3C62A

Tetrameric cytochrome cb562 (h59/d62/h63/h73/a74/h77) assembly stabilized by interprotein zinc coordination
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
106
structure length
106
Chain Sequence
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMHDFDHGFDILVGQIHAALHLANEGKVKEAQAAAEQLKTTCNACHQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Soluble cytochrome b562
publication title Metal-mediated self-assembly of protein superstructures: influence of secondary interactions on protein oligomerization and aggregation.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Electron transport
total genus 44
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 3c62A00
1E86A 1M6TA 2YL0A 4CDAA 3HNIA 5JT4A 1NBBA 5JVEA 2XLOA 3FOPA 4CDVA 1CGOA 1A7VA 3FOOA 3C63A 4CIPA 1YZCA 2XL6A 1APCA 3NMJA 2BC5A 1LM3B 3NMKA 2XLEA 2YL7A 3HNKA 2YLDA 5JSLA 1CPQA 3HNLA 2J8WA 1RCPA 3QW1A 4IAQA 4D4NA 3QVYA 2XLVA 2J9BA 3ZTZA 3DE8A 5JP7A 4IARA 1QPUA 3ZQVA 3IQ6A 4CJGA 5AGFA 1JAFA 1E84A 5B3IA 4N4WA 256BA 3C62A 4WGYA 1GQAA 4U9EA 4U9DA 2XLMA 1QQ3A 1CPRA 4IB4A 3NMIA 3ZQYA 3TOMA 1EKYA 1MQVA 2XLWA 3M79A 4ULVA 2YL3A 2XM4A 4WGZA 3U8PA 4JEAA 3HNJA 3M4CA 1YYXA 4JKVA 1E83A 3VRCA 3M15A 2XL8A 2CCYA 4ER9A 2YLGA 4D4XA 2YLIA 2YKZA 3QVZA 4NC3A 2XLDA 1S05A 1CGNA 4CDYA 4N6HA 3ZWIA 1YZAA 2XM0A 1BBHA 4L6RA 5JRAA 3QW0A 1YYJA 3M4BA 4CX9A 2QLAA 2YL1A 2XLHA 5JUAA 5JS5A 1E85A 4EIYA 3IQ5A 4CJOA 3TOLA 5JLIA 4JEBA 3ZTMA 3DE9A 4JE9A 3L1MA
chains in the Genus database with same CATH superfamily
1Q0GA 4CDAA 3LS1A 2VASA 1HW1A 1HE1A 2O9XA 3HNIA 3LUTB 3MYIA 4U5CE 2WZLA 2JPUA 3E9VA 2XLOA 4J7TA 4G0HA 4E7SA 5L0CA 1R4TA 1I4ZA 3DKAA 2KJGA 3MBGA 4CDVA 1HY5A 2HMZA 3C63A 3HTKC 3V7OA 2VH3A 3Q7GA 1MNDA 1OKKD 4MVMA 1C02A 2EPOA 3GORA 3NYMA 2W45A 5BQGA 2QY9A 3AG1C 3FHDA 2EPKX 2J7PD 3NMJA 1RJ9A 5TJ5E 3SEOA 5DVWA 4HEAJ 2IM8A 1QSPA 4HE8D 2DI3A 5A6BA 4NY3A 4PJMA 3MLGA 4KNVA 4QI0A 1FFTC 2ICWG 2NUTA 1RKEB 4HFKB 5CI9A 4O79A 3GM2A 2IXMA 2UUIA 4FWVA 5JSLA 4CSAA 1QVXA 1TKNA 1WASA 1J8MF 1BR2A 4XPXA 3UMHA 4CS9C 2LSEA 1ZU4A 4JJGA 2J8WA 2W9YA 3HLZA 1K40A 4D4NA 4YL0A 5AC5A 5GPGB 1M56C 3NKEA 3SZRA 2W4MA 2Q4FA 3DD7A 5KYWB 3WG7C 1Z6AA 3QVYA 3TJ5A 2NUPA 2LP4A 2XRHA 1SMYF 3ZTZA 3BRJA 1XZPA 3S9OA 2MYSA 4OIRF 4X0RA 4PACA 3RFYA 1UFBA 4XEVA 1G8XA 5JP7A 2Z15A 1XWJA 4RD9A 4PFOA 1RMVA 1QPUA 1VLSA 3BEHA 1WGWA 1FFHA 2R7OA 2KQ9A 4O7GA 1RKCA 4MVQA 3U5SA 4BPMA 3ZG1A 4CJGA 4U5HA 4O6NA 3HJCA 3UNGC 3EH1A 2LFFA 2UUHA 3LEVA 3S0XA 3EHNA 4R32A 3DMDA 2IYLD 2QUPA 4A4AA 1UG7A 3O6XA 1Z7Qc 3JRMO 2LD6A 1PD0A 3CAXA 3V5YA 2R02A 4I44A 1EA8A 3NYLA 3GM3A 1XZQA 1YJGA 2H7VC 5CI8A 1RJ9B 1T5OA 4AK9A 4RBNA 3RQEA 4Q5SF 1MMAA 1WOLA 2OCCC 3NMIA 5D92A 2RD9A 2NUTB 2CGEA 3DJUB 3F47A 1MQVA 1LIHA 1C17M 1V74B 2F22A 2WL8A 3ABKC 4M63A 4MNDA 4ULVA 3T6GB 4E17A 3TULA 3EJNA 4G7HF 3J06A 4MQ9F 2HSBA 2XL4A 4JEAA 