3C62A

Tetrameric cytochrome cb562 (h59/d62/h63/h73/a74/h77) assembly stabilized by interprotein zinc coordination
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
106
structure length
106
Chain Sequence
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMHDFDHGFDILVGQIHAALHLANEGKVKEAQAAAEQLKTTCNACHQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Soluble cytochrome b562
publication title Metal-mediated self-assembly of protein superstructures: influence of secondary interactions on protein oligomerization and aggregation.
pubmed doi rcsb
source organism Escherichia coli
total genus 44
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 3c62A00
1YYJA 3ZTZA 3FOOA 3HNLA 4CDVA 3C63A 1YZAA 2XLEA 3TOMA 1E86A 1APCA 1CPQA 2XL6A 3DE8A 3QW1A 4CJOA 4IB4A 3IQ5A 5B3IA 4JE9A 3QVYA 1QPUA 2XM0A 4JEAA 2XLOA 3ZWIA 2J8WA 3U8PA 3QVZA 3DE9A 1LM3B 1CGOA 5JLIA 4WGZA 3NMKA 1S05A 4IAQA 3TOLA 3QW0A 5JUAA 1NBBA 3L1MA 3HNJA 4CDAA 2YL1A 4U9DA 5JRAA 2YLDA 4U9EA 4JEBA 1GQAA 5JT4A 5JVEA 4WGYA 2XM4A 3ZQYA 4D4NA 3ZQVA 1JAFA 3HNIA 1QQ3A 4N4WA 1E84A 2XLDA 2XL8A 2XLHA 4D4XA 1MQVA 3M79A 2QLAA 5JP7A 4EIYA 4N6HA 2YKZA 3FOPA 1YZCA 5AGFA 2XLWA 1M6TA 4IARA 256BA 2YL3A 4ULVA 1CPRA 2YL7A 4JKVA 3IQ6A 2YLGA 3VRCA 4CDYA 4ER9A 1YYXA 3NMJA 4CX9A 1CGNA 1EKYA 2XLVA 3M15A 2CCYA 1A7VA 3M4CA 4NC3A 2XLMA 3NMIA 4CJGA 2YL0A 3M4BA 2BC5A 3ZTMA 3HNKA 4L6RA 1BBHA 1E85A 3C62A 5JS5A 5JSLA 1RCPA 2YLIA 4CIPA 2J9BA 1E83A
chains in the Genus database with same CATH superfamily
3SXYA 3S84A 1TR2A 1NZEA 3NYLA 1YYJA 1JR8A 2CW0F 2QE9A 3HNLA 1OKKD 1YZAA 5KYXA 2UUHA 2HV7A 1E86A 1CPQA 2J9VA 1YJGA 2R25A 4C3DA 1LPEA 1XZPA 3Q7GA 3ABLC 4GQHA 1YAUO 3IQ5A 2OJED 2W45A 3U2LA 1VYKA 5B3IA 4CSAA 1V54C 4WABA 4EBJA 3EH2A 4U5DE 1OCCC 4JE9A 1HMOA 4G7ZF 1C02A 4JIOA 1K04A 1ORJA 1OCRC 1PV3A 1QPUA 3GEHA 3ZG1A 5DLJA 4MVMA 3JRMO 4ZLCA 4MW3A 3Q6MA 3TD7A 3U9MA 3DE9A 3AGTA 1LM3B 1V4AA 4XPWA 2NUPA 1HW1A 3PMRA 3W8IA 1BDJB 2PBEA 3GEIA 3MFNA 4E0IA 4DBRA 3RFYA 2LK4A 4WGZA 5BUOA 3LUTB 1RKEB 1VB5A 2HSBA 2L9JA 2PFDA 3BRJA 4H54A 2Q7RA 3U3BA 5EK0A 3TOLA 2M4EA 4CS8A 3LS1A 4EHPA 2R7RA 2GAQA 4IAOA 2C04A 3B71A 3I5PA 4K0DA 4G7OF 4EKWA 2MWQA 4KI2A 4G78A 3S29A 1M2OA 5A6BD 1WASA 4DRIB 2R7WA 2KK1A 4KNWA 3DM9B 1CGME 3DAFA 3W4YA 3TULA 2OG2A 3K7DA 1Z7Qc 1QQ3A 2XLDA 3DI5A 3EHMA 1OCZC 2KJGA 4F4BA 1G5ZA 3KKBA 2TMVP 4OIRF 4CSAC 2HMZA 5BQHA 4X0RA 1B68A 2ETSA 2FFHA 3FVYA 2WZFA 2H7OA 5DQZA 1C03A 2EINC 2GWWA 2EILC 2IYLD 5L0HA 4C7OA 3ASNC 3JSZA 3W8HA 1D1AA 2XLWA 5KYYB 2ZD9A 1XWJA 4HFFB 2EPOA 2J0WA 1SYQA 2A6EF 2YL3A 4HE8D 4O6NA 5BQGA 2LFDA 2Y3DA 3V5ZA 3L8IA 1Q0DA 4K7BA 4ULVA 5EHHA 3EQLF 1MMNA 2IBFA 2YL7A 4AE4A 4NCQA 5CI9A 1A7EA 1WATA 5L3VA 1VTMP 1Q0GA 1PD1A 3C8GA 5E3CA 1H9GA 3DJNB 3J06A 3IHUA 4PJMA 4CX9A 4CS8C 1U89A 1RKEA 2A0UA 2DYRC 4ANJA 1MMGA 4HFKB 1T6QA 3LEOA 4A2NB 1VLSA 2OOCA 4FX5A 