3LS1A

Crystal structure of cyanobacterial psbq from synechocystis sp. pcc 6803 complexed with zn2+
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
133
structure length
133
Chain Sequence
GPLGSCSSPQVEIPTTYSPEKIAQLQVYVNPIAVARDGMEKRLQGLIADQNWVDTQTYIHGPLGQLRRDMLGLASSLLPKDQDKAKTLAKEVFGHLERLDAAAKDRNGSQAKIQYQEALADFDSFLNLLPQAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sll1638 protein
publication title Crystal Structure of PsbQ from Synechocystis sp. PCC 6803 at 1.8 A: Implications for Binding and Function in Cyanobacterial Photosystem II
pubmed doi rcsb
source organism Synechocystis sp.
molecule tags Photosynthesis
total genus 50
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05757 PsbQ Oxygen evolving enhancer protein 3 (PsbQ)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.290 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3ls1A00
3RFYA 3LS1A 1VYKA 3ZSUA 3JCUQ 1NZEA 3LS0A 2MWQA
chains in the Genus database with same CATH superfamily
1TFKB 3AG3C 3LLKA 4YT2A 1L3PA 2J45A 3SNHA 3GEIA 3C8ZA 3C18A 1JR8A 4IWBA 3IQ5A 1VK5A 1WGWA 3K1IC 4FX5A 4U9DA 3NYJA 1H6GA 3TD7A 3V5XA 2P0NA 4A2NB 5L0HA 3US6A 3CZ6A 3AJMA 4LLEA 4XEKA 1Q0KA 1M2VB 2QNLA 5F28E 3U9JA 2YKZA 4Z9IA 3QMKA 3W2VA 1L7CA 1NU7D 3AQBA 4PJNA 2YL0A 5L0CA 1RKEB 3L34A 3GWNA 5JRAA 1GGQA 1BR1A 1KNYA 4JW1A 4C7OB 1OCOC 2V3CC 2HV7A 4I3MA 2P6VA 5KYWA 1BR2A 2QLAA 4U9EA 5DLJA 1HW1A 2V26A 4JJGA 3LESA 3DAFA 5TJ5E 1LE4A 4MTOA 3B0PA 4CDVA 3GORA 4WGYA 3ASNC 3QVZA 1KU2A 4J7TA 1B68A 3LAYA 1YARO 4FESA 2A69F 4DXWA 1E86A 5KYUB 5AC4A 1YVIA 3AG1C 4HFFB 1RXQA 4CS8A 2TMVP 4C7OA 3V5YA 3LNMB 5L0IA 4YL3A 4CS9C 4DJ9A 4BEMJ 3IPMO 1HE9A 2XLEA 4PFPA 2J7PA 3RVZA 3JZ0A 4RBNA 2PX3A 4JEBA 2XL6A 5KYXA 2JD3A 1LM3B 1ORSC 1QSPA 3PCVA 4AX2A 4OIQF 3AOUA 4Q5SF 3Q6NA 5DS4A 2YQYA 1APCA 2OG2A 5DS5A 5KYUA 2R7XA 1F1MA 2XLDA 1LIHA 3K7DA 4RD9A 4DRHB 1D0YA 4IARA 1ST6A 4G78A 1OKKD 3SYNA 5A6JA 3TULA 2IXMA 3FDQA 3QW0A 3U9MA 4DVZA 1G8XA 3DM5A 3GODA 2M64A 2YEVA 3N2ZB 1KTMA 2IOQA 4ER9A 1UFBA 2R02A 1WWPA 2YWAA 1VYIA 1ZW3A 4K1OA 1O5HA 2I15A 2LP4A 1GS9A 2H7BA 3X1OA 5B3IA 4U5DE 2XLVA 2CNWD 1LI5A 2YLIA 3HLZA 4IAOA 1YJGA 4GEHA 2IYLD 4MVMA 4YT5A 1ZVZA 2R25A 3FAPB 3G4XA 3KYJA 2EPNA 4P9TA 2OEVA 3ATPA 3H2VA 4XPWA 3ZTMA 4OIPF 2VC9A 3KYIA 2I8BA 1J8MF 1SF8A 2EIMC 1FFTC 1XZPA 3DXJF 1OXBA 4J32B 4JCHA 2VCBA 3S9OA 3TJ5A 1E84A 2PX0A 3EG9B 3RH3A 2KJGA 2YLGA 2RD9A 4XWJA 4BPMA 5A6BD 1OW6A 1OQCA 1JRAA 2OOCA 2Y3DA 3MLGA 5JVEA 1YYXA 2A0UA 5HV9A 3RW0A 4I1MA 4BG0A 4YT8A 2NSFA 3IQCA 1ZHTA 2EINC 1E83A 2R7WA 3DE9A 2WZFA 1YA9A 2R9RB 2WZLA 3I5PA 3EQLF 1ZU5A 4I1OB 1Z6AA 3PHF2 1TFOB 2Y3GA 2IBFA 3U8VA 4KNVA 3SP1A 2XS1A 2KGOA 4E0HA 2AWYA 2WVQA 1PV3A 3RQEA 2G3KA 1Q0FA 1RCPA 1E85A 1VLSA 1JPJA 4IJJA 4OIOF 2GWWA 3DAGA 3V7OA 4EKWA 1AVOB 1WTYA 1M2OA 1N1CA 1HMDA 4WGZA 3MX3A 2H8AA 4PACA 4LDRA 1CPQA 2IXPA 3F46A 2P1AA 1JPNA 1K05A 3FOPA 2GFHA 1YLMA 4W8PA 1I5NA 2P7VA 1MNDA 4JKVA 2EIKC 1VYKA 4U5GA 2G62A 3WODF 