3LS1A

Crystal structure of cyanobacterial psbq from synechocystis sp. pcc 6803 complexed with zn2+
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
133
structure length
133
Chain Sequence
GPLGSCSSPQVEIPTTYSPEKIAQLQVYVNPIAVARDGMEKRLQGLIADQNWVDTQTYIHGPLGQLRRDMLGLASSLLPKDQDKAKTLAKEVFGHLERLDAAAKDRNGSQAKIQYQEALADFDSFLNLLPQAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sll1638 protein
publication title Crystal Structure of PsbQ from Synechocystis sp. PCC 6803 at 1.8 A: Implications for Binding and Function in Cyanobacterial Photosystem II
pubmed doi rcsb
source organism Synechocystis sp.
molecule tags Photosynthesis
total genus 50
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05757 PsbQ Oxygen evolving enhancer protein 3 (PsbQ)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.290 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3ls1A00
3LS1A 3JCUQ 1NZEA 2MWQA 1VYKA 3RFYA 3ZSUA 3LS0A
chains in the Genus database with same CATH superfamily
3KKBA 3JYYA 4MQ9F 3TK0A 4DRIB 3GODA 3C18A 2R02A 2ASRA 3A11A 3K1HA 1LE4A 2FAPB 4DBQA 5JUAA 1PD0A 5T1DB 2OCCC 1FNTc 1O5HA 1OCRC 1QZXA 4IAOA 1ZW3A 2OEVA 2YWAA 1RKCA 3EZHA 1GQAA 3H2UA 4CSAA 2EPOA 1T01A 1E83A 1CGME 2EIKC 3DM5A 3K66A 4JTCB 1YVIA 3SNHA 3S84A 3RW0A 2XXAA 3ABKC 3KYJA 2Q9BA 3M4BA 1I4YA 4RBNA 1VLSA 3UMHA 4YT5A 3UR3C 2LK4A 5KYWA 5KYYB 4YT8A 4FAPB 1FTSA 2Q4FA 3KL4A 2IBFA 3NKDA 2EPKX 4ZLCA 5L0FA 2YL7A 3O6XA 2AP3A 3AJMA 3BRJA 4EHPA 4WGZA 4EBKA 2HZ8A 2PBEA 3WG7C 1D0XA 2YL0A 2KK1A 4YT4A 1HE9A 2WVQA 1OQCA 3UMIA 1BBHA 1CGNA 1ST6A 4LDQA 3V5XA 1YARO 1FAPB 4JEAA 3AQCA 2VCBA 3LEOA 4O79A 2VH3A 1AUEA 1H7IA 4Q7CA 1TKNA 2Z15A 1K40A 5COGA 5DVWA 2OQMA 3RFYA 2X0CA 4N06A 2BE5F 4DXWA 3PCVA 3EJNA 3ITFA 2R7XA 3DXJF 3NMIA 4NC3A 1ZW2A 3U8VA 4YN0B 5BQGA 3K1IC 3SP1A 3F46A 3RVZA 3EHNA 3GEHA 4P9TA 4BJ6C 3CQZA 4CIPA 1R4TA 1YDIA 3K33A 3LNRA 1T6QA 2G3KA 1FMWA 1MMGA 4U9EA 2QUPA 1EA8A 2V26A 4EBJA 3T6GB 3LNMB 3M79A 3N2ZB 2F22A 3JSZA 4O6YA 1WWPA 4XTKA 4IAQA 3VF0A 2YKZA 3GANA 2LD6A 2XL6A 3W8IA 2MYSA 2GWWA 1VLTA 2WVNA 3EQLF 3IQ5A 2XS1A 3L34A 2A68F 1M56C 2EIMC 4FESA 2XL4A 4K0DA 1OCOC 1Z7Qc 1SZIA 2HJ3A 2J9VA 3AG3C 5L0DA 4FWVA 4JURI 1BZ4A 4XEFA 2E87A 2XLVA 2XXAB 2M64A 3G50A 5T3WA 2HUJA 2DYRC 3I5PA 1J8YF 1WGWA 2CGEA 3DKAA 4YL3A 1KTMA 2RD9A 2DYSC 5L3QA 3LLIA 1QVXA 2QE9A 2VC9A 2DB4A 2R7WA 3S29A 2EINC 3TOMA 3K1IA 4I1MA 3C8GA 4XWJA 3T6BA 2YL1A 2R9RB 2Q9CA 3TJ5A 3C8ZA 5CI8A 2R7VA 4MVOA 4O7GA 2WL8A 2HV6A 4J32B 1K05A 3K7DA 3M15A 4F4BA 1YA9A 2IM8A 2R25A 3ZIBA 3JT1A 4KC9A 4XEKA 4IGGA 2EILC 4OINF 3DAGA 2Q3TA 3M1CB 2IXPA 1AEPA 1ZHZA 2JPUA 3IPMO 1Y4CA 2A69F 2LIGA 3DAFA 4CJGA 3JRMO 3EG9A 2XM4A 5BUOA 4JCHA 1U6HA 4EIYA 1B68A 1VMAA 2WZFA 4RD9A 3ZDLA 4E7ZA 4AE4A 3LEVA 1YZAA 3LAYA 1Z63A 3T9OA 3IEEA 4G0HA 4PJNA 4OIRF 5DQZA 1V55C 1SMYF 1BR4A 4PJLA 4LLCA 4LDRA 4RDAA 5DLJA 4G78A 4NTFA 2Y3BA 2HS5A 3EPVA 4E18A 3DE9A 2ZPAA 4C3DA 4GYTA 5A6BA 3GEIA 1Q0DA 3U5SA 4U5HA 1H9GA 2R7OA 1XZPA 1VYKA 1DOWA 1SF8A 2KYHA 4ER9A 4AK9A 3U2LA 3RIPA 1O87A 3E9VA 5DS6A 3HJCA 1EKYA 1K04A 3T6JA 4IRUA 2PF4E 2WZGA 3NYMA 2XRHA 2XLWA 3L8JA 3AQBA 4CJOA 1LE2A 2YQYA 1U0BB 1TFOB 5BQHA 4IJJA 3IQCA 3AG2C 3DE8A 5B1AC 2AWYA 3ABLC 3NG1A 4YL0A 2C04A 2C03A 1FFHA 3GORA 3NKEA 2KW3C 1QPUA 2J9BA 4JJFA 3QMKA 5B3IA 2AVKA 1ZU5A 1DOVA 2RSEB 3JRTA 5JSLA 2Q00A 1L3PA 4C7OB 5F5HA 3CSKA 3L1MA 3GWLA 4CDYA 3POVA 2XLEA 1EI7A 1D1CA 4XQ1A 4MTGA 1GM5A 3A9CA 4H4KC 4KNVA 2LSEA 4I1OB 1LIHA 3FHDA 3NMJA 4GQHA 1APCA 3WAQA 1HW2A 2MHRA 3I4UA 4IWBA 3GM2A 5L3VA 5COMA 