1TFKB

Ribonuclease from escherichia coli complexed with its inhibtor protein
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
86
structure length
86
Chain Sequence
KMAMIDLAKLFLASKITAIEFSERICVERRRLYGVKDLSPNILNCGEELFMAAERFEPDADRANYEIDDNGLKVEVRSILEKFKLH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin/toxin inhibitor
molecule keywords Colicin D
publication title Relation between tRNase activity and the structure of colicin D according to X-ray crystallography
pubmed doi rcsb
source organism Escherichia coli
total genus 27
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2004-05-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.650 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Colicin D 1tfkB00
1V74B 1TFKB 1TFOB
chains in the Genus database with same CATH superfamily
1Q0GA 4QI2A 1WATA 4LDKA 1G4US 4FWVA 4BJ6C 2WL8A 4G78A 1NBBA 1R5ID 2R9RB 3EG9B 3NRHA 3WAQA 3Q7GA 2NG1A 4BJ5C 3LLIA 1VMAA 2PBEA 3QZCA 3LEVA 4IB4A 5A6JA 5F5FA 2W4BA 2MWQA 1E2XA 3ASOC 4MVRA 4Z9HA 3QVZA 5KYUB 1LI7A 1UG7A 3B0VC 2XLVA 3M4CA 5JRAA 2R7VA 5FZTA 4FAPB 5KYWA 1A0BA 3AQCA 5JT4A 2WVNA 2NUPA 3JYHA 5K0IA 3EQLF 4YL3A 2J0WA 1CPRA 2YL1A 2ASRA 4JCHA 2LFDA 5E33A 2X51A 4PJNA 3EGXA 2AVKA 3M79A 4JEBA 3MBGA 1FAPB 1I4ZA 3K7DA 2YHSA 3BRJA 2G3VA 4LLCA 2WVOA 1RKEB 2WB7A 1A7VA 4MVUA 4XQ1A 3SNHA 1WWPA 2HV7A 4I1OB 3SXMA 2IXNA 3DJNB 3V5XA 3CAXA 2I15A 1VLSA 1APCA 3SXYA 1ZU5A 3FAPB 3VRCA 1ORSC 3NG1A 4YJWA 2Y3DA 1TWCA 2L7AA 3SZRA 3ZSUA 1M2VB 1TWAA 2J9WA 1ZYRF 4ER9A 5B1AC 1YA7O 4ONSA 1JMWA 1K04A 5JSLA 2A69F 4OIRF 2R25A 3JCUQ 3NYLA 3KYJA 4IJJA 4EKWA 1F1MA 3EJNA 3AQBA 2YZSA 2YVKA 3EZHA 2XLWA 3H2UA 2DYSC 1J8MF 1O5HA 4QI0A 4YL0A 4J30B 2W4MA 5F5HA 4DBQA 1TFKB 2J45A 2OOCA 4CDYA 3C8GD 3H2VA 1OKKD 2KNHA 4AE4B 2Q4FA 3I5PA 1JPJA 2VB6A 3IHUA 2YLDA 1VOMA 2YL7A 1H9TA 1TFOB 3K1IA 4X0RA 4IGGA 2V3CC 3POVA 1LS1A 2VH3A 2IXPA 3F46A 2ZD9A 1E84A 1BZ4A 3KYIA 2JD3A 2XXAA 3AG2C 3G4XA 2HZ8A 3U9JA 1D0YA 1OCRC 4EBBA 2YRFA 3LS0A 3ZC4A 3TJ6A 3TD7A 1GS9A 2F22A 4PJLA 1OCZC 3RKOF 1E86A 1FMVA 4D4XA 1DOWA 4XLPF 4MVZA 4FESA 4A2NB 4JCZA 2HJMA 1G5ZA 4O79A 2QUPA 1O87A 1VB5A 2A68F 1H9GA 1MNDA 1V55C 2OJED 1IZMA 1ZW2A 3EFOA 1SMYF 3DI5A 2EPMX 4XPYA 3RQFA 2ZXRA 3IQ6A 1JAFA 2OU6A 1YZCA 3DE8A 2P0NA 4DBRA 5KYWB 3HNKA 4U9DA 3DWWA 1LIHA 3SP1A 4U5HA 3EHNA 2PX0A 3AG4C 3OWTA 5A6KA 2A0UA 5JP7A 4WGZA 1QLEC 1MMDA 2I8BA 1TKNA 3V7OA 4CSAA 