3VRCA

Crystal structure of cytochrome c' from thermochromatium tepidum
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
130
structure length
130
Chain Sequence
DLSPEEQIETRQAGYAFMAWNMGKIKANLEGEYNADQVRAAANVVAAIANSGMGALYGPGTDKNVGAVKTRAKPELFQNLEDVGKLARDLGTAANALAAAAATGEANAVKSAFADVGAACKACHQKYRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Cytochrome c'
publication title Structure Analysis and Comparative Characterization of the Cytochrome c' and Flavocytochrome c from Thermophilic Purple Photosynthetic Bacterium Thermochromatium tepidum
pubmed doi rcsb
total genus 56
structure length 130
sequence length 130
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 3vrcA00
3QW0A 3FOPA 3U8PA 4IB4A 5JVEA 4WGZA 3TOLA 1QPUA 1E85A 1MQVA 3TOMA 3IQ6A 5JP7A 3VRCA 5JRAA 2XL8A 1EKYA 2XLDA 256BA 1CGNA 1YYXA 5JSLA 4CDAA 3C63A 3ZTMA 2YL1A 1CGOA 5JT4A 4CX9A 4JE9A 1JAFA 2XLVA 5JUAA 2YKZA 1A7VA 3ZTZA 4U9DA 2YLDA 1RCPA 5AGFA 3M4BA 2XLMA 4ULVA 1E86A 2XLHA 3IQ5A 2YLIA 4NC3A 5B3IA 3L1MA 3HNKA 1YZAA 4CJOA 4JEAA 2CCYA 4EIYA 4WGYA 1LM3B 4IARA 3HNIA 1YYJA 3C62A 3DE9A 3NMIA 3ZWIA 4D4NA 2QLAA 4IAQA 3HNJA 2YL3A 1YZCA 2XL6A 3ZQVA 4N6HA 4JKVA 5JLIA 1NBBA 4CDYA 3M79A 2YLGA 3NMKA 4D4XA 3FOOA 4CIPA 1BBHA 3DE8A 4JEBA 4N4WA 1GQAA 3QW1A 4CDVA 1APCA 1M6TA 1E83A 3QVZA 2XM0A 4U9EA 3HNLA 2J8WA 1E84A 3NMJA 2YL7A 1QQ3A 1CPQA 2XLOA 2XLWA 2BC5A 1S05A 3ZQYA 2XM4A 5JS5A 4ER9A 3M4CA 2J9BA 4L6RA 4CJGA 2YL0A 2XLEA 1CPRA 3QVYA 3M15A
chains in the Genus database with same CATH superfamily
2OG2A 3QW0A 3S9OA 2P61A 3NDBB 3CEXA 2M64A 4CS8C 2VH3A 1H6GA 3TOLA 4ONSA 2DYRC 3CAXA 2KJGA 4EBJA 2ZD9A 4MW8A 5KYUB 4YT8A 3B71A 3V5XA 5JP7A 5DQTA 3MX3A 2XXAB 4RD9A 1BR4A 3JCUQ 3VRCA 2JD3A 1UFBA 3S90A 2QNLA 5KYWB 4E7ZA 1OXBA 1HE1A 2Q9CA 4MVOA 2HS5A 1D0ZA 3U3FA 4DBRA 2FGYA 2OJQA 5K0IA 3ABMC 4O6NA 2FAPB 3EGXB 3FAPB 3Q7LA 1OCCC 4E17A 3MBGA 5F5HA 2XRHA 3EJNA 1A41A 1M56C 2GDCA 3DM5A 5DLJA 2IOQA 1FR0A 2LSEA 1HMOA 4G78A 4DOZA 1CGOA 3OEOA 3UGPA 2OU6A 3IQTA 4IJJA 2G62A 5DS4A 2KQ9A 2A6EF 2DI3A 2L7AA 2P6VA 1WATA 2A0UA 3K33A 1QLEC 4U5DE 1HMDA 3FDQA 1OXKA 2YKZA 1C02A 1R4TA 3LAYA 2OQMA 2XS8A 1VB5A 2HJ3A 1D1BA 1OKKA 1RCPA 2GWWA 3JRMO 2WVNA 2AP3A 2XLMA 3EH2A 3KYIA 3M4BA 4JZAA 3RQGA 4E0HA 5A69A 1E86A 1SYQA 2R7QA 4HFFB 5L0HA 3PDMP 4U5CE 4Q5SF 4GQHA 3WHNA 3QZCA 1T6UA 4LDKA 3ZSUA 2WZGA 3DI5A 4JW1A 4J30B 3TD7A 2QTVA 3U2LA 4G7HF 2WL8A 2Q3TA 1I4ZA 1ZHXA 3R2PA 3HTKC 4IARA 5COFA 2JX0A 2W4BA 5EGYA 1ZW3A 3LEOA 3DE9A 1T6QA 1RJ9A 2O9XA 3PCVA 1ORYA 4F4BA 1Z7Qc 2QLAA 4IWBA 4NY3A 3C8GD 3EHMA 2PFDA 5L3VA 2ZXRA 3EPVA 4OINF 3B0PA 2MHRA 4IAQA 2R7WA 2KW3C 3LS1A 5L0GA 1IZMA 5A6KA 5A6BD 3KMIA 1YA7O 4JTDB 2NG1A 3F47A 1YAUO 1YZCA 1EA8A 2XL6A 4N6HA 1BZ4A 3N0TA 4P9TA 5KYYB 1MMGA 2HSQA 3N24A 4NTAA 2CW0F 3NMKA 4CS9C 4O6MA 4WJ0A 3EZIA 2RSEB 1BBHA 2QUPA 2ETSA 4HFKB 3W2WA 3ATPA 2ICWG 2XS1A 