4K1OA 3FAPB 5KYUB 3Q7LA 1WATA 1SR2A 2Y69C 4YK5A 2EIJC 2OU6A 3ECSA 3IHUA 3SZRA 4G7OF 4KNWA 2IYLD 1OW6A 3W2VA 4EWCA 4WJ0A 4QI2A 4MW8A 4PJJA 2NUTB 3MYFA 3Q7GA 3O55A 2JD3A 4J7TA 1M2VA 2A6EF 4N6CA 4H54A 3TQOA 3W4YA 2J8WA 4JVSA 4CBEA 2J7PA 1Q0MA 5E33A 3ZSUA 1IZMA 1VYIA 5CI9A 3O39A 5EGYA 3S90A 3J06A 3KMIA 3I5QA 2J0WA 4G7HF 3AOUA 1M57C 4PR9A 4Z9HA 1OXBA 3EGXA 1ORYA 4NTBA 2LCHA 1ZVZA 1A41A 4LERA 5KYXB 3QZCA 4MVUA 5JT4A 2PNOA 2KSFA 1ZYRF 3CAXA 4CS8C 2XL8A 5B1BC 4BPMA 2R7QA 5A6JA 1V4AA 4G7ZF 4HFKB 4NQFA 3ASOC 3C8GD 4ANJA 2L6FA 1NZEA 1JOGA 1TWCA 2ICWG 3TD7A 4EUKB 5FCLA 2YLGA 2WZLA 2GDCA 2QNLA 3C63A 5IY5C 1LPEA 3UGOA 1M6TA 4BEMJ 2PX0A 1QKRA 3U3BA 2X51A 2Y3GA 3GEEA 3JTLO 4YJWA 5FZTA 1YYJA 3DD7A 1EQ1A 4EKWA 3B0PA 4XLNF 2O9XA 5JRAA 3C7JA 3ZWIA 4CX9A 4DBRA 1KNYA 1H6GA 3NRHA 3HNKA 2HKVA 2KC3A 1F1MA 1ZHYA 1RKEA 1U89A 1TWHA 2B0JA 3OWTA 1LVKA 4NTAA 3U9JA 1YZCA 5HSWA 4AX2A 1ORJA 1I5NA 4U5DE 2L6HA 4U5EE 2UUHA 4MTOA 2FFHA 4U5CE 4WABA 5B3SC 5KYWB 1M2OA 4JEBA 3AGTA 1NSGB 2A0BA 1VK5A 2XLMA 2VCAA 3FAJA 4PJMA 1Z23A 4M63A 2CYDA 5F5FA 2W4BA 2FGYA 2MWQA 3LLKA 3SYNA 3GM3A 3U8PA 4AL1A 4CS8A 4CS9C 5JLIA 1LS1A 4BJ6A 1HW1A 3KYIA 5L0JA 4LLEA 1LM3B 2QLAA 5A6BD 3EGDA 4Q4ZF 3IQ6A 1JRAA 4P9FA 256BA 3Q6MA 2YZSA 2HJMA 4YL1A 4QI0A 4XPXA 4BEJA 2H7VC 3WODF 3B71A 3ZC4A 2CCYA 5JVEA 1BDJB 1C17M 1N1CA 2NUPA 2XLDA 1G5ZA 4AL0A 3L0IA 1YAUO 4N6HA 1GGQA 2BL2A 2J45A 1NLXA 3SXYA 4XPWA 5DQTA 3FXHA 1FMVA 2NSFA 5BQIA 2VASA 4LACB 1Z5ZA 5A6KA 2DI3A 4E17A 2NPUA 3KPHA 2I15A 5KYNA 4PFOA 1D1AA 5E3AA 3HLZA 3LS0A 4JW1A 3B29A 2P1AA 2EPMX 3ZQVA 2W4MA 1OR3A 1QLEC 3X2QC 2A6HF 3UMKA 3VYWA 3RQGA 1ZHWA 1A0BA 2XS8A 4CIHA 5L0GA 5A6AA 1OKKA 2D4UA 1S05A 1ZU4A 5E3CA 4HFFB 4ONSA 1MNDA 1ZHXA 4OIOF 3NDBB 3V7OA 2L6GA 4IB4A 4W8PA 3FOOA 3ZVRA 3MX3A 3NYLA 3SXKA 2ETSA 3VM6A 3AG4C 3LUTB 1C02A 2W9YA 3LESA 3NMKA 1AVOB 3C8GB 2OJQA 2CDQA 1C03A 2R05A 3QVZA 4MW3A 1TWAA 5KYYA 3E70C 2LFDA 2HMZA 3EGDB 3JZ0A 3QW0A 2J7PD 5D91A 3S0XA 1G4WR 3B0VC 4OIQF 5EHHA 1OXKA 2JX0A 2NG1A 3HNJA 3HKKA 4MTFA 3NYJA 1PV3A 3B0UX 2J9UA 5HV9A 4CSAC 4DOZA 4X0RA 5JS5A 3FDQA 4JRZA 1L7CA 4C3EA 3R2PA 2NUPB 3AG1C 2YHSA 2IXNA 4QDLA 1D0YA 1HMDA 3EG9B 1R5ID 2YEVA 4JE9A 4B6IA 3GM1A 4OIPF 1LS4A 4MNDA 3SXZA 3ZTZA 1O3UA 2L81A 1CGOA 4J30B 4AE4B 1E85A 2GAQA 3BEHA 4MVRA 3QTHA 3CEXA 1JR8A 3KH2A 3X1OA 1E86A 2V3CC 1T9KA 4U5GA 1WN0A 3O10A 3S9OA 1FFTC 1BR1A 1TQGA 1V74B 2VCCA 4PACA 3TJ6A 4HEAJ 4DVYP 1Y6DA 2YLIA 2HV7A 2YRFA 2QTVA 2CNWA 1UG7A 2XSEA 4JJGA 1Q0KA 1WASA 3RF3A 1D1BA 1J8MF 2Y3HA 3U9MA 1NFNA 2AWCA 3DZAA 1QQ3A 1TR2A 2WVOA 2P61A 3AGUA 2H7BA 5COFA 2AU5A 4JC7A 3TULA 2G62A 1JPJA 3RQEA 3EH2A 1VB5A 3EFOA 4MVSA 5TJ5E 2J46A 3TOLA 1FR0A 2G3VA 3MLGA 2P7VA 3IQTA 2Q7RA 1I4ZA 2W45A 2XM0A 4O6MA 5EK0A 1E84A 4HE8D 4CDVA 1OW8A 2KQ9A 3ATPA 3RQFA 3DJNB 2VB6A 2P0NA 2ZXWC 3VRCA 4D4XA 2Q9AA 5JP7A 1V54C 1G4US 2OOCA 3JYHA 3R7CA 4R32A 3ZG1A 4KI2A 4NCQA 1NFOA 3PMRA 5T3TA 1MMAA 3DI5A 1NU9C 5DS5A 3H2VA 3W8HA 2IOQA 3FMSA 4MVMA 3ZTMA 1OR2A 3G4ZA 4JCZA 4J7YA 1PD1A 3RYLA 1TWGA 3N0TA 3T4RA 1YA7O 2B0HA 3RH3A 1RMVA 2H7OA 2KNHA 3CZ6A 1RJ9A 3FOPA 2PP4A 3HTKC 4PFPA 5CIVA 5K0IA 1G8XA 1OCCC 2CW0F 3MBGA 4L6RA 2HMQA 4A2NB 1WOLA 2LFFA 4GEHA 3ABMC 1T5OA 1KU2A 2OEXA 3EHMA 5F28E 4A4AA 1XWJA 4MVQA 4DRHB 3K6BA 1Q0GA 4O6NA 3W2WA 2LP4A 3MYIA 4E7SA 3N24A 2P6VA 4FX5A 1HMOA 3H65A 4JKVA 3UNGC 2R7SA 5E2QA 3EH1A 4JTAB 4Q5SF 2WB7A 2EPLX 1M2VB 3EZIA 2EPNA 1GS9A 3SEOA 3DMDA 3QVYA 5A69A 2L7AA 4BJ5C 1OKKD 1Z6AA 2YVKA 3HNIA 3LJBA 4U9DA 3UGPA 2NSGA 3EFOB 3EGXB 4JTDB 1JAFA 4OD5A 4ULVA 1ZHTA 2HSBA 