2M4EA 1TWGA 4CBEA 1Z3IX 4XEKA 3CZ6A 2FGYA 4BJ1A 2XS1A 5AGFA 3UMHA 2J7PA 3VYWA 3KMIA 4LLEA 1NG1A 2GFHA 3N24A 3GORA 5CI9A 2Q7RA 4RBNA 1WTYA 2C03A 1MMNA 4JTCB 2CGEA 4BPMA 4XEFA 2HUJA 2YLIA 1HMDA 3FOOA 5E3AA 1ZU4A 2G3KA 5DLJA 1LM3B 3C7JA 2JX0A 3NKDA 2VCCA 2O9XA 5L0CA 3K1IC 4IRUA 1QKRA 2J9BA 1T6UA 4JJGA 2R7TA 4N4WA 2R02A 3KH2A 3NKEA 4DRHB 3HTKC 4EUKB 2VASA 3US6A 1CGME 1MMAA 1ORJA 1JRAA 1Q0KA 4JE9A 4O7GA 3TOMA 2A1DD 1TWHA 3S90A 2WZGA 5CI8A 2LCHA 4P9TA 4KNVA 4MVMA 2LQGA 3ECSA 3RH3A 3KKBA 3W8IA 4UDVA 4MVSA 4K1OA 2KYHA 4AX2A 1S05A 3TJ5A 3HNJA 1SYQA 4IAOA 3WODF 1HMOA 1SR2A 2G62A 2QLAA 4CS8A 4PJMA 3RF3A 4C7OB 5KYYB 3V5ZA 4NTAA 3ZQYA 3NMJA 5L0JA 4XEVA 4JW1A 2YWAA 2ZXOA 3S9OA 5DS5A 3U9MA 4BEJA 3UMIA 1FNTc 4CX9A 1OCCC 1H6GA 3C63A 4JZAA 3ZIBA 5DS4A 3T6GB 1BDJB 3LNMB 1D0ZA 1MMGA 2YLGA 4OD4A 2R7UA 1V74B 4JVSA 1U89A 2DI3A 5KYXB 1BR2A 4P9FA 2CDQA 3MLGA 1WOLA 2DYRC 3A11A 2ZXWC 4L6RA 3RFYA 4JIOA 2EINC 1ZVZA 4M63A 4YL1A 4CJOA 4CSAC 4YT8A 1FFHA 3K6BA 1HY5A 2B0HA 1VYKA 2QNLA 2UUHA 2Y3BA 3ITFA 3LESA 4RDAA 1E83A 3GWNA 2MYSA 3U8VA 3RYLA 1SZIA 3HNLA 5T1DB 5T3WA 2KW3C 4DRJB 4U9EA 3S28A 3U8PA 2YEVA 2KC3A 4E7ZA 3AG3C 4EHPA 1OXBA 4ULVA 3DZAA 4DOZA 3DAGA 3DXJF 1T5OA 2FAPB 2XM4A 3AJMA 3C8GB 1KU2A 3ZDLA 3VM6A 4ZLCA 3SXKA 3S84A 1YDIA 3CEXA 3UGOA 2QE9A 1NFOA 2R7QA 1M56C 2WZFA 1QVXA 3IQCA 3U2LA 3HLZA 3U5SA 1NU7D 4YWQA 3PHF2 4MVOA 2B0JA 4EIYA 3HNIA 4NTBA 4HFFB 1LPEA 2PP4A 2CYDA 3NYJA 3JRTA 3F47A 3DJUB 2Y3HA 1XZPA 5DVWA 1Q0MA 1RJ9B 2YL3A 2PX3A 4MVQA 5BUOA 3EHMA 4JJFA 2L6HA 1CPQA 2XL4A 1C02A 1ZHYA 2L6FA 4WJ0A 3GANA 2J0XA 2HS5A 1M6TA 3FOPA 3MX3A 1I4YA 1WGWA 3ABKC 3UNGC 3N2ZB 1TQGA 3ASNC 4W8KA 4MNDA 5L3VA 4YT2A 2TMVP 3B0UX 3J06A 2P61A 3W8HA 4Z9JA 1OXKA 1KNYA 3C62A 4PACA 3U0CA 1DOVA 2H7VC 2EPLX 2PF4E 3B0PA 3K1HA 3L34A 4I3MA 4AL1A 3PCVA 1C03A 2NUTB 2Y3GA 3R2PA 3RQGA 3W4YA 4FX5A 2J7PD 1D0XA 4HEAJ 2R7XA 3B71A 3B9QA 3O39A 4OD5A 3A9CA 3ZWIA 3N0TA 4LDRA 4O6MA 4XPWA 4CS9A 4LDQA 4JURI 5A6BA 1G8XA 1A7EA 3G4ZA 4MW8A 1LS4A 3O10A 5D91A 5JUAA 3E70C 1T6IA 3GEHA 4IAQA 5AC4A 3M4BA 1PD1A 2J46A 2W45A 1D1AA 2GA0A 2OEXA 3JYYA 1SF8A 2HV6A 1C17M 3MFNA 1WASA 2R05A 1OQCA 2XLDA 3DAFA 4AK9A 3VF0A 2EILC 4ULWA 1QPUA 3EG9A 5COMA 4E18A 3I5QA 5T3TA 2QTVA 4YT4A 2NSFA 3X1OA 5DS6A 5KYNA 3NYMA 3AGTA 2YQYA 5TJ5E 2NUPB 4EBKA 2PFDA 2XRHA 2ZXPA 1A7DA 1T6QA 1XZQA 1EA8A 2Z15A 3EH2A 4I44A 4DRIB 2HMZA 1OW8A 3Q6NA 3RVYA 3U3BA 2IOQA 