5E3AA 2LK4A 1U6HA 2PX0A 3X2QC 1HY5A 2Q7RA 2J0WA 3K1IA 4XLNF 1S7ZA 1APCA 1Q0DA 2EIKC 1TQGA 2Q4FA 1M6TA 5KYXB 2IXOA 1I4YA 2X51A 3QVZA 1L3PA 2XM0A 2ZXWC 2WVOA 3GEEA 1B68A 1TWAA 5B1BC 3DKAA 4BJ5A 3W8IA 4BEJA 1NG1A 4QDLA 5D91A 2J9WA 2Q9AA 2EPMX 2BC5A 3RH3A 2NSGA 2XM4A 1RMVA 5JS5A 3HKKA 3KL4A 4YT2A 1ZU4A 5DS6A 5DS5A 2IYLD 2RD9A 2ZPAA 3WODF 3SEOA 2Q9BA 3T6GB 4BJ1A 3O55A 2GA0A 1AUEA 1O3UA 1H9TA 2AWCA 2YL0A 2FFHA 1FMVA 4U5EE 4DRIB 2TMVP 5AC5A 5E3CA 1VYKA 1V54C 2DGJA 1PD1A 3HJCA 5A6AA 3G4XA 1E2XA 1Z6AA 5JVEA 1D0YA 1CGME 3ABLC 1LS4A 3CZ6A 3CSKA 5D92A 2PBEA 4C3EA 3NYJA 3WAQA 1M2VA 2I8BA 1QPUA 3EZHA 1ZVZA 1MNDA 4NTFA 1MQVA 1JOGA 2MYSA 1OKKD 3GM1A 4DRJB 3EG9B 2L6HA 3MFNA 3W2VA 2OEVA 3U0CA 4W8PA 4I44A 2J9UA 4LDQA 4XWJA 1ZHZA 1Z63A 4C3BA 3DJUB 1LS1A 2UUHA 4MTGA 4LDRA 1GM5A 1EKYA 1RKEB 2XLDA 3L8JA 2LD6A 3KPHA 1KNYA 3DWWA 3RQFA 3IQCA 4YL0A 3S84A 1VLSA 256BA 2GAQA 2IXPA 4KNWA 1CGNA 2CDQA 1JPNA 1YYXA 2A1DD 2V26A 5JSLA 3RF3A 3SP1A 3C63A 3JSEO 1KTMA 3ZTMA 2R7OA 2H7VC 3UMIA 1O87A 3Q7GA 4CS7A 3LNMB 3IEEA 2PNOA 4GYTA 4DVZA 4FAPB 1QKRA 3LLIA 1JAFA 1OW8A 2QY9A 4JE9A 1XWJA 2HJMA 3RIPA 5JUAA 2NUPA 2NUTB 4EWCA 3K1HA 2OEXA 1NSGB 4CS8A 1FMWA 1N1CA 3J06A 2R9RB 2YLDA 3TJ6A 1LE4A 1HW1A 2KK1A 3UMHA 2XLHA 3IQ5A 4MVUA 3MYIA 4A4AA 4NC3A 2H7OA 2Y3HA 1OCZC 3FAJA 4KI2A 2XXAA 3RW0A 3L1MA 4U5HA 1LIHA 3OA1A 1TKNA 5KYWA 3HNKA 1ZW2A 1YZAA 1K05A 5E2QA 4JEAA 3SXZA 1H9GA 2IBFA 2G3VA 1LM3B 3ITFA 3LESA 4U5FE 1JMWA 3U8VA 4G0HA 1SF8A 3C62A 3U2MA 2R7VA 3EGXA 4K0DA 1WOLA 3T9OA 5L0CA 1ZHYA 1ZU5A 3JRTA 4I1MA 1K40A 1RXQA 5DQZA 1PD0A 4FX5A 3SXKA 5L3QA 3I5PA 5L0DA 3NYMA 5JLIA 2CYDA 1OR3A 1WWPA 3BRJA 4KNVA 2YLGA 3EGDB 1U89A 2AVKA 3EHNA 3FOOA 4E7SA 1V55C 4YT4A 2ZXPA 4OD4A 1C03A 4Z9IA 2CGEA 2R7UA 4JEBA 3FHDA 3JYHA 1OW6A 3QW1A 4FWVA 4NQFA 4CDVA 1J8YF 4EBBA 4H54A 4BJTA 4BEMJ 2VCBA 5CI9A 3ZIBA 3HNLA 4BG0A 3O10A 1G4US 2EPOA 2KGOA 4JIOA 1CPQA 2XLOA 3DJNB 3W4YA 4BJ6C 2XLWA 2W9YA 4C7OB 1L7CA 4QI2A 2MWQA 1S05A 3DD7A 3LNRA 3ZQYA 1TFOB 3SYNA 4ER9A 2G3KA 1ORJA 4MW3A 3M4CA 4WABA 2J9BA 2R25A 5B1AC 5T1DB 3UMKA 4G7OF 3TK0A 4CJGA 4OIQF 3A9CA 1CPRA 3QVYA 1PV3A 3M15A 1QZXA 2IXNA 1TWCA 4JC7A 3FMSA 4PFOA 4BPMA 1OR2A 3CQZA 2A0BA 2B0HA 2L6GA 3ASNC 4O79A 4EKWA 5KYNA 2R7RA 4YN0B 4PJMA 1T5OA 1TWHA 3PHF2 1BDJB 1OW7A 1ZHWA 4CSAC 4H4KC 5CI8A 1UG7A 3K7DA 3SXYA 3GEHA 2A6HF 4CS9A 1E85A 4MVZA 5L0JA 2LIGA 2BE5F 4K7BA 2EINC 2W45A 5FZTA 1OCOC 3K66A 3SNHA 2HMQA 3JT1A 3TOMA 3U5SA 3EFOA 3E70C 4IAOA 1NLXA 5KYXA 4O7GA 3FVYA 4EUKB 2IXMA 4JCHA 4J7YA 2XL8A 4YK5A 3GWLA 3RVYA 1YVIA 1ZHTA 3U3BA 4AL1A 2Y3GA 2R7XA 1NU9C 4B6IA 4MVQA 3I4UA 2OKUA 3DAFA 2J45A 2Y3BA 1AVOB 2LQGA 2R03A 5CIVA 2H8AA 2GFHA 3H65A 3V5ZA 3DAGA 4KC9A 3V5YA 4CDAA 3L0IA 4XEFA 3AGTA 1NU7D 2E87A 3NKDA 2YL1A 3VF0A 3G4ZA 3RQEA 4LLCA 5B3SC 3DZAA 1FFHA 4CX9A 2KYHA 2P7VA 1HW2A 2D4UA 1LI7A 2HZ8A 4GEHA 5A6JA 1Y4CA 1A7VA 1C17M 