3M4CA 1YYXA 2VB6A 1Z3IX 3T6BA 3VAYA 4KC9A 1LS1A 2W4BA 2R05A 3EZIA 1H9TA 1A7DA 2YKZA 1LS4A 2J46A 2NUPB 2OKUA 3K7DA 4NC3A 1Z23A 2WZFA 1K05A 2XS8A 3K6BA 2GDCA 1S05A 2KW3C 3EGDA 4JTCB 5T3WA 3KPHA 4MW3A 4XLPF 4CDYA 3T6JA 2L9JA 3EHMA 1C03A 2KNHA 3EZHA 1TWGA 3AJMA 4PR9A 4P9TA 5KYUA 3SP1A 3RYLA 4MW8A 5A6BD 4DVYP 4ULWA 4EBBA 1VYIA 3SXYA 1YYJA 4BJ6C 1BR1A 1ZW3A 3M4BA 1T6UA 2QLAA 4B6IA 1KNYA 5L0HA 3U3BA 4EUKB 2XLHA 4K0DA 1M2OA 5JUAA 4BEMJ 1A7EA 5COMA 1D1BA 4ZLCA 1PD1A 2PX0A 3PHF2 2IXPA 2A6EF 2C04A 2VCAA 2EIKC 1W2WA 2IOQA 3CEXA 3DE9A 5DQZA 1U0BB 2AU5A 1ZU5A 3L1MA 5IY5C 2VCBA 1E86A 2YL0A 3QZCA 1SZIA 4K1OA 4XLNF 2XSEA 3UMKA 4MVRA 4G78A 5JT4A 5JVEA 3AG2C 2EIJC 3GEEA 3KH2A 3MYFA 4W8KA 2M4EA 1VTMP 3DM5A 1D1CA 2AWCA 3QMKA 2HSQA 3FOOA 4I1MA 2L6HA 5A6JA 3GEHA 2NSGA 4OD4A 4NTFA 4CS9A 4CIPA 1FNTc 1Z5ZA 2XL6A 4E0IA 5KYWA 3JSEO 3DJNB 3U8VA 5L0FA 2R7WA 3IQTA 1LM3B 3FVYA 1NLXA 4U5EE 3WAQA 1M2VA 2XLEA 2YHSA 3US6A 4XQ1A 1YARO 4IRUA 3EFOA 4JTAB 3AGUA 3W2WA 2M64A 3LNMB 3A11A 2ZXPA 4XTKA 1Y6DA 3AG3C 2PFDA 3EGDB 3HNLA 5D91A 5BUOA 4GYTA 4LDKA 4DXWA 4IAQA 3ZSUA 1VOMA 4E0HA 2Q9AA 5EGYA 2P61A 4PJNA 2ZXWC 3TQOA 1NU9C 2CNWD 5KYUB 2B0HA 1EQ1A 4J30B 2E87A 2BE5F 3ASNC 1ZYRF 2R7UA 3GEIA 5COFA 3T9OA 3KL4A 2HMQA 3B0UX 1L3PA 2QTVA 3ZIBA 3DE8A 1JPNA 2LQGA 4UDVA 1BDJB 3U0CA 1SF8A 3QTHA 2NSFA 4IARA 1LI7A 1JRAA 2OG2A 3EH2A 4JZAA 2EIMC 4MS2A 2YVKA 1YLMA 2J45A 3R7CA 3VM6A 3GM1A 3LESA 3U3FA 4CS8C 4K7BA 3FAJA 3POVA 2KC3A 2OU6A 3LLIA 4U5FE 4XWJA 1TWCA 3X2QC 4OIQF 1AEPA 1T01A 1ZHZA 1JAFA 3ITFA 4P6IC 3G50A 3LJBA 3M1CB 4U5BE 3RF3A 5F28E 1KU2A 4ONSA 3H65A 1H6GA 1Z63A 256BA 4OINF 4WGYA 1VB5A 4KI2A 1D0ZA 4RDAA 2EPLX 3SXZA 5B3SC 2KK1A 5EHHA 3O10A 1L7CA 4EKWA 1CPRA 3L8IA 2OEVA 1VLTA 5KYYA 4IB4A 1M2VB 3PDMP 3W2VA 2J9VA 3ZQYA 2R9RB 2YZSA 4QDLA 2R7TA 1ORSC 3EFOB 4IWBA 1OW7A 4IJJA 1HE9A 5FZTA 2WZGA 2D5RB 2Q00A 3C8GA 3DAGA 4JTDB 3RVYA 4YT4A 4O6YA 4JC7A 3HNJA 1G4US 3JT1A 1GM5A 2BL2A 2YRFA 3JYYA 1H7IA 2HS5A 3VRCA 2CW0F 3M15A 1I4YA 3CSKA 4Z9JA 4ER9A 4D4XA 1Q0DA 4YT5A 1PCXA 1VMAA 2G3VA 2IXOA 2WVNA 3K1IC 3I5QA 4FX5A 1DOVA 2Y39A 4OIPF 1YZAA 2P0NA 3S27A 1SYQA 4PJLA 3RIPA 3X1OA 2Y69C 2CNWA 2OQMA 3SYNA 1EI7A 1HW2A 5L3QA 5HV9A 3L0IA 2J9WA 1AUEA 2P1AA 1D1AA 3JSZA 4J7YA 3Q6NA 5JRAA 2R7VA 4HFFB 5L0GA 3W4YA 1WTYA 2X0CA 4JURI 2D4UA 2HJ3A 5A69A 1LVKA 2LIGA 2TMVP 4G7OF 3DAFA 1J8YF 1TFOB 4JW1A 4EIYA 4Q4ZF 3TOLA 1S7ZA 3B0VC 3G4ZA 2VCCA 2PX3A 2FAPB 2GWWA 3AG4C 3DWWA 4JJFA 5E3AA 3CZ6A 3EPVA 3KMIA 5KYYB 4CSAC 3ZDLA 3RQGA 2GAQA 3EG9A 4BJ5A 2HV7A 3L8JA 2YQYA 2Y3BA 3UGPA 2IXNA 4DOZA 1CGOA 3E70C 4BG0A 4KNWA 3C8GB 4G7ZF 2OJQA 2XS1A 1OCOC 2ZXRA 2AP3A 3S84A 1OCRC 4JCHA 1LE2A 2DYRC 1BZ4A 1YZCA 1JOGA 3B29A 2BC5A 4ANJA 1ZHTA 5COGA 3U2LA 4IAOA 2YL7A 4YN0B 3MX3A 1YA7O 1QKRA 2FFHA 4N6CA 3S29A 3SNHA 1IZMA 4AL0A 3GANA 3TK0A 4MTFA 2P6VA 1CPQA 3NG1A 1MNEA 2PNOA 1RCPA 3DI5A 3B71A 