3KKBA 2IM8A 2MWQA 4LERA 2WVNA 2B0HA 2KSFA 2VB6A 3EFOA 3EPVA 3LEVA 2XLWA 1G4US 2PBEA 2R7TA 4U5HA 3ASOC 1OCZC 4A4AA 1PD0A 2XS8A 4ZLDA 3LS0A 5L0GA 1YA7O 5EGYA 1T6IA 1M56C 5E3AA 4O6YA 3KH2A 4CIHA 2H7OA 1A7DA 4CDAA 1T9KA 3Q7LA 3IQ6A 4WABA 2L7AA 5L0DA 1ZW2A 1CGNA 4YJWA 4QI0A 4CSAC 1JMWA 3MYFA 4O6NA 4PJJA 2Q4FA 2XLOA 1M57C 1QLEC 2L6HA 3H65A 3HNJA 2CDQA 4G0HA 2HV6A 4DVYP 4NCQA 4LLCA 3C63A 3UNGC 3HTKC 1VB5A 1CPRA 1OCRC 1ZU4A 1MMDA 4MS2A 3E70C 4BJ6C 4CIPA 4F4BA 3K1IA 3S27A 2OJQA 3U8PA 4O79A 5DQTA 5D91A 2Q9AA 2C03A 1H7IA 2J8WA 3DI5A 3ZTZA 2HJ3A 2XL8A 2CCYA 1TKNA 2KNHA 3B29A 1RJ9B 2HMZA 3O55A 2AU5A 4LACB 3GM3A 1BR4A 3HJCA 4MVQA 4NTAA 5KYXB 4KI2A 2R7SA 3T6BA 3VYWA 3AGUA 4JC7A 1DOVA 1H9GA 1LE2A 5B1BC 3WAQA 2NG1A 3FOOA 4O6MA 3ZVRA 4BEJA 2LK4A 3TK0A 2AVKA 2J9WA 3K6BA 4OD5A 3VRCA 4J7YA 1WASA 4JRZA 1OKKA 1D0ZA 2QE9A 3RFYA 2PF4E 2YHSA 3JYYA 4XQ1A 5E33A 1V54C 3S84A 2LD6A 3RQGA 1D1CA 3DJUB 1ZZPA 2W4MA 2WB7A 3L8IA 1RJ9A 1U6HA 2H7VC 2IXNA 5COFA 4ULWA 1BDJB 3RYLA 1Z5ZA 2YZSA 4N06A 2CNWA 2Y3HA 1T6UA 4MW8A 5E3CA 3ZSUA 3C62A 1NZEA 4Z9JA 3I4UA 1GM5A 3ZG1A 1RMVA 3JCUQ 3SZRA 2LSEA 2R7UA 5L3QA 3DZAA 4GQHA 5F5HA 4EWCA 4FAPB 3A11A 1NFOA 4ZLCA 5GPGB 3DJNB 2YRFA 3I5QA 4QI2A 1LVKA 2EIJC 3FHDA 3DMDA 3EGXA 4M63A 2A0BA 1D0XA 2QUPA 4U5EE 4EBKA 3NMJA 2Y39A 1MNEA 4WJ0A 3DKAA 3HNKA 3R2PA 4ANJA 4EIYA 1T5OA 5A6BA 1Z23A 2EPMX 3HKKA 2YL3A 3W8HA 4CJOA 2HFIA 2XM0A 4N4WA 5JLIA 3QZCA 1K04A 3JRTA 4N6CA 1ZYRF 4JE9A 3K33A 1I4ZA 3LLIA 3JT1A 3W2WA 3PDMP 1SYQA 2Y69C 1OW8A 3CSKA 4U5BE 2CW0F 3LNRA 4HFKB 1VOMA 2AWCA 4FWVA 3B9QA 5EK0A 3VM6A 4E17A 2L6FA 1NLXA 3O6XA 2E87A 4XEVA 5IY5C 4OD4A 3EZIA 5A6AA 2LIGA 2R7VA 1MMAA 3NDBB 3N0TA 3U0CA 2HSBA 4NQFA 3HNLA 5T3TA 4JZAA 1NU9C 2D4UA 4G7OF 1W2WA 2NPUA 3JRMO 2EILC 2OQMA 2Q3TA 3RF3A 3NYLA 1S7ZA 2J7PD 3QW1A 2ZXRA 3K66A 4YN0B 4EHPA 2J9UA 1D1AA 4KNWA 2J9VA 2Q00A 3QVYA 1A7VA 4CX9A 3UR3C 2HUJA 5KYYA 4AE4B 3NRHA 4XLNF 4XTKA 2ETSA 4MTGA 4PJMA 2W4BA 4MW3A 3M4CA 1ZHZA 3X2QC 4OINF 2A1DD 3NYMA 1OW7A 4RDAA 3C8GD 1K40A 4L6RA 2B0JA 4BJ5A 4CJGA 4DRJB 5BUOA 5L0JA 1H9TA 2GDCA 4MNDA 2FAPB 1JOGA 2DYRC 3EFOB 4E7SA 5JUAA 2PFDA 4XLPF 3UMIA 2XXAB 3LEOA 4XPXA 4AL1A 3EHMA 3TOLA 3TOMA 1NSGB 1C03A 2Y3BA 3RVYA 5FCLA 5EHHA 2KYHA 4AE4A 1NBBA 4BJ1A 1R5ID 3G50A 3L1MA 3JYHA 3F47A 3DM9B 3EH2A 4JTDB 1O87A 2NSGA 3RQFA 3IQTA 2XSEA 5F5FA 1TWCA 2EPOA 3GM2A 5B3SC 4JVSA 3EGDB 3DWWA 4AK9A 4NTBA 3UMKA 5T3WA 3A9CA 4E0IA 4Z9HA 3U3BA 4HEAJ 1AEPA 4DBQA 3O39A 3JSZA 4C3DA 2L81A 5AGFA 3TQOA 2XXAA 1FMWA 2YL1A 5JSLA 1FR0A 1Y4CA 2HS5A 3U2LA 2HMQA 4MVUA 1LPEA 1ORYA 4C3EA 2NUPA 3NMIA 2XLMA 1TQGA 3FMSA 2J46A 3C7JA 3S90A 1FAPB 1BZ4A 1Q0MA 3L8JA 4JTAB 4MVZA 5JS5A 5BQIA 1ORJA 3M4BA 3NKEA 3ZQVA 2LFFA 3EGDA 2ZXWC 2NUTA 1G5ZA 1A0BA 3SXMA 4YWQA 3IEEA 4XPYA 2HJMA 3ZQYA 3BEHA 1BBHA 3S28A 3B0VC 3T9OA 2ZXPA 4I44A 5KYWB 2W9YA 1ZHXA 2XLHA 1Z7Qc 1EA8A 3ZIBA 4U5FE 1XZQA 4CSAA 2L6GA 2UUHA 2VH3A 2X51A 4KC9A 4QDLA 4ULVA 3U5SA 4YT4A 3S0XA 3B0UX 2YL7A 4D4XA 1S05A 3KPHA 