2L6FA 4LACB 1MMDA 4JRZA 4PFPA 5E33A 3ZTZA 1G4WR 1Z3IX 2ASRA 3B29A 3QMKA 4LLEA 4U9DA 4ANJA 4XPXA 5BQIA 1NFOA 4MVMA 2LFFA 4PR9A 2XL4A 1YLMA 1WASA 4YT5A 3UR3C 1BR2A 2PX3A 4AE4A 1G8XA 4PK4A 1A0BA 1JRAA 3VAYA 4DXWA 1OCRC 3I5QA 1T9KA 1W2WA 1SMYF 4P9FA 1DOWA 4PACA 5BUOA 5TJ5E 3JSZA 1RKCA 4N06A 4EBKA 2Y69C 4EIYA 1RKEA 1F1MA 2CCYA 2OCCC 4PJJA 4PJLA 2EPNA 4WGYA 4X0RA 3C8GB 1VYIA 4RDAA 1YYJA 2J0XA 4OIRF 4LERA 2LP4A 3C7JA 4XPYA 5FCLA 4YL3A 1U0BB 4DBQA 1AEPA 1O5HA 3HLZA 3QTHA 4XPWA 4OD5A 1VMAA 3HNJA 3MLGA 4J32B 5T3WA 2YL3A 2I15A 3PMRA 2C03A 4NCQA 5EK0A 3LS0A 1Z5ZA 3S28A 1EI7A 4JCZA 1Y6DA 4Q7CA 4Z9JA 5IY5C 4JKVA 2LCHA 2J7PA 2NUTA 3LUTB 3KH2A 3M79A 1VOMA 3NKEA 5KYUA 2VASA 3B0UX 1LE2A 4KBLA 2NUPB 3AJMA 1LI5A 1G5ZA 4NTBA 3GORA 3AGUA 2D5RB 3O39A 2X0CA 1PCXA 1Q0KA 2M4EA 3IHUA 5F28E 3U9JA 2HFIA 3U9MA 3W8HA 4DRHB 1YARO 1MMAA 5T3TA 4AK9A 3KYJA 3LEVA 2J8WA 1E84A 1VTMP 3F46A 3RKOF 1D1AA 2R7SA 2A68F 3TQOA 1QQ3A 2ZXOA 4ZLDA 2HV7A 2W4MA 2PF4E 1Z23A 1D1CA 4MS2A 5HSWA 2C04A 1A7DA 4FESA 3VM6A 4AX2A 1TWGA 2YQYA 2EPLX 4QI0A 2OOCA 4L6RA 2XLEA 3VYWA 3TJ5A 1LKXA 3TULA 4R32A 4MNDA 3UNGC 2EPKX 2IM8A 4ULWA 1QVXA 2J46A 1SZIA 3OWTA 2Y3DA 3FOPA 1NZEA 4J7TA 3U8PA 3E9VA 4IB4A 5BQHA 4WGZA 2LFDA 2YRFA 4OIPF 3EGDA 4CIHA 1TR2A 5COMA 1FTSA 3MYFA 4MVRA 2Y39A 2J9VA 1MMNA 4I1OB 3N2ZB 3IQ6A 1FFTC 4XTKA 2WZFA 2HSBA 3C8ZA 3V7OA 5JRAA 4ZLCA 1R5ID 1V74B 3FXHA 4JVSA 3T4RA 2DB4A 4XEKA 2CNWA 4K1OA 3T6BA 2PP4A 1KU2A 3GM3A 2HV6A 4C7OA 1RJ9B 3DM9B 4HEAJ 2NPUA 2YVKA 3BEHA 4BJ6A 3DXJF 3B9QA 2H7BA 4P6IC 5L0IA 3RYLA 1LVKA 1ZZPA 3JYYA 1GGQA 3WG7C 1GS9A 2QE9A 1ST6A 2R05A 5EHHA 4MTOA 2R02A 5JT4A 1YDIA 4I3MA 5KYYA 3A11A 3B0VC 4MVSA 4U5BE 2KSFA 5BQGA 3GEIA 3NG1A 3RFYA 3ECSA 2WZLA 2XLVA 5COGA 3AG2C 4JTAB 4HE8D 1YJGA 2YEVA 1M2OA 2OJED 3UGOA 4CBEA 5HV9A 2KC3A 4N6CA 1EQ1A 1Q0MA 1V4AA 2J7PD 4O6YA 2BL2A 3AOUA 3ZVRA 1VLTA 2HMZA 5AGFA 4CSAA 1M57C 3K1IC 1MNEA 3C18A 3LJBA 4ULVA 4XQ1A 4G7ZF 3K6BA 5AC4A 2WB7A 4IGGA 2YLIA 1T01A 1WN0A 1Q0FA 2Z15A 3ABKC 3RVZA 3T6JA 3ZDLA 2VCCA 3IPMO 3S29A 3SZRA 3X1OA 1NFNA 3POVA 4BJ5C 5B3IA 1LPEA 4UDVA 3US6A 1FAPB 1YA9A 3AQCA 2HKVA 3EFOB 1T6IA 4CJOA 1XZPA 4YWQA 1IW7F 1H7IA 2XSEA 2AWYA 4Z9HA 2L9JA 3HNIA 3NMIA 2HUJA 1D0XA 1FNTc 3ZWIA 3Q6NA 4OIOF 4D4NA 1VK5A 4YL1A 3GODA 3ASOC 3SXMA 1I5NA 4E18A 2B0JA 3G50A 4XEVA 5GPGB 1JR8A 3LLKA 3EQLF 1XZQA 3DMDA 1OQCA 2F22A 3KKBA 3AG4C 4MTFA 4JJGA 3JTLO 3ZQVA 2EIJC 3L34A 2A69F 2V3CC 1NBBA 3GM2A 4RBNA 4IRUA 4CDYA 3EG9A 3H2VA 4W8KA 4D4XA 2P0NA 4PJNA 1M2VB 4CIPA 1J8MF 5L0FA 4AL0A 3S27A 4YJWA 3Q6MA 2DYSC 2UUIA 4U5GA 5F5FA 1BR1A 2YWAA 3DE8A 4N4WA 3EH1A 3R7CA 1GQAA 2Q00A 3JZ0A 3NYLA 1SR2A 2P1AA 4XLPF 2VCAA 1WGWA 2VC9A 2WVQA 3H2UA 1E83A 3AG1C 1WTYA 1K04A 2NSFA 2VB6A 3ZG1A 4U9EA 1Q0GA 2L81A 3GWNA 2EIMC 4A2NB 4AE4B 3NMJA 4M63A 1DOVA 2YL7A 4E0IA 2R7TA 3ZC4A 1JPJA 1ORSC 2CNWD 4DJ9A 3C8GA 1A7EA 3AQBA 2JPUA 4MQ9F 2AU5A 3L8IA 4JURI 2EILC 1TFKB 3GANA 3M1CB 4JTCB 5A6BA 2YZSA 1QSPA 4JJFA 4C3DA 1HE9A 5DVWA 3S0XA 4Q4ZF 3O6XA 4EHPA 3AG3C 2YHSA 4DVYP 1ZYRF 3NRHA 2KNHA
