3C62A

Tetrameric cytochrome cb562 (h59/d62/h63/h73/a74/h77) assembly stabilized by interprotein zinc coordination
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
106
structure length
106
Chain Sequence
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMHDFDHGFDILVGQIHAALHLANEGKVKEAQAAAEQLKTTCNACHQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Soluble cytochrome b562
publication title Metal-mediated self-assembly of protein superstructures: influence of secondary interactions on protein oligomerization and aggregation.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Electron transport
total genus 44
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 3c62A00
1RCPA 3M79A 1CPRA 3L1MA 3QW0A 3QVYA 2XLVA 4IARA 5JSLA 1GQAA 3C63A 4CX9A 4CDVA 3FOPA 4JEAA 2XLOA 1APCA 3ZQYA 1MQVA 256BA 2XM4A 1E84A 3QW1A 1CPQA 5JS5A 1YYJA 1E86A 5B3IA 1YZCA 2BC5A 3IQ5A 1QQ3A 3NMKA 1NBBA 2YL0A 4U9EA 4D4XA 1EKYA 3TOMA 3HNLA 2YLGA 5JVEA 3IQ6A 1CGNA 2YL7A 4IAQA 4U9DA 4ULVA 2XLWA 4WGZA 1M6TA 3M4BA 2CCYA 3DE8A 3ZTMA 5JT4A 2XM0A 5AGFA 1BBHA 5JRAA 3C62A 4CJGA 3FOOA 1YYXA 2YLDA 3ZWIA 4CJOA 4N4WA 4CIPA 4CDAA 2XL6A 2XLDA 3U8PA 2J9BA 1LM3B 1JAFA 1E83A 2YL1A 3VRCA 2YKZA 1A7VA 4JE9A 5JLIA 3DE9A 4IB4A 4NC3A 2YLIA 3M4CA 5JUAA 2XLMA 3HNIA 3NMIA 1E85A 2YL3A 4D4NA 1CGOA 3TOLA 1QPUA 4N6HA 4L6RA 2QLAA 1YZAA 3NMJA 2XLHA 2XL8A 4CDYA 2XLEA 4ER9A 3ZQVA 4JKVA 3HNKA 3ZTZA 4WGYA 4JEBA 3M15A 2J8WA 3HNJA 1S05A 3QVZA 4EIYA 5JP7A
chains in the Genus database with same CATH superfamily
2J0XA 1SR2A 1Y4CA 1YJGA 1C17M 1RCPA 2G62A 2D5RB 3DWWA 5L0FA 1I5NA 3E9VA 1FMVA 3LJBA 4H4KC 4Q7CA 4JRZA 5A6BD 3L8IA 4NTFA 2Y3BA 2QTVA 2ZD9A 3ATPA 1E83A 3SNHA 4G7ZF 3K6BA 3S28A 5KYNA 1TFOB 4C3BA 4K7BA 3C63A 4W8PA 4MVSA 1BZ4A 2MHRA 4RD9A 1ORYA 1MNEA 2WVQA 4CDVA 1YA7O 4CX9A 2WVNA 4PACA 1OKKD 3ZQYA 3RF3A 1MQVA 2V26A 3Q7LA 3HJCA 3C8GD 4IJJA 4J32B 4CBEA 256BA 2I8BA 5A69A 4UDVA 1H6GA 1U0BB 2DYSC 3RIPA 3AG1C 2L6FA 4IRUA 2H8AA 1YYJA 2I15A 3AG2C 3B29A 1YDIA 2OKUA 4JW1A 2X51A 1WWPA 5B3IA 3JT1A 3S90A 1TWGA 5L0HA 2G3KA 3NMKA 4PR9A 2YL0A 3H65A 1Q0MA 4D4XA 3TOMA 2XXAA 4AE4A 2P61A 2YQYA 5CI9A 3CSKA 3UMIA 3B0UX 5L0IA 3C8ZA 4U9DA 4IAQA 2PNOA 3MYIA 2LP4A 2NPUA 2NSFA 2VB6A 3A11A 4J7TA 2V3CC 1XWJA 4C7OB 1A0BA 2EILC 2ZXOA 4P9TA 4EBBA 2Q00A 4JIOA 3MLGA 1HE9A 1UG7A 2C04A 1G8XA 3DM9B 3ZTMA 2OJED 2HJMA 4O6YA 1JRAA 2GDCA 1BBHA 2YRFA 3EGXB 1O5HA 3L8JA 2R03A 3NYJA 3VF0A 5JRAA 1DOVA 2ZXRA 3Q7GA 2D4UA 4XPYA 3ZG1A 3LNRA 1K05A 3AQBA 4ZLCA 4FX5A 4CS8A 4DOZA 3FOOA 1YYXA 4G0HA 5B1AC 3UNGC 3MFNA 1WTYA 4YN0B 4CJOA 4CIHA 4YL3A 4CIPA 1G5ZA 2Q3TA 5T3TA 1AEPA 1M2OA 5DS4A 1KTMA 4AK9A 4CDAA 3U8PA 2EPOA 2CW0F 2HMQA 2YL1A 1J8MF 1E2XA 2Z15A 3O10A 2TMVP 1HW1A 4OINF 3RQGA 3OWTA 2RD9A 4BJTA 2B0JA 2KJGA 4JURI 4JE9A 2J9UA 2IXMA 3NRHA 4XLNF 3DE9A 4RBNA 3SZRA 4EIYA 5KYWA 3GM3A 4LDRA 2WZGA 