2A6EF 4PK4A 4BJTA 1YDIA 3N24A 4XEFA 5CI8A 4DOZA 4E7ZA 2CGEA 1FFHA 2GAQA 1LS4A 1XWJA 3EH1A 2BC5A 4EBBA 4JTCB 5FZTA 3FVYA 1HMOA 4BJ6A 5A6KA 4GYTA 4JEAA 2R05A 4X0RA 5AC5A 2HSQA 3LUTB 2DI3A 3WG7C 4CS7A 1IW7F 1FTSA 2JX0A 3ABKC 1QQ3A 3FAJA 1PD1A 3FXHA 3KL4A 5D92A 3MYIA 3RKOF 4Q4ZF 3EGXB 1JAFA 2R7OA 3UGPA 3H2UA 3J06A 2IXOA 1U0BB 2WZGA 3HNIA 3LS1A 4IGGA 3O10A 2JPUA 2Q9BA 3EJNA 1OXKA 1TR2A 4CS8C 2J0XA 256BA 4K0DA 4CDYA 2ZXOA 2D5RB 2OKUA 2DB4A 3AGTA 3VF0A 1M2VA 2BE5F 2YVKA 1SR2A 1WATA 2KC3A 1LS1A 3AG2C 2EPLX 3ECSA 4K7BA 3S29A 1U89A 1RKEA 3C8GB 1QZXA 1V4AA 3M79A 4KBLA 5L3VA 3AQCA 1R4TA 2CYDA 4Q7CA 4PR9A 2A6HF 3MFNA 2M4EA 4MQ9F 1CGME 4EBJA 1HE1A 1V74B 5JP7A 4O7GA 5DVWA 2W45A 1T6QA 3CAXA 4JIOA 2EPKX 3DD7A 3ZWIA 2XM4A 2X0CA 3EZHA 2VASA 3ABLC 5CIVA 5HSWA 1G4WR 1CGOA 1FNTc 1RKCA 5BQGA 3CEXA 1Q0GA 3AG4C 4IRUA 5KYYB 1EQ1A 2VCAA 3IHUA 5COMA 4R32A 3RIPA 2PP4A 4MVSA 3OWTA 1ZHYA 2DGJA 3GEEA 3C8GA 1EKYA 1YYJA 4NTFA 1OR2A 1EI7A 2ZPAA 4CBEA 4J30B 2ICWG 3POVA 1C17M 1ZHWA 2C04A 2VCCA 3U3FA 2WVOA 4B6IA 3NG1A 1SMYF 4N6HA 5KYNA 3U2MA 1DOWA 4CS9A 3VAYA 2DYSC 1V55C 2HZ8A 2PNOA 2OJED 3W8IA 4YK5A 1OCCC 2QY9A 5B1AC 1PCXA 3EHNA 4P9FA 1A41A 1D1BA 4MVOA 5BQHA 4MTFA 2ASRA 1A7EA 2LQGA 1Q0DA 4JCZA 1MMNA 2J0WA 2LFDA 3T4RA 3V5ZA 3SXYA 4D4NA 3T6JA 3JTLO 4G7HF 5A69A 4OIRF 4MVRA 2OEXA 4LDKA 2WL8A 3OEOA 4H4KC 5E2QA 1MMGA 1Z63A 3UMHA 1HY5A 1QPUA 1WOLA 3GANA 2BL2A 5COGA 1LKXA 2OCCC 3K1HA 3ZC4A 1MQVA 4BJ5C 1LI7A 1VTMP 2MYSA 2F22A 4JJFA 3SXZA 3GM1A 3UGOA 4ONSA 2Z15A 1Z3IX 3CQZA 2L9JA 2NUPB 3LJBA 1AUEA 3M1CB 1YZCA 2MHRA 3Q7GA 4W8KA 1YAUO 4UDVA 2R7QA 1VLTA 3DE8A 2YLDA 3PMRA 4LDQA 4NC3A 5JT4A 4AL0A 3KMIA 2G3VA 1C02A 1QVXA 4C3BA 3SEOA 4U5CE 5CI9A 2OU6A 2R7RA 1VMAA 2LCHA 2NUTB 1M6TA 2P61A 1O3UA 2FGYA 2FFHA 2Q7RA 3ZDLA 3EG9A 3Q6MA 4JURI 4DRIB 2Q9CA 4PFOA 3MBGA 1TWAA 2O9XA 3E9VA 5DQZA 4EUKB 1TWHA 3SXKA 3T6GB 2J9BA 4IAQA 3ABMC 1Y6DA 3OA1A 3JSEO 4E18A 3R7CA 1QKRA 4HE8D 4PJLA 2QTVA 3W4YA 1UG7A 4DBRA 1GQAA 2GA0A 2UUIA 2ZD9A 1OR3A 1YZAA 3ITFA 3NMKA 1NFNA 2AP3A 1T01A 1E2XA 3B71A 5T1DB 3TJ6A 1IZMA 2XRHA 2HKVA 3GWLA 1I4YA 2KQ9A 2A68F 1NG1A 3M15A 4YL0A 3G4ZA 5DS6A 3WHNA 4NY3A 5K0IA 4G7ZF 2XL4A 3L0IA 4P6IC 5L0FA 1FMVA 1TWGA 3NKDA 3BRJA 4H54A 1J8YF 4IB4A 2KK1A 1SZIA 2KW3C 4YL1A 2RSEB 1WN0A 3GEHA 2R03A 1HW2A 3QTHA
chains in the Genus database with same CATH topology
3AG3C 3LLKA 4YT2A 2J45A 3SNHA 4IWBA 1VK5A 1WGWA 3K1IC 4FX5A 3NYJA 3TD7A 4A2NB 3CZ6A 4LLEA 1M2VB 3QMKA 3W2VA 1NU7D 3AQBA 4PJNA 3L34A 4JW1A 1BR1A 4C7OB 1OCOC 2V3CC 2HV7A 4I3MA 2P6VA 1BR2A 5DLJA 2V26A 4JJGA 3LESA 3DAFA 3B0PA 3ASNC 1KU2A 3LAYA 4FESA 2A69F 5KYUB 3AG1C 4HFFB 4CS8A 4C7OA 4PFPA 2J7PA 4RBNA 2PX3A 5KYXA 2JD3A 4AX2A 4OIQF 4Q5SF 3Q6NA 5DS4A 2OG2A 5DS5A 5KYUA 2R7XA 3K7DA 4RD9A 1D0YA 1ST6A 1OKKD 3SYNA 2IXMA 3FDQA 4DVZA 1G8XA 3GODA 3DM5A 2YEVA 3N2ZB 2IOQA 1VYIA 1O5HA 2H7BA 3X1OA 4U5DE 2CNWD 4IAOA 3HLZA 4YT5A 4GEHA 2IYLD 4OIPF 2I8BA 1J8MF 1SF8A 2EIMC 1FFTC 4JCHA 3DXJF 4J32B 2PX0A 3EG9B 