1LI5A 1OXKA 4OIQF 2PNOA 2Z15A 3LLIA 3OWTA 2YZSA 4NC3A 4LDQA 1G4WR 5EGYA 2IXMA 2A0BA 3RW0A 5BQIA 1D1BA 1T01A 3ZC4A 4LDKA 4IJJA 4E17A 2PF4E 2ICWG 1NLXA 1Q0FA 3GM1A 4CJGA 1V74B 1L3PA 2YL0A 1VK5A 3AGUA 3B29A 1LI7A 3QMKA 4BEJA 5FCLA 4O79A 2GDCA 1ORSC 4JZAA 3US6A 4E0HA 4PR9A 3U9JA 1YDIA 3DJUB 3H65A 4AL0A 2CNWA 4I1MA 2Y3GA 3WAQA 1YARO 3ECSA 5T1DB 2KQ9A 1OW8A 4E18A 1EQ1A 4U5HA 4XPXA 5D91A 3U8VA 2WB7A 1E83A 3B0PA 3E9VA 1FR0A 2OQMA 3U8PA 4LACB 2J0XA 4YN0B 4P6IC 4JW1A 1Q0KA 3C63A 4QDLA 2R7QA 3RKOF 1FFHA 1A7DA 3LS0A 3NYJA 4G7HF 4BJ6A 2AWYA 3TOMA 5KYYA 4ZLDA 2R7SA 3DE8A 3I4UA 3LAYA 3WG7C 2P0NA 3QTHA 4CS7A 1H6GA 1T6IA 2J45A 5F28E 2A69F 3ZIBA 3UMIA 1O87A 3H2UA 4JC7A 4OD4A 3QVYA 3AG3C 3FHDA 2VASA 5L0FA 1GS9A 2XM0A 3N2ZB 4FWVA 4JEAA 1R4TA 3ATPA 3C18A 3W2VA 3SP1A 2J8WA 3WODF 3AQCA 3RF3A 1V55C 3E70C 3A11A 4CIHA 1FMWA 3PDMP 1WWPA 2HV6A 3K6BA 3DZAA 3NMKA 2J7PD 1TKNA 2KYHA 1ZHWA 3H2VA 1Y4CA 2HFIA 2A1DD 2HJMA 2VCAA 2DB4A 3AG2C 3F47A 4GYTA 4IAQA 3QW0A 4XEVA 3S27A 1O3UA 4YJWA 1YVIA 4AL1A 3SXKA 3T6BA 1ZYRF 2YL1A 3EGDA 5D92A 4O7GA 4U9DA 3F46A 4IRUA 4KBLA 3O6XA 5A69A 4U5CE 4U9EA 2GFHA 4DVYP 5JT4A 5JVEA 1LVKA 1RMVA 4MVRA 5CI8A 3ZQVA 2AVKA 2VCCA 3K1HA 4GEHA 3FMSA 4BJ6C 2RD9A 4N4WA 1E84A 3PCVA 4BEMJ 5AC4A 4AE4B 3CEXA 2XLHA 2QNLA 4CS9A 2KC3A 2KNHA 2EPKX 3B0VC 3VF0A 1H9TA 1MQVA 2AP3A 3TJ5A 3V5XA 4BPMA 3C8GB 4DBQA 2JPUA 2P61A 1JPJA 1XZQA 2V26A 1RKCA 2NSGA 2QLAA 3CAXA 1WOLA 3UMHA 4DXWA 4EIYA 3DAGA 5GPGB 4Q4ZF 2CDQA 2EPMX 3LNRA 2H8AA 1TQGA 3S28A 4J7YA 5AGFA 2LD6A 4IARA 4YL0A 4EBBA 256BA 3GWLA 4MNDA 4OD5A 2Q4FA 1NU9C 2ZPAA 1ZW3A 2YRFA 4YT8A 4YL1A 1DOVA 3A9CA 4UDVA 5K0IA 1F1MA 2L6FA 1UFBA 2XS8A 4JKVA 2RSEB 3ZDLA 4YT2A 4MVQA 4DRHB 2Q9BA 1YA7O 4ER9A 1YYXA 3NMJA 3EH1A 1QSPA 3SYNA 4K1OA 4XQ1A 1EI7A 4YL3A 2WL8A 1K40A 3ABMC 3GANA 1WGWA 3K33A 1RJ9A 2YHSA 3R2PA 2HMQA 3DWWA 3S9OA 2WVNA 2HZ8A 3O39A 3NMIA 1FAPB 2J9UA 1GGQA 4JRZA 4E7ZA 3LJBA 3Q6NA 3SXMA 4OINF 1ZHYA 3TJ6A 3ABKC 1Z3IX 5E2QA 3U3FA 4CS9C 1L7CA 2PX3A 4RD9A 4MQ9F 4C3BA 2IXPA 4MS2A 3GM2A 4JTDB 1OXBA 3RIPA 2FGYA 2YWAA 1D0YA 2Q9CA 3KPHA 5JSLA 2D4UA 1OR3A 1WN0A 3SEOA 3V7OA 1JPNA 2J9WA 4CIPA 1SMYF 1J8MF 2IXOA 5T3TA 1YLMA 2R05A 4JJFA 4JJGA 2I8BA 2P6VA 3FOOA 4IWBA 3ZTZA 1OR2A 4CDVA 1S7ZA 2BL2A 3C7JA 3EFOA 3GM3A 2Q3TA 2VCBA 4MTOA 4BJTA 2XSEA 5AC5A 1GM5A 1APCA 3UGPA 3EPVA 2XL4A 4N06A 4RDAA 2HJ3A 3QW1A 2NG1A 4JVSA 3EZHA 3DM5A 2AWCA 1KNYA 5HSWA 4JCZA 3T4RA 2G3VA 3X2QC 1E2XA 1ORYA 5L0IA 4A4AA 3ITFA 3EZIA 1MNDA 1T5OA 2HS5A 3EGDB 3AJMA 3ASOC 3LNMB 4MVSA 5L3QA 3FAJA 2XLOA 2ZXPA 4QI2A 3SNHA 4Q7CA 4B6IA 3POVA 4J32B 1QVXA 1CGOA 1N1CA 1RXQA 2OJQA 5B1BC 5JLIA 2OKUA 2X51A 3JT1A 1VOMA 4XEFA 5DVWA 3C8ZA 3L8JA 1AVOB 1ZHZA 3FAPB 2B0JA 1S05A 4FESA 1ZVZA 2Y39A 4MW8A 3SXZA 2KW3C 4KNVA 5JUAA 1OKKA 1NBBA 1ZHXA 2EIMC 5L0JA 1AUEA 1I5NA 1DOWA 1LE2A 3AG4C 3HNJA 5FZTA 1D0ZA 3JZ0A 3RQGA 3MLGA 2YLDA 