1MMNA 1MNEA 2XLOA 1W2WA 1ORSC 4C3BA 3PDMP 2TMVP 4W8KA 1WTYA 1OCZC 3FVYA 1T6IA 4NY3A 3WHNA 5AC4A 2Y39A 2H8AA 3OEOA 1MQVA 5D92A 3M4CA 3JSEO 5L0IA 2GFHA 3DWWA 2D5RB 1IW7F 3L8IA 2PX3A 2HFIA 2KJGA 4DRJB 2GA0A 3B9QA 3Q6NA 4WGYA 3LS1A 4I44A 1NG1A 2YLDA 3DJUB 3MFNA 4K7BA 3V5ZA 1XZQA 2ZXOA 1T6UA 3C62A 4N4WA 3RVYA 1Z3IX 1OW7A 2HSQA 2L9JA 4MVZA 1RJ9B 1NBBA 4C7OA 4CS9A 1LI7A 2R7RA 1PCXA 2YL3A 1RKEB 1YYXA 2DGJA 4BJ5A 4CS7A 1BR2A 2R7UA 3V5YA 4KBLA 1H9TA 2OJED 4E0HA 4Z9IA 1JPNA 3F47A 1LI5A 1E2XA 5AGFA 2A1DD 1A7DA 1RCPA 1CPQA 3JCUQ 5KYUA 4OD4A 5AC5A 3U0CA 1S7ZA 4ZLDA 3GWNA 2J0XA 2M4EA 4JIOA 1CPRA 2CNWD 3U3FA 3HNLA 4D4NA 2IXMA 1D0ZA 1NU7D 1A7EA 1QSPA 2NUTA 4BJ1A 1TFKB 4BJTA 4JZAA 3PHF2 5GPGB 2XLHA 5L0CA 1VOMA 4DJ9A 4Z9JA 1SYQA 3OA1A 3US6A 4ULWA 5L0HA 2UUIA 4YWQA 2OG2A 4PK4A 1UFBA 2J9WA 4LDKA 2BC5A 3QW1A 4BG0A 3SXMA 1HE1A 4DVZA 4P6IC 4XLPF 1HY5A 1YJGA 4U5FE 2R03A 2A0UA 2LQGA 1A7VA 4U5BE 4E0IA 4EBBA 2ZD9A 1Q0FA 3DM9B 5KYXA 4IARA 4YT2A 3RKOF 3S27A 2QY9A 3ZQYA 2PFDA 3VAYA 1RXQA 3ASNC 2IXOA 4XPYA 5DS4A 1JMWA 1YLMA 1LKXA 4UDVA 1VTMP 2I8BA 2OKUA 1MMDA 4XEVA 4CDAA 2KGOA 2ZXRA 2Y3DA 2ZXPA 4MS2A 4I3MA 3S28A 1ZZPA 2R7TA 3U2MA 3G4XA
chains in the Genus database with same CATH topology
3KKBA 4MQ9F 3GODA 3K1HA 4DBQA 1PD0A 5T1DB 2OCCC 1O5HA 1OCRC 1QZXA 4IAOA 3EZHA 4CSAA 2EIKC 3DM5A 3K66A 3SNHA 2XXAA 3ABKC 2Q9BA 4RBNA 5KYWA 3UMHA 4YT5A 3UR3C 5KYYB 4YT8A 1FTSA 3KL4A 3NKDA 4ZLCA 3O6XA 3WG7C 1D0XA 4YT4A 2WVQA 3UMIA 1ST6A 3AQCA 4O79A 5DVWA 2VH3A 4Q7CA 1TKNA 2Z15A 3RFYA 4N06A 2BE5F 3EJNA 3ITFA 2R7XA 3DXJF 4YN0B 3K1IC 3SP1A 3F46A 3EHNA 4BJ6C 3CQZA 3LNRA 3K33A 2G3KA 1FMWA 1MMGA 2V26A 3N2ZB 3JSZA 4O6YA 4XTKA 3GANA 3W8IA 2MYSA 2WVNA 3EQLF 3L34A 2A68F 1M56C 2EIMC 4FESA 2XL4A 4K0DA 1OCOC 1SZIA 2J9VA 3AG3C 4FWVA 4JURI 2E87A 2XXAB 5T3WA 2DYRC 3I5PA 1J8YF 1WGWA 2CGEA 5L3QA 2DYSC 3LLIA 2R7WA 3S29A 2EINC 4XWJA 4I1MA 3T6BA 2Q9CA 5CI8A 2R7VA 4O7GA 2WL8A 2HV6A 4J32B 3K7DA 4F4BA 3ZIBA 3JT1A 4KC9A 2EILC 4OINF 3M1CB 3DAGA 2Q3TA 2IXPA 1ZHZA 2A69F 3DAFA 3EG9A 5BUOA 4JCHA 1VMAA 2WZFA 4RD9A 4E7ZA 4AE4A 3LEVA 3LAYA 1Z63A 3IEEA 4G0HA 4PJNA 4OIRF 5DQZA 1SMYF 1V55C 1BR4A 4PJLA 4LLCA 4RDAA 5DLJA 2Y3BA 3EPVA 2ZPAA 4C3DA 4GYTA 2R7OA 1VYKA 1SF8A 4AK9A 3RIPA 1O87A 3E9VA 5DS6A 3HJCA 3T6JA 4IRUA 2PF4E 2WZGA 3NYMA 2XRHA 3AQBA 4IJJA 3AG2C 5B1AC 3ABLC 3NG1A 2C04A 2C03A 1FFHA 3NKEA 2KW3C 4JJFA 3QMKA 1ZU5A 3JRTA 4C7OB 5F5HA 3CSKA 3POVA 1D1CA 4H4KC 4KNVA 2LSEA 4I1OB 3FHDA 3I4UA 4IWBA 5L3VA 5KYUB 3Q7LA 2Y69C 2EIJC 3ECSA 3SZRA 4G7OF 4KNWA 2IYLD 3W2VA 4EWCA 4WJ0A 4QI2A 4PJJA 2NUTB 3Q7GA 2JD3A 1M2VA 2A6EF 4JVSA 4CBEA 2J7PA 5E33A 3ZSUA 1IZMA 1VYIA 5CI9A 3O39A 5EGYA 3KMIA 3I5QA 2J0WA 4G7HF 1M57C 3EGXA 4LERA 5KYXB 3QZCA 1ZYRF 4CS8C 5B1BC 4G7ZF 2R7QA 4HFKB 3ASOC 4ANJA 1NZEA 1TWCA 3TD7A 5FCLA 2WZLA 5IY5C 3UGOA 2PX0A 2X51A 2Y3GA 4YJWA 3DD7A 3B0PA 4XLNF 2O9XA 4DBRA 3NRHA 1ZHYA 1TWHA 2B0JA 3OWTA 1LVKA 5HSWA 4AX2A 4U5DE 4U5EE 2FFHA 4U5CE 5B3SC 5KYWB 1M2OA 3FAJA 1VK5A 5F5FA 4PJMA 1Z23A 4M63A 2W4BA 2FGYA 2MWQA 3LLKA 3SYNA 4CS8A 4CS9C 1LS1A 4BJ6A 4LLEA 3EGDA 4Q4ZF 3Q6MA 2YZSA 4QI0A 4BEJA 2H7VC 3WODF 3ZC4A 2NUPA 1N1CA 3L0IA 2J45A 5DQTA 1FMVA 2VASA 4LACB 1Z5ZA 5KYNA 4PFOA 1D1AA 5E3AA 3HLZA 3LS0A 4JW1A 2W4MA 1QLEC 3X2QC 2A6HF 3UMKA 3VYWA 1ZHWA 4CIHA 1OKKA 1ZU4A 5E3CA 4HFFB 1MNDA 1ZHXA 4OIOF 3NDBB 3V7OA 3ZVRA 3MX3A 3NYLA 3AG4C 2W9YA 3LESA 2CDQA 1TWAA 5KYYA 3E70C 3EGDB 3B0VC 2J7PD 5D91A 3S0XA 4OIQF 5EHHA 2NG1A 3NYJA 3B0UX 2J9UA 4CSAC 4DOZA 4X0RA 3FDQA 4C3EA 2NUPB 3AG1C 2YHSA 2IXNA 4QDLA 