5KYUA 4DVZA 4ZLDA 3EGXB 1S7ZA 3X2QC 1VYIA 1JPNA 2EPKX 2M64A 3ZQVA 2R7RA 2Q00A 2NPUA 4BJ6A 3KL4A 3U3FA 3T4RA 4WGYA 1NU9C 2WZLA 2XS8A 2GWWA 1OR2A 3EGDA 2ICWG 2X0CA 1Q0DA 4G7HF 4G7ZF 2J9VA 4GQHA 2VCAA 4JKVA 4MW3A 5COFA 1LI5A 2CCYA 3LAYA 3QW0A 4QDLA 2Q9BA 1H7IA 3L8IA 5IY5C 1NZEA 1RKEA 1YVIA 1ZHWA 3JZ0A 5E3CA 4BG0A 2IXOA 4EWCA 2R7WA 1Z6AA 3TOLA 1V54C 2Q9CA 3HJCA 5JLIA 2KQ9A 2XL8A 4R32A 3LNRA 5B3IA 3NMIA 4YN0B 2D5RB 2KK1A 2P7VA 4J7YA 2J8WA 3SEOA 3DD7A 4CIPA 5CIVA 4KNWA 2Q9AA 4I1MA 2R7OA 1M2VA 5DQTA 3RW0A 3FMSA 4BEMJ 1ZW3A 3FDQA 3IPMO 3CSKA 3DMDA 1BR4A 1QQ3A 3VAYA 3S0XA 1T9KA 2IYLD 2KGOA 3EZIA 3QW1A 2J9UA 3RVZA 1RMVA 1HE9A 1NFNA 2EPNA 2H7OA 3HKKA 2OG2A 4BJTA 4A4AA 1NSGB 3R7CA 1Q0FA 2LFFA 1D1BA 1ORYA 5BQGA 1ZHZA 2XXAB 3K33A 4MTOA 4GEHA 5E2QA 1Z7Qc 3LLKA 4AE4A 4H4KC 2XLEA 3JT1A 2XL6A 5HV9A 4YK5A 1K40A 3MYIA 2HSQA 2LK4A 4PFPA 4O6NA 4CDVA 256BA 4E7SA 4OIPF 4DXWA 1OW7A 5B1BC 1LKXA 1D1CA 3DE9A 2OQMA 3PDMP 5EGYA 1YJGA 3QTHA 2D4UA 4PJJA 2AWCA 1HE1A 4N6CA 4AL0A 2R03A 1MQVA 3GM3A 1R4TA 4J7TA 2OJQA 1U6HA 3B29A 3TK0A 2P1AA 3EFOB 5JS5A 2RSEB 4OIQF 4F4BA 1PCXA 2P6VA 4JEAA 1M2OA 3QMKA 3T9OA 1G4WR 3WHNA 1V4AA 2EIMC 4N06A 4JRZA 2CW0F 2A0BA 1QSPA 4U5BE 2FFHA 3KPHA 2ETSA 1MNEA 3LJBA 4W8PA 1GQAA 1YARO 3TULA 1VK5A 3LEOA 5A6BD 3JTLO 1WN0A 3K66A 3H65A 4K7BA 4DJ9A 4U5FE 4OIOF 3ZTMA 1YYJA 1YLMA 5L0GA 1FFTC 2IBFA 5GPGB 4U5GA 5L0IA 3ZG1A 2C04A 2YL0A 4IARA 4MQ9F 1YAUO 2UUIA 1A41A 4G7OF 1VLTA 2CNWA 2BC5A 1YA9A 3PMRA 1AUEA 4IWBA 3EGDB 3G50A 2W9YA 1EQ1A 1RKCA 3QVYA 1ZZPA 1K05A 3LS1A 4CIHA 3FXHA 3JSZA 2AU5A 4G0HA 4XTKA 1XWJA 1Z5ZA 3CQZA 4XPXA 3T6JA 4CJGA 1PD0A 1LE2A 2MHRA 2Q3TA 4H54A 4P6IC 3U2MA 4CS8C 3NDBB 2L6GA 4Q7CA 4Q4ZF 4U5CE 3W2WA 3SYNA 4JC7A 3UMKA 2HFIA 1LE4A 1M57C 2EPOA 3M1CB 2EIJC 2Y39A 4PK4A 1BR1A 1RXQA 2BL2A 3W2VA 4JTDB 4C3DA 3UGPA 3IQTA 1Z23A 4MS2A 4DVYP 3S29A 2GAQA 3GODA 4KBLA 5L0FA 4NCQA 3C18A 3LUTB 2R7SA 3I4UA 2AWYA 3OA1A 4JTAB 2L81A 5DQZA 1HW1A 3L1MA 3ABMC 3O55A 3MYFA 3DM9B 1LVKA 1ZHTA 5F28E 2V26A 2HMQA 1N1CA 1QZXA 2OKUA 3NMKA 3DKAA 2BE5F 5EHHA 1AEPA 1ST6A 1VTMP 1L3PA 5EK0A 5L0HA 1OW6A 4CS7A 2LSEA 2VCBA 4C7OA 3JSEO 4MTGA 5L0DA 5KYYA 1E85A 3GM1A 5FCLA 2OEVA 2XM0A 3EPVA 5B3SC 4PFOA 4PR9A 3RIPA 3L0IA 1IW7F 4E17A 3ZTZA 2DB4A 2H7BA 2Y69C 4HFKB 1Z63A 3FVYA 5A6AA 3Q6MA 4U5DE 4C3BA 2GDCA 2PNOA 1T01A 5KYXA 1FR0A 2HJ3A 3JRMO 3M15A 5A69A 3L8JA 3OEOA 4B6IA 4E0IA 3TQOA 3GM2A 1AVOB 