3VRCA

Crystal structure of cytochrome c' from thermochromatium tepidum
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
130
structure length
130
Chain Sequence
DLSPEEQIETRQAGYAFMAWNMGKIKANLEGEYNADQVRAAANVVAAIANSGMGALYGPGTDKNVGAVKTRAKPELFQNLEDVGKLARDLGTAANALAAAAATGEANAVKSAFADVGAACKACHQKYRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c'
publication title Structure Analysis and Comparative Characterization of the Cytochrome c' and Flavocytochrome c from Thermophilic Purple Photosynthetic Bacterium Thermochromatium tepidum
pubmed doi rcsb
molecule tags Electron transport
total genus 56
structure length 130
sequence length 130
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 3vrcA00
1NBBA 4CDYA 1A7VA 3TOMA 4IAQA 3HNJA 1E85A 3NMKA 5JSLA 3M4CA 1YYXA 5JP7A 4JEAA 4IARA 4ULVA 3ZQVA 1QPUA 2J8WA 4CX9A 1CGOA 3HNLA 4L6RA 3HNIA 2CCYA 3QW0A 3HNKA 3C63A 3NMJA 2BC5A 3FOPA 1CPQA 5JT4A 4U9DA 3ZWIA 1YYJA 3M4BA 5JLIA 3M79A 4D4XA 3FOOA 3IQ5A 5JRAA 2XM0A 5B3IA 4JEBA 3IQ6A 2XLDA 5AGFA 2XLMA 4EIYA 2YKZA 1YZAA 2XLOA 3ZTZA 5JS5A 1E86A 2XM4A 4U9EA 2YL1A 2YLGA 1S05A 1QQ3A 4CJOA 3ZTMA 1CPRA 256BA 4N4WA 3U8PA 4WGZA 3QW1A 5JVEA 2YL3A 2XLEA 4CDVA 3L1MA 3C62A 2XLVA 1RCPA 2XLHA 1LM3B 4JE9A 2YLIA 2J9BA 1CGNA 1GQAA 3ZQYA 4WGYA 3QVYA 3NMIA 3QVZA 1MQVA 4IB4A 4NC3A 2YL7A 1JAFA 2XLWA 1BBHA 3VRCA 1E83A 3DE9A 1APCA 2XL6A 2QLAA 3TOLA 1M6TA 3DE8A 1YZCA 4JKVA 2XL8A 4D4NA 2YLDA 1E84A 2YL0A 3M15A 4CDAA 4CIPA 4N6HA 5JUAA 4CJGA 4ER9A 1EKYA
chains in the Genus database with same CATH superfamily
3TQOA 2EPLX 3EGXA 2LK4A 1SMYF 2Q3TA 2H7BA 3SXYA 1A7VA 1M56C 2VASA 2YVKA 3NRHA 4YK5A 3HNJA 3TOMA 4EHPA 4EKWA 1VMAA 3NMKA 2YHSA 4G7HF 3MLGA 1TQGA 2WVNA 4OIQF 1VOMA 4YL0A 5D91A 4CSAC 1MMGA 3I4UA 5E3AA 3T9OA 3ITFA 1XZQA 1ST6A 2WB7A 2HV7A 1AVOB 1ZVZA 3CSKA 1I4ZA 4GEHA 2L6GA 2L81A 3O39A 4HFKB 4W8PA 5A6BA 2EPKX 4Q4ZF 1CGME 5KYUA 1CGOA 1LE2A 5COGA 3B0UX 1NZEA 3GODA 1XWJA 3LUTB 4JVSA 1OR3A 4G7ZF 2OEVA 3N24A 4DRJB 2AWCA 3F46A 2QE9A 2L6FA 3O6XA 4MVUA 1XZPA 2BC5A 4G0HA 3W4YA 2P1AA 2EINC 1CPQA 1ZHXA 5KYWA 3U9MA 1YYJA 3OEOA 2CNWA 5L3QA 1TFKB 1TKNA 3MFNA 2J9VA 1G5ZA 2CYDA 3I5PA 3M79A 3J06A 3DI5A 1DOWA 4CDYA 4LDKA 3FOOA 3RKOF 5JRAA 1OCRC 5B3IA 4MVQA 4RD9A 1T9KA 1UG7A 2KQ9A 3FMSA 3FDQA 3IQ6A 3EGDA 1H6GA 3JT1A 4OIPF 2WL8A 4JW1A 2FGYA 3FAPB 3R7CA 1A0BA 3ZIBA 1ORSC 2R05A 2VB6A 1YZAA 1ZU4A 4I44A 2CDQA 1A7DA 2DI3A 3FAJA 1NU7D 2L9JA 4CIHA 5JS5A 1E86A 1JPJA 3KYJA 1WTYA 2HUJA 4OIRF 5HSWA 3H65A 4U9EA 4LDRA 4BEJA 2YL1A 3FVYA 3JZ0A 4E7SA 4XEVA 2R7OA 3S29A 1FFHA 3B0PA 5A69A 5A6BD 3K1HA 5DQZA 3C8GD 3CAXA 3EG9B 256BA 1HMOA 2HSBA 1I5NA 1YA7O 2KGOA 3EH2A 1LS1A 3NYMA 4WGZA 4AE4A 5JVEA 2EPMX 2PF4E 3QTHA 2LFDA 2HJ3A 2M64A 3JCUQ 4O79A 1WGWA 4ZLDA 4OD5A 4JZAA 3JYHA 3KMIA 1SYQA 1RCPA 2HZ8A 1F1MA 3SXMA 4EBKA 4JE9A 3N2ZB 4IRUA 4MW8A 2LIGA 2XS1A 4ULWA 3UGOA 2VCAA 