1M57C 3F46A 1O5HA 2J0WA 4A2NB 4Q7CA 1FAPB 3RW0A 3VF0A 2WVQA 3RH3A 3WHNA 4CS7A 3H2VA 3U9JA 3IPMO 1LKXA 3W8IA 1CGME 2HJMA 1NFNA 4NQFA 1LPEA 4YJWA 2J9BA 4AL1A 4CS8A 4EWCA 3JRTA 4C3EA 3C8GD 2EPMX 1WN0A 2HUJA 4C3BA 3K33A 4DRIB 2DYSC 3U2MA 2PP4A 1PV3A 1YAUO 2AWYA 1AVOB 1T9KA 3AQBA 3H2UA 3RQFA 3B9QA 5DLJA 2LCHA 4E18A 4OIOF 4AX2A 1SR2A 3K1HA 3DZAA 1ZW2A 4MVUA 3FMSA 1F1MA 5AGFA 5B1AC 5A6KA 3EG9B 3LLKA 3OEOA 1Y4CA 2J0XA 4LDQA 5E3CA 3T4RA 1E84A 3N24A 2L7AA 2YEVA 3TJ6A 1V54C 1GQAA 2HV6A 2WVOA 3I5PA 4U9EA 4YWQA 2XLMA 3UMIA 3NYJA 4YL3A 1LE4A 5CIVA 2J9UA 1TWHA 4DRJB 4MVOA 1EKYA 5DS4A 1R5ID 3U9MA 1YDIA 2XLWA 4AE4A 1N1CA 4YK5A 2YL3A 4FAPB 3PMRA 3G4XA 3EQLF 5BQHA 1JMWA 1YA9A 5L3VA 4YT2A 3C18A 3KKBA 2X51A 2Y3HA 3CQZA 5F5HA 4E7ZA 2MWQA 2ZXOA 4JKVA 1O3UA 3K1IA 1MMNA 3L34A 1G4WR 1ZHYA 4OD5A 2Q7RA 3AGTA 3OWTA 4H4KC 2CCYA 3UR3C 2A6HF 2YLGA 2YLIA 3QVZA 4PK4A 3N0TA 1B68A 1GGQA 2QNLA 2A1DD 3ZC4A 1FMVA 4C7OA 1VYKA 2L6FA 4N6HA 3SXKA 3ZWIA 4I3MA 4YT8A 2A69F 1K04A 1TR2A 4BJTA 1U89A 2ETSA 3PCVA 4I1OB 1H9GA 4ZLDA 3HKKA 1TFKB 2EINC 2KGOA 1YVIA 2KYHA 1Q0FA 1HMOA 3JTLO 3QW0A 1QLEC 3UGOA 4CX9A 5DS5A 4XPWA 5F5FA 3O55A 2EILC 2HKVA 2XXAB 1LI5A 3IQ5A 3ABLC 3NRHA 4CJOA 4QI2A 5JLIA 1NFOA 4JEBA 4W8PA 4JE9A 5E2QA 1OW6A 3V5ZA 1M6TA 1NG1A 5FCLA 3KYJA 1NZEA 3WODF 4BJ1A 1NBBA 3LNRA 1KTMA 3EGXA 5AC4A 2H7OA 1A0BA 4WABA 1O87A 2V26A 5B1BC 3FOPA 4AE4B 4BJ6A 2LK4A 3ECSA 2FGYA 1A7VA 4MVZA 2WB7A 1NU7D 1FTSA 5DQTA 3RVZA 3A9CA 3FAPB 4DVZA 5K0IA 4U5GA 1APCA 5DS6A 3NDBB 4MVSA 1D0YA 3NMKA 4EBJA 4FESA 3K66A 3S90A 1HMDA 2PF4E 2C03A 1OR2A 2B0JA 2Q9CA 1FMWA 2NPUA 2YLDA 1ZZPA 2ZD9A 3HNKA 3R2PA 4NTBA 3LEOA 1U6HA 1WWPA 4U5DE 5EK0A 4Z9HA 4EBKA 2IBFA 3AQCA 2NG1A 2LFDA 4C7OB 2L81A 3GWNA 2VC9A 2PBEA 4LERA 3QW1A 2ASRA 1V4AA 4LLEA 3B0PA 4KBLA 4GQHA 3KYIA 3SXMA 2H7BA 1ST6A 4NTAA 3IEEA 4BEJA 1DOWA 4CBEA 4F4BA 3FDQA 2EPNA 2XLVA 2R7RA 3LS0A 4PJJA 2KSFA 4EHPA 1NSGB 1ZHWA 4JVSA 3RKOF 5KYXA 2R7XA 3ASOC 1OW8A 4Z9IA 4N06A 3S28A 2HZ8A 1OKKA 2AVKA 1QZXA 3JYHA 2Y3GA 3DM9B 2J7PA 4GEHA 3ZQVA 3N2ZB 5T1DB 2I15A 3IQ6A 1ORYA 5L0IA 3JCUQ 4MTGA 1G5ZA 1T6IA 2A68F 4LLCA 1TWAA 4XEKA 3EGXB 5B3IA 3GODA 4N4WA 2Q9BA 3ABMC 4C3DA 1T6QA 3C62A 2CDQA 1GS9A 4U9DA 2V3CC 1JR8A 1QQ3A 1OXKA 2P7VA 1MMGA 3W8HA 3VYWA 4LDRA 1OR3A 1WATA 3NKDA 1IW7F 3TOMA 1FR0A 5E33A 4DRHB 3M79A 2L6GA 3AOUA 4H54A 3ATPA 5L0JA 2XM4A 4WGZA 3U8PA 1VK5A 5L0DA 1V55C 1ZHXA 4O6MA 4DJ9A 1Q0MA 1MMDA 3MFNA 4JCZA 4WJ0A 1OCCC 3Q6MA 1E83A 3O39A 2JX0A 2XL8A 1RXQA 3OA1A 3C8ZA 1I5NA 2RSEB 1D0XA 3C7JA 1RKEA 3V5XA 4JIOA 3FXHA 1OCZC 1JPJA 3ZVRA 2XLDA 1OQCA 2DGJA 4J32B 4JRZA 2XXAA 2A0BA 5KYNA 5KYXB 3I4UA 1ZVZA 3IQCA 2MHRA 1Q0KA 2OJED 1A41A 1CGNA 2G62A 2OEXA 1E2XA 2ZPAA 2OOCA 3GWLA 2CYDA 3Q7LA 4MTOA 4XPYA 2Q3TA 5BQIA 1TQGA 5A6AA 2R7SA 4CIHA 4IGGA 2XM0A 3TD7A 1OXBA 2G3KA 1BBHA 1ORJA 4L6RA 2DB4A 4BJ5C 4DBRA 5HSWA 2YWAA 3IHUA 4PFPA 2I8BA 3LAYA 2GFHA 4YL1A 5T3TA 3DXJF 2H8AA 1BR4A 2YL1A 4P9FA 2A0UA 4XEFA 2GA0A 2R7QA 2Y3DA 4DBQA 5JS5A 1E85A 4LACB 2QE9A 2R03A 2JD3A 3JZ0A 4NCQA 3ZTMA 2R25A 2HFIA