3U8VA 3UR3C 4KNVA 1OW8A 3PHF2 1Z5ZA 3KL4A 1WOLA 3V5YA 3M4CA 2IXOA 3UMKA 4W8KA 3HTKC 2UUIA 3N24A 5KYYA 3NMIA 4EKWA 3F47A 4JZAA 3TOLA 2B0HA 3M1CB 3EFOB 4CSAA 2A0BA 1T6QA 2AWYA 4OIPF 3SXKA 1TQGA 3LLIA 4HFFB 1D1BA 4CS7A 4FESA 4MVQA 1AVOB 2ETSA 4QI2A 1LI5A 3S29A 3Q6MA 2R7WA 1U6HA 5F28E 1S7ZA 3NG1A 5COFA 3I4UA 4MTOA 4PJNA 3ZTZA 2IXPA 3EHMA 2DB4A 3M15A 4JEBA 1B68A 4DVYP 4OD5A 4E18A 2KNHA 1BDJB 4P6IC 4DRIB 3B9QA 4O79A 3IQCA 1D0ZA 5T1DB 1ZHXA 1MMGA 2AU5A 2YHSA 2KK1A 3VYWA 5K0IA 1M2VA 3W8IA 1I4YA 3AOUA 3KYJA 5A6AA 4OIOF 2KGOA 1CPRA 1H7IA 2LK4A 2YVKA 4RDAA 1RKEA 1H9GA 1SYQA 2WZLA 2IBFA 3JTLO 1WGWA 2VCCA 2KSFA 2XLVA 3KMIA 4YT5A 5BQIA 1TFKB 5B1BC 2R7VA 1Q0KA 1RXQA 1YVIA 1V55C 2FFHA 4MVMA 4BEMJ 4E0IA 2Q9BA 3O55A 3EZHA 1ZW3A 3OEOA 3FOPA 4JEAA 4NQFA 2XLOA 4BG0A 1APCA 1ST6A 1NFNA 2HKVA 1A7DA 1MMAA 2EINC 3CAXA 1VLSA 3T6BA 1FFTC 2J9VA 3GORA 4EWCA 1J8YF 2KYHA 1M57C 2OOCA 3K1HA 3S84A 1C03A 3G4ZA 4EUKB 3PMRA 4K1OA 4G7OF 1U89A 1ZYRF 1T9KA 4KC9A 3SEOA 3W4YA 4DBRA 1LI7A 1YZCA 2BC5A 1RMVA 3CEXA 3IHUA 1QQ3A 3L34A 3K7DA 3S27A 1TWCA 1JR8A 1I4ZA 2P1AA 1D0XA 1FTSA 1TWHA 2NSGA 1PCXA 5CIVA 4Q4ZF 4IAOA 2OEXA 2OQMA 4C3EA 4E17A 4MVOA 4ULVA 3R7CA 2HSQA 2R7TA 4XTKA 3RVZA 1R4TA 2R02A 2XSEA 1M6TA 1K40A 3EZIA 3JZ0A 2Q4FA 3BEHA 4B6IA 2PFDA 3AGUA 3DKAA 3JRMO 3SYNA 4NTBA 2LSEA 5GPGB 5E3AA 5JT4A 2ICWG 4PK4A 1TWAA 3GWLA 2L81A 5AGFA 3TK0A 2Q9AA 1VB5A 3C62A 2QY9A 4AL0A 3O6XA 2NUTA 2WB7A 1QVXA 4CJGA 3JRTA 4OD4A 5F5HA 1SF8A 1D1AA 2L9JA 5FZTA 3DM5A 4Q5SF 5DVWA 3HKKA 3GEEA 3ABKC 4U5FE 5COGA 1HW2A 1RJ9A 2H7OA 4CS8C 2XLDA 4YT2A 4MW3A 1LM3B 1JAFA 1MMNA 1OCZC 2A6HF 2EIJC 3EGDA 3LUTB 3L0IA 2P6VA 3BRJA 4J30B 4MQ9F 2Q7RA 3V7OA 2XXAB 1OW7A 2DYRC 1BR2A 2EPKX 1KU2A 3DD7A 4YK5A 2YKZA 1A7VA 4JTDB 3MX3A 2OEVA 1ORSC 3LESA 4Z9HA 5JLIA 4MNDA 2W4BA 3SXMA 3ASNC 2Y69C 3DAFA 5HV9A 2Y3HA 1Q0GA 2Y3GA 3EJNA 5KYUB 4E7SA 1D0YA 2R7UA 2XLMA 4XPXA 5E33A 1E85A 2YL3A 4D4NA 1MNDA 3RW0A 5F5FA 4R32A 3HLZA 4N6HA 3WG7C 4L6RA 2QLAA 3ZC4A 2HFIA 1YZAA 2HV6A 4DXWA 2HV7A 3NKDA 4MW8A 2J7PA 2OJQA 2YWAA 2R25A 2VCBA 2XL8A 2YEVA 3ABLC 3QMKA 4LDQA 5COMA 1G4WR 4I44A 2LFDA 2J9WA 4CSAC 2XLEA 4ER9A 4U5CE 4Z9IA 3FAPB 2WVOA 2GAQA 5BQHA 4WGYA 1JMWA 3MBGA 4LLEA 3U0CA 3FMSA 1NU7D 2J0WA 2EPLX 5HSWA 1HMDA 3AQCA 2VCAA 1Z3IX 5A6BA 2QNLA 2X0CA 4GYTA 4N06A 2WL8A 3QVZA 3T6GB 4JJFA 1N1CA 1V54C 5KYXA 3H2UA 2AWCA 2HS5A 4ULWA 3O39A 3B0PA 3W2VA 3LLKA 3X1OA 1OKKA 2H7BA 1Z23A 3QW0A 4MS2A 4MVZA 4AE4B 3C8GA 4YT4A 2R05A 4IARA 2OU6A 3KYIA 2VASA 2R7SA 3GWNA 2KQ9A 1VLTA 1A7EA 4PJMA 4I1OB 4QDLA 3H2VA 1PV3A 4BJ6A 2IOQA 1PD1A 3ZSUA 1MMDA 3DMDA 3Q6NA 2CYDA 3G4XA 1SMYF 1TR2A 2NUPA 1VK5A 3DI5A 3ITFA 3TJ5A 1E84A 1CPQA 4LACB 5JS5A 2A6EF 3NKEA 1PD0A 1E86A 1CGME 4XEVA 3A9CA 3EG9A 4K0DA 1OQCA 4U5BE 3RQFA 3ABMC 3G50A 3IQ5A 4HE8D 1VTMP 1OW6A 4JC7A 3RKOF 2W4MA 3QZCA 3U5SA 2GA0A 2LQGA 3NYMA 1Z63A 3EPVA 2AP3A 1WATA 