1L7CA 4Q5SF 4YT5A 3V5YA 1NLXA 1UFBA 2QY9A 3BEHA 4LACB 2XSEA 3GEEA 2LP4A 2XLHA 4LERA 4NQFA 3RQEA 3GWLA 2JPUA 3WG7C 4EBJA 4BJ5A 1CGOA 1BBHA 2KJGA 3C8ZA 4C3EA 1RCPA 3GEIA 5BQHA 4XWJA 3DM5A 1Y4CA 1GGQA 3O6XA 1OR3A 2LD6A 1JOGA 1Y6DA 1CGNA 1PV3A 2IXMA 4KC9A 1B68A 1YZAA 3ABLC 4HE8D 4NTFA 4WABA 3C8GA 1KTMA 1OKKA 3AG1C 2DGJA 3Q7LA 2E87A 3FAJA 4NC3A 2A6EF 4CDAA 2XLOA 1J8YF 1EI7A 4OINF 3IQ5A 2NSGA 3E9VA 3ZVRA 5L3QA 2LIGA 4CS9C 1GM5A 2H8AA 1JR8A 5JVEA 1HW2A 1U0BB 2HKVA 2XLMA 4GYTA 1I5NA 2EIKC 1EKYA 3FHDA 3AGUA 3ATPA 1YYXA 4U5EE 4XLNF 3UR3C 1FMWA 4ANJA 1ZHXA 2HSBA 1RJ9A 2YKZA 4MTFA 3S27A 2IM8A 4N6HA 4O6YA 2OCCC 5BQIA 4KI2A 1TR2A 2KSFA 2CNWD 1OCOC 2AP3A 3T6BA 1W2WA 4Z9IA 3EH1A 2ZPAA 4NY3A 4D4NA 4E0HA 3IEEA 4K0DA 5COGA 2RD9A 2NUTA 5AC5A 2A6HF 2L9JA 4J32B 3SXZA 2WVQA 4RD9A 1O3UA 5D92A 2VC9A 5HSWA 3AOUA 1FTSA
chains in the Genus database with same CATH topology
1V74B 1TFKB 1TFOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V74 B;  1TFK B;  1TFO B; 
#chains in the Genus database with same CATH topology
 1Q0G A;  4QI2 A;  1WAT A;  4LDK A;  1G4U S;  4FWV A;  4BJ6 C;  2WL8 A;  4G78 A;  1NBB A;  1R5I D;  2R9R B;  3EG9 B;  3NRH A;  3WAQ A;  3Q7G A;  2NG1 A;  4BJ5 C;  3LLI A;  1VMA A;  2PBE A;  3QZC A;  3LEV A;  4IB4 A;  5A6J A;  5F5F A;  2W4B A;  2MWQ A;  1E2X A;  3ASO C;  4MVR A;  4Z9H A;  3QVZ A;  5KYU B;  1LI7 A;  1UG7 A;  3B0V C;  2XLV A;  3M4C A;  5JRA A;  2R7V A;  5FZT A;  4FAP B;  5KYW A;  1A0B A;  3AQC A;  5JT4 A;  2WVN A;  2NUP A;  3JYH A;  5K0I A;  3EQL F;  4YL3 A;  2J0W A;  1CPR A;  2YL1 A;  2ASR A;  4JCH A;  2LFD A;  5E33 A;  2X51 A;  4PJN A;  3EGX A;  2AVK A;  3M79 A;  4JEB A;  3MBG A;  1FAP B;  1I4Z A;  3K7D A;  2YHS A;  3BRJ A;  2G3V A;  4LLC A;  2WVO A;  1RKE B;  2WB7 A;  1A7V A;  4MVU A;  4XQ1 A;  3SNH A;  1WWP A;  2HV7 A;  4I1O B;  3SXM A;  2IXN A;  3DJN B;  3V5X A;  3CAX A;  2I15 A;  1VLS A;  1APC A;  3SXY A;  1ZU5 A;  3FAP B;  3VRC A;  1ORS C;  3NG1 A;  4YJW A;  2Y3D A;  1TWC A;  2L7A A;  3SZR A;  3ZSU A;  1M2V B;  1TWA A;  2J9W A;  1ZYR F;  4ER9 A;  5B1A C;  1YA7 O;  4ONS A;  1JMW A;  1K04 A;  5JSL A;  2A69 F;  4OIR F;  2R25 A;  3JCU Q;  3NYL A;  3KYJ A;  4IJJ A;  4EKW A;  1F1M A;  3EJN A;  3AQB A;  2YZS A;  2YVK A;  3EZH A;  2XLW A;  3H2U A;  2DYS C;  1J8M F;  1O5H A;  4QI0 A;  4YL0 A;  4J30 B;  2W4M A;  5F5H A;  4DBQ A;  1TFK B;  2J45 A;  