1D0YA 3EG9B 4B6IA 2YEVA 4OIPF 4MNDA 2L81A 4J30B 4AE4B 3KH2A 3X1OA 2V3CC 4U5GA 1FFTC 1BR1A 4HEAJ 4DVYP 2HV7A 2QTVA 2CNWA 2XSEA 4JJGA 1D1BA 1J8MF 2Y3HA 3DZAA 1TR2A 2WVOA 2H7BA 2G62A 1JPJA 3EH2A 3EFOA 2J46A 2G3VA 3MLGA 2P7VA 2W45A 4O6MA 4HE8D 2KQ9A 3DJNB 2VB6A 2ZXWC 2Q9AA 1V54C 3JYHA 3ZG1A 4KI2A 3PMRA 5T3TA 1MMAA 1NU9C 5DS5A 3W8HA 2IOQA 1PD1A 3RYLA 1TWGA 3N0TA 3T4RA 3RH3A 2H7OA 2KNHA 3CZ6A 1RJ9A 3HTKC 2PP4A 4PFPA 1G8XA 1OCCC 2CW0F 4A2NB 4GEHA 3ABMC 1KU2A 3EHMA 3K6BA 4O6NA 3W2WA 4E7SA 3N24A 2P6VA 4FX5A 3H65A 3UNGC 2R7SA 5E2QA 3EH1A 4Q5SF 2WB7A 1M2VB 3EZIA 3SEOA 3DMDA 4BJ5C 1OKKD 1Z6AA 3LJBA 3UGPA 3EFOB 3EGXB 4OD5A 1ZHTA 1MMNA 1MNEA 4C3BA 1W2WA 4W8KA 1OCZC 3FVYA 4NY3A 2Y39A 3OEOA 5D92A 2GFHA 2D5RB 1IW7F 2PX3A 2KJGA 3B9QA 3Q6NA 3LS1A 4I44A 1NG1A 3DJUB 4K7BA 2ZXOA 1Z3IX 2L9JA 1RJ9B 4C7OA 4CS9A 2R7RA 1PCXA 2DGJA 4BJ5A 4CS7A 1BR2A 2R7UA 4KBLA 1JPNA 3F47A 2A1DD 3JCUQ 5KYUA 4OD4A 1S7ZA 4ZLDA 2J0XA 2M4EA 2CNWD 2IXMA 1NU7D 1D0ZA 4BJ1A 2NUTA 4BJTA 4JZAA 3PHF2 1VOMA 3OA1A 4ULWA 4YWQA 2OG2A 4PK4A 2J9WA 4BG0A 4DVZA 4XLPF 4P6IC 4U5FE 4U5BE 4EBBA 3DM9B 5KYXA 4YT2A 3RKOF 3S27A 2QY9A 2PFDA 3VAYA 3ASNC 5DS4A 2IXOA 1LKXA 2I8BA 1MMDA 2KGOA 2ZXRA 2Y3DA 2ZXPA 3S28A 4I3MA 2R7TA 4U5HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LS1 A;  3JCU Q;  1NZE A;  2MWQ A;  1VYK A;  3RFY A;  3ZSU A;  3LS0 A; 
#chains in the Genus database with same CATH topology
 3KKB A;  3JYY A;  4MQ9 F;  3TK0 A;  4DRI B;  3GOD A;  3C18 A;  2R02 A;  2ASR A;  3A11 A;  3K1H A;  1LE4 A;  2FAP B;  4DBQ A;  5JUA A;  1PD0 A;  5T1D B;  2OCC C;  1FNT c;  1O5H A;  1OCR C;  1QZX A;  4IAO A;  1ZW3 A;  2OEV A;  2YWA A;  1RKC A;  3EZH A;  1GQA A;  3H2U A;  4CSA A;  2EPO A;  1T01 A;  1E83 A;  1CGM E;  2EIK C;  3DM5 A;  3K66 A;  4JTC B;  1YVI A;  3SNH A;  3S84 A;  3RW0 A;  2XXA A;  3ABK C;  3KYJ A;  2Q9B A;  3M4B A;  1I4Y A;  4RBN A;  1VLS A;  3UMH A;  4YT5 A;  3UR3 C;  2LK4 A;  5KYW A;  5KYY B;  4YT8 A;  4FAP B;  1FTS A;  2Q4F A;  3KL4 A;  2IBF A;  3NKD A;  2EPK X;  4ZLC A;  5L0F A;  2YL7 A;  3O6X A;  2AP3 A;  3AJM A;  3BRJ A;  4EHP A;  4WGZ A;  4EBK A;  2HZ8 A;  2PBE A;  3WG7 C;  1D0X A;  2YL0 A;  2KK1 A;  4YT4 A;  1HE9 A;  2WVQ A;  1OQC A;  3UMI A;  1BBH A;  1CGN A;  1ST6 A;  4LDQ A;  3V5X A;  1YAR O;  1FAP B;  4JEA A;  3AQC A;  2VCB A;  3LEO A;  4O79 A;  2VH3 A;  1AUE A;  1H7I A;  4Q7C A;  1TKN A;  2Z15 A;  1K40 A;  5COG A;  5DVW A;  2OQM A;  3RFY A;  2X0C A;  4N06 A;  2BE5 F;  4DXW A;  3PCV A;  3EJN A;  3ITF A;  2R7X A;  3DXJ F;  3NMI A;  4NC3 A;  1ZW2 A;  3U8V A;  4YN0 B;  5BQG A;  3K1I C;  3SP1 A;  3F46 A;  3RVZ A;  3EHN A;  3GEH A;  4P9T A;  4BJ6 C;  3CQZ A;  4CIP A;  1R4T A;  1YDI A;  3K33 A;  3LNR A;  1T6Q A;  2G3K A;  1FMW A;  1MMG A;  4U9E A;  2QUP A;  1EA8 A;  2V26 A;  4EBJ A;  3T6G B;  3LNM B;  3M79 A;  3N2Z B;  2F22 A;  3JSZ A;  4O6Y A;  1WWP A;  4XTK A;  4IAQ A;  3VF0 A;  2YKZ A;  3GAN A;  2LD6 A;  2XL6 A;  3W8I A;  2MYS A;  2GWW A;  1VLT A;  2WVN A;  3EQL F;  3IQ5 A;  2XS1 A;  3L34 A;  2A68 F;  1M56 C;  2EIM C;  4FES A;  2XL4 A;  4K0D A;  1OCO C;  1Z7Q c;  1SZI A;  2HJ3 A;  2J9V A;  3AG3 C;  5L0D A;  4FWV A;  4JUR I;  1BZ4 A;  4XEF A;  2E87 A;  2XLV A;  2XXA B;  2M64 A;  3G50 A;  5T3W A;  2HUJ A;  2DYR C;  3I5P A;  1J8Y F;  1WGW A;  2CGE A;  3DKA A;  4YL3 A;  1KTM A;  2RD9 A;  2DYS C;  5L3Q A;  3LLI A;  1QVX A;  2QE9 A;  2VC9 A;  2DB4 A;  2R7W A;  3S29 A;  2EIN C;  3TOM A;  3K1I A;  4I1M A;  3C8G A;  4XWJ A;  3T6B A;  2YL1 A;  2R9R B;  2Q9C A;  