1ZU4A 5IY5C 1EKYA 1FFHA 4GQHA 4F4BA 4OIQF 3JSEO 3KPHA 3IQ6A 1CGNA 2JPUA 3S9OA 2XL4A 1OR3A 3V5XA 1LE2A 5L3QA 2LCHA 4MVRA 2Y39A 3T6JA 5L3VA 3ZVRA 3IPMO 4NY3A 2MWQA 1JPNA 3KH2A 4JVSA 1EI7A 3T4RA 1TKNA 2CCYA 3AG4C 3DE8A 3EH2A 3U2LA 4AL1A 4EBJA 5KYWB 3SP1A 2Q9CA 3N2ZB 1QZXA 3GANA 1L7CA 4CS9A 2R7RA 1ZHWA 3OA1A 4QI0A 1XZQA 5BUOA 1NLXA 2W45A 4A4AA 4DJ9A 4PFOA 5KYYB 2ASRA 1YARO 2MYSA 3VAYA 4G78A 3ZWIA 2WZFA 4N4WA 3QTHA 2DGJA 3DAGA 1FR0A 1R5ID 4JTCB 4BJ5A 2XL6A 3WAQA 2OCCC 1H9TA 1T6UA 3X2QC 2CNWD 5AC5A 3RFYA 3E70C 4C7OA 1ORJA 1ZHTA 4Z9JA 3VRCA 3J06A 1LPEA 2HJ3A 4ONSA 4M63A 2PBEA 2VH3A 3U3FA 2UUHA 2PX3A 3I5PA 4IB4A 4LLCA 1OCRC 1K04A 3TULA 1QLEC 3EGXA 4J7YA 2A1DD 2JX0A 2LIGA 4X0RA 2LFFA 4PFPA 2YLIA 2ZXPA 4YL0A 3TD7A 1L3PA 5JUAA 2XRHA 1M2VB 4O6MA 3HNIA 4XEKA 2J45A 4JCZA 4KNWA 3JCUQ 4MVUA 1HMOA 2HMZA 2P7VA 2KW3C 1RKEB 1OCCC 3NMJA 3KKBA 2YZSA 3K1IA 5D91A 4AX2A 4HEAJ 3C7JA 4BEJA 4U5GA 5L0JA 1T5OA 3TQOA 4CDYA 3GM1A 3ZQVA 3R2PA 5EGYA 4HFKB 2GWWA 1OXBA 4JKVA 1LIHA 2XS1A 3HNKA 1EA8A 1OXKA 1Q0DA 1Z7Qc 2A69F 1YA9A 4I3MA 3WODF 3HNJA 1UFBA 1LS1A 1S05A 2EPNA 2H7VC 5D92A 3RVYA 3V5ZA 5BQGA 4XPWA 4OIRF 3EH1A 1VMAA 4MTGA 3SXYA 3WHNA 5CI8A 3POVA 3AJMA 5TJ5E 3UGOA 1FMWA 5JP7A 4ZLDA 4WABA 4DRJB 1GS9A 2O9XA 5L0GA 1V74B 1G4US 3M79A 3U3BA 3N0TA 3L1MA 2IM8A 4JJGA 3EFOA 1LE4A 4LDKA 1VYKA 3S0XA 1ZU5A 2NG1A 3LNMB 3QVYA 1V4AA 4DRHB 4E7ZA 1YLMA 1NSGB 3AGTA 1T01A 3DXJF 5E3CA 2BE5F 5JSLA 4EHPA 2R7OA 3FVYA 1GQAA 2A0UA 4FAPB 2DI3A 2XS8A 3K66A 3LS1A 5DQTA 1LKXA 3FAJA 2EIMC 3I5QA 2P0NA 3LEOA 3RYLA 1W2WA 1SZIA 1BR1A 3JYHA 4NTAA 4C3DA 5FCLA 2M64A 2XM4A 3F46A 2LD6A 4BPMA 3QW1A 4KI2A 2VC9A 2E87A 2L6HA 4BJ6C 3FHDA 3IEEA 3FXHA 1O87A 2NUTB 3LS0A 3EHNA 3SXZA 3U9MA 5EHHA 5A6KA 1BR4A 2CNWA 3C18A 3T9OA 1VOMA 1JPJA 3IQTA 3PDMP 2AVKA 3CZ6A 4GEHA 1KNYA 3ZIBA 1NU9C 1NBBA 3RQEA 1HE1A 2CDQA 2L6GA 4U9EA 4LERA 1DOWA 3HNLA 1RJ9B 2HSBA 3JSZA 2YLGA 1IZMA 3MYFA 4O6NA 5JVEA 2YL7A 1NG1A 1IW7F 3PCVA 3UMHA 3EGDB 2XLWA 1HY5A 1XZPA 1ZW2A 4U5HA 4WGZA 4PJLA 3TJ6A 1ZHYA 4DVZA 1Z6AA 1C02A 2OG2A 5E2QA 4BJ1A 3M4BA 3ECSA 2G3VA 3GODA 4XQ1A 5L0CA 2XM0A 2QE9A 1A41A 3K33A 4XLPF 4JCHA 1NFOA 2R7QA 2ZXWC 3JYYA 2R9RB 2CGEA 1QKRA 3DJNB 1F1MA 3LAYA 4DBQA 2PX0A 4H54A 4NCQA 1GM5A 1LS4A 1ZZPA 1ZHZA 2JD3A 2YLDA 4KBLA 5T3WA 4CS9C 4EBKA 4E0HA 5DS5A 1M56C 1RKCA 3US6A 2EIKC 2F22A 2HZ8A 2J9BA 4YT8A 3GEIA 4MTFA 1ZVZA 5DQZA 1JOGA 2PP4A 3W8HA 3GEHA 1QSPA 4IGGA 2IYLD 2L7AA 3ASOC 5DLJA 5DS6A 5L0DA 4BJ5C 1O3UA 3U2MA 2EPMX 4PJJA 4FWVA 3RH3A 3UGPA 2HUJA 3W2WA 1OR2A 1AUEA 1D1CA 3B0VC 2GFHA 4NC3A 2KC3A 1WASA 3FDQA 4G7HF 1Q0FA 2Y3DA 4IWBA 3U9JA 5KYXB 3GM2A 2J46A 2ZPAA 3CQZA 4U5EE 3ZDLA 1CGOA 2A68F 4JTAB 1GGQA 4XEFA 1QPUA 2C03A 2PF4E 4ANJA 4YL1A 2RSEB 1FNTc 3AG3C 3C8GB 3B71A 2XLHA 3DJUB 5AC4A 2W9YA 5EK0A 5B3SC 1T6IA 3LEVA 3NDBB 3EQLF 1VYIA 4YJWA 1OCOC 4U5DE 3VM6A 1WN0A 1LVKA 2QUPA 3K1IC 1FAPB 1NZEA 4WJ0A 2IXNA 3NYLA 4I1MA 2R7XA 2BL2A 2FAPB 2J7PD 2J8WA 1YAUO 4A2NB 3DZAA 2NUPB 4N6CA 1Y6DA 4P9FA 5A6JA 1EQ1A 4XWJA 2M4EA 5KYUA 3EG9B 4O7GA 4YWQA 2FGYA