2OOC A;  4CDY A;  3C8G D;  3H2V A;  1OKK D;  2KNH A;  4AE4 B;  2Q4F A;  3I5P A;  1JPJ A;  2VB6 A;  3IHU A;  2YLD A;  1VOM A;  2YL7 A;  1H9T A;  1TFO B;  3K1I A;  4X0R A;  4IGG A;  2V3C C;  3POV A;  1LS1 A;  2VH3 A;  2IXP A;  3F46 A;  2ZD9 A;  1E84 A;  1BZ4 A;  3KYI A;  2JD3 A;  2XXA A;  3AG2 C;  3G4X A;  2HZ8 A;  3U9J A;  1D0Y A;  1OCR C;  4EBB A;  2YRF A;  3LS0 A;  3ZC4 A;  3TJ6 A;  3TD7 A;  1GS9 A;  2F22 A;  4PJL A;  1OCZ C;  3RKO F;  1E86 A;  1FMV A;  4D4X A;  1DOW A;  4XLP F;  4MVZ A;  4FES A;  4A2N B;  4JCZ A;  2HJM A;  1G5Z A;  4O79 A;  2QUP A;  1O87 A;  1VB5 A;  2A68 F;  1H9G A;  1MND A;  1V55 C;  2OJE D;  1IZM A;  1ZW2 A;  3EFO A;  1SMY F;  3DI5 A;  2EPM X;  4XPY A;  3RQF A;  2ZXR A;  3IQ6 A;  1JAF A;  2OU6 A;  1YZC A;  3DE8 A;  2P0N A;  4DBR A;  5KYW B;  3HNK A;  4U9D A;  3DWW A;  1LIH A;  3SP1 A;  4U5H A;  3EHN A;  2PX0 A;  3AG4 C;  3OWT A;  5A6K A;  2A0U A;  5JP7 A;  4WGZ A;  1QLE C;  1MMD A;  2I8B A;  1TKN A;  3V7O A;  4CSA A;  2M4E A;  1TWG A;  4CBE A;  1Z3I X;  4XEK A;  3CZ6 A;  2FGY A;  4BJ1 A;  2XS1 A;  5AGF A;  3UMH A;  2J7P A;  3VYW A;  3KMI A;  4LLE A;  1NG1 A;  2GFH A;  3N24 A;  3GOR A;  5CI9 A;  2Q7R A;  4RBN A;  1WTY A;  2C03 A;  1MMN A;  4JTC B;  2CGE A;  4BPM A;  4XEF A;  2HUJ A;  2YLI A;  1HMD A;  3FOO A;  5E3A A;  1ZU4 A;  2G3K A;  5DLJ A;  1LM3 B;  3C7J A;  2JX0 A;  3NKD A;  2VCC A;  2O9X A;  5L0C A;  3K1I C;  4IRU A;  1QKR A;  2J9B A;  1T6U A;  4JJG A;  2R7T A;  4N4W A;  2R02 A;  3KH2 A;  3NKE A;  4DRH B;  3HTK C;  4EUK B;  2VAS A;  3US6 A;  1CGM E;  1MMA A;  1ORJ A;  1JRA A;  1Q0K A;  4JE9 A;  4O7G A;  3TOM A;  2A1D D;  1TWH A;  3S90 A;  2WZG A;  5CI8 A;  2LCH A;  4P9T A;  4KNV A;  4MVM A;  2LQG A;  3ECS A;  3RH3 A;  3KKB A;  3W8I A;  4UDV A;  4MVS A;  4K1O A;  2KYH A;  4AX2 A;  1S05 A;  3TJ5 A;  3HNJ A;  1SYQ A;  4IAO A;  3WOD F;  1HMO A;  1SR2 A;  2G62 A;  2QLA A;  4CS8 A;  4PJM A;  3RF3 A;  4C7O B;  5KYY B;  3V5Z A;  4NTA A;  3ZQY A;  3NMJ A;  5L0J A;  4XEV A;  4JW1 A;  2YWA A;  2ZXO A;  3S9O A;  5DS5 A;  3U9M A;  4BEJ A;  3UMI A;  1FNT c;  4CX9 A;  1OCC C;  1H6G A;  3C63 A;  4JZA A;  3ZIB A;  5DS4 A;  3T6G B;  1BDJ B;  3LNM B;  1D0Z A;  1MMG A;  2YLG A;  4OD4 A;  2R7U A;  1V74 B;  4JVS A;  1U89 A;  2DI3 A;  5KYX B;  1BR2 A;  4P9F A;  2CDQ A;  3MLG A;  1WOL A;  2DYR C;  3A11 A;  2ZXW C;  4L6R A;  3RFY A;  4JIO A;  2EIN