3TJ5 A;  3C8Z A;  5CI8 A;  2R7V A;  4MVO A;  4O7G A;  2WL8 A;  2HV6 A;  4J32 B;  1K05 A;  3K7D A;  3M15 A;  4F4B A;  1YA9 A;  2IM8 A;  2R25 A;  3ZIB A;  3JT1 A;  4KC9 A;  4XEK A;  4IGG A;  2EIL C;  4OIN F;  3DAG A;  2Q3T A;  3M1C B;  2IXP A;  1AEP A;  1ZHZ A;  2JPU A;  3IPM O;  1Y4C A;  2A69 F;  2LIG A;  3DAF A;  4CJG A;  3JRM O;  3EG9 A;  2XM4 A;  5BUO A;  4JCH A;  1U6H A;  4EIY A;  1B68 A;  1VMA A;  2WZF A;  4RD9 A;  3ZDL A;  4E7Z A;  4AE4 A;  3LEV A;  1YZA A;  3LAY A;  1Z63 A;  3T9O A;  3IEE A;  4G0H A;  4PJN A;  4OIR F;  5DQZ A;  1V55 C;  1SMY F;  1BR4 A;  4PJL A;  4LLC A;  4LDR A;  4RDA A;  5DLJ A;  4G78 A;  4NTF A;  2Y3B A;  2HS5 A;  3EPV A;  4E18 A;  3DE9 A;  2ZPA A;  4C3D A;  4GYT A;  5A6B A;  3GEI A;  1Q0D A;  3U5S A;  4U5H A;  1H9G A;  2R7O A;  1XZP A;  1VYK A;  1DOW A;  1SF8 A;  2KYH A;  4ER9 A;  4AK9 A;  3U2L A;  3RIP A;  1O87 A;  3E9V A;  5DS6 A;  3HJC A;  1EKY A;  1K04 A;  3T6J A;  4IRU A;  2PF4 E;  2WZG A;  3NYM A;  2XRH A;  2XLW A;  3L8J A;  3AQB A;  4CJO A;  1LE2 A;  2YQY A;  1U0B B;  1TFO B;  5BQH A;  4IJJ A;  3IQC A;  3AG2 C;  3DE8 A;  5B1A C;  2AWY A;  3ABL C;  3NG1 A;  4YL0 A;  2C04 A;  2C03 A;  1FFH A;  3GOR A;  3NKE A;  2KW3 C;  1QPU A;  2J9B A;  4JJF A;  3QMK A;  5B3I A;  2AVK A;  1ZU5 A;  1DOV A;  2RSE B;  3JRT A;  5JSL A;  2Q00 A;  1L3P A;  4C7O B;  5F5H A;  3CSK A;  3L1M A;  3GWL A;  4CDY A;  3POV A;  2XLE A;  1EI7 A;  1D1C A;  4XQ1 A;  4MTG A;  1GM5 A;  3A9C A;  4H4K C;  4KNV A;  2LSE A;  4I1O B;  1LIH A;  3FHD A;  3NMJ A;  4GQH A;  1APC A;  3WAQ A;  1HW2 A;  2MHR A;  3I4U A;  4IWB A;  3GM2 A;  5L3V A;  5COM A;  4K1O A;  3FAP B;  5KYU B;  3Q7L A;  1WAT A;  1SR2 A;  2Y69 C;  4YK5 A;  2EIJ C;  2OU6 A;  3ECS A;  3IHU A;  3SZR A;  4G7O F;  4KNW A;  2IYL D;  1OW6 A;  3W2V A;  4EWC A;  4WJ0 A;  4QI2 A;  4MW8 A;  4PJJ A;  2NUT B;  3MYF A;  3Q7G A;  3O55 A;  2JD3 A;  4J7T A;  1M2V A;  2A6E F;  4N6C A;  4H54 A;  3TQO A;  3W4Y A;  2J8W A;  4JVS A;  4CBE A;  2J7P A;  1Q0M A;  5E33 A;  3ZSU A;  1IZM A;  1VYI A;  5CI9 A;  3O39 A;  5EGY A;  3S90 A;  3J06 A;  3KMI A;  3I5Q A;  2J0W A;  4G7H F;  3AOU A;  1M57 C;  4PR9 A;  4Z9H A;  1OXB A;  3EGX A;  1ORY A;  4NTB A;  2LCH A;  1ZVZ A;  1A41 A;  4LER A;  5KYX B;  3QZC A;  4MVU A;  5JT4 A;  2PNO A;  2KSF A;  1ZYR F;  3CAX A;  4CS8 C;  2XL8 A;  5B1B C;  4BPM A;  2R7Q A;  5A6J A;  1V4A A;  4G7Z F;  4HFK B;  4NQF A;  3ASO C;  3C8G D;  4ANJ A;  2L6F A;  1NZE A;  1JOG A;  1TWC A;  2ICW G;  3TD7 A;  4EUK B;  5FCL A;  2YLG A;  2WZL A;  2GDC A;  2QNL A;  3C63 A;  5IY5 C;  1LPE A;  3UGO A;  1M6T A;  4BEM J;  2PX0 A;  1QKR A;  3U3B A;  2X51 A;  2Y3G A;  3GEE A;  3JTL O;  4YJW A;  5FZT A;  1YYJ A;  3DD7 A;  1EQ1 A;  4EKW A;  3B0P A;  4XLN F;  2O9X A;  5JRA A;  3C7J A;  3ZWI A;  4CX9 A;  4DBR A;  1KNY A;  1H6G A;  3NRH A;  3HNK A;  2HKV A;  2KC3 A;  1F1M A;  1ZHY A;  1RKE A;  1U89 A;  1TWH A;  2B0J A;  3OWT A;  1LVK A;  4NTA A;  3U9J A;  1YZC A;  5HSW A;  4AX2 A;  1ORJ A;  1I5N A;  4U5D E;  2L6H A;  4U5E E;  2UUH A;  4MTO A;  2FFH A;  4U5C E;  4WAB A;  5B3S C;  5KYW B;  1M2O A;  4JEB A;  3AGT A;  1NSG B;  2A0B A;  1VK5 A;  2XLM A;  2VCA A;  3FAJ A;  4PJM A;  1Z23 A;  4M63 A;  2CYD A;  5F5F A;  2W4B A;  2FGY A;  2MWQ A;  3LLK A;  3SYN A;  3GM3 A;  3U8P A;  4AL1 A;  4CS8 A;  4CS9 C;  5JLI A;  1LS1 A;  4BJ6 A;  1HW1 A;  3KYI A;  5L0J A;  4LLE A;  1LM3 B;  2QLA A;  5A6B D;  3EGD A;  4Q4Z F;  3IQ6 A;  1JRA A;  4P9F A;  256B A;  3Q6M A;  2YZS A;  2HJM A;  