3RH3A 2KJGA 4XWJA 2Y3DA 3MLGA 4I1MA 4BG0A 4YT8A 1ZHTA 2EINC 2R7WA 2WZFA 2WZLA 3I5PA 3EQLF 1ZU5A 4I1OB 1Z6AA 3PHF2 2Y3GA 4KNVA 3SP1A 2KGOA 2WVQA 2G3KA 1JPJA 4IJJA 4OIOF 3DAGA 3V7OA 1M2OA 1N1CA 3MX3A 2IXPA 3F46A 1JPNA 2GFHA 2P7VA 1MNDA 4U5GA 2EIKC 1VYKA 2G62A 3WODF 3KKBA 4LERA 2MWQA 2WVNA 2VB6A 3EFOA 3EPVA 3LEVA 2R7TA 4U5HA 3ASOC 1OCZC 1PD0A 4ZLDA 3LS0A 5EGYA 1M56C 5E3AA 4O6YA 3KH2A 4CIHA 2H7OA 3Q7LA 4YJWA 4QI0A 4CSAC 4O6NA 4PJJA 1M57C 1QLEC 3H65A 2CDQA 4G0HA 2HV6A 4DVYP 4LLCA 3UNGC 3HTKC 1ZU4A 1OCRC 1MMDA 3E70C 4BJ6C 4F4BA 3S27A 5DQTA 4O79A 5D91A 2Q9AA 2C03A 1TKNA 2KNHA 4LACB 1RJ9B 5KYXB 3HJCA 1BR4A 2R7SA 4KI2A 3T6BA 3VYWA 5B1BC 2NG1A 3ZVRA 4BEJA 4OD5A 3K6BA 2J9WA 1OKKA 1D0ZA 3RFYA 2PF4E 2YHSA 5E33A 1V54C 1D1CA 3DJUB 2W4MA 2WB7A 1RJ9A 2H7VC 2IXNA 4ULWA 3RYLA 1Z5ZA 2YZSA 4N06A 2CNWA 2Y3HA 5E3CA 3ZSUA 1NZEA 2R7UA 3I4UA 3ZG1A 3JCUQ 3SZRA 2LSEA 5L3QA 3DZAA 4EWCA 5F5HA 4ZLCA 3DJNB 3I5QA 4QI2A 1LVKA 2EIJC 3FHDA 3DMDA 3EGXA 4M63A 4U5EE 1D0XA 2Y39A 1MNEA 4WJ0A 4ANJA 1Z23A 3W8HA 3QZCA 3JRTA 3W2WA 1ZYRF 3K33A 3LLIA 3JT1A 2Y69C 4CS9C 3CSKA 4U5BE 2CW0F 3LNRA 4HFKB 1VOMA 4FWVA 3B9QA 3O6XA 2E87A 5IY5C 4OD4A 3EZIA 2R7VA 1MMAA 3NDBB 3N0TA 5T3TA 4JZAA 1NU9C 4G7OF 1W2WA 2EILC 2Q3TA 3NYLA 1S7ZA 2J7PD 2ZXRA 3K66A 4YN0B 2J9UA 1D1AA 4KNWA 2J9VA 3UR3C 5KYYA 4AE4B 3NRHA 4XLNF 4XTKA 4PJMA 2W4BA 3X2QC 1ZHZA 4OINF 2A1DD 3NYMA 4RDAA 4BJ5A 2B0JA 5BUOA 4MNDA 2DYRC 3EFOB 4E7SA 2PFDA 4XLPF 3UMIA 2XXAB 3EHMA 2Y3BA 5FCLA 5EHHA 4AE4A 4BJ1A 3JYHA 3F47A 3DM9B 3EH2A 1O87A 2XSEA 5F5FA 1TWCA 5B3SC 4JVSA 3EGDB 4AK9A 3UMKA 5T3WA 4HEAJ 4DBQA 3O39A 3JSZA 4C3DA 2L81A 2XXAA 1FMWA 4C3EA 2NUPA 2J46A 3NKEA 3EGDA 2ZXWC 2NUTA 4YWQA 3IEEA 3S28A 3B0VC 2ZXPA 4I44A 5KYWB 2W9YA 1ZHXA 3ZIBA 4U5FE 4CSAA 2VH3A 2X51A 4KC9A 4QDLA 4YT4A 3S0XA 3B0UX 4BJTA 2A6EF 4PK4A 3N24A 5CI8A 4E7ZA 4DOZA 2CGEA 1FFHA 3EH1A 4EBBA 3FVYA 4BJ6A 4GYTA 4X0RA 3WG7C 4CS7A 1FTSA 1IW7F 3ABKC 3FAJA 3KL4A 5KYWA 1PD1A 5D92A 3RKOF 4Q4ZF 3EGXB 2R7OA 3UGPA 2IXOA 2WZGA 3LS1A 2Q9BA 3EJNA 1TR2A 4CS8C 2J0XA 4K0DA 2ZXOA 2D5RB 1M2VA 2BE5F 1LS1A 3AG2C 3ECSA 4K7BA 3S29A 1QZXA 4KBLA 5L3VA 3AQCA 4Q7CA 2A6HF 2M4EA 4MQ9F 4O7GA 5DVWA 2W45A 3DD7A 3EZHA 2VASA 3ABLC 5HSWA 3AG4C 4IRUA 5KYYB 3RIPA 2PP4A 3OWTA 1ZHYA 2DGJA 2ZPAA 4CBEA 4J30B 1ZHWA 2C04A 2WVOA 4B6IA 3NG1A 1SMYF 5KYNA 4CS9A 3VAYA 2DYSC 1V55C 3W8IA 1OCCC 2QY9A 5B1AC 1PCXA 3EHNA 1D1BA 1MMNA 2J0WA 3T4RA 3T6JA 4G7HF 4OIRF 2WL8A 3OEOA 4H4KC 5E2QA 1MMGA 1Z63A 3UMHA 3GANA 1LKXA 2OCCC 3K1HA 3ZC4A 4BJ5C 2MYSA 4JJFA 3UGOA 3M1CB 2Z15A 1Z3IX 2L9JA 2NUPB 3LJBA 3CQZA 3POVA 3Q7GA 4W8KA 2R7QA 3PMRA 3KMIA 2G3VA 4C3BA 3SEOA 4U5CE 5CI9A 2R7RA 1VMAA 2NUTB 2FGYA 2FFHA 3EG9A 3Q6MA 4JURI 2Q9CA 4PFOA 1TWAA 2O9XA 3E9VA 5DQZA 1TWHA 3ABMC 3OA1A 4HE8D 4PJLA 2QTVA 4DBRA 3ITFA 4O6MA 5T1DB 1IZMA 2XRHA 2KQ9A 2A68F 1NG1A 5DS6A 4NY3A 4G7ZF 2XL4A 3L0IA 4P6IC 1FMVA 1TWGA 3NKDA 1J8YF 1SZIA 2KW3C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RFY A;  3LS1 A;  1VYK A;  3ZSU A;  3JCU Q;  1NZE A;  3LS0 A;  2MWQ A; 