chains in the Genus database with same CATH topology
1E86A 1M6TA 2YL0A 4CDAA 3HNIA 5JT4A 1NBBA 5JVEA 2XLOA 3FOPA 4CDVA 1CGOA 1A7VA 3FOOA 3C63A 4CIPA 1YZCA 2XL6A 1APCA 3NMJA 2BC5A 1LM3B 3NMKA 2XLEA 2YL7A 3HNKA 2YLDA 5JSLA 1CPQA 3HNLA 2J8WA 1RCPA 3QW1A 4IAQA 4D4NA 3QVYA 2XLVA 2J9BA 3ZTZA 3DE8A 5JP7A 4IARA 1QPUA 3ZQVA 3IQ6A 4CJGA 5AGFA 1JAFA 1E84A 5B3IA 4N4WA 256BA 3C62A 4WGYA 1GQAA 4U9EA 4U9DA 2XLMA 1QQ3A 1CPRA 4IB4A 3NMIA 3ZQYA 3TOMA 1EKYA 1MQVA 2XLWA 3M79A 4ULVA 2YL3A 2XM4A 4WGZA 3U8PA 4JEAA 3HNJA 3M4CA 1YYXA 4JKVA 1E83A 3VRCA 3M15A 2XL8A 2CCYA 4ER9A 2YLGA 4D4XA 2YLIA 2YKZA 3QVZA 4NC3A 2XLDA 1S05A 1CGNA 4CDYA 4N6HA 3ZWIA 1YZAA 2XM0A 1BBHA 4L6RA 5JRAA 3QW0A 1YYJA 3M4BA 4CX9A 2QLAA 2YL1A 2XLHA 5JUAA 5JS5A 1E85A 4EIYA 3IQ5A 4CJOA 3TOLA 5JLIA 4JEBA 3ZTMA 3DE9A 4JE9A 3L1MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E86 A;  1M6T A;  2YL0 A;  4CDA A;  3HNI A;  5JT4 A;  1NBB A;  5JVE A;  2XLO A;  3FOP A;  4CDV A;  1CGO A;  1A7V A;  3FOO A;  3C63 A;  4CIP A;  1YZC A;  2XL6 A;  1APC A;  3NMJ A;  2BC5 A;  1LM3 B;  3NMK A;  2XLE A;  2YL7 A;  3HNK A;  2YLD A;  5JSL A;  1CPQ A;  3HNL A;  2J8W A;  1RCP A;  3QW1 A;  4IAQ A;  4D4N A;  3QVY A;  2XLV A;  2J9B A;  3ZTZ A;  3DE8 A;  5JP7 A;  4IAR A;  1QPU A;  3ZQV A;  3IQ6 A;  4CJG A;  5AGF A;  1JAF A;  1E84 A;  5B3I A;  4N4W A;  256B A;  3C62 A;  4WGY A;  1GQA A;  4U9E A;  4U9D A;  2XLM A;  1QQ3 A;  1CPR A;  4IB4 A;  3NMI A;  3ZQY A;  3TOM A;  1EKY A;  1MQV A;  2XLW A;  3M79 A;  4ULV A;  2YL3 A;  2XM4 A;  4WGZ A;  3U8P A;  4JEA A;  3HNJ A;  3M4C A;  1YYX A;  4JKV A;  1E83 A;  3VRC A;  3M15 A;  2XL8 A;  2CCY A;  4ER9 A;  2YLG A;  4D4X A;  2YLI A;  2YKZ A;  3QVZ A;  4NC3 A;  2XLD A;  1S05 A;  1CGN A;  4CDY A;  4N6H A;  3ZWI A;  1YZA A;  2XM0 A;  1BBH A;  4L6R A;  5JRA A;  3QW0 A;  1YYJ A;  3M4B A;  4CX9 A;  2QLA A;  2YL1 A;  2XLH A;  5JUA A;  5JS5 A;  1E85 A;  4EIY A;  3IQ5 A;  4CJO A;  3TOL A;  5JLI A;  4JEB A;  3ZTM A;  3DE9 A;  4JE9 A;  3L1M A; 
#chains in the Genus database with same CATH topology
 1Q0G A;  4CDA A;  3LS1 A;  2VAS A;  1HW1 A;  1HE1 A;  2O9X A;  3HNI A;  3LUT B;  3MYI A;  4U5C E;  2WZL A;  2JPU A;  3E9V A;  2XLO A;  4J7T A;  4G0H A;  4E7S A;  5L0C A;  1R4T A;  1I4Z A;  3DKA A;  2KJG A;  3MBG A;  4CDV A;  1HY5 A;  2HMZ A;  3C63 A;  3HTK C;  3V7O A;  2VH3 A;  3Q7G A;  1MND A;  1OKK D;  4MVM A;  1C02 A;  2EPO A;  3GOR A;  3NYM A;  2W45 A;  5BQG A;  2QY9 A;  3AG1 C;  3FHD A;  2EPK X;  2J7P D;  3NMJ A;  1RJ9 A;  5TJ5 E;  3SEO A;  5DVW A;  4HEA J;  2IM8 A;  1QSP A;  4HE8 D;  2DI3 A;  5A6B A;  4NY3 A;  4PJM A;  3MLG A;  4KNV A;  4QI0 A;  1FFT C;  2ICW G;  2NUT A;  1RKE