4YL1 A;  4QI0 A;  4XPX A;  4BEJ A;  2H7V C;  3WOD F;  3B71 A;  3ZC4 A;  2CCY A;  5JVE A;  1BDJ B;  1C17 M;  1N1C A;  2NUP A;  2XLD A;  1G5Z A;  4AL0 A;  3L0I A;  1YAU O;  4N6H A;  1GGQ A;  2BL2 A;  2J45 A;  1NLX A;  3SXY A;  4XPW A;  5DQT A;  3FXH A;  1FMV A;  2NSF A;  5BQI A;  2VAS A;  4LAC B;  1Z5Z A;  5A6K A;  2DI3 A;  4E17 A;  2NPU A;  3KPH A;  2I15 A;  5KYN A;  4PFO A;  1D1A A;  5E3A A;  3HLZ A;  3LS0 A;  4JW1 A;  3B29 A;  2P1A A;  2EPM X;  3ZQV A;  2W4M A;  1OR3 A;  1QLE C;  3X2Q C;  2A6H F;  3UMK A;  3VYW A;  3RQG A;  1ZHW A;  1A0B A;  2XS8 A;  4CIH A;  5L0G A;  5A6A A;  1OKK A;  2D4U A;  1S05 A;  1ZU4 A;  5E3C A;  4HFF B;  4ONS A;  1MND A;  1ZHX A;  4OIO F;  3NDB B;  3V7O A;  2L6G A;  4IB4 A;  4W8P A;  3FOO A;  3ZVR A;  3MX3 A;  3NYL A;  3SXK A;  2ETS A;  3VM6 A;  3AG4 C;  3LUT B;  1C02 A;  2W9Y A;  3LES A;  3NMK A;  1AVO B;  3C8G B;  2OJQ A;  2CDQ A;  1C03 A;  2R05 A;  3QVZ A;  4MW3 A;  1TWA A;  5KYY A;  3E70 C;  2LFD A;  2HMZ A;  3EGD B;  3JZ0 A;  3QW0 A;  2J7P D;  5D91 A;  3S0X A;  1G4W R;  3B0V C;  4OIQ F;  5EHH A;  1OXK A;  2JX0 A;  2NG1 A;  3HNJ A;  3HKK A;  4MTF A;  3NYJ A;  1PV3 A;  3B0U X;  2J9U A;  5HV9 A;  4CSA C;  4DOZ A;  4X0R A;  5JS5 A;  3FDQ A;  4JRZ A;  1L7C A;  4C3E A;  3R2P A;  2NUP B;  3AG1 C;  2YHS A;  2IXN A;  4QDL A;  1D0Y A;  1HMD A;  3EG9 B;  1R5I D;  2YEV A;  4JE9 A;  4B6I A;  3GM1 A;  4OIP F;  1LS4 A;  4MND A;  3SXZ A;  3ZTZ A;  1O3U A;  2L81 A;  1CGO A;  4J30 B;  4AE4 B;  1E85 A;  2GAQ A;  3BEH A;  4MVR A;  3QTH A;  3CEX A;  1JR8 A;  3KH2 A;  3X1O A;  1E86 A;  2V3C C;  1T9K A;  4U5G A;  1WN0 A;  3O10 A;  3S9O A;  1FFT C;  1BR1 A;  1TQG A;  1V74 B;  2VCC A;  4PAC A;  3TJ6 A;  4HEA J;  4DVY P;  1Y6D A;  2YLI A;  2HV7 A;  2YRF A;  2QTV A;  2CNW A;  1UG7 A;  2XSE A;  4JJG A;  1Q0K A;  1WAS A;  3RF3 A;  1D1B A;  1J8M F;  2Y3H A;  3U9M A;  1NFN A;  2AWC A;  3DZA A;  1QQ3 A;  1TR2 A;  2WVO A;  2P61 A;  3AGU A;  2H7B A;  5COF A;  2AU5 A;  4JC7 A;  3TUL A;  2G62 A;  1JPJ A;  3RQE A;  3EH2 A;  1VB5 A;  3EFO A;  4MVS A;  5TJ5 E;  2J46 A;  3TOL A;  1FR0 A;  2G3V A;  3MLG A;  2P7V A;  3IQT A;  2Q7R A;  1I4Z A;  2W45 A;  2XM0 A;  4O6M A;  5EK0 A;  1E84 A;  4HE8 D;  4CDV A;  1OW8 A;  2KQ9 A;  3ATP A;  3RQF A;  3DJN B;  2VB6 A;  2P0N A;  2ZXW C;  3VRC A;  4D4X A;  2Q9A A;  5JP7 A;  1V54 C;  1G4U S;  2OOC A;  3JYH A;  3R7C A;  4R32 A;  3ZG1 A;  4KI2 A;  4NCQ A;  1NFO A;  3PMR A;  5T3T A;  1MMA A;  3DI5 A;  1NU9 C;  5DS5 A;  3H2V A;  3W8H A;  2IOQ A;  3FMS A;  4MVM A;  3ZTM A;  1OR2 A;  3G4Z A;  4JCZ A;  4J7Y A;  1PD1 A;  3RYL A;  1TWG A;  3N0T A;  3T4R A;  1YA7 O;  2B0H A;  3RH3 A;  1RMV A;  2H7O A;  2KNH A;  3CZ6 A;  1RJ9 A;  3FOP A;  2PP4 A;  3HTK C;  4PFP A;  5CIV A;  5K0I A;  1G8X A;  1OCC C;  2CW0 F;  3MBG A;  4L6R A;  2HMQ A;  4A2N B;  1WOL A;  2LFF A;  4GEH A;  3ABM C;  1T5O A;  1KU2 A;  2OEX A;  3EHM A;  5F28 E;  4A4A A;  1XWJ A;  4MVQ A;  4DRH B;  3K6B A;  1Q0G A;  4O6N A;  3W2W A;  2LP4 A;  3MYI A;  4E7S A;  3N24 A;  2P6V A;  4FX5 A;  1HMO A;  3H65 A;  4JKV A;  3UNG C;  2R7S A;  5E2Q A;  3EH1 A;  4JTA B;  4Q5S F;  2WB7 A;  2EPL X;  1M2V B;  3EZI A;  2EPN A;  1GS9 A;  3SEO A;  3DMD A;  3QVY A;  5A69 A;  2L7A A;  4BJ5 C;  1OKK D;  1Z6A A;  2YVK A;  3HNI A;  3LJB A;  4U9D A;  3UGP A;  2NSG A;  3EFO B;  3EGX B;  4JTD B;  1JAF A;  4OD5 A;  4ULV A;  1ZHT A;  2HSB A;  1MMN A;  1MNE A;  2XLO A;  1W2W A;  1ORS C;  4C3B A;  3PDM P;  2TMV P;  4W8K A;  1WTY A;  1OCZ C;  3FVY A;  