1V55C 1DOVA 3VAYA 3LLKA 3AG4C 2RD9A 1PD0A 3SXKA 3PDMP 2YQYA 1MQVA 2HMZA 3GORA 4XLPF 1SF8A 3OA1A 1LPEA 2LFFA 4NC3A 2YL7A 1R5ID 2IXMA 1JAFA 1LI7A 1IZMA 1BBHA 4H54A 4O6MA 4AK9A 5KYXB 1H9GA 1RXQA 2E87A 2GAQA 2Y3HA 2JPUA 3DAGA 3DD7A 4LERA 4QDLA 1APCA 1AEPA 1OKKD 3G4XA 2PFDA 3C7JA 2XL6A 1Z63A 1OXKA 4CBEA 3DE8A 1HW1A 2QUPA 4C3EA 3C8GB 3K33A 4P9TA 2IOQA 1NLXA 2H8AA 2YLDA 4N06A 2OKUA 4Z9HA 4MTFA 3KPHA 3S84A 2KK1A 4MNDA 3V5ZA 1Z6AA 4MTOA 3T6JA 4CIPA 4N6HA 4Q7CA 1ZHWA 1NFNA 1D1BA 1Q0GA 1Z3IX 4ER9A 5L0CA 1FNTc 5BQIA 1TWGA 1C17M 1OW8A 2IXNA 2J46A 2LP4A 3T6GB 2MYSA 1RMVA 2OCCC 1WWPA 2Q9BA 1NBBA 3KKBA 2WVQA 3NYLA 3DWWA 5B1AC 1W2WA 2DB4A 4IAQA 2OOCA 1FMVA 4BG0A 5FCLA 1E85A 3EQLF 4KC9A 2YRFA 1LI5A 1KU2A 1BR2A 2NUTB 1RJ9A 2QNLA 3M4CA 1YYXA 5JP7A 4JEAA 1D0YA 1OR2A 2A6HF 2WVOA 1JR8A 2NSGA 4IARA 4ULVA 5B3SC 4Q5SF 3ZQVA 3ZVRA 2X0CA 1VTMP 4MVMA 3HNLA 3UMKA 1JOGA 5DVWA 2R7TA 4I1MA 4O7GA 3LS1A 3RH3A 4R32A 4XEKA 4HE8D 1EA8A 4DVZA 2D4UA 2OJQA 5KYYB 5CI9A 3EFOA 3G50A 2O9XA 1SZIA 4QI2A 2G62A 1V4AA 2Z15A 2CW0F 3FOPA 4BEMJ 2NUPA 3SP1A 3FXHA 4U9DA 3R2PA 1MNEA 1G4US 3A11A 4K1OA 4XEFA 1GS9A 4BJTA 1J8YF 4IJJA 3AJMA 1D0XA 2XXAA 2ZXOA 4B6IA 3M4BA 2W4BA 3NG1A 3S27A 3EZIA 4D4XA 4FAPB 5L0HA 1OXBA 2VC9A 2ZXPA 2KW3C 1T6IA 3AGTA 4JRZA 4BJ6A 2G3KA 5A6AA 1AUEA 5DLJA 4P6IC 2XLDA 3IHUA 4IAOA 3AOUA 4JJFA 4C7OA 4E7ZA 1WATA 4HFFB 2X51A 1OCOC 4NTBA 2R7XA 2XLMA 4AL1A 4EIYA 1RKEA 1Q0DA 2Q9CA 1J8MF 1C03A 1UFBA 2IXPA 3KL4A 3RQFA 5TJ5E 1PD1A 3NYJA 3NDBB 1NFOA 5E3CA 1H7IA 2A0BA 5L0GA 5AC4A 2HV6A 4XWJA 1QKRA 2I15A 1S05A 2YLGA 1U6HA 4Z9JA 3S90A 1K04A 2VCBA 2DYSC 4BJ5A 4UDVA 1WASA 4E0IA 4N4WA 1A41A 1ZYRF 3CZ6A 1HE9A 3IQTA 4CDVA 3C18A 4YT8A 3U2MA 5DS6A 4OIOF 4OD4A 3SEOA 2PX0A 2PBEA 2VCCA 3PMRA 4BJ6C 2AU5A 3U0CA 2KYHA 2XLVA 3DKAA 2R7SA 1ZW3A 1LM3B 2GA0A 5L3VA 1S7ZA 1LKXA 1SR2A 3QMKA 1CGNA 1GQAA 2A68F 5EHHA 3QVYA 4WJ0A 2GWWA 2L6HA 1LE4A 1TWCA 2AVKA 3RQEA 2IXOA 4IB4A 2EIKC 1QZXA 3TJ6A 3UMHA 1M2VA 5COFA 4JCHA 2ETSA 3CQZA 1LIHA 4DOZA 1MMAA 1GGQA 4BJ5C 1E83A 4J7YA 4GYTA 4DRIB 1ZW2A 4DBRA 4G7OF 3W2VA 4QI0A 5T1DB 4C3BA 5BQGA 1FMWA 2QLAA 1M6TA 1YARO 2W45A 3US6A 2EILC 4YT4A 1JRAA 2XRHA 1YZCA 3IPMO 4JKVA 2XL8A 4U5GA 1ZZPA 1NG1A 1I4YA 3AGUA 1HMDA 2P7VA 4MVRA 3AQBA 4WABA 1YJGA 2YL0A 3DJNB 3M15A 3Q7GA 4YL3A 4CDAA 1FR0A 3N0TA 3U3BA 4PJNA 3Q6NA 1D1AA 2MWQA 3L0IA 3EHMA 4C3DA 2JD3A 5L0FA 2CNWD 2OQMA 3OWTA 1TFOB 4W8KA 1A7EA 3W8IA 2C03A 3EZHA 2OJED 1YA9A 2FAPB 2UUHA 2R9RB 4A4AA 4AX2A 3E70C 3EGXB 1T6UA 3LEOA 2KJGA 1R4TA 4K7BA 3LS0A 4N6CA 5JSLA 3B29A 1HW2A 3L34A 1O5HA 1L3PA 2KNHA 1FTSA 5B1BC 3AG1C 4YWQA 5F5HA 1NSGB 5IY5C 5COMA 1QPUA 4CX9A 2B0HA 4P9FA 4MW3A 3VYWA 1WOLA 4BPMA 3JRMO 5AC5A 3CEXA 2DGJA 4L6RA 3HNIA 1YAUO 2LCHA 1D1CA 2YWAA 3RFYA 2PP4A 4OINF 5BQHA 2R7VA 4LLCA 5T3WA 3HNKA 2HJMA 3DZAA 1ORJA 2HFIA 2ZXWC 3NMJA 4M63A 3U3FA 2LD6A 3U8PA 5JT4A 2Q4FA 1L7CA 