B;  4HFK B;  5CI9 A;  4O79 A;  3GM2 A;  2IXM A;  2UUI A;  4FWV A;  5JSL A;  4CSA A;  1QVX A;  1TKN A;  1WAS A;  1J8M F;  1BR2 A;  4XPX A;  3UMH A;  4CS9 C;  2LSE A;  1ZU4 A;  4JJG A;  2J8W A;  2W9Y A;  3HLZ A;  1K40 A;  4D4N A;  4YL0 A;  5AC5 A;  5GPG B;  1M56 C;  3NKE A;  3SZR A;  2W4M A;  2Q4F A;  3DD7 A;  5KYW B;  3WG7 C;  1Z6A A;  3QVY A;  3TJ5 A;  2NUP A;  2LP4 A;  2XRH A;  1SMY F;  3ZTZ A;  3BRJ A;  1XZP A;  3S9O A;  2MYS A;  4OIR F;  4X0R A;  4PAC A;  3RFY A;  1UFB A;  4XEV A;  1G8X A;  5JP7 A;  2Z15 A;  1XWJ A;  4RD9 A;  4PFO A;  1RMV A;  1QPU A;  1VLS A;  3BEH A;  1WGW A;  1FFH A;  2R7O A;  2KQ9 A;  4O7G A;  1RKC A;  4MVQ A;  3U5S A;  4BPM A;  3ZG1 A;  4CJG A;  4U5H A;  4O6N A;  3HJC A;  3UNG C;  3EH1 A;  2LFF A;  2UUH A;  3LEV A;  3S0X A;  3EHN A;  4R32 A;  3DMD A;  2IYL D;  2QUP A;  4A4A A;  1UG7 A;  3O6X A;  1Z7Q c;  3JRM O;  2LD6 A;  1PD0 A;  3CAX A;  3V5Y A;  2R02 A;  4I44 A;  1EA8 A;  3NYL A;  3GM3 A;  1XZQ A;  1YJG A;  2H7V C;  5CI8 A;  1RJ9 B;  1T5O A;  4AK9 A;  4RBN A;  3RQE A;  4Q5S F;  1MMA A;  1WOL A;  2OCC C;  3NMI A;  5D92 A;  2RD9 A;  2NUT B;  2CGE A;  3DJU B;  3F47 A;  1MQV A;  1LIH A;  1C17 M;  1V74 B;  2F22 A;  2WL8 A;  3ABK C;  4M63 A;  4MND A;  4ULV A;  3T6G B;  4E17 A;  3TUL A;  3EJN A;  4G7H F;  3J06 A;  4MQ9 F;  2HSB A;  2XL4 A;  4JEA A;  3M4C A;  1YYX A;  2VB6 A;  1Z3I X;  3T6B A;  3VAY A;  4KC9 A;  1LS1 A;  2W4B A;  2R05 A;  3EZI A;  1H9T A;  1A7D A;  2YKZ A;  1LS4 A;  2J46 A;  2NUP B;  2OKU A;  3K7D A;  4NC3 A;  1Z23 A;  2WZF A;  1K05 A;  2XS8 A;  3K6B A;  2GDC A;  1S05 A;  2KW3 C;  3EGD A;  4JTC B;  5T3W A;  3KPH A;  4MW3 A;  4XLP F;  4CDY A;  3T6J A;  2L9J A;  3EHM A;  1C03 A;  2KNH A;  3EZH A;  1TWG A;  3AJM A;  4PR9 A;  4P9T A;  5KYU A;  3SP1 A;  3RYL A;  4MW8 A;  5A6B D;  4DVY P;  4ULW A;  4EBB A;  1VYI A;  3SXY A;  1YYJ A;  4BJ6 C;  1BR1 A;  1ZW3 A;  3M4B A;  1T6U A;  2QLA A;  4B6I A;  1KNY A;  5L0H A;  3U3B A;  4EUK B;  2XLH A;  4K0D A;  1M2O A;  5JUA A;  4BEM J;  1A7E A;  5COM A;  1D1B A;  4ZLC A;  1PD1 A;  2PX0 A;  3PHF 2;  2IXP A;  2A6E F;  2C04 A;  2VCA A;  2EIK C;  1W2W A;  2IOQ A;  3CEX A;  3DE9 A;  5DQZ A;  1U0B B;  2AU5 A;  1ZU5 A;  3L1M A;  5IY5 C;  2VCB A;  1E86 A;  2YL0 A;  3QZC A;  1SZI A;  4K1O A;  4XLN F;  2XSE A;  3UMK A;  4MVR A;  4G78 A;  5JT4 A;  5JVE A;  3AG2 C;  2EIJ C;  3GEE A;  3KH2 A;  3MYF A;  4W8K A;  2M4E A;  1VTM P;  3DM5 A;  1D1C A;  2AWC A;  3QMK A;  2HSQ A;  3FOO A;  4I1M A;  2L6H A;  5A6J A;  3GEH A;  2NSG A;  4OD4 A;  4NTF A;  4CS9 A;  4CIP A;  1FNT c;  1Z5Z A;  2XL6 A;  4E0I A;  5KYW A;  3JSE O;  3DJN B;  3U8V A;  5L0F A;  2R7W A;  3IQT A;  1LM3 B;  3FVY A;  1NLX A;  4U5E E;  3WAQ A;  1M2V A;  2XLE A;  2YHS A;  3US6 A;  4XQ1 A;  1YAR O;  4IRU A;  3EFO A;  4JTA B;  3AGU A;  3W2W A;  2M64 A;  3LNM B;  3A11 