#chains in the Genus database with same CATH topology
 1TFK B;  3AG3 C;  3LLK A;  4YT2 A;  1L3P A;  2J45 A;  3SNH A;  3GEI A;  3C8Z A;  3C18 A;  1JR8 A;  4IWB A;  3IQ5 A;  1VK5 A;  1WGW A;  3K1I C;  4FX5 A;  4U9D A;  3NYJ A;  1H6G A;  3TD7 A;  3V5X A;  2P0N A;  4A2N B;  5L0H A;  3US6 A;  3CZ6 A;  3AJM A;  4LLE A;  4XEK A;  1Q0K A;  1M2V B;  2QNL A;  5F28 E;  3U9J A;  2YKZ A;  4Z9I A;  3QMK A;  3W2V A;  1L7C A;  1NU7 D;  3AQB A;  4PJN A;  2YL0 A;  5L0C A;  1RKE B;  3L34 A;  3GWN A;  5JRA A;  1GGQ A;  1BR1 A;  1KNY A;  4JW1 A;  4C7O B;  1OCO C;  2V3C C;  2HV7 A;  4I3M A;  2P6V A;  5KYW A;  1BR2 A;  2QLA A;  4U9E A;  5DLJ A;  1HW1 A;  2V26 A;  4JJG A;  3LES A;  3DAF A;  5TJ5 E;  1LE4 A;  4MTO A;  3B0P A;  4CDV A;  3GOR A;  4WGY A;  3ASN C;  3QVZ A;  1KU2 A;  4J7T A;  1B68 A;  3LAY A;  1YAR O;  4FES A;  2A69 F;  4DXW A;  1E86 A;  5KYU B;  5AC4 A;  1YVI A;  3AG1 C;  4HFF B;  1RXQ A;  4CS8 A;  2TMV P;  4C7O A;  3V5Y A;  3LNM B;  5L0I A;  4YL3 A;  4CS9 C;  4DJ9 A;  4BEM J;  3IPM O;  1HE9 A;  2XLE A;  4PFP A;  2J7P A;  3RVZ A;  3JZ0 A;  4RBN A;  2PX3 A;  4JEB A;  2XL6 A;  5KYX A;  2JD3 A;  1LM3 B;  1ORS C;  1QSP A;  3PCV A;  4AX2 A;  4OIQ F;  3AOU A;  4Q5S F;  3Q6N A;  5DS4 A;  2YQY A;  1APC A;  2OG2 A;  5DS5 A;  5KYU A;  2R7X A;  1F1M A;  2XLD A;  1LIH A;  3K7D A;  4RD9 A;  4DRH B;  1D0Y A;  4IAR A;  1ST6 A;  4G78 A;  1OKK D;  3SYN A;  5A6J A;  3TUL A;  2IXM A;  3FDQ A;  3QW0 A;  3U9M A;  4DVZ A;  1G8X A;  3DM5 A;  3GOD A;  2M64 A;  2YEV A;  3N2Z B;  1KTM A;  2IOQ A;  4ER9 A;  1UFB A;  2R02 A;  1WWP A;  2YWA A;  1VYI A;  1ZW3 A;  4K1O A;  1O5H A;  2I15 A;  2LP4 A;  1GS9 A;  2H7B A;  3X1O A;  5B3I A;  4U5D E;  2XLV A;  2CNW D;  1LI5 A;  2YLI A;  3HLZ A;  4IAO A;  1YJG A;  4GEH A;  2IYL D;  4MVM A;  4YT5 A;  1ZVZ A;  2R25 A;  3FAP B;  3G4X A;  3KYJ A;  2EPN A;  4P9T A;  2OEV A;  3ATP A;  3H2V A;  4XPW A;  3ZTM A;  4OIP F;  2VC9 A;  3KYI A;  2I8B A;  1J8M F;  1SF8 A;  2EIM C;  1FFT C;  1XZP A;  3DXJ F;  1OXB A;  4J32 B;  4JCH A;  2VCB A;  3S9O A;  3TJ5 A;  1E84 A;  2PX0 A;  3EG9 B;  3RH3 A;  2KJG A;  2YLG A;  2RD9 A;  4XWJ A;  4BPM A;  5A6B D;  1OW6 A;  1OQC A;  1JRA A;  2OOC A;  2Y3D A;  3MLG A;  5JVE A;  1YYX A;  2A0U A;  5HV9 A;  3RW0 A;  4I1M A;  4BG0 A;  4YT8 A;  2NSF A;  3IQC A;  1ZHT A;  2EIN C;  1E83 A;  2R7W A;  3DE9 A;  2WZF A;  1YA9 A;  2R9R B;  2WZL A;  3I5P A;  3EQL F;  1ZU5 A;  4I1O B;  1Z6A A;  3PHF 2;  1TFO B;  2Y3G A;  2IBF A;  3U8V A;  4KNV A;  3SP1 A;  2XS1 A;  2KGO A;  4E0H A;  2AWY A;  2WVQ A;  1PV3 A;  3RQE A;  2G3K A;  1Q0F A;  1RCP A;  1E85 A;  1VLS A;  1JPJ A;  4IJJ A;  4OIO F;  2GWW A;  3DAG A;  3V7O A;  4EKW A;  1AVO B;  1WTY A;  1M2O A;  1N1C A;  1HMD A;  4WGZ A;  3MX3 A;  2H8A A;  4PAC A;  4LDR A;  1CPQ A;  2IXP A;  3F46 A;  2P1A A;  1JPN A;  1K05 A;  3FOP A;  2GFH A;  1YLM A;  4W8P A;  1I5N A;  2P7V A;  