4J30B 4NY3A 2YEVA 1TWHA 4MVZA 4E17A 5GPGB 3ZWIA 5KYNA 4ZLCA 1EI7A 3GWNA 3ABMC 4HEAJ 5KYWB 1BR4A 2IYLD 4PJLA 1Z7Qc 3WG7C 3S0XA 3EPVA 2GDCA 3A9CA 3C8ZA 3IQCA 3LLIA 1O87A 3X1OA 3UR3C 4EBBA 4EWCA 2GFHA 3LNMB 4U5CE 3M1CB 5AGFA 3UGPA 1ORYA 1U89A 2BE5F 2PNOA 4YJWA 3ABKC 4PK4A 5F28E 5FZTA 3RW0A 3SYNA 2MHRA 2YKZA 1ZHZA 4IGGA 3B9QA 2ZXRA 3JTLO 3Q6MA 3MYFA 4JURI 4XPYA 4CS7A 2A6EF 2XM4A 3LAYA 3GWLA 3ECSA 1OQCA 3MX3A 3DM9B 4JTAB 3F47A 1IW7F 2H7VC 2W4MA 5DS4A 1WN0A 4JC7A 3BRJA 1MNDA 3EG9A 2EIJC 1YVIA 5CI8A 1CPRA 3DXJF 2Y3BA 4FWVA 1B68A 3K7DA 3ZC4A 2Q00A 3H2UA 4PJMA 4KNWA 2Q9AA 4YN0B 4MTGA 4YT5A 2LSEA 3GEHA 2ZPAA 1LS4A 1OCZC 2W9YA 3DAFA 4NTAA 5DS5A 3NKEA 2DYRC 1ZHYA 2J45A 5F5FA 3NKDA 1VLTA 1V54C 3I5QA 3L1MA 4U5HA 4AE4B 3AG2C 1M57C 2NPUA 1ZU5A 2PX3A 3IEEA 2L7AA 3K66A 1OW7A 4H4KC 4U5DE 2V3CC 1Q0KA 3Q7LA 2WZFA 3EH1A 4O6NA 3ZG1A 1JMWA 1K05A 2M4EA 3ZQYA 3G4ZA 3RYLA 3RQGA 4U5BE 1PV3A 3NMIA 3K1IA 3QVZA 2A0UA 2J7PA 1M2OA 2CGEA 3WAQA 1QSPA 1HY5A 1PCXA 3T6BA 4F4BA 5HV9A 3B0VC 5KYXA 4I3MA 1RKCA 2XLWA 2IM8A 2RSEB 3PHF2 1YLMA 4DJ9A 3HKKA 1Y4CA 3DE9A 2R7WA 4XQ1A 4XPWA 2Q7RA 2OG2A 4PR9A 2WZLA 3C8GA 4LLEA 3TOLA 1FFTC 3ASOC 3E9VA 1Y6DA 1VB5A 3X2QC 4D4NA 1T5OA 1Z5ZA 3FHDA 3GM1A 4BJ1A 4PFPA 2C04A 1KNYA 4JTDB 1MMDA 4CJGA 4PJJA 4FX5A 4PACA 4JJGA 3ABLC 4FESA 5A6JA 1C02A 1N1CA 3HJCA 3JYYA 1KTMA 3U5SA 3K1IC 3KYIA 3O10A 3RVZA 2ASRA 5BUOA 2NUTA 3W2WA 4J32B 4O6YA 1NU9C 2ICWG 4NTFA 3K6BA 4NQFA 1VYIA 1H9TA 4RBNA 3GANA 2NSFA 3LEVA 5T3TA 3ASNC 1RJ9B 3QZCA 3AQCA 2KC3A 4XPXA 2J8WA 1YDIA 3U9JA 2VH3A 3V7OA 2HS5A 5E2QA 3UNGC 3LJBA 3S28A 3GM3A 5KYYA 1G4WR 2J7PD 1OKKA 3B71A 2CCYA 3QW0A 4K0DA 3SZRA 4I1OB 2UUIA 3PCVA 2XS8A 1Q0MA 1BR1A 3C63A 4ANJA 2R03A 3DJUB 2P0NA 5A6KA 3SXZA 4A2NB 4KBLA 1D0ZA 4CS9A 2NG1A 2IBFA 3EFOB 3WODF 1OCCC 1TR2A 1VLSA 3KH2A 3ZDLA 2Y69C 1T6QA 3MBGA 2NUPB 4DXWA 1G8XA 3TJ5A 2Y3DA 3RIPA 1BZ4A 1V74B 2F22A 3GEIA 4JTCB 5E33A 2R02A 1E2XA 5JLIA 3ATPA 3EHNA 2XXAB 3IQ5A 2HKVA 3ZSUA 2XM0A 4RDAA 1OW6A 3JSEO 4JEBA 1TWAA 4MVOA 5D92A 4DVYP 4J7TA 3RF3A 3VF0A 3GM2A 2LQGA 4C7OB 4YT2A 3L8IA 2HMQA 5KYUB 2Y3GA 1FAPB 3U2LA 3O55A 1RKEB 2QY9A 2XLOA 2YZSA 3ZTZA 1U0BB 2R7UA 2A69F 4G78A 3L8JA 4ONSA 4XTKA 5L0JA 1Z23A 2BL2A 2A1DD 3GEEA 1LVKA 2J0WA 2OEXA 3V5XA 2OU6A 3TD7A 4CS9C 5EGYA 1QQ3A 4CJOA 1EQ1A 3ZTMA 2XL4A 3HTKC 4XLNF 4Z9IA 4JIOA 1K40A 5CIVA 2WZGA 3QW1A 4EUKB 2YL3A 4DRHB 2AP3A 2XLEA 2ZD9A 2J9WA 3LNRA 2EIMC 3T4RA 2J9UA 4DBQA 3C62A 3RVYA 4GQHA 3H2VA 3S9OA 3AG3C 2KSFA 2XLHA 4LACB 1Q0FA 4CS8A 3UMIA 2YLIA 3EGDB 3JRTA 2J0XA 2J9BA 2XSEA 1ZHTA 2EPNA 5L0DA 5EK0A 2P61A 3BEHA 4WGYA 3V5YA 4PFOA 2R25A 4MS2A 5DQTA 4E18A 3EJNA 2G3VA 3SNHA 4JCZA 3U8VA 3TULA 4EBJA 2JX0A 4U5FE 3LESA 2P6VA 3WHNA 2H7OA 4CSAA 2FFHA 2Y39A 2R7RA 1BDJB 4MQ9F 2D5RB 3VRCA 1M2VB 3MYIA 4LDQA 2R7QA 4NCQA 3POVA 1MMNA 4E0HA 4IWBA 4KNVA 2HSQA 1GM5A 1JPNA 1O3UA 4KI2A 2QTVA 3W8HA 3VM6A 5L0IA 2AWYA 3TK0A 2V26A 1VK5A 4U5EE 2I8BA 3HLZA 4AL0A 1QVXA 2B0JA 1HE1A 1QLEC 1T01A 4MVSA 4X0RA 4CS8C 5K0IA 3JSZA 1E84A 2TMVP 2EPOA 5JUAA 3DM5A 4YL1A 1EKYA 1VYKA 3DMDA