chains in the Genus database with same CATH topology
3QW0A 3FOPA 3U8PA 4IB4A 5JVEA 4WGZA 3TOLA 1QPUA 1E85A 1MQVA 3TOMA 3IQ6A 5JP7A 3VRCA 5JRAA 2XL8A 1EKYA 2XLDA 256BA 1CGNA 1YYXA 5JSLA 4CDAA 3C63A 3ZTMA 2YL1A 1CGOA 5JT4A 4CX9A 4JE9A 1JAFA 2XLVA 5JUAA 2YKZA 1A7VA 3ZTZA 4U9DA 2YLDA 1RCPA 5AGFA 3M4BA 2XLMA 4ULVA 1E86A 2XLHA 3IQ5A 2YLIA 4NC3A 5B3IA 3L1MA 3HNKA 1YZAA 4CJOA 4JEAA 2CCYA 4EIYA 4WGYA 1LM3B 4IARA 3HNIA 1YYJA 3C62A 3DE9A 3NMIA 3ZWIA 4D4NA 2QLAA 4IAQA 3HNJA 2YL3A 1YZCA 2XL6A 3ZQVA 4N6HA 4JKVA 5JLIA 1NBBA 4CDYA 3M79A 2YLGA 3NMKA 4D4XA 3FOOA 4CIPA 1BBHA 3DE8A 4JEBA 4N4WA 1GQAA 3QW1A 4CDVA 1APCA 1M6TA 1E83A 3QVZA 2XM0A 4U9EA 3HNLA 2J8WA 1E84A 3NMJA 2YL7A 1QQ3A 1CPQA 2XLOA 2XLWA 2BC5A 1S05A 3ZQYA 2XM4A 5JS5A 4ER9A 3M4CA 2J9BA 4L6RA 4CJGA 2YL0A 2XLEA 1CPRA 3QVYA 3M15A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QW0 A;  3FOP A;  3U8P A;  4IB4 A;  5JVE A;  4WGZ A;  3TOL A;  1QPU A;  1E85 A;  1MQV A;  3TOM A;  3IQ6 A;  5JP7 A;  3VRC A;  5JRA A;  2XL8 A;  1EKY A;  2XLD A;  256B A;  1CGN A;  1YYX A;  5JSL A;  4CDA A;  3C63 A;  3ZTM A;  2YL1 A;  1CGO A;  5JT4 A;  4CX9 A;  4JE9 A;  1JAF A;  2XLV A;  5JUA A;  2YKZ A;  1A7V A;  3ZTZ A;  4U9D A;  2YLD A;  1RCP A;  5AGF A;  3M4B A;  2XLM A;  4ULV A;  1E86 A;  2XLH A;  3IQ5 A;  2YLI A;  4NC3 A;  5B3I A;  3L1M A;  3HNK A;  1YZA A;  4CJO A;  4JEA A;  2CCY A;  4EIY A;  4WGY A;  1LM3 B;  4IAR A;  3HNI A;  1YYJ A;  3C62 A;  3DE9 A;  3NMI A;  3ZWI A;  4D4N A;  2QLA A;  4IAQ A;  3HNJ A;  2YL3 A;  1YZC A;  2XL6 A;  3ZQV A;  4N6H A;  4JKV A;  5JLI A;  1NBB A;  4CDY A;  3M79 A;  2YLG A;  3NMK A;  4D4X A;  3FOO A;  4CIP A;  1BBH A;  3DE8 A;  4JEB A;  4N4W A;  1GQA A;  3QW1 A;  4CDV A;  1APC A;  1M6T A;  1E83 A;  3QVZ A;  2XM0 A;  4U9E A;  3HNL A;  2J8W A;  1E84 A;  3NMJ A;  2YL7 A;  1QQ3 A;  1CPQ A;  2XLO A;  2XLW A;  2BC5 A;  1S05 A;  3ZQY A;  2XM4 A;  5JS5 A;  4ER9 A;  3M4C A;  2J9B A;  4L6R A;  4CJG A;  2YL0 A;  2XLE A;  1CPR A;  3QVY A;  3M15 A; 
#chains in the Genus database with same CATH topology
 2OG2 A;  3QW0 A;  3S9O A;  2P61 A;  3NDB B;  3CEX A;  2M64 A;  4CS8 C;  2VH3 A;  1H6G A;  3TOL A;  4ONS A;  2DYR C;  3CAX A;  2KJG A;  4EBJ A;  2ZD9 A;  4MW8 A;  5KYU B;  4YT8 A;  3B71 A;  3V5X A;  5JP7 A;  5DQT A;  3MX3 A;  2XXA B;  4RD9 A;  1BR4 A;  3JCU Q;  3VRC A;  2JD3 A;  1UFB A;  3S90 A;  2QNL A;  5KYW B;  4E7Z A;  1OXB A;  1HE1 A;  2Q9C A;  4MVO A;  2HS5 A;  1D0Z A;  3U3F A;  4DBR A;  2FGY A;  2OJQ A;  5K0I A;  3ABM C;  4O6N A;  2FAP B;  3EGX B;  3FAP B;  3Q7L A;  1OCC C;  4E17 A;  3MBG A;  5F5H A;  2XRH A;  3EJN A;  1A41 A;  1M56 C;  2GDC A;  3DM5 A;  5DLJ A;  2IOQ A;  1FR0 A;  