chains in the Genus database with same CATH topology
1RCPA 3M79A 1CPRA 3L1MA 3QW0A 3QVYA 2XLVA 4IARA 5JSLA 1GQAA 3C63A 4CX9A 4CDVA 3FOPA 4JEAA 2XLOA 1APCA 3ZQYA 1MQVA 256BA 2XM4A 1E84A 3QW1A 1CPQA 5JS5A 1YYJA 1E86A 5B3IA 1YZCA 2BC5A 3IQ5A 1QQ3A 3NMKA 1NBBA 2YL0A 4U9EA 4D4XA 1EKYA 3TOMA 3HNLA 2YLGA 5JVEA 3IQ6A 1CGNA 2YL7A 4IAQA 4U9DA 4ULVA 2XLWA 4WGZA 1M6TA 3M4BA 2CCYA 3DE8A 3ZTMA 5JT4A 2XM0A 5AGFA 1BBHA 5JRAA 3C62A 4CJGA 3FOOA 1YYXA 2YLDA 3ZWIA 4CJOA 4N4WA 4CIPA 4CDAA 2XL6A 2XLDA 3U8PA 2J9BA 1LM3B 1JAFA 1E83A 2YL1A 3VRCA 2YKZA 1A7VA 4JE9A 5JLIA 3DE9A 4IB4A 4NC3A 2YLIA 3M4CA 5JUAA 2XLMA 3HNIA 3NMIA 1E85A 2YL3A 4D4NA 1CGOA 3TOLA 1QPUA 4N6HA 4L6RA 2QLAA 1YZAA 3NMJA 2XLHA 2XL8A 4CDYA 2XLEA 4ER9A 3ZQVA 4JKVA 3HNKA 3ZTZA 4WGYA 4JEBA 3M15A 2J8WA 3HNJA 1S05A 3QVZA 4EIYA 5JP7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RCP A;  3M79 A;  1CPR A;  3L1M A;  3QW0 A;  3QVY A;  2XLV A;  4IAR A;  5JSL A;  1GQA A;  3C63 A;  4CX9 A;  4CDV A;  3FOP A;  4JEA A;  2XLO A;  1APC A;  3ZQY A;  1MQV A;  256B A;  2XM4 A;  1E84 A;  3QW1 A;  1CPQ A;  5JS5 A;  1YYJ A;  1E86 A;  5B3I A;  1YZC A;  2BC5 A;  3IQ5 A;  1QQ3 A;  3NMK A;  1NBB A;  2YL0 A;  4U9E A;  4D4X A;  1EKY A;  3TOM A;  3HNL A;  2YLG A;  5JVE A;  3IQ6 A;  1CGN A;  2YL7 A;  4IAQ A;  4U9D A;  4ULV A;  2XLW A;  4WGZ A;  1M6T A;  3M4B A;  2CCY A;  3DE8 A;  3ZTM A;  5JT4 A;  2XM0 A;  5AGF A;  1BBH A;  5JRA A;  3C62 A;  4CJG A;  3FOO A;  1YYX A;  2YLD A;  3ZWI A;  4CJO A;  4N4W A;  4CIP A;  4CDA A;  2XL6 A;  2XLD A;  3U8P A;  2J9B A;  1LM3 B;  1JAF A;  1E83 A;  2YL1 A;  3VRC A;  2YKZ A;  1A7V A;  4JE9 A;  5JLI A;  3DE9 A;  4IB4 A;  4NC3 A;  2YLI A;  3M4C A;  5JUA A;  2XLM A;  3HNI A;  3NMI A;  1E85 A;  2YL3 A;  4D4N A;  1CGO A;  3TOL A;  1QPU A;  4N6H A;  4L6R A;  2QLA A;  1YZA A;  3NMJ A;  2XLH A;  2XL8 A;  4CDY A;  2XLE A;  4ER9 A;  3ZQV A;  4JKV A;  3HNK A;  3ZTZ A;  4WGY A;  4JEB A;  3M15 A;  2J8W A;  3HNJ A;  1S05 A;  3QVZ A;  4EIY A;  5JP7 A; 
#chains in the Genus database with same CATH topology
 2J0X A;  1SR2 A;  1Y4C A;  1YJG A;  1C17 M;  1RCP A;  2G62 A;  2D5R B;  3DWW A;  5L0F A;  1I5N A;  3E9V A;  1FMV A;  3LJB A;  4H4K C;  4Q7C A;  4JRZ A;  5A6B D;  3L8I A;  4NTF A;  2Y3B A;  2QTV A;  2ZD9 A;  3ATP A;  1E83 A;  3SNH A;  4G7Z F;  3K6B A;  3S28 A;  5KYN A;  1TFO B;  4C3B A;  4K7B A;  3C63 A;  4W8P A;  4MVS A;  1BZ4 A;  2MHR A;  4RD9 A;  1ORY A;  1MNE A;  2WVQ A;  4CDV A;  1YA7 O;  4CX9 A;  2WVN A;  4PAC A;  1OKK D;  3ZQY A;  3RF3 A;  1MQV A;  2V26 A;  3Q7L A;  3HJC A;  3C8G D;  4IJJ A;  4J32 B;  4CBE A;  256B A;  2I8B A;  5A69 A;  4UDV A;  1H6G A;  1U0B B;  2DYS C;  3RIP