLYA 3NQGA 3WD4A 3UD6A 4PA8A 5L0CA 4DJFC 2CBIA 2GGJA 2JQXA 1FCQA 3CLMA 3DJUB 2PGEA 1E6NA 4WY0B 1H7XA 3MB9A 3PHF2 5AN7A 1HNYA 3TNOA 3VDBA 2YPIA 3EH2A 3UFYA 1W5MA 3C0LA 4GMEA 3BH4A 1WXZA 2KQ9A 3I4EA 3I4KA 3EFOB 1TPWA 4AZCA 1FNTc 3QXBA 1GYMA 1U89A 1BRLA 1NFPA 1EJTC 3EZHA 4YVPA 4HE8D 4LRSA 2VDGA 3GW0A 4GVIA 1M2VA 3OO2A 4OJYA 2V0TA 4YL3A 5FL1A 4GUJA 4HVXA 5J04A 1WB0A 4O6YA 4HPJA 4ERIA 2OR2A 1MQQA 4J32B 4ZTYA 1J01A 4KRTA 4A22A 1HO4A 1OJXA 3TQPA 3ITOA 3SXZA 3M0XA 1FMVA 3MO7A 3HZ3A 2XSAA 3TYDA 2JPUA 3DWWA 4W86A 3BW2A 1CGNA 5CAHA 1JDFA 2XLHA 3KMIA 2AQVA 3C62A 3FY1A 3TW9A 1M56C 4MJ2A 2E6DA 4ZLDA 4Y90A 4GQHA 2QCMA 4AMCA 4AZHA 1REQA 4D72A 1QASA 2VQUA 1P0NA 3GNRA 2CLIA 4LX4A 2HV5A 4AXNA 3R94A 1W3KA 2OXNA 2YEVA 3ZIBA 1FWHC 2V68A 4Q6XA 3MP5A 1RD6A 1SO5A 3FW6A 4U2YA 4NI8A 4NX0A 2X16A 3UG8A 1GEQA 1F05A 3P8IA 1DWGM 2W45A 1FWSA 3DZAA 1O1HA 4MNKA 3W84A 4IHCA 2J7FA 3HPFA 2QJMA 5HULA 3AU6A 3LERA 3GHUA 3GM3A 3N4AA 4OBSA 1V7AA 1JFXA 4JFVA 1XIMA 3EDDA 4DZAA 4S1FA 3ASOC 5K9DA 3TFCA 3VNDA 2YFNA 5B3IA 2DIEA 1EO7A 4FF5A 3WEZA 4JZ5A 1TX2A 4L6HA 1Q13A 3K1GA 3WQGA 1TR1A 3LHYA 3WCZA 2H7VC 2YIHA 3TNBA 2H3DA 3VOCA 2O4QA 3AIWA 1YNPA 3BO9A 3BCDA 4PCPA 1TIMA 1UBPC 2Y5SA 4U5IA 3W74A 1IZKA 2YYUA 3WG6A 3TOLA 2XIIA 3TUUA 1O5QA 5AVNA 3SRFA 2P7VA 1J11A 3UWZA 3UXKA 1G4EA 3PJXA 1D8WA 2KNHA 3O10A 3S2CA 1I2NA 4QGCA 1OZQA 2FPYA 4AF0A 2IQ0A 3CYJA 3CT2A 4LCQA 4LH8A 2BFGA 1B3OA 1MEHA 2DZUA 3JZEA 3K6BA 1PZ1A 1TR2A 1TVNA 4KWSA 5DCDA 2V3GA 3ZC4A 2J7DA 2HE5A 3NMJA 2X09A 1HL8A 2HBXA 2GOUA 1JYNA 1RP9A 4NYYA 3AHYA 1RD5A 3RO8A 1DWAM 4OBRA 4ZQOA 1A47A 2NUPB 3H24A 3M44A 2NXHA 4J7YA 3L7RA 4LB4A 1T8QA 2BXYA 4ZQRA 5EFDA 5G4HC 1TE1A 5A6JA 2CXEA 4L4MA 1KRCC 1FWBC 1JAEA 3LMYA 2BBFA 1KGUA 4PGLA 4MWAC 4DO4A 3IGUA 3DOPA 1L6YA 1B3XA 1M6JA 4MVSA 1R87A 4W93A 4IFOA 4ICMA 1D0XA 2WHKA 2I57A 3GS6A 3GHRA 3GUGA 3AQBA 4FA3A 1V77A 4RDYA 2ZICA 3E96A 1YPIA 2FJKA 4ENLA 1MUWA 2WQPA 1KTNA 4LDRA 1EKOA 3DFYA 3WJYA 4A2NB 2Y3BA 2JKEA 2JFEX 1F1MA 5AHFA 4ZMGA 4XKYB 1I75A 2E9LA 1SJBA 