C;  1ZVZ A;  4M63 A;  4YL1 A;  4CJO A;  4CSA C;  4YT8 A;  1FFH A;  3K6B A;  1HY5 A;  2B0H A;  1VYK A;  2QNL A;  2UUH A;  2Y3B A;  3ITF A;  3LES A;  4RDA A;  1E83 A;  3GWN A;  2MYS A;  3U8V A;  3RYL A;  1SZI A;  3HNL A;  5T1D B;  5T3W A;  2KW3 C;  4DRJ B;  4U9E A;  3S28 A;  3U8P A;  2YEV A;  2KC3 A;  4E7Z A;  3AG3 C;  4EHP A;  1OXB A;  4ULV A;  3DZA A;  4DOZ A;  3DAG A;  3DXJ F;  1T5O A;  2FAP B;  2XM4 A;  3AJM A;  3C8G B;  1KU2 A;  3ZDL A;  3VM6 A;  4ZLC A;  3SXK A;  3S84 A;  1YDI A;  3CEX A;  3UGO A;  2QE9 A;  1NFO A;  2R7Q A;  1M56 C;  2WZF A;  1QVX A;  3IQC A;  3U2L A;  3HLZ A;  3U5S A;  1NU7 D;  4YWQ A;  3PHF 2;  4MVO A;  2B0J A;  4EIY A;  3HNI A;  4NTB A;  4HFF B;  1LPE A;  2PP4 A;  2CYD A;  3NYJ A;  3JRT A;  3F47 A;  3DJU B;  2Y3H A;  1XZP A;  5DVW A;  1Q0M A;  1RJ9 B;  2YL3 A;  2PX3 A;  4MVQ A;  5BUO A;  3EHM A;  4JJF A;  2L6H A;  1CPQ A;  2XL4 A;  1C02 A;  1ZHY A;  2L6F A;  4WJ0 A;  3GAN A;  2J0X A;  2HS5 A;  1M6T A;  3FOP A;  3MX3 A;  1I4Y A;  1WGW A;  3ABK C;  3UNG C;  3N2Z B;  1TQG A;  3ASN C;  4W8K A;  4MND A;  5L3V A;  4YT2 A;  2TMV P;  3B0U X;  3J06 A;  2P61 A;  3W8H A;  4Z9J A;  1OXK A;  1KNY A;  3C62 A;  4PAC A;  3U0C A;  1DOV A;  2H7V C;  2EPL X;  2PF4 E;  3B0P A;  3K1H A;  3L34 A;  4I3M A;  4AL1 A;  3PCV A;  1C03 A;  2NUT B;  2Y3G A;  3R2P A;  3RQG A;  3W4Y A;  4FX5 A;  2J7P D;  1D0X A;  4HEA J;  2R7X A;  3B71 A;  3B9Q A;  3O39 A;  4OD5 A;  3A9C A;  3ZWI A;  3N0T A;  4LDR A;  4O6M A;  4XPW A;  4CS9 A;  4LDQ A;  4JUR I;  5A6B A;  1G8X A;  1A7E A;  3G4Z A;  4MW8 A;  1LS4 A;  3O10 A;  5D91 A;  5JUA A;  3E70 C;  1T6I A;  3GEH A;  4IAQ A;  5AC4 A;  3M4B A;  1PD1 A;  2J46 A;  2W45 A;  1D1A A;  2GA0 A;  2OEX A;  3JYY A;  1SF8 A;  2HV6 A;  1C17 M;  3MFN A;  1WAS A;  2R05 A;  1OQC A;  2XLD A;  3DAF A;  4AK9 A;  3VF0 A;  2EIL C;  4ULW A;  1QPU A;  3EG9 A;  5COM A;  4E18 A;  3I5Q A;  5T3T A;  2QTV A;  4YT4 A;  2NSF A;  3X1O A;  5DS6 A;  5KYN A;  3NYM A;  3AGT A;  2YQY A;  5TJ5 E;  2NUP B;  4EBK A;  2PFD A;  2XRH A;  2ZXP A;  1A7D A;  1T6Q A;  1XZQ A;  1EA8 A;  2Z15 A;  3EH2 A;  4I44 A;  4DRI B;  2HMZ A;  1OW8 A;  3Q6N A;  3RVY A;  3U3B A;  2IOQ A;  5KYU A;  4DVZ A;  4ZLD A;  3EGX B;  1S7Z A;  3X2Q C;  1VYI A;  1JPN A;  2EPK X;  2M64 A;  3ZQV A;  2R7R A;  2Q00 A;  2NPU A;  4BJ6 A;  3KL4 A;  3U3F A;  3T4R A;  4WGY A;  1NU9 C;  2WZL A;  2XS8 