A;  2ZXP A;  4XTK A;  1Y6D A;  3AG3 C;  2PFD A;  3EGD B;  3HNL A;  5D91 A;  5BUO A;  4GYT A;  4LDK A;  4DXW A;  4IAQ A;  3ZSU A;  1VOM A;  4E0H A;  2Q9A A;  5EGY A;  2P61 A;  4PJN A;  2ZXW C;  3TQO A;  1NU9 C;  2CNW D;  5KYU B;  2B0H A;  1EQ1 A;  4J30 B;  2E87 A;  2BE5 F;  3ASN C;  1ZYR F;  2R7U A;  3GEI A;  5COF A;  3T9O A;  3KL4 A;  2HMQ A;  3B0U X;  1L3P A;  2QTV A;  3ZIB A;  3DE8 A;  1JPN A;  2LQG A;  4UDV A;  1BDJ B;  3U0C A;  1SF8 A;  3QTH A;  2NSF A;  4IAR A;  1LI7 A;  1JRA A;  2OG2 A;  3EH2 A;  4JZA A;  2EIM C;  4MS2 A;  2YVK A;  1YLM A;  2J45 A;  3R7C A;  3VM6 A;  3GM1 A;  3LES A;  3U3F A;  4CS8 C;  4K7B A;  3FAJ A;  3POV A;  2KC3 A;  2OU6 A;  3LLI A;  4U5F E;  4XWJ A;  1TWC A;  3X2Q C;  4OIQ F;  1AEP A;  1T01 A;  1ZHZ A;  1JAF A;  3ITF A;  4P6I C;  3G50 A;  3LJB A;  3M1C B;  4U5B E;  3RF3 A;  5F28 E;  1KU2 A;  4ONS A;  3H65 A;  1H6G A;  1Z63 A;  256B A;  4OIN F;  4WGY A;  1VB5 A;  4KI2 A;  1D0Z A;  4RDA A;  2EPL X;  3SXZ A;  5B3S C;  2KK1 A;  5EHH A;  3O10 A;  1L7C A;  4EKW A;  1CPR A;  3L8I A;  2OEV A;  1VLT A;  5KYY A;  4IB4 A;  1M2V B;  3PDM P;  3W2V A;  2J9V A;  3ZQY A;  2R9R B;  2YZS A;  4QDL A;  2R7T A;  1ORS C;  3EFO B;  4IWB A;  1OW7 A;  4IJJ A;  1HE9 A;  5FZT A;  2WZG A;  2D5R B;  2Q00 A;  3C8G A;  3DAG A;  4JTD B;  3RVY A;  4YT4 A;  4O6Y A;  4JC7 A;  3HNJ A;  1G4U S;  3JT1 A;  1GM5 A;  2BL2 A;  2YRF A;  3JYY A;  1H7I A;  2HS5 A;  3VRC A;  2CW0 F;  3M15 A;  1I4Y A;  3CSK A;  4Z9J A;  4ER9 A;  4D4X A;  1Q0D A;  4YT5 A;  1PCX A;  1VMA A;  2G3V A;  2IXO A;  2WVN A;  3K1I C;  3I5Q A;  4FX5 A;  1DOV A;  2Y39 A;  4OIP F;  1YZA A;  2P0N A;  3S27 A;  1SYQ A;  4PJL A;  3RIP A;  3X1O A;  2Y69 C;  2CNW A;  2OQM A;  3SYN A;  1EI7 A;  1HW2 A;  5L3Q A;  5HV9 A;  3L0I A;  2J9W A;  1AUE A;  2P1A A;  1D1A A;  3JSZ A;  4J7Y A;  3Q6N A;  5JRA A;  2R7V A;  4HFF B;  5L0G A;  3W4Y A;  1WTY A;  2X0C A;  4JUR I;  2D4U A;  2HJ3 A;  5A69 A;  1LVK A;  2LIG A;  2TMV P;  4G7O F;  3DAF A;  1J8Y F;  1TFO B;  4JW1 A;  4EIY A;  4Q4Z F;  3TOL A;  1S7Z A;  3B0V C;  3G4Z A;  2VCC A;  2PX3 A;  2FAP B;  2GWW A;  3AG4 C;  3DWW A;  4JJF A;  5E3A A;  3CZ6 A;  3EPV A;  3KMI A;  5KYY B;  4CSA C;  3ZDL A;  3RQG A;  2GAQ A;  3EG9 A;  4BJ5 A;  2HV7 A;  3L8J A;  2YQY A;  2Y3B A;  3UGP A;  2IXN A;  4DOZ A;  1CGO A;  3E70 C;  4BG0 A;  4KNW A;  3C8G B;  4G7Z F;  2OJQ A;  2XS1 A;  1OCO C;  2ZXR A;  2AP3 A;  3S84 A;  1OCR C;  4JCH A;  1LE2 A;  2DYR C;  1BZ4 A;  1YZC A;  1JOG A;  3B29 A;  2BC5 A;  4ANJ A;  1ZHT A;  5COG A;  3U2L A;  4IAO A;  2YL7 A;  4YN0 B;  3MX3 A;  1YA7 O;  1QKR A;  2FFH A;  4N6C A;  3S29 A;  3SNH A;  1IZM A;  4AL0 A;  3GAN A;  3TK0 A;  4MTF A;  2P6V A;  1CPQ A;  3NG1 A;  1MNE A;  2PNO A;  1RCP A;  3DI5 A;  3B71 A;  1M57 C;  3F46 A;  1O5H A;  2J0W A;  4A2N B;  4Q7C A;  1FAP B;  3RW0 A;  