1T6I A;  4NY3 A;  3WHN A;  5AC4 A;  2Y39 A;  2H8A A;  3OEO A;  1MQV A;  5D92 A;  3M4C A;  3JSE O;  5L0I A;  2GFH A;  3DWW A;  2D5R B;  1IW7 F;  3L8I A;  2PX3 A;  2HFI A;  2KJG A;  4DRJ B;  2GA0 A;  3B9Q A;  3Q6N A;  4WGY A;  3LS1 A;  4I44 A;  1NG1 A;  2YLD A;  3DJU B;  3MFN A;  4K7B A;  3V5Z A;  1XZQ A;  2ZXO A;  1T6U A;  3C62 A;  4N4W A;  3RVY A;  1Z3I X;  1OW7 A;  2HSQ A;  2L9J A;  4MVZ A;  1RJ9 B;  1NBB A;  4C7O A;  4CS9 A;  1LI7 A;  2R7R A;  1PCX A;  2YL3 A;  1RKE B;  1YYX A;  2DGJ A;  4BJ5 A;  4CS7 A;  1BR2 A;  2R7U A;  3V5Y A;  4KBL A;  1H9T A;  2OJE D;  4E0H A;  4Z9I A;  1JPN A;  3F47 A;  1LI5 A;  1E2X A;  5AGF A;  2A1D D;  1A7D A;  1RCP A;  1CPQ A;  3JCU Q;  5KYU A;  4OD4 A;  5AC5 A;  3U0C A;  1S7Z A;  4ZLD A;  3GWN A;  2J0X A;  2M4E A;  4JIO A;  1CPR A;  2CNW D;  3U3F A;  3HNL A;  4D4N A;  2IXM A;  1D0Z A;  1NU7 D;  1A7E A;  1QSP A;  2NUT A;  4BJ1 A;  1TFK B;  4BJT A;  4JZA A;  3PHF 2;  5GPG B;  2XLH A;  5L0C A;  1VOM A;  4DJ9 A;  4Z9J A;  1SYQ A;  3OA1 A;  3US6 A;  4ULW A;  5L0H A;  2UUI A;  4YWQ A;  2OG2 A;  4PK4 A;  1UFB A;  2J9W A;  4LDK A;  2BC5 A;  3QW1 A;  4BG0 A;  3SXM A;  1HE1 A;  4DVZ A;  4P6I C;  4XLP F;  1HY5 A;  1YJG A;  4U5F E;  2R03 A;  2A0U A;  2LQG A;  1A7V A;  4U5B E;  4E0I A;  4EBB A;  2ZD9 A;  1Q0F A;  3DM9 B;  5KYX A;  4IAR A;  4YT2 A;  3RKO F;  3S27 A;  2QY9 A;  3ZQY A;  2PFD A;  3VAY A;  1RXQ A;  3ASN C;  2IXO A;  4XPY A;  5DS4 A;  1JMW A;  1YLM A;  1LKX A;  4UDV A;  1VTM P;  2I8B A;  2OKU A;  1MMD A;  4XEV A;  4CDA A;  2KGO A;  2ZXR A;  2Y3D A;  2ZXP A;  4MS2 A;  4I3M A;  3S28 A;  1ZZP A;  2R7T A;  3U2M A;  3G4X A; 
#chains in the Genus database with same CATH homology
 3KKB A;  4MQ9 F;  3GOD A;  3K1H A;  4DBQ A;  1PD0 A;  5T1D B;  2OCC C;  1O5H A;  1OCR C;  1QZX A;  4IAO A;  3EZH A;  4CSA A;  2EIK C;  3DM5 A;  3K66 A;  3SNH A;  2XXA A;  3ABK C;  2Q9B A;  4RBN A;  5KYW A;  3UMH A;  4YT5 A;  3UR3 C;  5KYY B;  4YT8 A;  1FTS A;  3KL4 A;  3NKD A;  4ZLC A;  3O6X A;  3WG7 C;  1D0X A;  4YT4 A;  2WVQ A;  3UMI A;  1ST6 A;  3AQC A;  4O79 A;  5DVW A;  2VH3 A;  4Q7C A;  1TKN A;  2Z15 A;  3RFY A;  4N06 A;  2BE5 F;  3EJN A;  3ITF A;  2R7X A;  3DXJ F;  4YN0 B;  3K1I C;  3SP1 A;  3F46 A;  3EHN A;  4BJ6 C;  3CQZ A;  3LNR A;  3K33 A;  2G3K A;  1FMW A;  1MMG A;  2V26 A;  3N2Z B;  3JSZ A;  4O6Y A;  4XTK A;  3GAN A;  3W8I A;  2MYS A;  2WVN A;  3EQL F;  3L34 A;  2A68 F;  1M56 C;  2EIM C;  4FES A;  2XL4 A;  4K0D A;  1OCO C;  1SZI A;  2J9V A;  3AG3 C;  4FWV A;  4JUR I;  2E87 A;  2XXA B;  5T3W A;  2DYR C;  3I5P A;  1J8Y F;  1WGW A;  2CGE A;  5L3Q A;  2DYS C;  3LLI A;  2R7W A;  3S29 A;  2EIN C;  4XWJ A;  4I1M A;  3T6B A;  2Q9C A;  5CI8 A;  2R7V A;  4O7G A;  2WL8 A;  2HV6 A;  4J32 B;  3K7D A;  4F4B A;  3ZIB A;  3JT1 A;  4KC9 A;  2EIL C;  4OIN F;  3M1C B;  3DAG A;  2Q3T A;  2IXP A;  1ZHZ A;  2A69 F;  3DAF A;  3EG9 A;  5BUO A;  4JCH A;  1VMA A;  2WZF A;  4RD9 A;  4E7Z A;  4AE4 A;  3LEV A;  3LAY A;  1Z63 A;  3IEE A;  4G0H A;  4PJN A;  4OIR F;  5DQZ A;  1SMY F;  1V55 C;  1BR4 A;  4PJL A;  4LLC A;  4RDA A;  5DLJ A;  2Y3B A;  3EPV A;  2ZPA A;  4C3D A;  4GYT A;  2R7O A;  1VYK A;  1SF8 A;  4AK9 A;  3RIP A;  1O87 A;  3E9V A;  5DS6 A;  3HJC A;  3T6J A;  4IRU A;  2PF4 E;  2WZG A;  3NYM A;  2XRH A;  3AQB A;  4IJJ A;  3AG2 C;  5B1A C;  3ABL C;  3NG1 A;  2C04 A;  2C03 A;  1FFH A;  3NKE A;  2KW3 C;  4JJF A;  3QMK A;  1ZU5 A;  3JRT A;  4C7O B;  5F5H A;  3CSK A;  3POV A;  1D1C A;  4H4K C;  4KNV A;  2LSE