A;  3AG1 C;  2L6F A;  4IRU A;  2H8A A;  1YYJ A;  2I15 A;  3AG2 C;  3B29 A;  1YDI A;  2OKU A;  4JW1 A;  2X51 A;  1WWP A;  5B3I A;  3JT1 A;  3S90 A;  1TWG A;  5L0H A;  2G3K A;  3NMK A;  4PR9 A;  2YL0 A;  3H65 A;  1Q0M A;  4D4X A;  3TOM A;  2XXA A;  4AE4 A;  2P61 A;  2YQY A;  5CI9 A;  3CSK A;  3UMI A;  3B0U X;  5L0I A;  3C8Z A;  4U9D A;  4IAQ A;  2PNO A;  3MYI A;  2LP4 A;  2NPU A;  2NSF A;  2VB6 A;  3A11 A;  4J7T A;  2V3C C;  1XWJ A;  4C7O B;  1A0B A;  2EIL C;  2ZXO A;  4P9T A;  4EBB A;  2Q00 A;  4JIO A;  3MLG A;  1HE9 A;  1UG7 A;  2C04 A;  1G8X A;  3DM9 B;  3ZTM A;  2OJE D;  2HJM A;  4O6Y A;  1JRA A;  2GDC A;  1BBH A;  2YRF A;  3EGX B;  1O5H A;  3L8J A;  2R03 A;  3NYJ A;  3VF0 A;  5JRA A;  1DOV A;  2ZXR A;  3Q7G A;  2D4U A;  4XPY A;  3ZG1 A;  3LNR A;  1K05 A;  3AQB A;  4ZLC A;  4FX5 A;  4CS8 A;  4DOZ A;  3FOO A;  1YYX A;  4G0H A;  5B1A C;  3UNG C;  3MFN A;  1WTY A;  4YN0 B;  4CJO A;  4CIH A;  4YL3 A;  4CIP A;  1G5Z A;  2Q3T A;  5T3T A;  1AEP A;  1M2O A;  5DS4 A;  1KTM A;  4AK9 A;  4CDA A;  3U8P A;  2EPO A;  2CW0 F;  2HMQ A;  2YL1 A;  1J8M F;  1E2X A;  2Z15 A;  3O10 A;  2TMV P;  1HW1 A;  4OIN F;  3RQG A;  3OWT A;  2RD9 A;  4BJT A;  2B0J A;  2KJG A;  4JUR I;  4JE9 A;  2J9U A;  2IXM A;  3NRH A;  4XLN F;  3DE9 A;  4RBN A;  3SZR A;  4EIY A;  5KYW A;  3GM3 A;  4LDR A;  2WZG A;  3U8V A;  3UR3 C;  4KNV A;  1OW8 A;  3PHF 2;  1Z5Z A;  3KL4 A;  1WOL A;  3V5Y A;  3M4C A;  2IXO A;  3UMK A;  4W8K A;  3HTK C;  2UUI A;  3N24 A;  5KYY A;  3NMI A;  4EKW A;  3F47 A;  4JZA A;  3TOL A;  2B0H A;  3M1C B;  3EFO B;  4CSA A;  2A0B A;  1T6Q A;  2AWY A;  4OIP F;  3SXK A;  1TQG A;  3LLI A;  4HFF B;  1D1B A;  4CS7 A;  4FES A;  4MVQ A;  1AVO B;  2ETS A;  4QI2 A;  1LI5 A;  3S29 A;  3Q6M A;  2R7W A;  1U6H A;  5F28 E;  1S7Z A;  3NG1 A;  5COF A;  3I4U A;  4MTO A;  4PJN A;  3ZTZ A;  2IXP A;  3EHM A;  2DB4 A;  3M15 A;  4JEB A;  1B68 A;  4DVY P;  4OD5 A;  4E18 A;  2KNH A;  1BDJ B;  4P6I C;  4DRI B;  3B9Q A;  4O79 A;  3IQC A;  1D0Z A;  5T1D B;  1ZHX A;  1MMG A;  2AU5 A;  2YHS A;  2KK1 A;  3VYW A;  5K0I A;  1M2V A;  3W8I A;  1I4Y A;  3AOU A;  3KYJ A;  5A6A A;  4OIO F;  2KGO A;  1CPR A;  1H7I A;  2LK4 A;  2YVK A;  4RDA A;  1RKE A;  1H9G A;  1SYQ A;  2WZL A;  2IBF A;  3JTL O;  1WGW A;  2VCC A;  2KSF A;  2XLV A;  3KMI A;  4YT5 A;  5BQI A;  1TFK B;  5B1B C;  2R7V A;  1Q0K A;  1RXQ A;  1YVI A;  1V55 C;  2FFH A;  4MVM A;  4BEM J;  4E0I A;  2Q9B A;  3O55 A;  3EZH A;  1ZW3 A;  3OEO A;  3FOP A;  4JEA A;  4NQF A;  2XLO A;  4BG0 A;  1APC A;  1ST6 A;  1NFN A;  2HKV A;  1A7D A;  1MMA A;  2EIN C;  3CAX A;  1VLS A;  3T6B A;  1FFT C;  2J9V A;  3GOR A;  4EWC A;  1J8Y F;  2KYH A;  1M57 C;  2OOC A;  3K1H A;  3S84 A;  1C03 A;  3G4Z A;  4EUK B;  3PMR A;  4K1O A;  4G7O F;  1U89 A;  1ZYR F;  1T9K A;  4KC9 A;  3SEO A;  3W4Y A;  4DBR A;  1LI7 