3VF0 A;  2WVQ A;  3RH3 A;  3WHN A;  4CS7 A;  3H2V A;  3U9J A;  3IPM O;  1LKX A;  3W8I A;  1CGM E;  2HJM A;  1NFN A;  4NQF A;  1LPE A;  4YJW A;  2J9B A;  4AL1 A;  4CS8 A;  4EWC A;  3JRT A;  4C3E A;  3C8G D;  2EPM X;  1WN0 A;  2HUJ A;  4C3B A;  3K33 A;  4DRI B;  2DYS C;  3U2M A;  2PP4 A;  1PV3 A;  1YAU O;  2AWY A;  1AVO B;  1T9K A;  3AQB A;  3H2U A;  3RQF A;  3B9Q A;  5DLJ A;  2LCH A;  4E18 A;  4OIO F;  4AX2 A;  1SR2 A;  3K1H A;  3DZA A;  1ZW2 A;  4MVU A;  3FMS A;  1F1M A;  5AGF A;  5B1A C;  5A6K A;  3EG9 B;  3LLK A;  3OEO A;  1Y4C A;  2J0X A;  4LDQ A;  5E3C A;  3T4R A;  1E84 A;  3N24 A;  2L7A A;  2YEV A;  3TJ6 A;  1V54 C;  1GQA A;  2HV6 A;  2WVO A;  3I5P A;  4U9E A;  4YWQ A;  2XLM A;  3UMI A;  3NYJ A;  4YL3 A;  1LE4 A;  5CIV A;  2J9U A;  1TWH A;  4DRJ B;  4MVO A;  1EKY A;  5DS4 A;  1R5I D;  3U9M A;  1YDI A;  2XLW A;  4AE4 A;  1N1C A;  4YK5 A;  2YL3 A;  4FAP B;  3PMR A;  3G4X A;  3EQL F;  5BQH A;  1JMW A;  1YA9 A;  5L3V A;  4YT2 A;  3C18 A;  3KKB A;  2X51 A;  2Y3H A;  3CQZ A;  5F5H A;  4E7Z A;  2MWQ A;  2ZXO A;  4JKV A;  1O3U A;  3K1I A;  1MMN A;  3L34 A;  1G4W R;  1ZHY A;  4OD5 A;  2Q7R A;  3AGT A;  3OWT A;  4H4K C;  2CCY A;  3UR3 C;  2A6H F;  2YLG A;  2YLI A;  3QVZ A;  4PK4 A;  3N0T A;  1B68 A;  1GGQ A;  2QNL A;  2A1D D;  3ZC4 A;  1FMV A;  4C7O A;  1VYK A;  2L6F A;  4N6H A;  3SXK A;  3ZWI A;  4I3M A;  4YT8 A;  2A69 F;  1K04 A;  1TR2 A;  4BJT A;  1U89 A;  2ETS A;  3PCV A;  4I1O B;  1H9G A;  4ZLD A;  3HKK A;  1TFK B;  2EIN C;  2KGO A;  1YVI A;  2KYH A;  1Q0F A;  1HMO A;  3JTL O;  3QW0 A;  1QLE C;  3UGO A;  4CX9 A;  5DS5 A;  4XPW A;  5F5F A;  3O55 A;  2EIL C;  2HKV A;  2XXA B;  1LI5 A;  3IQ5 A;  3ABL C;  3NRH A;  4CJO A;  4QI2 A;  5JLI A;  1NFO A;  4JEB A;  4W8P A;  4JE9 A;  5E2Q A;  1OW6 A;  3V5Z A;  1M6T A;  1NG1 A;  5FCL A;  3KYJ A;  1NZE A;  3WOD F;  4BJ1 A;  1NBB A;  3LNR A;  1KTM A;  3EGX A;  5AC4 A;  2H7O A;  1A0B A;  4WAB A;  1O87 A;  2V26 A;  5B1B C;  3FOP A;  4AE4 B;  4BJ6 A;  2LK4 A;  3ECS A;  2FGY A;  1A7V A;  4MVZ A;  2WB7 A;  1NU7 D;  1FTS A;  5DQT A;  3RVZ A;  3A9C A;  3FAP B;  4DVZ A;  5K0I A;  4U5G A;  1APC A;  5DS6 A;  3NDB B;  4MVS A;  1D0Y A;  3NMK A;  4EBJ A;  4FES A;  3K66 A;  3S90 A;  1HMD A;  2PF4 E;  2C03 A;  1OR2 A;  2B0J A;  2Q9C A;  1FMW A;  2NPU A;  2YLD A;  1ZZP A;  2ZD9 A;  3HNK A;  3R2P A;  4NTB A;  3LEO A;  1U6H A;  1WWP A;  4U5D E;  5EK0 A;  4Z9H A;  4EBK A;  2IBF A;  3AQC A;  2NG1 A;  2LFD A;  4C7O B;  2L81 A;  3GWN A;  2VC9 A;  2PBE A;  4LER A;  3QW1 A;  2ASR A;  1V4A A;  4LLE A;  3B0P A;  4KBL A;  4GQH A;  3KYI A;  3SXM A;  2H7B A;  1ST6 A;  4NTA A;  3IEE A;  4BEJ A;  1DOW A;  4CBE A;  4F4B A;  3FDQ A;  2EPN A;  2XLV A;  2R7R A;  3LS0 A;  4PJJ A;  2KSF A;  4EHP A;  1NSG B;  1ZHW A;  4JVS A;  3RKO F;  5KYX A;  2R7X A;  3ASO C;  1OW8 A;  4Z9I A;  