3C8GD 4Z9JA 4DRJB 1Z63A 2QTVA 4JEBA 1GQAA 2UUIA 4C3EA 3ZSUA 3ZQYA 3AOUA 2IOQA 1WTYA 1O5HA 2JD3A 3HJCA 3DMDA 4WJ0A 4D4NA 1UG7A 1JAFA 1JMWA 2C03A 3HNIA 5B3SC 5HV9A 5E33A 4OIPF 1Y6DA 1M56C 5IY5C 3UGOA 3JTLO 1LE4A 1D1CA 5DS5A 2R7VA 4MVUA 1Q0MA 1VMAA 4P9FA 4AX2A 4JURI 2DI3A 5DQTA 1PD0A 2ZXRA 3EJNA 4LLEA 4D4XA 1QZXA 5KYWA 4H4KC 2HKVA 3M79A 4MVZA 1Z6AA 2P1AA 2WVQA 2R9RB 4ONSA 3O10A 4R32A 4EUKB 4BG0A 4FAPB 3Q7LA 1LKXA 2YKZA 3FOPA 4MTFA 4N6HA 1RJ9B 2CNWD 4NTAA 2LQGA 4YWQA 2MYSA 2L7AA 4P9TA 5CIVA 4O6MA 3LEVA 3TQOA 4DOZA 3K66A 3OA1A 4LLCA 4NY3A 2AU5A 1U0BB 1OCOC 1M2VB 4XPYA 3IQ6A 4XLPF 3W2WA 1KTMA 4ULWA 3G4XA 4YK5A 3MX3A 1NFNA 5A6BA 2O9XA 1EKYA 1I4YA 1NSGB 2XLVA 1NG1A 2PX0A 5A6AA 1TWHA 3HTKC 3M15A 3GWNA 2LIGA 1A7VA 3JYHA 4IGGA 2BE5F 4PK4A 3B0UX 4RBNA 1BZ4A 2XLMA 1KU2A 3K1IA 1PCXA 3UMKA 3FDQA 1A0BA 2Y3HA 3T9OA 3EFOB 1D0XA 1VYIA 1BR1A 2PP4A 4PFOA 1JRAA 1ZU5A 1LIHA 3M4BA 3AG1C 3OEOA 3VYWA 3NKEA 2WVOA 2EIJC 1TWGA 4I1OB 1H7IA 3UNGC 3HLZA 3HNKA 3GEEA 2WZGA 3HKKA 4Q5SF 3CSKA 1E85A 4DJ9A 3U0CA 2VH3A 2VC9A 2YLIA 3EG9B 2M64A 3N0TA 3RQFA 1MMDA 2OCCC 3KH2A 2R7TA 3JYYA 3S0XA 3VM6A 3UR3C 4QI0A 3NKDA 2EPNA 2XLEA 3S90A 4BJ1A 2XL6A 2XXAB 2OEXA 1Z23A 3JSEO 3X1OA 1T9KA 1JOGA 1G8XA 1Z5ZA 2D5RB 4IB4A 4CJOA 4XWJA 3GODA 2F22A 3IQCA 4XEKA 1M2VA 3N24A 2KSFA 5KYUA 2I15A 2NPUA 1HW2A 1FMVA 2LP4A 4PJJA 1G4US 1K05A 3EGXA 3T6GB 2Y3BA 1HE1A 1LS1A 1MNEA 4I44A 3I5QA 4BJ5A 3G50A 1ZHTA 2YEVA 3RVZA 3T6JA 3TK0A 4YT4A 3M1CB 5DS4A 2LFFA 3ZWIA 4U5EE 2OU6A 1QLEC 2QUPA 3U5SA 3QVZA 4J7TA 1TFOB 3LLKA 5T3WA 5L0DA 3K1IC 4NTBA 4EWCA 1IZMA 2R02A 4U5FE 2B0HA 1T6UA 2QY9A 4N6CA 3V5YA 4PFPA 2R7XA 1OQCA 3KL4A 1ZW2A 1HY5A 5KYNA 3RH3A 1OW7A 4XLNF 2EPLX 1U6HA 3IQTA 3AQBA 2HSQA 2EIKC 2V3CC 1NFOA 5KYWB 1C17M 1BR2A 1A41A 2NUTB 1ZU4A 2ZXWC 2NSFA 2W9YA 3L1MA 2JX0A 5DS6A 4CDAA 1W2WA 5JRAA 2W4BA 1ZZPA 2L81A 3L34A 1LS4A 4LDRA 4YT5A 4WGYA 3EG9A 3QZCA 1TWCA 2XM4A 4JTAB 2W4MA 5A6JA 2LSEA 1TWAA 2A6HF 5L0GA 2MHRA 3NG1A 3U2MA 3BEHA 4PJNA 3CQZA 3O55A 1NU7D 5F5HA 2CYDA 2HUJA 1MMAA 2WZLA 4EBKA 2LCHA 2H7BA 5A6KA 2R7UA 2XL8A 3EHNA 2Q00A 3NYMA 1M57C 1FNTc 2XXAA 1VLTA 1J8YF 2Y69C 1SZIA 1SF8A 3VAYA 3B9QA 1R5ID 3PHF2 3NRHA 2A68F 4W8PA 4U5BE 4NQFA 5JP7A 3SZRA 2YVKA 5TJ5E 2IM8A 4BJ5C 3KMIA 4PJLA 5COGA 1YZCA 2G3KA 2L6GA 5KYXB 1M6TA 3FXHA 4M63A 4MVOA 3RYLA 4O6YA 3RVYA 2J7PA 4Z9HA 2DYSC 3MYIA 1YA9A 2P7VA 4XTKA 4NTFA 3DD7A 1CPRA 4U5GA 4C7OB 3KYIA 1ST6A 2YLGA 3VRCA 3MBGA 4CDYA 3ZVRA 1QKRA 3MYFA 4AK9A 4JCHA 3KYJA 3G4ZA 2R03A 1CGNA 4J30B 4CBEA 2Q9AA 4E7SA 3NDBB 2CCYA 1FFTC 3IEEA 2NUPB 2XRHA 5COFA 3DXJF 3M4CA 2NUTA 2E87A 1BR4A 1HMDA 2H7VC 3JCUQ 4W8KA 3R7CA 4PACA 1I4ZA 3L0IA 3LESA 4G0HA 1OW6A 3JRTA 4Z9IA 2IXNA 2GA0A 2OEVA 4HEAJ 2XS1A 1EA8A 5L0CA 1SR2A 2BC5A 2YQYA 2ZXOA 2DGJA 1TFKB 3CZ6A 4I3MA 3WHNA 5F5FA 3ZTMA 4MTGA 2ASRA 1HE9A 1IW7F 4KC9A 2FAPB 1FTSA 3DKAA 4L6RA 4DVZA 5E3AA 1BBHA 5B1AC 5KYUB 2KGOA 3C62A 5JS5A 3GORA 2X0CA 4JTCB 1RCPA 2CGEA 2G62A 3RQEA 4OIOF 1AEPA 5COMA 2J46A 3EGXB 4LERA 3IPMO 2J9BA 2R7OA 2VB6A 2L6HA