A;  1YZC A;  2BC5 A;  1RMV A;  3CEX A;  3IHU A;  1QQ3 A;  3L34 A;  3K7D A;  3S27 A;  1TWC A;  1JR8 A;  1I4Z A;  2P1A A;  1D0X A;  1FTS A;  1TWH A;  2NSG A;  1PCX A;  5CIV A;  4Q4Z F;  4IAO A;  2OEX A;  2OQM A;  4C3E A;  4E17 A;  4MVO A;  4ULV A;  3R7C A;  2HSQ A;  2R7T A;  4XTK A;  3RVZ A;  1R4T A;  2R02 A;  2XSE A;  1M6T A;  1K40 A;  3EZI A;  3JZ0 A;  2Q4F A;  3BEH A;  4B6I A;  2PFD A;  3AGU A;  3DKA A;  3JRM O;  3SYN A;  4NTB A;  2LSE A;  5GPG B;  5E3A A;  5JT4 A;  2ICW G;  4PK4 A;  1TWA A;  3GWL A;  2L81 A;  5AGF A;  3TK0 A;  2Q9A A;  1VB5 A;  3C62 A;  2QY9 A;  4AL0 A;  3O6X A;  2NUT A;  2WB7 A;  1QVX A;  4CJG A;  3JRT A;  4OD4 A;  5F5H A;  1SF8 A;  1D1A A;  2L9J A;  5FZT A;  3DM5 A;  4Q5S F;  5DVW A;  3HKK A;  3GEE A;  3ABK C;  4U5F E;  5COG A;  1HW2 A;  1RJ9 A;  2H7O A;  4CS8 C;  2XLD A;  4YT2 A;  4MW3 A;  1LM3 B;  1JAF A;  1MMN A;  1OCZ C;  2A6H F;  2EIJ C;  3EGD A;  3LUT B;  3L0I A;  2P6V A;  3BRJ A;  4J30 B;  4MQ9 F;  2Q7R A;  3V7O A;  2XXA B;  1OW7 A;  2DYR C;  1BR2 A;  2EPK X;  1KU2 A;  3DD7 A;  4YK5 A;  2YKZ A;  1A7V A;  4JTD B;  3MX3 A;  2OEV A;  1ORS C;  3LES A;  4Z9H A;  5JLI A;  4MND A;  2W4B A;  3SXM A;  3ASN C;  2Y69 C;  3DAF A;  5HV9 A;  2Y3H A;  1Q0G A;  2Y3G A;  3EJN A;  5KYU B;  4E7S A;  1D0Y A;  2R7U A;  2XLM A;  4XPX A;  5E33 A;  1E85 A;  2YL3 A;  4D4N A;  1MND A;  3RW0 A;  5F5F A;  4R32 A;  3HLZ A;  4N6H A;  3WG7 C;  4L6R A;  2QLA A;  3ZC4 A;  2HFI A;  1YZA A;  2HV6 A;  4DXW A;  2HV7 A;  3NKD A;  4MW8 A;  2J7P A;  2OJQ A;  2YWA A;  2R25 A;  2VCB A;  2XL8 A;  2YEV A;  3ABL C;  3QMK A;  4LDQ A;  5COM A;  1G4W R;  4I44 A;  2LFD A;  2J9W A;  4CSA C;  2XLE A;  4ER9 A;  4U5C E;  4Z9I A;  3FAP B;  2WVO A;  2GAQ A;  5BQH A;  4WGY A;  1JMW A;  3MBG A;  4LLE A;  3U0C A;  3FMS A;  1NU7 D;  2J0W A;  2EPL X;  5HSW A;  1HMD A;  3AQC A;  2VCA A;  1Z3I X;  5A6B A;  2QNL A;  2X0C A;  4GYT A;  4N06 A;  2WL8 A;  3QVZ A;  3T6G B;  4JJF A;  1N1C A;  1V54 C;  5KYX A;  3H2U A;  2AWC A;  2HS5 A;  4ULW A;  3O39 A;  3B0P A;  3W2V A;  3LLK A;  3X1O A;  1OKK A;  2H7B A;  1Z23 A;  3QW0 A;  4MS2 A;  4MVZ A;  4AE4 B;  3C8G A;  4YT4 A;  2R05 A;  4IAR A;  2OU6 A;  3KYI A;  2VAS A;  2R7S A;  3GWN A;  2KQ9 A;  1VLT A;  1A7E A;  4PJM A;  4I1O B;  4QDL A;  3H2V A;  1PV3 A;  4BJ6 A;  2IOQ A;  1PD1 A;  3ZSU A;  1MMD A;  3DMD A;  3Q6N A;  2CYD A;  3G4X A;  1SMY F;  1TR2 A;  2NUP A;  1VK5 A;  3DI5 A;  3ITF A;  3TJ5 A;  1E84 A;  1CPQ A;  4LAC B;  5JS5 A;  2A6E F;  3NKE A;  1PD0 A;  1E86 A;  1CGM E;  4XEV A;  3A9C A;  3EG9 A;  4K0D A;  1OQC A;  4U5B E;  3RQF A;  3ABM C;  3G50 A;  3IQ5 A;  4HE8 D;  1VTM P;  1OW6 A;  4JC7 A;  3RKO F;  2W4M A;  3QZC A;  3U5S A;  2GA0 A;  2LQG A;  3NYM A;  1Z63 A;  3EPV A;  2AP3 A;  1WAT A;  1ZU4 A;  5IY5 C;  1EKY A;  1FFH A;  4GQH A;  4F4B A;  4OIQ F;  3JSE O;  