chains in the Genus database with same CATH topology
1NBBA 4CDYA 1A7VA 3TOMA 4IAQA 3HNJA 1E85A 3NMKA 5JSLA 3M4CA 1YYXA 5JP7A 4JEAA 4IARA 4ULVA 3ZQVA 1QPUA 2J8WA 4CX9A 1CGOA 3HNLA 4L6RA 3HNIA 2CCYA 3QW0A 3HNKA 3C63A 3NMJA 2BC5A 3FOPA 1CPQA 5JT4A 4U9DA 3ZWIA 1YYJA 3M4BA 5JLIA 3M79A 4D4XA 3FOOA 3IQ5A 5JRAA 2XM0A 5B3IA 4JEBA 3IQ6A 2XLDA 5AGFA 2XLMA 4EIYA 2YKZA 1YZAA 2XLOA 3ZTZA 5JS5A 1E86A 2XM4A 4U9EA 2YL1A 2YLGA 1S05A 1QQ3A 4CJOA 3ZTMA 1CPRA 256BA 4N4WA 3U8PA 4WGZA 3QW1A 5JVEA 2YL3A 2XLEA 4CDVA 3L1MA 3C62A 2XLVA 1RCPA 2XLHA 1LM3B 4JE9A 2YLIA 2J9BA 1CGNA 1GQAA 3ZQYA 4WGYA 3QVYA 3NMIA 3QVZA 1MQVA 4IB4A 4NC3A 2YL7A 1JAFA 2XLWA 1BBHA 3VRCA 1E83A 3DE9A 1APCA 2XL6A 2QLAA 3TOLA 1M6TA 3DE8A 1YZCA 4JKVA 2XL8A 4D4NA 2YLDA 1E84A 2YL0A 3M15A 4CDAA 4CIPA 4N6HA 5JUAA 4CJGA 4ER9A 1EKYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NBB A;  4CDY A;  1A7V A;  3TOM A;  4IAQ A;  3HNJ A;  1E85 A;  3NMK A;  5JSL A;  3M4C A;  1YYX A;  5JP7 A;  4JEA A;  4IAR A;  4ULV A;  3ZQV A;  1QPU A;  2J8W A;  4CX9 A;  1CGO A;  3HNL A;  4L6R A;  3HNI A;  2CCY A;  3QW0 A;  3HNK A;  3C63 A;  3NMJ A;  2BC5 A;  3FOP A;  1CPQ A;  5JT4 A;  4U9D A;  3ZWI A;  1YYJ A;  3M4B A;  5JLI A;  3M79 A;  4D4X A;  3FOO A;  3IQ5 A;  5JRA A;  2XM0 A;  5B3I A;  4JEB A;  3IQ6 A;  2XLD A;  5AGF A;  2XLM A;  4EIY A;  2YKZ A;  1YZA A;  2XLO A;  3ZTZ A;  5JS5 A;  1E86 A;  2XM4 A;  4U9E A;  2YL1 A;  2YLG A;  1S05 A;  1QQ3 A;  4CJO A;  3ZTM A;  1CPR A;  256B A;  4N4W A;  3U8P A;  4WGZ A;  3QW1 A;  5JVE A;  2YL3 A;  2XLE A;  4CDV A;  3L1M A;  3C62 A;  2XLV A;  1RCP A;  2XLH A;  1LM3 B;  4JE9 A;  2YLI A;  2J9B A;  1CGN A;  1GQA A;  3ZQY A;  4WGY A;  3QVY A;  3NMI A;  3QVZ A;  1MQV A;  4IB4 A;  4NC3 A;  2YL7 A;  1JAF A;  2XLW A;  1BBH A;  3VRC A;  1E83 A;  3DE9 A;  1APC A;  2XL6 A;  2QLA A;  3TOL A;  1M6T A;  3DE8 A;  1YZC A;  4JKV A;  2XL8 A;  4D4N A;  2YLD A;  1E84 A;  2YL0 A;  3M15 A;  4CDA A;  4CIP A;  4N6H A;  5JUA A;  4CJG A;  4ER9 A;  1EKY A; 
#chains in the Genus database with same CATH topology
 3TQO A;  2EPL X;  3EGX A;  2LK4 A;  1SMY F;  2Q3T A;  2H7B A;  3SXY A;  1A7V A;  1M56 C;  2VAS A;  2YVK A;  3NRH A;  4YK5 A;  3HNJ A;  3TOM A;  4EHP A;  4EKW A;  1VMA A;  3NMK A;  2YHS A;  4G7H F;  3MLG A;  1TQG A;  2WVN A;  4OIQ F;  1VOM A;  4YL0 A;  5D91 A;  4CSA C;  1MMG A;  3I4U A;  5E3A A;  3T9O A;  3ITF A;  1XZQ A;  1ST6 A;  2WB7 A;  2HV7 A;  1AVO B;  1ZVZ A;  3CSK A;  1I4Z A;  4GEH A;  2L6G A;  2L81 A;  3O39 A;  4HFK B;  4W8P A;  5A6B A;  2EPK X;  4Q4Z F;  1CGM E;  5KYU A;  1CGO A;  1LE2 A;  5COG A;  3B0U X;  1NZE A;  3GOD A;  1XWJ A;  3LUT B;  4JVS A;  1OR3 A;  4G7Z F;  