1MND A;  4JKV A;  2EIK C;  1VYK A;  4U5G A;  2G62 A;  3WOD F;  3KKB A;  2IM8 A;  2MWQ A;  4LER A;  2WVN A;  2B0H A;  2KSF A;  2VB6 A;  3EFO A;  3EPV A;  3LEV A;  2XLW A;  1G4U S;  2PBE A;  2R7T A;  4U5H A;  3ASO C;  1OCZ C;  4A4A A;  1PD0 A;  2XS8 A;  4ZLD A;  3LS0 A;  5L0G A;  1YA7 O;  5EGY A;  1T6I A;  1M56 C;  5E3A A;  4O6Y A;  3KH2 A;  4CIH A;  2H7O A;  1A7D A;  4CDA A;  1T9K A;  3Q7L A;  3IQ6 A;  4WAB A;  2L7A A;  5L0D A;  1ZW2 A;  1CGN A;  4YJW A;  4QI0 A;  4CSA C;  1JMW A;  3MYF A;  4O6N A;  4PJJ A;  2Q4F A;  2XLO A;  1M57 C;  1QLE C;  2L6H A;  3H65 A;  3HNJ A;  2CDQ A;  4G0H A;  2HV6 A;  4DVY P;  4NCQ A;  4LLC A;  3C63 A;  3UNG C;  3HTK C;  1VB5 A;  1CPR A;  1OCR C;  1ZU4 A;  1MMD A;  4MS2 A;  3E70 C;  4BJ6 C;  4CIP A;  4F4B A;  3K1I A;  3S27 A;  2OJQ A;  3U8P A;  4O79 A;  5DQT A;  5D91 A;  2Q9A A;  2C03 A;  1H7I A;  2J8W A;  3DI5 A;  3ZTZ A;  2HJ3 A;  2XL8 A;  2CCY A;  1TKN A;  2KNH A;  3B29 A;  1RJ9 B;  2HMZ A;  3O55 A;  2AU5 A;  4LAC B;  3GM3 A;  1BR4 A;  3HJC A;  4MVQ A;  4NTA A;  5KYX B;  4KI2 A;  2R7S A;  3T6B A;  3VYW A;  3AGU A;  4JC7 A;  1DOV A;  1H9G A;  1LE2 A;  5B1B C;  3WAQ A;  2NG1 A;  3FOO A;  4O6M A;  3ZVR A;  4BEJ A;  2LK4 A;  3TK0 A;  2AVK A;  2J9W A;  3K6B A;  4OD5 A;  3VRC A;  4J7Y A;  1WAS A;  4JRZ A;  1OKK A;  1D0Z A;  2QE9 A;  3RFY A;  2PF4 E;  2YHS A;  3JYY A;  4XQ1 A;  5E33 A;  1V54 C;  3S84 A;  2LD6 A;  3RQG A;  1D1C A;  3DJU B;  1ZZP A;  2W4M A;  2WB7 A;  3L8I A;  1RJ9 A;  1U6H A;  2H7V C;  2IXN A;  5COF A;  4ULW A;  1BDJ B;  3RYL A;  1Z5Z A;  2YZS A;  4N06 A;  2CNW A;  2Y3H A;  1T6U A;  4MW8 A;  5E3C A;  3ZSU A;  3C62 A;  1NZE A;  4Z9J A;  3I4U A;  1GM5 A;  3ZG1 A;  1RMV A;  3JCU Q;  3SZR A;  2LSE A;  2R7U A;  5L3Q A;  3DZA A;  4GQH A;  5F5H A;  4EWC A;  4FAP B;  3A11 A;  1NFO A;  4ZLC A;  5GPG B;  3DJN B;  2YRF A;  3I5Q A;  4QI2 A;  1LVK A;  2EIJ C;  3FHD A;  3DMD A;  3EGX A;  4M63 A;  2A0B A;  1D0X A;  2QUP A;  4U5E E;  4EBK A;  3NMJ A;  2Y39 A;  1MNE A;  4WJ0 A;  3DKA A;  3HNK A;  3R2P A;  4ANJ A;  4EIY A;  1T5O A;  5A6B A;  1Z23 A;  2EPM X;  3HKK A;  2YL3 A;  3W8H A;  4CJO A;  2HFI A;  2XM0 A;  4N4W A;  5JLI A;  3QZC A;  1K04 A;  3JRT A;  4N6C A;  1ZYR F;  4JE9 A;  3K33 A;  1I4Z A;  3LLI A;  3JT1 A;  3W2W A;  3PDM P;  1SYQ A;  2Y69 C;  1OW8 A;  3CSK A;  4U5B E;  2CW0 F;  3LNR A;  4HFK B;  1VOM A;  2AWC A;  4FWV A;  3B9Q A;  5EK0 A;  3VM6 A;  4E17 A;  2L6F A;  1NLX A;  3O6X A;  2E87 A;  4XEV A;  5IY5 C;  4OD4 A;  3EZI A;  5A6A A;  2LIG A;  2R7V A;  1MMA A;  3NDB B;  3N0T A;  3U0C A;  2HSB A;  4NQF A;  3HNL A;  5T3T A;  4JZA A;  1NU9 C;  2D4U A;  4G7O F;  1W2W A;  2NPU A;  3JRM O;  2EIL C;  2OQM A;  2Q3T A;  3RF3 A;  3NYL A;  1S7Z A;  2J7P D;  3QW1 A;  2ZXR A;  3K66 A;  4YN0 B;  4EHP A;  2J9U A;  1D1A A;  4KNW A;  2J9V A;  2Q00 A;  3QVY A;  1A7V A;  4CX9 A;  3UR3 C;  2HUJ A;  5KYY A;  4AE4 B;  3NRH A;  4XLN F;  4XTK A;  2ETS A;  4MTG A;  