A;  2GWW A;  1OR2 A;  3EGD A;  2ICW G;  2X0C A;  1Q0D A;  4G7H F;  4G7Z F;  2J9V A;  4GQH A;  2VCA A;  4JKV A;  4MW3 A;  5COF A;  1LI5 A;  2CCY A;  3LAY A;  3QW0 A;  4QDL A;  2Q9B A;  1H7I A;  3L8I A;  5IY5 C;  1NZE A;  1RKE A;  1YVI A;  1ZHW A;  3JZ0 A;  5E3C A;  4BG0 A;  2IXO A;  4EWC A;  2R7W A;  1Z6A A;  3TOL A;  1V54 C;  2Q9C A;  3HJC A;  5JLI A;  2KQ9 A;  2XL8 A;  4R32 A;  3LNR A;  5B3I A;  3NMI A;  4YN0 B;  2D5R B;  2KK1 A;  2P7V A;  4J7Y A;  2J8W A;  3SEO A;  3DD7 A;  4CIP A;  5CIV A;  4KNW A;  2Q9A A;  4I1M A;  2R7O A;  1M2V A;  5DQT A;  3RW0 A;  3FMS A;  4BEM J;  1ZW3 A;  3FDQ A;  3IPM O;  3CSK A;  3DMD A;  1BR4 A;  1QQ3 A;  3VAY A;  3S0X A;  1T9K A;  2IYL D;  2KGO A;  3EZI A;  3QW1 A;  2J9U A;  3RVZ A;  1RMV A;  1HE9 A;  1NFN A;  2EPN A;  2H7O A;  3HKK A;  2OG2 A;  4BJT A;  4A4A A;  1NSG B;  3R7C A;  1Q0F A;  2LFF A;  1D1B A;  1ORY A;  5BQG A;  1ZHZ A;  2XXA B;  3K33 A;  4MTO A;  4GEH A;  5E2Q A;  1Z7Q c;  3LLK A;  4AE4 A;  4H4K C;  2XLE A;  3JT1 A;  2XL6 A;  5HV9 A;  4YK5 A;  1K40 A;  3MYI A;  2HSQ A;  2LK4 A;  4PFP A;  4O6N A;  4CDV A;  256B A;  4E7S A;  4OIP F;  4DXW A;  1OW7 A;  5B1B C;  1LKX A;  1D1C A;  3DE9 A;  2OQM A;  3PDM P;  5EGY A;  1YJG A;  3QTH A;  2D4U A;  4PJJ A;  2AWC A;  1HE1 A;  4N6C A;  4AL0 A;  2R03 A;  1MQV A;  3GM3 A;  1R4T A;  4J7T A;  2OJQ A;  1U6H A;  3B29 A;  3TK0 A;  2P1A A;  3EFO B;  5JS5 A;  2RSE B;  4OIQ F;  4F4B A;  1PCX A;  2P6V A;  4JEA A;  1M2O A;  3QMK A;  3T9O A;  1G4W R;  3WHN A;  1V4A A;  2EIM C;  4N06 A;  4JRZ A;  2CW0 F;  2A0B A;  1QSP A;  4U5B E;  2FFH A;  3KPH A;  2ETS A;  1MNE A;  3LJB A;  4W8P A;  1GQA A;  1YAR O;  3TUL A;  1VK5 A;  3LEO A;  5A6B D;  3JTL O;  1WN0 A;  3K66 A;  3H65 A;  4K7B A;  4DJ9 A;  4U5F E;  4OIO F;  3ZTM A;  1YYJ A;  1YLM A;  5L0G A;  1FFT C;  2IBF A;  5GPG B;  4U5G A;  5L0I A;  3ZG1 A;  2C04 A;  2YL0 A;  4IAR A;  4MQ9 F;  1YAU O;  2UUI A;  1A41 A;  4G7O F;  1VLT A;  2CNW A;  2BC5 A;  1YA9 A;  3PMR A;  1AUE A;  4IWB A;  3EGD B;  3G50 A;  2W9Y A;  1EQ1 A;  1RKC A;  3QVY A;  1ZZP A;  1K05 A;  3LS1 A;  4CIH A;  3FXH A;  3JSZ A;  2AU5 A;  4G0H A;  4XTK A;  1XWJ A;  1Z5Z A;  3CQZ A;  4XPX A;  3T6J A;  4CJG A;  1PD0 A;  1LE2 A;  2MHR A;  2Q3T A;  4H54 A;  4P6I C;  3U2M A;  4CS8 C;  3NDB B;  2L6G A;  4Q7C A;  4Q4Z F;  4U5C E;  3W2W A;  3SYN A;  4JC7 A;  3UMK A;  2HFI A;  1LE4 