chains in the Genus database with same CATH topology
1YYJA 3ZTZA 3FOOA 3HNLA 4CDVA 3C63A 1YZAA 2XLEA 3TOMA 1E86A 1APCA 1CPQA 2XL6A 3DE8A 3QW1A 4CJOA 4IB4A 3IQ5A 5B3IA 4JE9A 3QVYA 1QPUA 2XM0A 4JEAA 2XLOA 3ZWIA 2J8WA 3U8PA 3QVZA 3DE9A 1LM3B 1CGOA 5JLIA 4WGZA 3NMKA 1S05A 4IAQA 3TOLA 3QW0A 5JUAA 1NBBA 3L1MA 3HNJA 4CDAA 2YL1A 4U9DA 5JRAA 2YLDA 4U9EA 4JEBA 1GQAA 5JT4A 5JVEA 4WGYA 2XM4A 3ZQYA 4D4NA 3ZQVA 1JAFA 3HNIA 1QQ3A 4N4WA 1E84A 2XLDA 2XL8A 2XLHA 4D4XA 1MQVA 3M79A 2QLAA 5JP7A 4EIYA 4N6HA 2YKZA 3FOPA 1YZCA 5AGFA 2XLWA 1M6TA 4IARA 256BA 2YL3A 4ULVA 1CPRA 2YL7A 4JKVA 3IQ6A 2YLGA 3VRCA 4CDYA 4ER9A 1YYXA 3NMJA 4CX9A 1CGNA 1EKYA 2XLVA 3M15A 2CCYA 1A7VA 3M4CA 4NC3A 2XLMA 3NMIA 4CJGA 2YL0A 3M4BA 2BC5A 3ZTMA 3HNKA 4L6RA 1BBHA 1E85A 3C62A 5JS5A 5JSLA 1RCPA 2YLIA 4CIPA 2J9BA 1E83A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YYJ A;  3ZTZ A;  3FOO A;  3HNL A;  4CDV A;  3C63 A;  1YZA A;  2XLE A;  3TOM A;  1E86 A;  1APC A;  1CPQ A;  2XL6 A;  3DE8 A;  3QW1 A;  4CJO A;  4IB4 A;  3IQ5 A;  5B3I A;  4JE9 A;  3QVY A;  1QPU A;  2XM0 A;  4JEA A;  2XLO A;  3ZWI A;  2J8W A;  3U8P A;  3QVZ A;  3DE9 A;  1LM3 B;  1CGO A;  5JLI A;  4WGZ A;  3NMK A;  1S05 A;  4IAQ A;  3TOL A;  3QW0 A;  5JUA A;  1NBB A;  3L1M A;  3HNJ A;  4CDA A;  2YL1 A;  4U9D A;  5JRA A;  2YLD A;  4U9E A;  4JEB A;  1GQA A;  5JT4 A;  5JVE A;  4WGY A;  2XM4 A;  3ZQY A;  4D4N A;  3ZQV A;  1JAF A;  3HNI A;  1QQ3 A;  4N4W A;  1E84 A;  2XLD A;  2XL8 A;  2XLH A;  4D4X A;  1MQV A;  3M79 A;  2QLA A;  5JP7 A;  4EIY A;  4N6H A;  2YKZ A;  3FOP A;  1YZC A;  5AGF A;  2XLW A;  1M6T A;  4IAR A;  256B A;  2YL3 A;  4ULV A;  1CPR A;  2YL7 A;  4JKV A;  3IQ6 A;  2YLG A;  3VRC A;  4CDY A;  4ER9 A;  1YYX A;  3NMJ A;  4CX9 A;  1CGN A;  1EKY A;  2XLV A;  3M15 A;  2CCY A;  1A7V A;  3M4C A;  4NC3 A;  2XLM A;  3NMI A;  4CJG A;  2YL0 A;  3M4B A;  2BC5 A;  3ZTM A;  3HNK A;  4L6R A;  1BBH A;  1E85 A;  3C62 A;  5JS5 A;  5JSL A;  1RCP A;  2YLI A;  4CIP A;  2J9B A;  1E83 A; 
#chains in the Genus database with same CATH topology
 3SXY A;  3S84 A;  1TR2 A;  1NZE A;  3NYL A;  1YYJ A;  1JR8 A;  2CW0 F;  2QE9 A;  3HNL A;  1OKK D;  1YZA A;  5KYX A;  2UUH A;  2HV7 A;  1E86 A;  1CPQ A;  2J9V A;  1YJG A;  2R25 A;  4C3D A;  1LPE A;  1XZP A;  3Q7G A;  3ABL C;  4GQH A;  1YAU O;  3IQ5 A;  2OJE D;  2W45 A;  3U2L A;  1VYK A;  5B3I A;  4CSA A;  1V54 C;  4WAB A;  4EBJ A;  3EH2 A;  4U5D E;  1OCC C;  4JE9 A;  1HMO A;  4G7Z F;  1C02 A;  4JIO A;  1K04 A;  1ORJ A;  1OCR C;  1PV3 A;  1QPU A;  3GEH A;  3ZG1 A;  5DLJ A;  4MVM A;  3JRM O;  4ZLC A;  4MW3 A;  3Q6M A;  3TD7 A;  3U9M A;  3DE9 A;  3AGT A;  1LM3 B;  1V4A A;  4XPW A;  2NUP A;  1HW1 A;  