2LSE A;  1HMO A;  4G78 A;  4DOZ A;  1CGO A;  3OEO A;  3UGP A;  2OU6 A;  3IQT A;  4IJJ A;  2G62 A;  5DS4 A;  2KQ9 A;  2A6E F;  2DI3 A;  2L7A A;  2P6V A;  1WAT A;  2A0U A;  3K33 A;  1QLE C;  4U5D E;  1HMD A;  3FDQ A;  1OXK A;  2YKZ A;  1C02 A;  1R4T A;  3LAY A;  2OQM A;  2XS8 A;  1VB5 A;  2HJ3 A;  1D1B A;  1OKK A;  1RCP A;  2GWW A;  3JRM O;  2WVN A;  2AP3 A;  2XLM A;  3EH2 A;  3KYI A;  3M4B A;  4JZA A;  3RQG A;  4E0H A;  5A69 A;  1E86 A;  1SYQ A;  2R7Q A;  4HFF B;  5L0H A;  3PDM P;  4U5C E;  4Q5S F;  4GQH A;  3WHN A;  3QZC A;  1T6U A;  4LDK A;  3ZSU A;  2WZG A;  3DI5 A;  4JW1 A;  4J30 B;  3TD7 A;  2QTV A;  3U2L A;  4G7H F;  2WL8 A;  2Q3T A;  1I4Z A;  1ZHX A;  3R2P A;  3HTK C;  4IAR A;  5COF A;  2JX0 A;  2W4B A;  5EGY A;  1ZW3 A;  3LEO A;  3DE9 A;  1T6Q A;  1RJ9 A;  2O9X A;  3PCV A;  1ORY A;  4F4B A;  1Z7Q c;  2QLA A;  4IWB A;  4NY3 A;  3C8G D;  3EHM A;  2PFD A;  5L3V A;  2ZXR A;  3EPV A;  4OIN F;  3B0P A;  2MHR A;  4IAQ A;  2R7W A;  2KW3 C;  3LS1 A;  5L0G A;  1IZM A;  5A6K A;  5A6B D;  3KMI A;  1YA7 O;  4JTD B;  2NG1 A;  3F47 A;  1YAU O;  1YZC A;  1EA8 A;  2XL6 A;  4N6H A;  1BZ4 A;  3N0T A;  4P9T A;  5KYY B;  1MMG A;  2HSQ A;  3N24 A;  4NTA A;  2CW0 F;  3NMK A;  4CS9 C;  4O6M A;  4WJ0 A;  3EZI A;  2RSE B;  1BBH A;  2QUP A;  2ETS A;  4HFK B;  3W2W A;  3ATP A;  2ICW G;  2XS1 A;  5E3A A;  2LK4 A;  1U6H A;  2PX0 A;  3X2Q C;  1HY5 A;  2Q7R A;  2J0W A;  3K1I A;  4XLN F;  1S7Z A;  1APC A;  1Q0D A;  2EIK C;  1TQG A;  2Q4F A;  1M6T A;  5KYX B;  2IXO A;  1I4Y A;  2X51 A;  3QVZ A;  1L3P A;  2XM0 A;  2ZXW C;  2WVO A;  3GEE A;  1B68 A;  1TWA A;  5B1B C;  3DKA A;  4BJ5 A;  3W8I A;  4BEJ A;  1NG1 A;  4QDL A;  5D91 A;  2J9W A;  2Q9A A;  2EPM X;  2BC5 A;  3RH3 A;  2NSG A;  2XM4 A;  1RMV A;  5JS5 A;  3HKK A;  3KL4 A;  4YT2 A;  1ZU4 A;  5DS6 A;  5DS5 A;  2IYL D;  2RD9 A;  2ZPA A;  3WOD F;  3SEO A;  2Q9B A;  3T6G B;  4BJ1 A;  3O55 A;  2GA0 A;  1AUE A;  1O3U A;  1H9T A;  2AWC A;  2YL0 A;  2FFH A;  1FMV A;  4U5E E;  4DRI B;  2TMV P;  5AC5 A;  5E3C A;  1VYK A;  1V54 C;  2DGJ A;  1PD1 A;  3HJC A;  5A6A A;  3G4X A;  1E2X A;  1Z6A A;  5JVE A;  1D0Y A;  1CGM E;  3ABL C;  1LS4 A;  3CZ6 A;  3CSK A;  5D92 A;  2PBE A;  4C3E A;  3NYJ A;  3WAQ A;  1M2V A;  2I8B A;  1QPU A;  3EZH A;  1ZVZ A;  1MND A;  4NTF A;  1MQV A;  1JOG A;  2MYS A;  1OKK D;  3GM1 A;  4DRJ B;  3EG9 B;  2L6H A;  3MFN A;  3W2V A;  2OEV A;  3U0C A;  4W8P A;  4I44 A;  2J9U A;  4LDQ A;  4XWJ A;  1ZHZ A;  1Z63 A;  4C3B A;  3DJU B;  1LS1 A;  2UUH A;  4MTG A;  4LDR A;  1GM5 A;  1EKY A;  1RKE B;  2XLD A;  3L8J A;  2LD6 A;  3KPH A;  1KNY A;  3DWW A;  3RQF A;  3IQC A;  4YL0 A;  3S84 A;  1VLS A;  256B A;  2GAQ A;  2IXP A;  4KNW A;  1CGN A;  2CDQ A;  1JPN A;  1YYX A;  2A1D D;  2V26 A;  5JSL A;  3RF3 A;  3SP1 A;  3C63 A;  3JSE O;  1KTM A;  3ZTM A;  2R7O