2OEV A;  3N24 A;  4DRJ B;  2AWC A;  3F46 A;  2QE9 A;  2L6F A;  3O6X A;  4MVU A;  1XZP A;  2BC5 A;  4G0H A;  3W4Y A;  2P1A A;  2EIN C;  1CPQ A;  1ZHX A;  5KYW A;  3U9M A;  1YYJ A;  3OEO A;  2CNW A;  5L3Q A;  1TFK B;  1TKN A;  3MFN A;  2J9V A;  1G5Z A;  2CYD A;  3I5P A;  3M79 A;  3J06 A;  3DI5 A;  1DOW A;  4CDY A;  4LDK A;  3FOO A;  3RKO F;  5JRA A;  1OCR C;  5B3I A;  4MVQ A;  4RD9 A;  1T9K A;  1UG7 A;  2KQ9 A;  3FMS A;  3FDQ A;  3IQ6 A;  3EGD A;  1H6G A;  3JT1 A;  4OIP F;  2WL8 A;  4JW1 A;  2FGY A;  3FAP B;  3R7C A;  1A0B A;  3ZIB A;  1ORS C;  2R05 A;  2VB6 A;  1YZA A;  1ZU4 A;  4I44 A;  2CDQ A;  1A7D A;  2DI3 A;  3FAJ A;  1NU7 D;  2L9J A;  4CIH A;  5JS5 A;  1E86 A;  1JPJ A;  3KYJ A;  1WTY A;  2HUJ A;  4OIR F;  5HSW A;  3H65 A;  4U9E A;  4LDR A;  4BEJ A;  2YL1 A;  3FVY A;  3JZ0 A;  4E7S A;  4XEV A;  2R7O A;  3S29 A;  1FFH A;  3B0P A;  5A69 A;  5A6B D;  3K1H A;  5DQZ A;  3C8G D;  3CAX A;  3EG9 B;  256B A;  1HMO A;  2HSB A;  1I5N A;  1YA7 O;  2KGO A;  3EH2 A;  1LS1 A;  3NYM A;  4WGZ A;  4AE4 A;  5JVE A;  2EPM X;  2PF4 E;  3QTH A;  2LFD A;  2HJ3 A;  2M64 A;  3JCU Q;  4O79 A;  1WGW A;  4ZLD A;  4OD5 A;  4JZA A;  3JYH A;  3KMI A;  1SYQ A;  1RCP A;  2HZ8 A;  1F1M A;  3SXM A;  4EBK A;  4JE9 A;  3N2Z B;  4IRU A;  4MW8 A;  2LIG A;  2XS1 A;  4ULW A;  3UGO A;  2VCA A;  1V55 C;  1DOV A;  3VAY A;  3LLK A;  3AG4 C;  2RD9 A;  1PD0 A;  3SXK A;  3PDM P;  2YQY A;  1MQV A;  2HMZ A;  3GOR A;  4XLP F;  1SF8 A;  3OA1 A;  1LPE A;  2LFF A;  4NC3 A;  2YL7 A;  1R5I D;  2IXM A;  1JAF A;  1LI7 A;  1IZM A;  1BBH A;  4H54 A;  4O6M A;  4AK9 A;  5KYX B;  1H9G A;  1RXQ A;  2E87 A;  2GAQ A;  2Y3H A;  2JPU A;  3DAG A;  3DD7 A;  4LER A;  4QDL A;  1APC A;  1AEP A;  1OKK D;  3G4X A;  2PFD A;  3C7J A;  2XL6 A;  1Z63 A;  1OXK A;  4CBE A;  3DE8 A;  1HW1 A;  2QUP A;  4C3E A;  3C8G B;  3K33 A;  4P9T A;  2IOQ A;  1NLX A;  2H8A A;  2YLD A;  4N06 A;  2OKU A;  4Z9H A;  4MTF A;  3KPH A;  3S84 A;  2KK1 A;  4MND A;  3V5Z A;  1Z6A A;  4MTO A;  3T6J A;  4CIP A;  4N6H A;  4Q7C A;  1ZHW A;  1NFN A;  1D1B A;  1Q0G A;  1Z3I X;  4ER9 A;  5L0C A;  1FNT c;  5BQI A;  1TWG A;  1C17 M;  1OW8 A;  2IXN A;  2J46 A;  2LP4 A;  3T6G B;  2MYS A;  1RMV A;  2OCC C;  1WWP A;  2Q9B A;  1NBB A;  3KKB A;  2WVQ A;  3NYL A;  3DWW A;  5B1A C;  1W2W A;  2DB4 A;  4IAQ A;  2OOC A;  1FMV A;  4BG0 A;  5FCL A;  1E85 A;  3EQL F;  4KC9 A;  2YRF A;  1LI5 A;  1KU2 A;  1BR2 A;  2NUT B;  1RJ9 A;  2QNL A;  3M4C A;  1YYX A;  5JP7 A;  4JEA A;  1D0Y A;  1OR2 A;  2A6H F;  2WVO A;  1JR8 A;  2NSG A;  4IAR A;  4ULV A;  5B3S C;  4Q5S F;  3ZQV A;  3ZVR A;  2X0C A;  1VTM P;  4MVM A;  3HNL A;  3UMK A;  1JOG A;  5DVW A;  2R7T A;  4I1M A;  4O7G A;  3LS1 A;  3RH3 A;  4R32 A;  4XEK A;  4HE8 D;  1EA8 A;  4DVZ A;  2D4U A;  2OJQ A;  5KYY B;  5CI9 A;  3EFO A;  3G50 A;  2O9X A;  1SZI A;  