A;  1M57 C;  2EPO A;  3M1C B;  2EIJ C;  2Y39 A;  4PK4 A;  1BR1 A;  1RXQ A;  2BL2 A;  3W2V A;  4JTD B;  4C3D A;  3UGP A;  3IQT A;  1Z23 A;  4MS2 A;  4DVY P;  3S29 A;  2GAQ A;  3GOD A;  4KBL A;  5L0F A;  4NCQ A;  3C18 A;  3LUT B;  2R7S A;  3I4U A;  2AWY A;  3OA1 A;  4JTA B;  2L81 A;  5DQZ A;  1HW1 A;  3L1M A;  3ABM C;  3O55 A;  3MYF A;  3DM9 B;  1LVK A;  1ZHT A;  5F28 E;  2V26 A;  2HMQ A;  1N1C A;  1QZX A;  2OKU A;  3NMK A;  3DKA A;  2BE5 F;  5EHH A;  1AEP A;  1ST6 A;  1VTM P;  1L3P A;  5EK0 A;  5L0H A;  1OW6 A;  4CS7 A;  2LSE A;  2VCB A;  4C7O A;  3JSE O;  4MTG A;  5L0D A;  5KYY A;  1E85 A;  3GM1 A;  5FCL A;  2OEV A;  2XM0 A;  3EPV A;  5B3S C;  4PFO A;  4PR9 A;  3RIP A;  3L0I A;  1IW7 F;  4E17 A;  3ZTZ A;  2DB4 A;  2H7B A;  2Y69 C;  4HFK B;  1Z63 A;  3FVY A;  5A6A A;  3Q6M A;  4U5D E;  4C3B A;  2GDC A;  2PNO A;  1T01 A;  5KYX A;  1FR0 A;  2HJ3 A;  3JRM O;  3M15 A;  5A69 A;  3L8J A;  3OEO A;  4B6I A;  4E0I A;  3TQO A;  3GM2 A;  1AVO B;  1L7C A;  4Q5S F;  4YT5 A;  3V5Y A;  1NLX A;  1UFB A;  2QY9 A;  3BEH A;  4LAC B;  2XSE A;  3GEE A;  2LP4 A;  2XLH A;  4LER A;  4NQF A;  3RQE A;  3GWL A;  2JPU A;  3WG7 C;  4EBJ A;  4BJ5 A;  1CGO A;  1BBH A;  2KJG A;  3C8Z A;  4C3E A;  1RCP A;  3GEI A;  5BQH A;  4XWJ A;  3DM5 A;  1Y4C A;  1GGQ A;  3O6X A;  1OR3 A;  2LD6 A;  1JOG A;  1Y6D A;  1CGN A;  1PV3 A;  2IXM A;  4KC9 A;  1B68 A;  1YZA A;  3ABL C;  4HE8 D;  4NTF A;  4WAB A;  3C8G A;  1KTM A;  1OKK A;  3AG1 C;  2DGJ A;  3Q7L A;  2E87 A;  3FAJ A;  4NC3 A;  2A6E F;  4CDA A;  2XLO A;  1J8Y F;  1EI7 A;  4OIN F;  3IQ5 A;  2NSG A;  3E9V A;  3ZVR A;  5L3Q A;  2LIG A;  4CS9 C;  1GM5 A;  2H8A A;  1JR8 A;  5JVE A;  1HW2 A;  1U0B B;  2HKV A;  2XLM A;  4GYT A;  1I5N A;  2EIK C;  1EKY A;  3FHD A;  3AGU A;  3ATP A;  1YYX A;  4U5E E;  4XLN F;  3UR3 C;  1FMW A;  4ANJ A;  1ZHX A;  2HSB A;  1RJ9 A;  2YKZ A;  4MTF A;  3S27 A;  2IM8 A;  4N6H A;  4O6Y A;  2OCC C;  5BQI A;  4KI2 A;  1TR2 A;  2KSF A;  2CNW D;  1OCO C;  2AP3 A;  3T6B A;  1W2W A;  4Z9I A;  3EH1 A;  2ZPA A;  4NY3 A;  4D4N A;  4E0H A;  3IEE A;  4K0D A;  5COG A;  2RD9 A;  2NUT A;  5AC5 A;  2A6H F;  2L9J A;  4J32 B;  3SXZ A;  2WVQ A;  4RD9 A;  1O3U A;  5D92 A;  2VC9 A;  5HSW A;  3AOU A;  1FTS A; 
#chains in the Genus database with same CATH homology
 1V74 B;  1TFK B;  1TFO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...