3PMR A;  3W8I A;  1BDJ B;  2PBE A;  3GEI A;  3MFN A;  4E0I A;  4DBR A;  3RFY A;  2LK4 A;  4WGZ A;  5BUO A;  3LUT B;  1RKE B;  1VB5 A;  2HSB A;  2L9J A;  2PFD A;  3BRJ A;  4H54 A;  2Q7R A;  3U3B A;  5EK0 A;  3TOL A;  2M4E A;  4CS8 A;  3LS1 A;  4EHP A;  2R7R A;  2GAQ A;  4IAO A;  2C04 A;  3B71 A;  3I5P A;  4K0D A;  4G7O F;  4EKW A;  2MWQ A;  4KI2 A;  4G78 A;  3S29 A;  1M2O A;  5A6B D;  1WAS A;  4DRI B;  2R7W A;  2KK1 A;  4KNW A;  3DM9 B;  1CGM E;  3DAF A;  3W4Y A;  3TUL A;  2OG2 A;  3K7D A;  1Z7Q c;  1QQ3 A;  2XLD A;  3DI5 A;  3EHM A;  1OCZ C;  2KJG A;  4F4B A;  1G5Z A;  3KKB A;  2TMV P;  4OIR F;  4CSA C;  2HMZ A;  5BQH A;  4X0R A;  1B68 A;  2ETS A;  2FFH A;  3FVY A;  2WZF A;  2H7O A;  5DQZ A;  1C03 A;  2EIN C;  2GWW A;  2EIL C;  2IYL D;  5L0H A;  4C7O A;  3ASN C;  3JSZ A;  3W8H A;  1D1A A;  2XLW A;  5KYY B;  2ZD9 A;  1XWJ A;  4HFF B;  2EPO A;  2J0W A;  1SYQ A;  2A6E F;  2YL3 A;  4HE8 D;  4O6N A;  5BQG A;  2LFD A;  2Y3D A;  3V5Z A;  3L8I A;  1Q0D A;  4K7B A;  4ULV A;  5EHH A;  3EQL F;  1MMN A;  2IBF A;  2YL7 A;  4AE4 A;  4NCQ A;  5CI9 A;  1A7E A;  1WAT A;  5L3V A;  1VTM P;  1Q0G A;  1PD1 A;  3C8G A;  5E3C A;  1H9G A;  3DJN B;  3J06 A;  3IHU A;  4PJM A;  4CX9 A;  4CS8 C;  1U89 A;  1RKE A;  2A0U A;  2DYR C;  4ANJ A;  1MMG A;  4HFK B;  1T6Q A;  3LEO A;  4A2N B;  1VLS A;  2OOC A;  4FX5 A;  1LI5 A;  1OXK A;  4OIQ F;  2PNO A;  2Z15 A;  3LLI A;  3OWT A;  2YZS A;  4NC3 A;  4LDQ A;  1G4W R;  5EGY A;  2IXM A;  2A0B A;  3RW0 A;  5BQI A;  1D1B A;  1T01 A;  3ZC4 A;  4LDK A;  4IJJ A;  4E17 A;  2PF4 E;  2ICW G;  1NLX A;  1Q0F A;  3GM1 A;  4CJG A;  1V74 B;  1L3P A;  2YL0 A;  1VK5 A;  3AGU A;  3B29 A;  1LI7 A;  3QMK A;  4BEJ A;  5FCL A;  4O79 A;  2GDC A;  1ORS C;  4JZA A;  3US6 A;  4E0H A;  4PR9 A;  3U9J A;  1YDI A;  3DJU B;  3H65 A;  4AL0 A;  2CNW A;  4I1M A;  2Y3G A;  3WAQ A;  1YAR O;  3ECS A;  5T1D B;  2KQ9 A;  1OW8 A;  4E18 A;  1EQ1 A;  4U5H A;  4XPX A;  5D91 A;  3U8V A;  2WB7 A;  1E83 A;  3B0P A;  3E9V A;  1FR0 A;  2OQM A;  3U8P A;  4LAC B;  2J0X A;  4YN0 B;  4P6I C;  4JW1 A;  1Q0K A;  3C63 A;  4QDL A;  2R7Q A;  3RKO F;  1FFH A;  1A7D A;  3LS0 A;  3NYJ A;  4G7H F;  4BJ6 A;  2AWY A;  3TOM A;  5KYY A;  4ZLD A;  2R7S A;  3DE8 A;  3I4U A;  3LAY A;  3WG7 C;  2P0N A;  3QTH A;  4CS7 A;  1H6G A;  1T6I A;  2J45 A;  5F28 E;  2A69 F;  3ZIB A;  3UMI A;  1O87 A;  3H2U A;  4JC7 A;  4OD4 A;  3QVY A;  3AG3 C;  3FHD A;  2VAS A;  5L0F A;  1GS9 A;  2XM0 A;  3N2Z B;  4FWV A;  4JEA A;  1R4T A;  3ATP A;  3C18 A;  3W2V A;  3SP1 A;  2J8W A;  3WOD F;  3AQC A;  3RF3 A;  1V55 C;  3E70 C;  3A11 A;  4CIH A;  1FMW A;  3PDM P;  1WWP A;  2HV6 A;  3K6B A;  3DZA A;  3NMK A;  2J7P D;  1TKN A;  2KYH A;  1ZHW A;  3H2V A;  1Y4C A;  2HFI A;  2A1D D;  2HJM A;  2VCA A;  2DB4 A;  3AG2 C;  3F47 A;  4GYT A;  4IAQ A;  3QW0 A;  4XEV