A;  2H7V C;  3UMI A;  1O87 A;  3Q7G A;  4CS7 A;  3LNM B;  3IEE A;  2PNO A;  4GYT A;  4DVZ A;  4FAP B;  1QKR A;  3LLI A;  1JAF A;  1OW8 A;  2QY9 A;  4JE9 A;  1XWJ A;  2HJM A;  3RIP A;  5JUA A;  2NUP A;  2NUT B;  4EWC A;  3K1H A;  2OEX A;  1NSG B;  4CS8 A;  1FMW A;  1N1C A;  3J06 A;  2R9R B;  2YLD A;  3TJ6 A;  1LE4 A;  1HW1 A;  2KK1 A;  3UMH A;  2XLH A;  3IQ5 A;  4MVU A;  3MYI A;  4A4A A;  4NC3 A;  2H7O A;  2Y3H A;  1OCZ C;  3FAJ A;  4KI2 A;  2XXA A;  3RW0 A;  3L1M A;  4U5H A;  1LIH A;  3OA1 A;  1TKN A;  5KYW A;  3HNK A;  1ZW2 A;  1YZA A;  1K05 A;  5E2Q A;  4JEA A;  3SXZ A;  1H9G A;  2IBF A;  2G3V A;  1LM3 B;  3ITF A;  3LES A;  4U5F E;  1JMW A;  3U8V A;  4G0H A;  1SF8 A;  3C62 A;  3U2M A;  2R7V A;  3EGX A;  4K0D A;  1WOL A;  3T9O A;  5L0C A;  1ZHY A;  1ZU5 A;  3JRT A;  4I1M A;  1K40 A;  1RXQ A;  5DQZ A;  1PD0 A;  4FX5 A;  3SXK A;  5L3Q A;  3I5P A;  5L0D A;  3NYM A;  5JLI A;  2CYD A;  1OR3 A;  1WWP A;  3BRJ A;  4KNV A;  2YLG A;  3EGD B;  1U89 A;  2AVK A;  3EHN A;  3FOO A;  4E7S A;  1V55 C;  4YT4 A;  2ZXP A;  4OD4 A;  1C03 A;  4Z9I A;  2CGE A;  2R7U A;  4JEB A;  3FHD A;  3JYH A;  1OW6 A;  3QW1 A;  4FWV A;  4NQF A;  4CDV A;  1J8Y F;  4EBB A;  4H54 A;  4BJT A;  4BEM J;  2VCB A;  5CI9 A;  3ZIB A;  3HNL A;  4BG0 A;  3O10 A;  1G4U S;  2EPO A;  2KGO A;  4JIO A;  1CPQ A;  2XLO A;  3DJN B;  3W4Y A;  4BJ6 C;  2XLW A;  2W9Y A;  4C7O B;  1L7C A;  4QI2 A;  2MWQ A;  1S05 A;  3DD7 A;  3LNR A;  3ZQY A;  1TFO B;  3SYN A;  4ER9 A;  2G3K A;  1ORJ A;  4MW3 A;  3M4C A;  4WAB A;  2J9B A;  2R25 A;  5B1A C;  5T1D B;  3UMK A;  4G7O F;  3TK0 A;  4CJG A;  4OIQ F;  3A9C A;  1CPR A;  3QVY A;  1PV3 A;  3M15 A;  1QZX A;  2IXN A;  1TWC A;  4JC7 A;  3FMS A;  4PFO A;  4BPM A;  1OR2 A;  3CQZ A;  2A0B A;  2B0H A;  2L6G A;  3ASN C;  4O79 A;  4EKW A;  5KYN A;  2R7R A;  4YN0 B;  4PJM A;  1T5O A;  1TWH A;  3PHF 2;  1BDJ B;  1OW7 A;  1ZHW A;  4CSA C;  4H4K C;  5CI8 A;  1UG7 A;  3K7D A;  3SXY A;  3GEH A;  2A6H F;  4CS9 A;  1E85 A;  4MVZ A;  5L0J A;  2LIG A;  2BE5 F;  4K7B A;  2EIN C;  2W45 A;  5FZT A;  1OCO C;  3K66 A;  3SNH A;  2HMQ A;  3JT1 A;  3TOM A;  3U5S A;  3EFO A;  3E70 C;  4IAO A;  1NLX A;  5KYX A;  4O7G A;  3FVY A;  4EUK B;  2IXM A;  4JCH A;  4J7Y A;  2XL8 A;  4YK5 A;  3GWL A;  3RVY A;  1YVI A;  1ZHT A;  3U3B A;  4AL1 A;  2Y3G A;  2R7X A;  1NU9 C;  4B6I A;  4MVQ A;  3I4U A;  2OKU A;  3DAF A;  2J45 A;  2Y3B A;  1AVO B;  2LQG A;  2R03 A;  5CIV A;  2H8A A;  2GFH A;  3H65 A;  3V5Z A;  3DAG A;  4KC9 A;  3V5Y A;  4CDA A;  3L0I A;  4XEF A;  3AGT A;  1NU7 D;  2E87 A;  3NKD A;  2YL1 A;  3VF0 A;  3G4Z A;  3RQE A;  4LLC A;  5B3S C;  3DZA A;  1FFH A;  4CX9 A;  2KYH A;  2P7V A;  1HW2 A;  2D4U A;  1LI7 A;  2HZ8 A;  4GEH A;  5A6J A;  1Y4C A;  1A7V A;  1C17 M;  2L6F A;  4LAC B;  1MMD A;  4JRZ A;  4PFP A;  5E33 A;  3ZTZ A;  1G4W