4PJM A;  2W4B A;  4MW3 A;  3M4C A;  1ZHZ A;  3X2Q C;  4OIN F;  2A1D D;  3NYM A;  1OW7 A;  4RDA A;  3C8G D;  1K40 A;  4L6R A;  2B0J A;  4BJ5 A;  4CJG A;  4DRJ B;  5BUO A;  5L0J A;  1H9T A;  2GDC A;  4MND A;  2FAP B;  1JOG A;  2DYR C;  3EFO B;  4E7S A;  5JUA A;  2PFD A;  4XLP F;  3UMI A;  2XXA B;  3LEO A;  4XPX A;  4AL1 A;  3EHM A;  3TOL A;  3TOM A;  1NSG B;  1C03 A;  2Y3B A;  3RVY A;  5FCL A;  5EHH A;  2KYH A;  4AE4 A;  1NBB A;  4BJ1 A;  1R5I D;  3G50 A;  3L1M A;  3JYH A;  3F47 A;  3DM9 B;  3EH2 A;  4JTD B;  1O87 A;  2NSG A;  3RQF A;  3IQT A;  2XSE A;  5F5F A;  1TWC A;  2EPO A;  3GM2 A;  5B3S C;  4JVS A;  3EGD B;  3DWW A;  4AK9 A;  4NTB A;  3UMK A;  5T3W A;  3A9C A;  4E0I A;  4Z9H A;  3U3B A;  4HEA J;  1AEP A;  4DBQ A;  3O39 A;  3JSZ A;  4C3D A;  2L81 A;  5AGF A;  3TQO A;  2XXA A;  1FMW A;  2YL1 A;  5JSL A;  1FR0 A;  1Y4C A;  2HS5 A;  3U2L A;  2HMQ A;  4MVU A;  1LPE A;  1ORY A;  4C3E A;  2NUP A;  3NMI A;  2XLM A;  1TQG A;  3FMS A;  2J46 A;  3C7J A;  3S90 A;  1FAP B;  1BZ4 A;  1Q0M A;  3L8J A;  4JTA B;  4MVZ A;  5JS5 A;  5BQI A;  1ORJ A;  3M4B A;  3NKE A;  3ZQV A;  2LFF A;  3EGD A;  2ZXW C;  2NUT A;  1G5Z A;  1A0B A;  3SXM A;  4YWQ A;  3IEE A;  4XPY A;  2HJM A;  3ZQY A;  3BEH A;  1BBH A;  3S28 A;  3B0V C;  3T9O A;  2ZXP A;  4I44 A;  5KYW B;  2W9Y A;  1ZHX A;  2XLH A;  1Z7Q c;  1EA8 A;  3ZIB A;  4U5F E;  1XZQ A;  4CSA A;  2L6G A;  2UUH A;  2VH3 A;  2X51 A;  4KC9 A;  4QDL A;  4ULV A;  3U5S A;  4YT4 A;  3S0X A;  3B0U X;  2YL7 A;  4D4X A;  1S05 A;  3KPH A;  2A6E F;  4PK4 A;  4BJT A;  1YDI A;  3N24 A;  4XEF A;  5CI8 A;  4DOZ A;  4E7Z A;  2CGE A;  1FFH A;  2GAQ A;  1LS4 A;  1XWJ A;  3EH1 A;  2BC5 A;  4EBB A;  4JTC B;  5FZT A;  3FVY A;  1HMO A;  4BJ6 A;  5A6K A;  4GYT A;  4JEA A;  2R05 A;  4X0R A;  5AC5 A;  2HSQ A;  3LUT B;  2DI3 A;  3WG7 C;  4CS7 A;  1IW7 F;  1FTS A;  2JX0 A;  3ABK C;  1QQ3 A;  3FAJ A;  1PD1 A;  3FXH A;  3KL4 A;  5D92 A;  3MYI A;  3RKO F;  4Q4Z F;  3EGX B;  1JAF A;  2R7O A;  3UGP A;  3H2U A;  3J06 A;  2IXO A;  1U0B B;  2WZG A;  3HNI A;  3LS1 A;  4IGG A;  3O10 A;  2JPU A;  2Q9B A;  3EJN A;  1OXK A;  1TR2 A;  4CS8 C;  2J0X A;  256B A;  4K0D A;  4CDY A;  2ZXO A;  2D5R B;  2OKU A;  2DB4 A;  3AGT A;  3VF0 A;  1M2V A;  2BE5 F;  2YVK A;  1SR2 A;  1WAT A;  2KC3 A;  1LS1 A;  3AG2 C;  2EPL X;  3ECS A;  4K7B A;  3S29 A;  1U89 A;  1RKE A;  3C8G B;  1QZX A;  1V4A A;  3M79 A;  4KBL A;  5L3V A;  3AQC A;  1R4T A;  2CYD A;  4Q7C A;  4PR9 A;  2A6H F;  3MFN A;  2M4E A;  4MQ9 F;  1CGM E;  4EBJ A;  1HE1 A;  1V74 B;  5JP7 A;  4O7G A;  5DVW A;  2W45 A;  1T6Q A;  3CAX A;  4JIO A;  2EPK X;  3DD7 A;  3ZWI A;  2XM4 A;  2X0C A;  3EZH A;  2VAS A;  3ABL C;  5CIV A;  5HSW A;  1G4W R;  1CGO A;  1FNT c;  1RKC A;  5BQG A;  3CEX A;  1Q0G A;  3AG4 C;  4IRU A;  5KYY B;  1EQ1 A;  2VCA A;  3IHU A;  5COM A;  4R32 A;  3RIP A;  2PP4 A;  4MVS A;  3OWT A;  1ZHY A;  2DGJ A;  3GEE A;  3C8G A;  1EKY A;  1YYJ A;  4NTF