3KPH A;  3IQ6 A;  1CGN A;  2JPU A;  3S9O A;  2XL4 A;  1OR3 A;  3V5X A;  1LE2 A;  5L3Q A;  2LCH A;  4MVR A;  2Y39 A;  3T6J A;  5L3V A;  3ZVR A;  3IPM O;  4NY3 A;  2MWQ A;  1JPN A;  3KH2 A;  4JVS A;  1EI7 A;  3T4R A;  1TKN A;  2CCY A;  3AG4 C;  3DE8 A;  3EH2 A;  3U2L A;  4AL1 A;  4EBJ A;  5KYW B;  3SP1 A;  2Q9C A;  3N2Z B;  1QZX A;  3GAN A;  1L7C A;  4CS9 A;  2R7R A;  1ZHW A;  3OA1 A;  4QI0 A;  1XZQ A;  5BUO A;  1NLX A;  2W45 A;  4A4A A;  4DJ9 A;  4PFO A;  5KYY B;  2ASR A;  1YAR O;  2MYS A;  3VAY A;  4G78 A;  3ZWI A;  2WZF A;  4N4W A;  3QTH A;  2DGJ A;  3DAG A;  1FR0 A;  1R5I D;  4JTC B;  4BJ5 A;  2XL6 A;  3WAQ A;  2OCC C;  1H9T A;  1T6U A;  3X2Q C;  2CNW D;  5AC5 A;  3RFY A;  3E70 C;  4C7O A;  1ORJ A;  1ZHT A;  4Z9J A;  3VRC A;  3J06 A;  1LPE A;  2HJ3 A;  4ONS A;  4M63 A;  2PBE A;  2VH3 A;  3U3F A;  2UUH A;  2PX3 A;  3I5P A;  4IB4 A;  4LLC A;  1OCR C;  1K04 A;  3TUL A;  1QLE C;  3EGX A;  4J7Y A;  2A1D D;  2JX0 A;  2LIG A;  4X0R A;  2LFF A;  4PFP A;  2YLI A;  2ZXP A;  4YL0 A;  3TD7 A;  1L3P A;  5JUA A;  2XRH A;  1M2V B;  4O6M A;  3HNI A;  4XEK A;  2J45 A;  4JCZ A;  4KNW A;  3JCU Q;  4MVU A;  1HMO A;  2HMZ A;  2P7V A;  2KW3 C;  1RKE B;  1OCC C;  3NMJ A;  3KKB A;  2YZS A;  3K1I A;  5D91 A;  4AX2 A;  4HEA J;  3C7J A;  4BEJ A;  4U5G A;  5L0J A;  1T5O A;  3TQO A;  4CDY A;  3GM1 A;  3ZQV A;  3R2P A;  5EGY A;  4HFK B;  2GWW A;  1OXB A;  4JKV A;  1LIH A;  2XS1 A;  3HNK A;  1EA8 A;  1OXK A;  1Q0D A;  1Z7Q c;  2A69 F;  1YA9 A;  4I3M A;  3WOD F;  3HNJ A;  1UFB A;  1LS1 A;  1S05 A;  2EPN A;  2H7V C;  5D92 A;  3RVY A;  3V5Z A;  5BQG A;  4XPW A;  4OIR F;  3EH1 A;  1VMA A;  4MTG A;  3SXY A;  3WHN A;  5CI8 A;  3POV A;  3AJM A;  5TJ5 E;  3UGO A;  1FMW A;  5JP7 A;  4ZLD A;  4WAB A;  4DRJ B;  1GS9 A;  2O9X A;  5L0G A;  1V74 B;  1G4U S;  3M79 A;  3U3B A;  3N0T A;  3L1M A;  2IM8 A;  4JJG A;  3EFO A;  1LE4 A;  4LDK A;  1VYK A;  3S0X A;  1ZU5 A;  2NG1 A;  3LNM B;  3QVY A;  1V4A A;  4DRH B;  4E7Z A;  1YLM A;  1NSG B;  3AGT A;  1T01 A;  3DXJ F;  5E3C A;  2BE5 F;  5JSL A;  4EHP A;  2R7O A;  3FVY A;  1GQA A;  2A0U A;  4FAP B;  2DI3 A;  2XS8 A;  3K66 A;  3LS1 A;  5DQT A;  1LKX A;  3FAJ A;  2EIM C;  3I5Q A;  2P0N A;  3LEO A;  3RYL A;  1W2W A;  1SZI A;  1BR1 A;  3JYH A;  4NTA A;  4C3D A;  5FCL A;  2M64 A;  2XM4 A;  3F46 A;  2LD6 A;  4BPM A;  3QW1 A;  4KI2 A;  2VC9 A;  2E87 A;  2L6H A;  4BJ6 C;  3FHD A;  3IEE A;  3FXH A;  1O87 A;  2NUT B;  3LS0 A;  3EHN A;  3SXZ A;  3U9M A;  5EHH A;  5A6K A;  1BR4 A;  2CNW A;  3C18 A;  3T9O A;  1VOM A;  1JPJ A;  3IQT A;  3PDM P;  2AVK A;  3CZ6 A;  4GEH A;  1KNY A;  3ZIB A;  1NU9 C;  1NBB A;  3RQE A;  1HE1 A;  2CDQ A;  2L6G A;  4U9E A;  4LER A;  1DOW A;  3HNL A;  1RJ9 B;  2HSB A;  3JSZ A;  2YLG A;  1IZM A;  3MYF A;  4O6N A;  5JVE A;  2YL7 A;  1NG1 A;  1IW7 F;  3PCV A;  3UMH A;  