R;  1Z3I X;  2ASR A;  3B29 A;  3QMK A;  4LLE A;  4U9D A;  4ANJ A;  4XPX A;  5BQI A;  1NFO A;  4MVM A;  2LFF A;  4PR9 A;  2XL4 A;  1YLM A;  1WAS A;  4YT5 A;  3UR3 C;  1BR2 A;  2PX3 A;  4AE4 A;  1G8X A;  4PK4 A;  1A0B A;  1JRA A;  3VAY A;  4DXW A;  1OCR C;  3I5Q A;  1T9K A;  1W2W A;  1SMY F;  4P9F A;  1DOW A;  4PAC A;  5BUO A;  5TJ5 E;  3JSZ A;  1RKC A;  4N06 A;  4EBK A;  2Y69 C;  4EIY A;  1RKE A;  1F1M A;  2CCY A;  2OCC C;  4PJJ A;  4PJL A;  2EPN A;  4WGY A;  4X0R A;  3C8G B;  1VYI A;  4RDA A;  1YYJ A;  2J0X A;  4OIR F;  4LER A;  2LP4 A;  3C7J A;  4XPY A;  5FCL A;  4YL3 A;  1U0B B;  4DBQ A;  1AEP A;  1O5H A;  3HLZ A;  3QTH A;  4XPW A;  4OD5 A;  1VMA A;  3HNJ A;  3MLG A;  4J32 B;  5T3W A;  2YL3 A;  2I15 A;  3PMR A;  2C03 A;  4NCQ A;  5EK0 A;  3LS0 A;  1Z5Z A;  3S28 A;  1EI7 A;  4JCZ A;  1Y6D A;  4Q7C A;  4Z9J A;  5IY5 C;  4JKV A;  2LCH A;  2J7P A;  2NUT A;  3LUT B;  3KH2 A;  3M79 A;  1VOM A;  3NKE A;  5KYU A;  2VAS A;  3B0U X;  1LE2 A;  4KBL A;  2NUP B;  3AJM A;  1LI5 A;  1G5Z A;  4NTB A;  3GOR A;  3AGU A;  2D5R B;  3O39 A;  2X0C A;  1PCX A;  1Q0K A;  2M4E A;  3IHU A;  5F28 E;  3U9J A;  2HFI A;  3U9M A;  3W8H A;  4DRH B;  1YAR O;  1MMA A;  5T3T A;  4AK9 A;  3KYJ A;  3LEV A;  2J8W A;  1E84 A;  1VTM P;  3F46 A;  3RKO F;  1D1A A;  2R7S A;  2A68 F;  3TQO A;  1QQ3 A;  2ZXO A;  4ZLD A;  2HV7 A;  2W4M A;  2PF4 E;  1Z23 A;  1D1C A;  4MS2 A;  5HSW A;  2C04 A;  1A7D A;  4FES A;  3VM6 A;  4AX2 A;  1TWG A;  2YQY A;  2EPL X;  4QI0 A;  2OOC A;  4L6R A;  2XLE A;  3VYW A;  3TJ5 A;  1LKX A;  3TUL A;  4R32 A;  4MND A;  3UNG C;  2EPK X;  2IM8 A;  4ULW A;  1QVX A;  2J46 A;  1SZI A;  3OWT A;  2Y3D A;  3FOP A;  1NZE A;  4J7T A;  3U8P A;  3E9V A;  4IB4 A;  5BQH A;  4WGZ A;  2LFD A;  2YRF A;  4OIP F;  3EGD A;  4CIH A;  1TR2 A;  5COM A;  1FTS A;  3MYF A;  4MVR A;  2Y39 A;  2J9V A;  1MMN A;  4I1O B;  3N2Z B;  3IQ6 A;  1FFT C;  4XTK A;  2WZF A;  2HSB A;  3C8Z A;  3V7O A;  5JRA A;  4ZLC A;  1R5I D;  1V74 B;  3FXH A;  4JVS A;  3T4R A;  2DB4 A;  4XEK A;  2CNW A;  4K1O A;  3T6B A;  2PP4 A;  1KU2 A;  3GM3 A;  2HV6 A;  4C7O A;  1RJ9 B;  3DM9 B;  4HEA J;  2NPU A;  2YVK A;  3BEH A;  4BJ6 A;  3DXJ F;  3B9Q A;  2H7B A;  4P6I C;  5L0I A;  3RYL A;  1LVK A;  1ZZP A;  3JYY A;  1GGQ A;  3WG7 C;  1GS9 A;  2QE9 A;  1ST6 A;  2R05 A;  5EHH A;  4MTO A;  2R02 A;  5JT4 A;  1YDI A;  4I3M A;  5KYY A;  3A11 A;  3B0V C;  4MVS A;  4U5B E;  2KSF A;  5BQG A;  3GEI A;  3NG1 A;  3RFY A;  3ECS A;  2WZL A;  2XLV A;  5COG A;  3AG2 C;  4JTA B;  4HE8 D;  1YJG A;  2YEV A;  1M2O A;  2OJE D;  3UGO A;  4CBE A;  5HV9 A;  2KC3 A;  4N6C A;  1EQ1 A;  1Q0M A;  1V4A A;  2J7P D;  4O6Y A;  2BL2 A;  3AOU A;  3ZVR A;  1VLT A;  2HMZ A;  5AGF A;  4CSA A;  1M57 C;  3K1I C;  1MNE A;  3C18 A;  3LJB A;  4ULV A;  4XQ1 A;  4G7Z F;  3K6B A;  5AC4 A;  2WB7 A;  