4N06 A;  3S28 A;  2HZ8 A;  1OKK A;  2AVK A;  1QZX A;  3JYH A;  2Y3G A;  3DM9 B;  2J7P A;  4GEH A;  3ZQV A;  3N2Z B;  5T1D B;  2I15 A;  3IQ6 A;  1ORY A;  5L0I A;  3JCU Q;  4MTG A;  1G5Z A;  1T6I A;  2A68 F;  4LLC A;  1TWA A;  4XEK A;  3EGX B;  5B3I A;  3GOD A;  4N4W A;  2Q9B A;  3ABM C;  4C3D A;  1T6Q A;  3C62 A;  2CDQ A;  1GS9 A;  4U9D A;  2V3C C;  1JR8 A;  1QQ3 A;  1OXK A;  2P7V A;  1MMG A;  3W8H A;  3VYW A;  4LDR A;  1OR3 A;  1WAT A;  3NKD A;  1IW7 F;  3TOM A;  1FR0 A;  5E33 A;  4DRH B;  3M79 A;  2L6G A;  3AOU A;  4H54 A;  3ATP A;  5L0J A;  2XM4 A;  4WGZ A;  3U8P A;  1VK5 A;  5L0D A;  1V55 C;  1ZHX A;  4O6M A;  4DJ9 A;  1Q0M A;  1MMD A;  3MFN A;  4JCZ A;  4WJ0 A;  1OCC C;  3Q6M A;  1E83 A;  3O39 A;  2JX0 A;  2XL8 A;  1RXQ A;  3OA1 A;  3C8Z A;  1I5N A;  2RSE B;  1D0X A;  3C7J A;  1RKE A;  3V5X A;  4JIO A;  3FXH A;  1OCZ C;  1JPJ A;  3ZVR A;  2XLD A;  1OQC A;  2DGJ A;  4J32 B;  4JRZ A;  2XXA A;  2A0B A;  5KYN A;  5KYX B;  3I4U A;  1ZVZ A;  3IQC A;  2MHR A;  1Q0K A;  2OJE D;  1A41 A;  1CGN A;  2G62 A;  2OEX A;  1E2X A;  2ZPA A;  2OOC A;  3GWL A;  2CYD A;  3Q7L A;  4MTO A;  4XPY A;  2Q3T A;  5BQI A;  1TQG A;  5A6A A;  2R7S A;  4CIH A;  4IGG A;  2XM0 A;  3TD7 A;  1OXB A;  2G3K A;  1BBH A;  1ORJ A;  4L6R A;  2DB4 A;  4BJ5 C;  4DBR A;  5HSW A;  2YWA A;  3IHU A;  4PFP A;  2I8B A;  3LAY A;  2GFH A;  4YL1 A;  5T3T A;  3DXJ F;  2H8A A;  1BR4 A;  2YL1 A;  4P9F A;  2A0U A;  4XEF A;  2GA0 A;  2R7Q A;  2Y3D A;  4DBQ A;  5JS5 A;  1E85 A;  4LAC B;  2QE9 A;  2R03 A;  2JD3 A;  3JZ0 A;  4NCQ A;  3ZTM A;  2R25 A;  2HFI A; 
#chains in the Genus database with same CATH homology
 1E86 A;  1M6T A;  2YL0 A;  4CDA A;  3HNI A;  5JT4 A;  1NBB A;  5JVE A;  2XLO A;  3FOP A;  4CDV A;  1CGO A;  1A7V A;  3FOO A;  3C63 A;  4CIP A;  1YZC A;  2XL6 A;  1APC A;  3NMJ A;  2BC5 A;  1LM3 B;  3NMK A;  2XLE A;  2YL7 A;  3HNK A;  2YLD A;  5JSL A;  1CPQ A;  3HNL A;  2J8W A;  1RCP A;  3QW1 A;  4IAQ A;  4D4N A;  3QVY A;  2XLV A;  2J9B A;  3ZTZ A;  3DE8 A;  5JP7 A;  4IAR A;  1QPU A;  3ZQV A;  3IQ6 A;  4CJG A;  5AGF A;  1JAF A;  1E84 A;  5B3I A;  4N4W A;  256B A;  3C62 A;  4WGY A;  1GQA A;  4U9E A;  4U9D A;  2XLM A;  1QQ3 A;  1CPR A;  4IB4 A;  3NMI A;  3ZQY A;  3TOM A;  1EKY A;  1MQV A;  2XLW A;  3M79 A;  4ULV A;  2YL3 A;  2XM4 A;  4WGZ A;  3U8P A;  4JEA A;  3HNJ A;  3M4C A;  1YYX A;  4JKV A;  1E83 A;  3VRC A;  3M15 A;  2XL8 A;  2CCY A;  4ER9 A;  2YLG A;  4D4X A;  2YLI A;  2YKZ A;  3QVZ A;  4NC3 A;  2XLD A;  1S05 A;  1CGN A;  4CDY A;  4N6H A;  3ZWI A;  1YZA A;  2XM0 A;  1BBH A;  4L6R A;  5JRA A;  3QW0 A;  1YYJ A;  3M4B A;  4CX9 A;  2QLA A;  2YL1 A;  2XLH A;  5JUA A;  5JS5 A;  1E85 A;  4EIY A;  3IQ5 A;  4CJO A;  3TOL A;  5JLI A;  4JEB A;  3ZTM A;  3DE9 A;  4JE9 A;  3L1M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...