4QI2 A;  2G62 A;  1V4A A;  2Z15 A;  2CW0 F;  3FOP A;  4BEM J;  2NUP A;  3SP1 A;  3FXH A;  4U9D A;  3R2P A;  1MNE A;  1G4U S;  3A11 A;  4K1O A;  4XEF A;  1GS9 A;  4BJT A;  1J8Y F;  4IJJ A;  3AJM A;  1D0X A;  2XXA A;  2ZXO A;  4B6I A;  3M4B A;  2W4B A;  3NG1 A;  3S27 A;  3EZI A;  4D4X A;  4FAP B;  5L0H A;  1OXB A;  2VC9 A;  2ZXP A;  2KW3 C;  1T6I A;  3AGT A;  4JRZ A;  4BJ6 A;  2G3K A;  5A6A A;  1AUE A;  5DLJ A;  4P6I C;  2XLD A;  3IHU A;  4IAO A;  3AOU A;  4JJF A;  4C7O A;  4E7Z A;  1WAT A;  4HFF B;  2X51 A;  1OCO C;  4NTB A;  2R7X A;  2XLM A;  4AL1 A;  4EIY A;  1RKE A;  1Q0D A;  2Q9C A;  1J8M F;  1C03 A;  1UFB A;  2IXP A;  3KL4 A;  3RQF A;  5TJ5 E;  1PD1 A;  3NYJ A;  3NDB B;  1NFO A;  5E3C A;  1H7I A;  2A0B A;  5L0G A;  5AC4 A;  2HV6 A;  4XWJ A;  1QKR A;  2I15 A;  1S05 A;  2YLG A;  1U6H A;  4Z9J A;  3S90 A;  1K04 A;  2VCB A;  2DYS C;  4BJ5 A;  4UDV A;  1WAS A;  4E0I A;  4N4W A;  1A41 A;  1ZYR F;  3CZ6 A;  1HE9 A;  3IQT A;  4CDV A;  3C18 A;  4YT8 A;  3U2M A;  5DS6 A;  4OIO F;  4OD4 A;  3SEO A;  2PX0 A;  2PBE A;  2VCC A;  3PMR A;  4BJ6 C;  2AU5 A;  3U0C A;  2KYH A;  2XLV A;  3DKA A;  2R7S A;  1ZW3 A;  1LM3 B;  2GA0 A;  5L3V A;  1S7Z A;  1LKX A;  1SR2 A;  3QMK A;  1CGN A;  1GQA A;  2A68 F;  5EHH A;  3QVY A;  4WJ0 A;  2GWW A;  2L6H A;  1LE4 A;  1TWC A;  2AVK A;  3RQE A;  2IXO A;  4IB4 A;  2EIK C;  1QZX A;  3TJ6 A;  3UMH A;  1M2V A;  5COF A;  4JCH A;  2ETS A;  3CQZ A;  1LIH A;  4DOZ A;  1MMA A;  1GGQ A;  4BJ5 C;  1E83 A;  4J7Y A;  4GYT A;  4DRI B;  1ZW2 A;  4DBR A;  4G7O F;  3W2V A;  4QI0 A;  5T1D B;  4C3B A;  5BQG A;  1FMW A;  2QLA A;  1M6T A;  1YAR O;  2W45 A;  3US6 A;  2EIL C;  4YT4 A;  1JRA A;  2XRH A;  1YZC A;  3IPM O;  4JKV A;  2XL8 A;  4U5G A;  1ZZP A;  1NG1 A;  1I4Y A;  3AGU A;  1HMD A;  2P7V A;  4MVR A;  3AQB A;  4WAB A;  1YJG A;  2YL0 A;  3DJN B;  3M15 A;  3Q7G A;  4YL3 A;  4CDA A;  1FR0 A;  3N0T A;  3U3B A;  4PJN A;  3Q6N A;  1D1A A;  2MWQ A;  3L0I A;  3EHM A;  4C3D A;  2JD3 A;  5L0F A;  2CNW D;  2OQM A;  3OWT A;  1TFO B;  4W8K A;  1A7E A;  3W8I A;  2C03 A;  3EZH A;  2OJE D;  1YA9 A;  2FAP B;  2UUH A;  2R9R B;  4A4A A;  4AX2 A;  3E70 C;  3EGX B;  1T6U A;  3LEO A;  2KJG A;  1R4T A;  4K7B A;  3LS0 A;  4N6C A;  5JSL A;  3B29 A;  1HW2 A;  3L34 A;  1O5H A;  1L3P A;  2KNH A;  1FTS A;  5B1B C;  3AG1 C;  4YWQ A;  5F5H A;  1NSG B;  5IY5 C;  5COM A;  1QPU A;  4CX9 A;  2B0H A;  4P9F A;  4MW3 A;  3VYW A;  1WOL A;  4BPM A;  3JRM O;  5AC5 A;  3CEX A;  2DGJ A;  4L6R A;  3HNI A;  1YAU O;  2LCH A;  1D1C A;  2YWA A;  3RFY A;  2PP4 A;  4OIN F;  5BQH A;  2R7V A;  4LLC A;  5T3W A;  3HNK A;  2HJM A;  3DZA A;  1ORJ A;  2HFI A;  2ZXW C;  3NMJ A;  4M63 A;  3U3F A;  2LD6 A;  3U8P A;  5JT4 A;  2Q4F A;  1L7C A;  4J30 B;  4NY3 A;  2YEV A;  1TWH A;  4MVZ A;  4E17 A;  5GPG B;  3ZWI A;  5KYN A;  4ZLC A;  