4IGG A;  2YLI A;  1T01 A;  1WN0 A;  1Q0F A;  2Z15 A;  3ABK C;  3RVZ A;  3T6J A;  3ZDL A;  2VCC A;  3IPM O;  3S29 A;  3SZR A;  3X1O A;  1NFN A;  3POV A;  4BJ5 C;  5B3I A;  1LPE A;  4UDV A;  3US6 A;  1FAP B;  1YA9 A;  3AQC A;  2HKV A;  3EFO B;  1T6I A;  4CJO A;  1XZP A;  4YWQ A;  1IW7 F;  1H7I A;  2XSE A;  2AWY A;  4Z9H A;  2L9J A;  3HNI A;  3NMI A;  2HUJ A;  1D0X A;  1FNT c;  3ZWI A;  3Q6N A;  4OIO F;  4D4N A;  1VK5 A;  4YL1 A;  3GOD A;  3ASO C;  3SXM A;  1I5N A;  4E18 A;  2B0J A;  3G50 A;  4XEV A;  5GPG B;  1JR8 A;  3LLK A;  3EQL F;  1XZQ A;  3DMD A;  1OQC A;  2F22 A;  3KKB A;  3AG4 C;  4MTF A;  4JJG A;  3JTL O;  3ZQV A;  2EIJ C;  3L34 A;  2A69 F;  2V3C C;  1NBB A;  3GM2 A;  4RBN A;  4IRU A;  4CDY A;  3EG9 A;  3H2V A;  4W8K A;  4D4X A;  2P0N A;  4PJN A;  1M2V B;  4CIP A;  1J8M F;  5L0F A;  4AL0 A;  3S27 A;  4YJW A;  3Q6M A;  2DYS C;  2UUI A;  4U5G A;  5F5F A;  1BR1 A;  2YWA A;  3DE8 A;  4N4W A;  3EH1 A;  3R7C A;  1GQA A;  2Q00 A;  3JZ0 A;  3NYL A;  1SR2 A;  2P1A A;  4XLP F;  2VCA A;  1WGW A;  2VC9 A;  2WVQ A;  3H2U A;  1E83 A;  3AG1 C;  1WTY A;  1K04 A;  2NSF A;  2VB6 A;  3ZG1 A;  4U9E A;  1Q0G A;  2L81 A;  3GWN A;  2EIM C;  4A2N B;  4AE4 B;  3NMJ A;  4M63 A;  1DOV A;  2YL7 A;  4E0I A;  2R7T A;  3ZC4 A;  1JPJ A;  1ORS C;  2CNW D;  4DJ9 A;  3C8G A;  1A7E A;  3AQB A;  2JPU A;  4MQ9 F;  2AU5 A;  3L8I A;  4JUR I;  2EIL C;  1TFK B;  3GAN A;  3M1C B;  4JTC B;  5A6B A;  2YZS A;  1QSP A;  4JJF A;  4C3D A;  1HE9 A;  5DVW A;  3S0X A;  4Q4Z F;  3O6X A;  4EHP A;  3AG3 C;  2YHS A;  4DVY P;  1ZYR F;  3NRH A;  2KNH A; 
#chains in the Genus database with same CATH homology
 3QW0 A;  3FOP A;  3U8P A;  4IB4 A;  5JVE A;  4WGZ A;  3TOL A;  1QPU A;  1E85 A;  1MQV A;  3TOM A;  3IQ6 A;  5JP7 A;  3VRC A;  5JRA A;  2XL8 A;  1EKY A;  2XLD A;  256B A;  1CGN A;  1YYX A;  5JSL A;  4CDA A;  3C63 A;  3ZTM A;  2YL1 A;  1CGO A;  5JT4 A;  4CX9 A;  4JE9 A;  1JAF A;  2XLV A;  5JUA A;  2YKZ A;  1A7V A;  3ZTZ A;  4U9D A;  2YLD A;  1RCP A;  5AGF A;  3M4B A;  2XLM A;  4ULV A;  1E86 A;  2XLH A;  3IQ5 A;  2YLI A;  4NC3 A;  5B3I A;  3L1M A;  3HNK A;  1YZA A;  4CJO A;  4JEA A;  2CCY A;  4EIY A;  4WGY A;  1LM3 B;  4IAR A;  3HNI A;  1YYJ A;  3C62 A;  3DE9 A;  3NMI A;  3ZWI A;  4D4N A;  2QLA A;  4IAQ A;  3HNJ A;  2YL3 A;  1YZC A;  2XL6 A;  3ZQV A;  4N6H A;  4JKV A;  5JLI A;  1NBB A;  4CDY A;  3M79 A;  2YLG A;  3NMK A;  4D4X A;  3FOO A;  4CIP A;  1BBH A;  3DE8 A;  4JEB A;  4N4W A;  1GQA A;  3QW1 A;  4CDV A;  1APC A;  1M6T A;  1E83 A;  3QVZ A;  2XM0 A;  4U9E A;  3HNL A;  2J8W A;  1E84 A;  3NMJ A;  2YL7 A;  1QQ3 A;  1CPQ A;  2XLO A;  2XLW A;  2BC5 A;  1S05 A;  3ZQY A;  2XM4 A;  5JS5 A;  4ER9 A;  3M4C A;  2J9B A;  4L6R A;  4CJG A;  2YL0 A;  2XLE A;  1CPR A;  3QVY A;  3M15 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...