A;  4I1O B;  3FHD A;  3I4U A;  4IWB A;  5L3V A;  5KYU B;  3Q7L A;  2Y69 C;  2EIJ C;  3ECS A;  3SZR A;  4G7O F;  4KNW A;  2IYL D;  3W2V A;  4EWC A;  4WJ0 A;  4QI2 A;  4PJJ A;  2NUT B;  3Q7G A;  2JD3 A;  1M2V A;  2A6E F;  4JVS A;  4CBE A;  2J7P A;  5E33 A;  3ZSU A;  1IZM A;  1VYI A;  5CI9 A;  3O39 A;  5EGY A;  3KMI A;  3I5Q A;  2J0W A;  4G7H F;  1M57 C;  3EGX A;  4LER A;  5KYX B;  3QZC A;  1ZYR F;  4CS8 C;  5B1B C;  4G7Z F;  2R7Q A;  4HFK B;  3ASO C;  4ANJ A;  1NZE A;  1TWC A;  3TD7 A;  5FCL A;  2WZL A;  5IY5 C;  3UGO A;  2PX0 A;  2X51 A;  2Y3G A;  4YJW A;  3DD7 A;  3B0P A;  4XLN F;  2O9X A;  4DBR A;  3NRH A;  1ZHY A;  1TWH A;  2B0J A;  3OWT A;  1LVK A;  5HSW A;  4AX2 A;  4U5D E;  4U5E E;  2FFH A;  4U5C E;  5B3S C;  5KYW B;  1M2O A;  3FAJ A;  1VK5 A;  5F5F A;  4PJM A;  1Z23 A;  4M63 A;  2W4B A;  2FGY A;  2MWQ A;  3LLK A;  3SYN A;  4CS8 A;  4CS9 C;  1LS1 A;  4BJ6 A;  4LLE A;  3EGD A;  4Q4Z F;  3Q6M A;  2YZS A;  4QI0 A;  4BEJ A;  2H7V C;  3WOD F;  3ZC4 A;  2NUP A;  1N1C A;  3L0I A;  2J45 A;  5DQT A;  1FMV A;  2VAS A;  4LAC B;  1Z5Z A;  5KYN A;  4PFO A;  1D1A A;  5E3A A;  3HLZ A;  3LS0 A;  4JW1 A;  2W4M A;  1QLE C;  3X2Q C;  2A6H F;  3UMK A;  3VYW A;  1ZHW A;  4CIH A;  1OKK A;  1ZU4 A;  5E3C A;  4HFF B;  1MND A;  1ZHX A;  4OIO F;  3NDB B;  3V7O A;  3ZVR A;  3MX3 A;  3NYL A;  3AG4 C;  2W9Y A;  3LES A;  2CDQ A;  1TWA A;  5KYY A;  3E70 C;  3EGD B;  3B0V C;  2J7P D;  5D91 A;  3S0X A;  4OIQ F;  5EHH A;  2NG1 A;  3NYJ A;  3B0U X;  2J9U A;  4CSA C;  4DOZ A;  4X0R A;  3FDQ A;  4C3E A;  2NUP B;  3AG1 C;  2YHS A;  2IXN A;  4QDL A;  1D0Y A;  3EG9 B;  4B6I A;  2YEV A;  4OIP F;  4MND A;  2L81 A;  4J30 B;  4AE4 B;  3KH2 A;  3X1O A;  2V3C C;  4U5G A;  1FFT C;  1BR1 A;  4HEA J;  4DVY P;  2HV7 A;  2QTV A;  2CNW A;  2XSE A;  4JJG A;  1D1B A;  1J8M F;  2Y3H A;  3DZA A;  1TR2 A;  2WVO A;  2H7B A;  2G62 A;  1JPJ A;  3EH2 A;  3EFO A;  2J46 A;  2G3V A;  3MLG A;  2P7V A;  2W45 A;  4O6M A;  4HE8 D;  2KQ9 A;  3DJN B;  2VB6 A;  2ZXW C;  2Q9A A;  1V54 C;  3JYH A;  3ZG1 A;  4KI2 A;  3PMR A;  5T3T A;  1MMA A;  1NU9 C;  5DS5 A;  3W8H A;  2IOQ A;  1PD1 A;  3RYL A;  1TWG A;  3N0T A;  3T4R A;  3RH3 A;  2H7O A;  2KNH A;  3CZ6 A;  1RJ9 A;  3HTK C;  2PP4 A;  4PFP A;  1G8X A;  1OCC C;  2CW0 F;  4A2N B;  4GEH A;  3ABM C;  1KU2 A;  3EHM A;  3K6B A;  4O6N A;  3W2W A;  4E7S A;  3N24 A;  2P6V A;  4FX5 A;  3H65 A;  3UNG C;  2R7S A;  5E2Q A;  3EH1 A;  4Q5S F;  2WB7 A;  1M2V B;  3EZI A;  3SEO A;  3DMD A;  4BJ5 C;  1OKK D;  1Z6A A;  3LJB A;  3UGP A;  3EFO B;  3EGX B;  4OD5 A;  1ZHT A;  1MMN A;  1MNE A;  4C3B A;  1W2W A;  4W8K A;  1OCZ C;  3FVY A;  4NY3 A;  2Y39 A;  3OEO A;  5D92 A;  2GFH A;  2D5R B;  1IW7 F;  2PX3 A;  2KJG A;  3B9Q A;  3Q6N A;  3LS1 A;  4I44 A;  1NG1 A;  3DJU B;  4K7B A;  2ZXO A;  1Z3I X;  2L9J A;  1RJ9 B;  4C7O A;  4CS9 A;  2R7R A;  1PCX A;  2DGJ A;  4BJ5 A;  4CS7 A;  1BR2 A;  2R7U A;  4KBL A;  1JPN A;  3F47 A;  2A1D D;  3JCU Q;  5KYU A;  4OD4 A;  1S7Z A;  4ZLD A;  2J0X A;  2M4E A;  2CNW D;  2IXM A;  1NU7 D;  1D0Z A;  4BJ1 A;  2NUT A;  4BJT A;  4JZA A;  3PHF 2;  1VOM A;  3OA1 A;  4ULW A;  4YWQ A;  2OG2 A;  4PK4 A;  2J9W A;  4BG0 A;  4DVZ A;  4XLP F;  4P6I C;  4U5F E;  4U5B E;  4EBB A;  3DM9 B;  5KYX A;  4YT2 A;  3RKO F;  3S27 A;  2QY9 A;  2PFD A;  3VAY A;  3ASN C;  5DS4 A;  2IXO A;  1LKX A;  2I8B A;  1MMD A;  2KGO A;  2ZXR A;  2Y3D A;  2ZXP A;  3S28 A;  4I3M A;  2R7T A;  4U5H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...