1EI7 A;  3GWN A;  3ABM C;  4HEA J;  5KYW B;  1BR4 A;  2IYL D;  4PJL A;  1Z7Q c;  3WG7 C;  3S0X A;  3EPV A;  2GDC A;  3A9C A;  3C8Z A;  3IQC A;  3LLI A;  1O87 A;  3X1O A;  3UR3 C;  4EBB A;  4EWC A;  2GFH A;  3LNM B;  4U5C E;  3M1C B;  5AGF A;  3UGP A;  1ORY A;  1U89 A;  2BE5 F;  2PNO A;  4YJW A;  3ABK C;  4PK4 A;  5F28 E;  5FZT A;  3RW0 A;  3SYN A;  2MHR A;  2YKZ A;  1ZHZ A;  4IGG A;  3B9Q A;  2ZXR A;  3JTL O;  3Q6M A;  3MYF A;  4JUR I;  4XPY A;  4CS7 A;  2A6E F;  2XM4 A;  3LAY A;  3GWL A;  3ECS A;  1OQC A;  3MX3 A;  3DM9 B;  4JTA B;  3F47 A;  1IW7 F;  2H7V C;  2W4M A;  5DS4 A;  1WN0 A;  4JC7 A;  3BRJ A;  1MND A;  3EG9 A;  2EIJ C;  1YVI A;  5CI8 A;  1CPR A;  3DXJ F;  2Y3B A;  4FWV A;  1B68 A;  3K7D A;  3ZC4 A;  2Q00 A;  3H2U A;  4PJM A;  4KNW A;  2Q9A A;  4YN0 B;  4MTG A;  4YT5 A;  2LSE A;  3GEH A;  2ZPA A;  1LS4 A;  1OCZ C;  2W9Y A;  3DAF A;  4NTA A;  5DS5 A;  3NKE A;  2DYR C;  1ZHY A;  2J45 A;  5F5F A;  3NKD A;  1VLT A;  1V54 C;  3I5Q A;  3L1M A;  4U5H A;  4AE4 B;  3AG2 C;  1M57 C;  2NPU A;  1ZU5 A;  2PX3 A;  3IEE A;  2L7A A;  3K66 A;  1OW7 A;  4H4K C;  4U5D E;  2V3C C;  1Q0K A;  3Q7L A;  2WZF A;  3EH1 A;  4O6N A;  3ZG1 A;  1JMW A;  1K05 A;  2M4E A;  3ZQY A;  3G4Z A;  3RYL A;  3RQG A;  4U5B E;  1PV3 A;  3NMI A;  3K1I A;  3QVZ A;  2A0U A;  2J7P A;  1M2O A;  2CGE A;  3WAQ A;  1QSP A;  1HY5 A;  1PCX A;  3T6B A;  4F4B A;  5HV9 A;  3B0V C;  5KYX A;  4I3M A;  1RKC A;  2XLW A;  2IM8 A;  2RSE B;  3PHF 2;  1YLM A;  4DJ9 A;  3HKK A;  1Y4C A;  3DE9 A;  2R7W A;  4XQ1 A;  4XPW A;  2Q7R A;  2OG2 A;  4PR9 A;  2WZL A;  3C8G A;  4LLE A;  3TOL A;  1FFT C;  3ASO C;  3E9V A;  1Y6D A;  1VB5 A;  3X2Q C;  4D4N A;  1T5O A;  1Z5Z A;  3FHD A;  3GM1 A;  4BJ1 A;  4PFP A;  2C04 A;  1KNY A;  4JTD B;  1MMD A;  4CJG A;  4PJJ A;  4FX5 A;  4PAC A;  4JJG A;  3ABL C;  4FES A;  5A6J A;  1C02 A;  1N1C A;  3HJC A;  3JYY A;  1KTM A;  3U5S A;  3K1I C;  3KYI A;  3O10 A;  3RVZ A;  2ASR A;  5BUO A;  2NUT A;  3W2W A;  4J32 B;  4O6Y A;  1NU9 C;  2ICW G;  4NTF A;  3K6B A;  4NQF A;  1VYI A;  1H9T A;  4RBN A;  3GAN A;  2NSF A;  3LEV A;  5T3T A;  3ASN C;  1RJ9 B;  3QZC A;  3AQC A;  2KC3 A;  4XPX A;  2J8W A;  1YDI A;  3U9J A;  2VH3 A;  3V7O A;  2HS5 A;  5E2Q A;  3UNG C;  3LJB A;  3S28 A;  3GM3 A;  5KYY A;  1G4W R;  2J7P D;  1OKK A;  3B71 A;  2CCY A;  3QW0 A;  4K0D A;  3SZR A;  4I1O B;  2UUI A;  3PCV A;  2XS8 A;  1Q0M A;  1BR1 A;  3C63 A;  4ANJ A;  2R03 A;  3DJU B;  2P0N A;  5A6K A;  3SXZ A;  4A2N B;  4KBL A;  1D0Z A;  4CS9 A;  2NG1 A;  2IBF A;  3EFO B;  3WOD F;  1OCC C;  1TR2 A;  1VLS A;  3KH2 A;  3ZDL A;  2Y69 C;  1T6Q A;  3MBG A;  2NUP B;  4DXW A;  1G8X A;  3TJ5 A;  2Y3D A;  3RIP A;  1BZ4 A;  1V74 B;  2F22 A;  3GEI A;  4JTC B;  5E33 A;  2R02 A;  1E2X A;  5JLI A;  3ATP A;  3EHN A;  2XXA B;  3IQ5 A;  2HKV A;  3ZSU A;  2XM0 A;  