3EGD B;  2XLW A;  1HY5 A;  1XZP A;  1ZW2 A;  4U5H A;  4WGZ A;  4PJL A;  3TJ6 A;  1ZHY A;  4DVZ A;  1Z6A A;  1C02 A;  2OG2 A;  5E2Q A;  4BJ1 A;  3M4B A;  3ECS A;  2G3V A;  3GOD A;  4XQ1 A;  5L0C A;  2XM0 A;  2QE9 A;  1A41 A;  3K33 A;  4XLP F;  4JCH A;  1NFO A;  2R7Q A;  2ZXW C;  3JYY A;  2R9R B;  2CGE A;  1QKR A;  3DJN B;  1F1M A;  3LAY A;  4DBQ A;  2PX0 A;  4H54 A;  4NCQ A;  1GM5 A;  1LS4 A;  1ZZP A;  1ZHZ A;  2JD3 A;  2YLD A;  4KBL A;  5T3W A;  4CS9 C;  4EBK A;  4E0H A;  5DS5 A;  1M56 C;  1RKC A;  3US6 A;  2EIK C;  2F22 A;  2HZ8 A;  2J9B A;  4YT8 A;  3GEI A;  4MTF A;  1ZVZ A;  5DQZ A;  1JOG A;  2PP4 A;  3W8H A;  3GEH A;  1QSP A;  4IGG A;  2IYL D;  2L7A A;  3ASO C;  5DLJ A;  5DS6 A;  5L0D A;  4BJ5 C;  1O3U A;  3U2M A;  2EPM X;  4PJJ A;  4FWV A;  3RH3 A;  3UGP A;  2HUJ A;  3W2W A;  1OR2 A;  1AUE A;  1D1C A;  3B0V C;  2GFH A;  4NC3 A;  2KC3 A;  1WAS A;  3FDQ A;  4G7H F;  1Q0F A;  2Y3D A;  4IWB A;  3U9J A;  5KYX B;  3GM2 A;  2J46 A;  2ZPA A;  3CQZ A;  4U5E E;  3ZDL A;  1CGO A;  2A68 F;  4JTA B;  1GGQ A;  4XEF A;  1QPU A;  2C03 A;  2PF4 E;  4ANJ A;  4YL1 A;  2RSE B;  1FNT c;  3AG3 C;  3C8G B;  3B71 A;  2XLH A;  3DJU B;  5AC4 A;  2W9Y A;  5EK0 A;  5B3S C;  1T6I A;  3LEV A;  3NDB B;  3EQL F;  1VYI A;  4YJW A;  1OCO C;  4U5D E;  3VM6 A;  1WN0 A;  1LVK A;  2QUP A;  3K1I C;  1FAP B;  1NZE A;  4WJ0 A;  2IXN A;  3NYL A;  4I1M A;  2R7X A;  2BL2 A;  2FAP B;  2J7P D;  2J8W A;  1YAU O;  4A2N B;  3DZA A;  2NUP B;  4N6C A;  1Y6D A;  4P9F A;  5A6J A;  1EQ1 A;  4XWJ A;  2M4E A;  5KYU A;  3EG9 B;  4O7G A;  4YWQ A;  2FGY A; 
#chains in the Genus database with same CATH homology
 1RCP A;  3M79 A;  1CPR A;  3L1M A;  3QW0 A;  3QVY A;  2XLV A;  4IAR A;  5JSL A;  1GQA A;  3C63 A;  4CX9 A;  4CDV A;  3FOP A;  4JEA A;  2XLO A;  1APC A;  3ZQY A;  1MQV A;  256B A;  2XM4 A;  1E84 A;  3QW1 A;  1CPQ A;  5JS5 A;  1YYJ A;  1E86 A;  5B3I A;  1YZC A;  2BC5 A;  3IQ5 A;  1QQ3 A;  3NMK A;  1NBB A;  2YL0 A;  4U9E A;  4D4X A;  1EKY A;  3TOM A;  3HNL A;  2YLG A;  5JVE A;  3IQ6 A;  1CGN A;  2YL7 A;  4IAQ A;  4U9D A;  4ULV A;  2XLW A;  4WGZ A;  1M6T A;  3M4B A;  2CCY A;  3DE8 A;  3ZTM A;  5JT4 A;  2XM0 A;  5AGF A;  1BBH A;  5JRA A;  3C62 A;  4CJG A;  3FOO A;  1YYX A;  2YLD A;  3ZWI A;  4CJO A;  4N4W A;  4CIP A;  4CDA A;  2XL6 A;  2XLD A;  3U8P A;  2J9B A;  1LM3 B;  1JAF A;  1E83 A;  2YL1 A;  3VRC A;  2YKZ A;  1A7V A;  4JE9 A;  5JLI A;  3DE9 A;  4IB4 A;  4NC3 A;  2YLI A;  3M4C A;  5JUA A;  2XLM A;  3HNI A;  3NMI A;  1E85 A;  2YL3 A;  4D4N A;  1CGO A;  3TOL A;  1QPU A;  4N6H A;  4L6R A;  2QLA A;  1YZA A;  3NMJ A;  2XLH A;  2XL8 A;  4CDY A;  2XLE A;  4ER9 A;  3ZQV A;  4JKV A;  3HNK A;  3ZTZ A;  4WGY A;  4JEB A;  3M15 A;  2J8W A;  3HNJ A;  1S05 A;  3QVZ A;  4EIY A;  5JP7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...