2PTXA 5L0HA 3WMSA 1BKSA 3MSGA 5HPCA 3E0IA 5A6AA 5C55A 3CAWA 2C15A 4HGXA 5I6SA 3MSYA 2X30A 1HW6A 3C0JA 3LXCA 1D2KA 5M03A 4DO5A 1QCWA 2Y8VA 3OZMA 1JFHA 3ZLGA 3JRKA 5E70A 3W1MA 3KH2A 3NOEA 1DXIA 1J5SA 2J77A 3MVTA 2OOCA 2MYSA 3D46A 5CPQA 3W7LA 3S1GA 3SFKA 2YX0A 1OX5A 1WASA 4E3TA 1W54A 4N9EA 4BKNA 1FA2A 3T8LA 3KVLA 2CITA 2ZUMA 1C93A 4HFFB 3G1YA 2F38A 2V5KA 1J93A 3T4WA 1I0DA 2PZ0A 2ON3A 4G7EA 4UBPC 3N3MA 4K1OA 1E72M 1QO2A 4OIFA 4P8WA 2J9ZA 4I1MA 4M5PA 1S2TA 4X63A 2Q8ZA 4WKAA 2X8RA 2OLSA 1IZMA 3GDRA 1UP0A 3VILA 2AMXA 5FD0A 4H41A 3WBAA 4MLRA 2I9EA 4S2CA 1AH4A 2AQWA 3N2BA 4PMDA 5KTLA 3CQJA 4DPQA 1BTCA 2ZC1A 3ZQVA 4YHGA 3W6LA 1HMDA 3I3EA 4UDVA 2PLMA 1A0CA 2FPVA 3NPWA 2B0MA 4WGYA 4JCMA 3P0WA 1MEIA 1VQTA 5LIXX 4M1BA 1XDJA 2EPKX 5DRCA 1NOFA 3EDEA 2GVYA 2VUYA 1ZS2A 4A21A 4A8IA 4QDPA 3KPHA 2DZWA 4HNLA 1PO9A 2HS8A 4GA8A 1DTUA 4KS0A 1A5LC 1X1NA 1KW1A 1S3HA 4MKVA 3NL5A 3H23A 5EB8A 4W8PA 3SI9A 7ODCA 1V0KA 4IIGA 1EF2A 3X1OA 2O7QA 3W2MA 3GRIA 2W61A 1DJWA 4HT3A 3NMKA 7REQA 4LYPA 1E15A 1RZMA 4GJ1A 4DWSD 1EYWA 4H9MA 1VH7A 2EG6A 4F4RA 3WNKA 1EWDA 5LXXA 2Z1SA 1FDYA 2XH2A 2JBMA 1NP0A 2A68F 1BGGA 4WF7A 2IKHA 2NV2A 4DELA 5I3JA 1OIFA 3MSDA 4AIOA 2OO0A 3BPWA 2IUZA 3NO1A 3M0IA 4B2DD 4UQBA 1MNEA 2WC7A 1GK8A 1XW8A 3C52A 3QY6A 4LBRA 1WPCA 3PAOA 1KM2A 4YPJA 3HA1A 4DUXA 2A6LA 3BG5A 3LLDA 4DM1A 4NVTA 3TQVA 3WLKX 2WL8A 1ZW3A 1HJQA 5EMKA 2DVTA 5GJNA 4CLMA 2R82A 5MHBA 4ILSA 2BX7A 3PANA 3PY2A 4GNVA 1VB5A 1TFOB 3FLUA 4IMCA 3VX0A 4NUWA 3MKCA 1JG9A 1PYFA 2EPMX 2UBPC 1D9EA 1UIPA 5FI8A 4MTVA 2PFDA 2BGSA 1PKLA 2UY5A 4DNMA 3BURA 4I3GA 3ITVA 1SGJA 3BOXA 1LS4A 5C9UA 3UY7A 1OYCA 4HSOA 3CV7A 1TPC1 3A6OA 1Y5WA 1XD0A 1M5WA 3GXPA 3UNGC 1MUCA 4IL2A 3M5VA 3SXMA 5K4XA 1ME7A 1APCA 5DFAA 1DE6A 2FH8A 1NF0A 2L5HA 1ZAHA 3HFYA 5L9FA 4TO8A 4P6IC 3D3FA 3DBNA 2VFDA 4GNKB 3LCXA 4HCDA 3SQMA 5CCZA 3B03A 5CZJA 4M82A 4H6EA 1XXXA 4H6RA 3RFYA 1FH9A 1KNWA 3UXIA 4E17A 1VYRA 1A0EA 2YWAA 3HNLA 1O60A 3EYPA 3NR0A 2ABBA 2ZE3A 4DBSA 1UKSA 4U3CA 1SUXA 3S2JA 1W2VA 2D2JA 3H53A