A;  3S27 A;  1O3U A;  4YJW A;  1YVI A;  4AL1 A;  3SXK A;  3T6B A;  1ZYR F;  2YL1 A;  3EGD A;  5D92 A;  4O7G A;  4U9D A;  3F46 A;  4IRU A;  4KBL A;  3O6X A;  5A69 A;  4U5C E;  4U9E A;  2GFH A;  4DVY P;  5JT4 A;  5JVE A;  1LVK A;  1RMV A;  4MVR A;  5CI8 A;  3ZQV A;  2AVK A;  2VCC A;  3K1H A;  4GEH A;  3FMS A;  4BJ6 C;  2RD9 A;  4N4W A;  1E84 A;  3PCV A;  4BEM J;  5AC4 A;  4AE4 B;  3CEX A;  2XLH A;  2QNL A;  4CS9 A;  2KC3 A;  2KNH A;  2EPK X;  3B0V C;  3VF0 A;  1H9T A;  1MQV A;  2AP3 A;  3TJ5 A;  3V5X A;  4BPM A;  3C8G B;  4DBQ A;  2JPU A;  2P61 A;  1JPJ A;  1XZQ A;  2V26 A;  1RKC A;  2NSG A;  2QLA A;  3CAX A;  1WOL A;  3UMH A;  4DXW A;  4EIY A;  3DAG A;  5GPG B;  4Q4Z F;  2CDQ A;  2EPM X;  3LNR A;  2H8A A;  1TQG A;  3S28 A;  4J7Y A;  5AGF A;  2LD6 A;  4IAR A;  4YL0 A;  4EBB A;  256B A;  3GWL A;  4MND A;  4OD5 A;  2Q4F A;  1NU9 C;  2ZPA A;  1ZW3 A;  2YRF A;  4YT8 A;  4YL1 A;  1DOV A;  3A9C A;  4UDV A;  5K0I A;  1F1M A;  2L6F A;  1UFB A;  2XS8 A;  4JKV A;  2RSE B;  3ZDL A;  4YT2 A;  4MVQ A;  4DRH B;  2Q9B A;  1YA7 O;  4ER9 A;  1YYX A;  3NMJ A;  3EH1 A;  1QSP A;  3SYN A;  4K1O A;  4XQ1 A;  1EI7 A;  4YL3 A;  2WL8 A;  1K40 A;  3ABM C;  3GAN A;  1WGW A;  3K33 A;  1RJ9 A;  2YHS A;  3R2P A;  2HMQ A;  3DWW A;  3S9O A;  2WVN A;  2HZ8 A;  3O39 A;  3NMI A;  1FAP B;  2J9U A;  1GGQ A;  4JRZ A;  4E7Z A;  3LJB A;  3Q6N A;  3SXM A;  4OIN F;  1ZHY A;  3TJ6 A;  3ABK C;  1Z3I X;  5E2Q A;  3U3F A;  4CS9 C;  1L7C A;  2PX3 A;  4RD9 A;  4MQ9 F;  4C3B A;  2IXP A;  4MS2 A;  3GM2 A;  4JTD B;  1OXB A;  3RIP A;  2FGY A;  2YWA A;  1D0Y A;  2Q9C A;  3KPH A;  5JSL A;  2D4U A;  1OR3 A;  1WN0 A;  3SEO A;  3V7O A;  1JPN A;  2J9W A;  4CIP A;  1SMY F;  1J8M F;  2IXO A;  5T3T A;  1YLM A;  2R05 A;  4JJF A;  4JJG A;  2I8B A;  2P6V A;  3FOO A;  4IWB A;  3ZTZ A;  1OR2 A;  4CDV A;  1S7Z A;  2BL2 A;  3C7J A;  3EFO A;  3GM3 A;  2Q3T A;  2VCB A;  4MTO A;  4BJT A;  2XSE A;  5AC5 A;  1GM5 A;  1APC A;  3UGP A;  3EPV A;  2XL4 A;  4N06 A;  4RDA A;  2HJ3 A;  3QW1 A;  2NG1 A;  4JVS A;  3EZH A;  3DM5 A;  2AWC A;  1KNY A;  5HSW A;  4JCZ A;  3T4R A;  2G3V A;  3X2Q C;  1E2X A;  1ORY A;  5L0I A;  4A4A A;  3ITF A;  3EZI A;  1MND A;  1T5O A;  2HS5 A;  3EGD B;  3AJM A;  3ASO C;  3LNM B;  4MVS A;  5L3Q A;  3FAJ A;  2XLO A;  2ZXP A;  4QI2 A;  3SNH A;  4Q7C A;  4B6I A;  3POV A;  4J32 B;  1QVX A;  1CGO A;  1N1C A;  1RXQ A;  2OJQ A;  5B1B C;  5JLI A;  2OKU A;  2X51 A;  3JT1 A;  1VOM A;  4XEF A;  5DVW A;  3C8Z A;  3L8J A;  1AVO B;  1ZHZ A;  3FAP B;  2B0J A;  1S05 A;  4FES A;  1ZVZ A;  2Y39 A;  4MW8 A;  3SXZ A;  2KW3 C;  4KNV A;  5JUA A;  1OKK A;  1NBB A;  1ZHX A;  2EIM C;  5L0J A;  1AUE A;  1I5N A;  1DOW A;  1LE2 A;  3AG4 C;  3HNJ A;  5FZT A;  1D0Z A;  3JZ0 A;  3RQG A;  3MLG A;  2YLD A;  3C8G D;  4Z9J A;  4DRJ B;  1Z63 A;  2QTV A;  4JEB A;  