4RDA A;  1OW6 A;  3JSE O;  4JEB A;  1TWA A;  4MVO A;  5D92 A;  4DVY P;  4J7T A;  3RF3 A;  3VF0 A;  3GM2 A;  2LQG A;  4C7O B;  4YT2 A;  3L8I A;  2HMQ A;  5KYU B;  2Y3G A;  1FAP B;  3U2L A;  3O55 A;  1RKE B;  2QY9 A;  2XLO A;  2YZS A;  3ZTZ A;  1U0B B;  2R7U A;  2A69 F;  4G78 A;  3L8J A;  4ONS A;  4XTK A;  5L0J A;  1Z23 A;  2BL2 A;  2A1D D;  3GEE A;  1LVK A;  2J0W A;  2OEX A;  3V5X A;  2OU6 A;  3TD7 A;  4CS9 C;  5EGY A;  1QQ3 A;  4CJO A;  1EQ1 A;  3ZTM A;  2XL4 A;  3HTK C;  4XLN F;  4Z9I A;  4JIO A;  1K40 A;  5CIV A;  2WZG A;  3QW1 A;  4EUK B;  2YL3 A;  4DRH B;  2AP3 A;  2XLE A;  2ZD9 A;  2J9W A;  3LNR A;  2EIM C;  3T4R A;  2J9U A;  4DBQ A;  3C62 A;  3RVY A;  4GQH A;  3H2V A;  3S9O A;  3AG3 C;  2KSF A;  2XLH A;  4LAC B;  1Q0F A;  4CS8 A;  3UMI A;  2YLI A;  3EGD B;  3JRT A;  2J0X A;  2J9B A;  2XSE A;  1ZHT A;  2EPN A;  5L0D A;  5EK0 A;  2P61 A;  3BEH A;  4WGY A;  3V5Y A;  4PFO A;  2R25 A;  4MS2 A;  5DQT A;  4E18 A;  3EJN A;  2G3V A;  3SNH A;  4JCZ A;  3U8V A;  3TUL A;  4EBJ A;  2JX0 A;  4U5F E;  3LES A;  2P6V A;  3WHN A;  2H7O A;  4CSA A;  2FFH A;  2Y39 A;  2R7R A;  1BDJ B;  4MQ9 F;  2D5R B;  3VRC A;  1M2V B;  3MYI A;  4LDQ A;  2R7Q A;  4NCQ A;  3POV A;  1MMN A;  4E0H A;  4IWB A;  4KNV A;  2HSQ A;  1GM5 A;  1JPN A;  1O3U A;  4KI2 A;  2QTV A;  3W8H A;  3VM6 A;  5L0I A;  2AWY A;  3TK0 A;  2V26 A;  1VK5 A;  4U5E E;  2I8B A;  3HLZ A;  4AL0 A;  1QVX A;  2B0J A;  1HE1 A;  1QLE C;  1T01 A;  4MVS A;  4X0R A;  4CS8 C;  5K0I A;  3JSZ A;  1E84 A;  2TMV P;  2EPO A;  5JUA A;  3DM5 A;  4YL1 A;  1EKY A;  1VYK A;  3DMD A; 
#chains in the Genus database with same CATH homology
 1NBB A;  4CDY A;  1A7V A;  3TOM A;  4IAQ A;  3HNJ A;  1E85 A;  3NMK A;  5JSL A;  3M4C A;  1YYX A;  5JP7 A;  4JEA A;  4IAR A;  4ULV A;  3ZQV A;  1QPU A;  2J8W A;  4CX9 A;  1CGO A;  3HNL A;  4L6R A;  3HNI A;  2CCY A;  3QW0 A;  3HNK A;  3C63 A;  3NMJ A;  2BC5 A;  3FOP A;  1CPQ A;  5JT4 A;  4U9D A;  3ZWI A;  1YYJ A;  3M4B A;  5JLI A;  3M79 A;  4D4X A;  3FOO A;  3IQ5 A;  5JRA A;  2XM0 A;  5B3I A;  4JEB A;  3IQ6 A;  2XLD A;  5AGF A;  2XLM A;  4EIY A;  2YKZ A;  1YZA A;  2XLO A;  3ZTZ A;  5JS5 A;  1E86 A;  2XM4 A;  4U9E A;  2YL1 A;  2YLG A;  1S05 A;  1QQ3 A;  4CJO A;  3ZTM A;  1CPR A;  256B A;  4N4W A;  3U8P A;  4WGZ A;  3QW1 A;  5JVE A;  2YL3 A;  2XLE A;  4CDV A;  3L1M A;  3C62 A;  2XLV A;  1RCP A;  2XLH A;  1LM3 B;  4JE9 A;  2YLI A;  2J9B A;  1CGN A;  1GQA A;  3ZQY A;  4WGY A;  3QVY A;  3NMI A;  3QVZ A;  1MQV A;  4IB4 A;  4NC3 A;  2YL7 A;  1JAF A;  2XLW A;  1BBH A;  3VRC A;  1E83 A;  3DE9 A;  1APC A;  2XL6 A;  2QLA A;  3TOL A;  1M6T A;  3DE8 A;  1YZC A;  4JKV A;  2XL8 A;  4D4N A;  2YLD A;  1E84 A;  2YL0 A;  3M15 A;  4CDA A;  4CIP A;  4N6H A;  5JUA A;  4CJG A;  4ER9 A;  1EKY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...