1GQA A;  2UUI A;  4C3E A;  3ZSU A;  3ZQY A;  3AOU A;  2IOQ A;  1WTY A;  1O5H A;  2JD3 A;  3HJC A;  3DMD A;  4WJ0 A;  4D4N A;  1UG7 A;  1JAF A;  1JMW A;  2C03 A;  3HNI A;  5B3S C;  5HV9 A;  5E33 A;  4OIP F;  1Y6D A;  1M56 C;  5IY5 C;  3UGO A;  3JTL O;  1LE4 A;  1D1C A;  5DS5 A;  2R7V A;  4MVU A;  1Q0M A;  1VMA A;  4P9F A;  4AX2 A;  4JUR I;  2DI3 A;  5DQT A;  1PD0 A;  2ZXR A;  3EJN A;  4LLE A;  4D4X A;  1QZX A;  5KYW A;  4H4K C;  2HKV A;  3M79 A;  4MVZ A;  1Z6A A;  2P1A A;  2WVQ A;  2R9R B;  4ONS A;  3O10 A;  4R32 A;  4EUK B;  4BG0 A;  4FAP B;  3Q7L A;  1LKX A;  2YKZ A;  3FOP A;  4MTF A;  4N6H A;  1RJ9 B;  2CNW D;  4NTA A;  2LQG A;  4YWQ A;  2MYS A;  2L7A A;  4P9T A;  5CIV A;  4O6M A;  3LEV A;  3TQO A;  4DOZ A;  3K66 A;  3OA1 A;  4LLC A;  4NY3 A;  2AU5 A;  1U0B B;  1OCO C;  1M2V B;  4XPY A;  3IQ6 A;  4XLP F;  3W2W A;  1KTM A;  4ULW A;  3G4X A;  4YK5 A;  3MX3 A;  1NFN A;  5A6B A;  2O9X A;  1EKY A;  1I4Y A;  1NSG B;  2XLV A;  1NG1 A;  2PX0 A;  5A6A A;  1TWH A;  3HTK C;  3M15 A;  3GWN A;  2LIG A;  1A7V A;  3JYH A;  4IGG A;  2BE5 F;  4PK4 A;  3B0U X;  4RBN A;  1BZ4 A;  2XLM A;  1KU2 A;  3K1I A;  1PCX A;  3UMK A;  3FDQ A;  1A0B A;  2Y3H A;  3T9O A;  3EFO B;  1D0X A;  1VYI A;  1BR1 A;  2PP4 A;  4PFO A;  1JRA A;  1ZU5 A;  1LIH A;  3M4B A;  3AG1 C;  3OEO A;  3VYW A;  3NKE A;  2WVO A;  2EIJ C;  1TWG A;  4I1O B;  1H7I A;  3UNG C;  3HLZ A;  3HNK A;  3GEE A;  2WZG A;  3HKK A;  4Q5S F;  3CSK A;  1E85 A;  4DJ9 A;  3U0C A;  2VH3 A;  2VC9 A;  2YLI A;  3EG9 B;  2M64 A;  3N0T A;  3RQF A;  1MMD A;  2OCC C;  3KH2 A;  2R7T A;  3JYY A;  3S0X A;  3VM6 A;  3UR3 C;  4QI0 A;  3NKD A;  2EPN A;  2XLE A;  3S90 A;  4BJ1 A;  2XL6 A;  2XXA B;  2OEX A;  1Z23 A;  3JSE O;  3X1O A;  1T9K A;  1JOG A;  1G8X A;  1Z5Z A;  2D5R B;  4IB4 A;  4CJO A;  4XWJ A;  3GOD A;  2F22 A;  3IQC A;  4XEK A;  1M2V A;  3N24 A;  2KSF A;  5KYU A;  2I15 A;  2NPU A;  1HW2 A;  1FMV A;  2LP4 A;  4PJJ A;  1G4U S;  1K05 A;  3EGX A;  3T6G B;  2Y3B A;  1HE1 A;  1LS1 A;  1MNE A;  4I44 A;  3I5Q A;  4BJ5 A;  3G50 A;  1ZHT A;  2YEV A;  3RVZ A;  3T6J A;  3TK0 A;  4YT4 A;  3M1C B;  5DS4 A;  2LFF A;  3ZWI A;  4U5E E;  2OU6 A;  1QLE C;  2QUP A;  3U5S A;  3QVZ A;  4J7T A;  1TFO B;  3LLK A;  5T3W A;  5L0D A;  3K1I C;  4NTB A;  4EWC A;  1IZM A;  2R02 A;  4U5F E;  2B0H A;  1T6U A;  2QY9 A;  4N6C A;  3V5Y A;  4PFP A;  2R7X A;  1OQC A;  3KL4 A;  1ZW2 A;  1HY5 A;  5KYN A;  3RH3 A;  1OW7 A;  4XLN F;  2EPL X;  1U6H A;  3IQT A;  3AQB A;  2HSQ A;  2EIK C;  2V3C C;  1NFO A;  5KYW B;  1C17 M;  1BR2 A;  1A41 A;  2NUT B;  1ZU4 A;  2ZXW C;  2NSF A;  2W9Y A;  3L1M A;  2JX0 A;  5DS6 A;  4CDA A;  1W2W A;  5JRA A;  2W4B A;  1ZZP A;  2L81 A;  3L34 A;  1LS4 A;  4LDR A;  4YT5 A;  4WGY A;  3EG9 A;  3QZC A;  1TWC A;  2XM4 A;  4JTA B;  2W4M A;  5A6J A;  2LSE A;  1TWA A;  2A6H F;  5L0G A;  2MHR A;  3NG1 A;  3U2M A;  3BEH A;  4PJN A;  3CQZ A;  3O55 A;  1NU7 D;  5F5H A;  2CYD A;  2HUJ A;  1MMA A;  2WZL A;  4EBK A;  2LCH A;  2H7B A;  5A6K A;  2R7U A;  2XL8 A;  3EHN A;  2Q00 A;  3NYM A;  1M57 C;  1FNT c;  2XXA A;  1VLT A;  1J8Y F;  2Y69 C;  1SZI A;  1SF8 A;  3VAY A;  3B9Q A;  1R5I D;  3PHF 2;  3NRH A;  2A68 F;  4W8P A;  4U5B E;  4NQF A;  5JP7 A;  3SZR A;  2YVK A;  5TJ5 E;  2IM8 A;  4BJ5 C;  3KMI A;  4PJL A;  5COG A;  1YZC A;  2G3K A;  2L6G A;  5KYX B;  1M6T A;  3FXH A;  4M63 A;  4MVO A;  3RYL A;  4O6Y A;  3RVY A;  2J7P A;  4Z9H A;  2DYS C;  3MYI A;  1YA9 A;  2P7V A;  4XTK A;  4NTF A;  3DD7 A;  1CPR A;  4U5G A;  4C7O B;  3KYI A;  1ST6 A;  2YLG A;  3VRC A;  3MBG A;  4CDY A;  3ZVR A;  1QKR A;  3MYF A;  4AK9 A;  4JCH A;  3KYJ A;  3G4Z A;  2R03 A;  1CGN A;  4J30 B;  4CBE A;  2Q9A A;  4E7S A;  3NDB B;  2CCY A;  1FFT C;  3IEE A;  2NUP B;  2XRH A;  5COF A;  3DXJ F;  3M4C A;  2NUT A;  2E87 A;  1BR4 A;  1HMD A;  2H7V C;  3JCU Q;  4W8K A;  3R7C A;  4PAC A;  1I4Z A;  3L0I A;  3LES A;  4G0H A;  1OW6 A;  3JRT A;  4Z9I A;  2IXN A;  2GA0 A;  2OEV A;  4HEA J;  2XS1 A;  1EA8 A;  5L0C A;  1SR2 A;  2BC5 A;  2YQY A;  2ZXO A;  2DGJ A;  1TFK B;  3CZ6 A;  4I3M A;  3WHN A;  5F5F A;  3ZTM A;  4MTG A;  2ASR A;  1HE9 A;  1IW7 F;  4KC9 A;  2FAP B;  1FTS A;  3DKA A;  4L6R A;  4DVZ A;  5E3A A;  1BBH A;  5B1A C;  5KYU B;  2KGO A;  3C62 A;  5JS5 A;  3GOR A;  2X0C A;  4JTC B;  1RCP A;  2CGE A;  2G62 A;  3RQE A;  4OIO F;  1AEP A;  5COM A;  2J46 A;  3EGX B;  4LER A;  3IPM O;  2J9B A;  2R7O A;  2VB6 A;  2L6H A; 
#chains in the Genus database with same CATH homology
 1YYJ A;  3ZTZ A;  3FOO A;  3HNL A;  4CDV A;  3C63 A;  1YZA A;  2XLE A;  3TOM A;  1E86 A;  1APC A;  1CPQ A;  2XL6 A;  3DE8 A;  3QW1 A;  4CJO A;  4IB4 A;  3IQ5 A;  5B3I A;  4JE9 A;  3QVY A;  1QPU A;  2XM0 A;  4JEA A;  2XLO A;  3ZWI A;  2J8W A;  3U8P A;  3QVZ A;  3DE9 A;  1LM3 B;  1CGO A;  5JLI A;  4WGZ A;  3NMK A;  1S05 A;  4IAQ A;  3TOL A;  3QW0 A;  5JUA A;  1NBB A;  3L1M A;  3HNJ A;  4CDA A;  2YL1 A;  4U9D A;  5JRA A;  2YLD A;  4U9E A;  4JEB A;  1GQA A;  5JT4 A;  5JVE A;  4WGY A;  2XM4 A;  3ZQY A;  4D4N A;  3ZQV A;  1JAF A;  3HNI A;  1QQ3 A;  4N4W A;  1E84 A;  2XLD A;  2XL8 A;  2XLH A;  4D4X A;  1MQV A;  3M79 A;  2QLA A;  5JP7 A;  4EIY A;  4N6H A;  2YKZ A;  3FOP A;  1YZC A;  5AGF A;  2XLW A;  1M6T A;  4IAR A;  256B A;  2YL3 A;  4ULV A;  1CPR A;  2YL7 A;  4JKV A;  3IQ6 A;  2YLG A;  3VRC A;  4CDY A;  4ER9 A;  1YYX A;  3NMJ A;  4CX9 A;  1CGN A;  1EKY A;  2XLV A;  3M15 A;  2CCY A;  1A7V A;  3M4C A;  4NC3 A;  2XLM A;  3NMI A;  4CJG A;  2YL0 A;  3M4B A;  2BC5 A;  3ZTM A;  3HNK A;  4L6R A;  1BBH A;  1E85 A;  3C62 A;  5JS5 A;  5JSL A;  1RCP A;  2YLI A;  4CIP A;  2J9B A;  1E83 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...