A;  1OR2 A;  1EI7 A;  2ZPA A;  4CBE A;  4J30 B;  2ICW G;  3POV A;  1C17 M;  1ZHW A;  2C04 A;  2VCC A;  3U3F A;  2WVO A;  4B6I A;  3NG1 A;  1SMY F;  4N6H A;  5KYN A;  3U2M A;  1DOW A;  4CS9 A;  3VAY A;  2DYS C;  1V55 C;  2HZ8 A;  2PNO A;  2OJE D;  3W8I A;  4YK5 A;  1OCC C;  2QY9 A;  5B1A C;  1PCX A;  3EHN A;  4P9F A;  1A41 A;  1D1B A;  4MVO A;  5BQH A;  4MTF A;  2ASR A;  1A7E A;  2LQG A;  1Q0D A;  4JCZ A;  1MMN A;  2J0W A;  2LFD A;  3T4R A;  3V5Z A;  3SXY A;  4D4N A;  3T6J A;  3JTL O;  4G7H F;  5A69 A;  4OIR F;  4MVR A;  2OEX A;  4LDK A;  2WL8 A;  3OEO A;  4H4K C;  5E2Q A;  1MMG A;  1Z63 A;  3UMH A;  1HY5 A;  1QPU A;  1WOL A;  3GAN A;  2BL2 A;  5COG A;  1LKX A;  2OCC C;  3K1H A;  3ZC4 A;  1MQV A;  4BJ5 C;  1LI7 A;  1VTM P;  2MYS A;  2F22 A;  4JJF A;  3SXZ A;  3GM1 A;  3UGO A;  4ONS A;  2Z15 A;  1Z3I X;  3CQZ A;  2L9J A;  2NUP B;  3LJB A;  1AUE A;  3M1C B;  1YZC A;  2MHR A;  3Q7G A;  4W8K A;  1YAU O;  4UDV A;  2R7Q A;  1VLT A;  3DE8 A;  2YLD A;  3PMR A;  4LDQ A;  4NC3 A;  5JT4 A;  4AL0 A;  3KMI A;  2G3V A;  1C02 A;  1QVX A;  4C3B A;  3SEO A;  4U5C E;  5CI9 A;  2OU6 A;  2R7R A;  1VMA A;  2LCH A;  2NUT B;  1M6T A;  2P61 A;  1O3U A;  2FGY A;  2FFH A;  2Q7R A;  3ZDL A;  3EG9 A;  3Q6M A;  4JUR I;  4DRI B;  2Q9C A;  4PFO A;  3MBG A;  1TWA A;  2O9X A;  3E9V A;  5DQZ A;  4EUK B;  1TWH A;  3SXK A;  3T6G B;  2J9B A;  4IAQ A;  3ABM C;  1Y6D A;  3OA1 A;  3JSE O;  4E18 A;  3R7C A;  1QKR A;  4HE8 D;  4PJL A;  2QTV A;  3W4Y A;  1UG7 A;  4DBR A;  1GQA A;  2GA0 A;  2UUI A;  2ZD9 A;  1OR3 A;  1YZA A;  3ITF A;  3NMK A;  1NFN A;  2AP3 A;  1T01 A;  1E2X A;  3B71 A;  5T1D B;  3TJ6 A;  1IZM A;  2XRH A;  2HKV A;  3GWL A;  1I4Y A;  2KQ9 A;  2A68 F;  1NG1 A;  3M15 A;  4YL0 A;  3G4Z A;  5DS6 A;  3WHN A;  4NY3 A;  5K0I A;  4G7Z F;  2XL4 A;  3L0I A;  4P6I C;  5L0F A;  1FMV A;  1TWG A;  3NKD A;  3BRJ A;  4H54 A;  1J8Y F;  4IB4 A;  2KK1 A;  1SZI A;  2KW3 C;  4YL1 A;  2RSE B;  1WN0 A;  3GEH A;  2R03 A;  1HW2 A;  3QTH A; 
#chains in the Genus database with same CATH homology
 3AG3 C;  3LLK A;  4YT2 A;  2J45 A;  3SNH A;  4IWB A;  1VK5 A;  1WGW A;  3K1I C;  4FX5 A;  3NYJ A;  3TD7 A;  4A2N B;  3CZ6 A;  4LLE A;  1M2V B;  3QMK A;  3W2V A;  1NU7 D;  3AQB A;  4PJN A;  3L34 A;  4JW1 A;  1BR1 A;  4C7O B;  1OCO C;  2V3C C;  2HV7 A;  4I3M A;  2P6V A;  1BR2 A;  5DLJ A;  2V26 A;  4JJG A;  3LES A;  3DAF A;  3B0P A;  3ASN C;  1KU2 A;  3LAY A;  4FES A;  2A69 F;  5KYU B;  3AG1 C;  4HFF B;  4CS8 A;  4C7O A;  4PFP A;  2J7P A;  4RBN A;  2PX3 A;  5KYX A;  2JD3 A;  4AX2 A;  4OIQ F;  4Q5S F;  3Q6N A;  5DS4 A;  2OG2 A;  5DS5 A;  5KYU A;  2R7X A;  3K7D A;  4RD9 A;  1D0Y A;  1ST6 A;  1OKK D;  3SYN A;  2IXM A;  3FDQ A;  4DVZ A;  1G8X A;  3GOD A;  3DM5 A;  2YEV A;  3N2Z B;  2IOQ A;  1VYI A;  1O5H A;  2H7B A;  3X1O A;  4U5D E;  2CNW D;  4IAO A;  3HLZ A;  4YT5 A;  4GEH A;  2IYL D;  4OIP F;  2I8B A;  1J8M F;  1SF8 A;  2EIM C;  1FFT C;  4JCH A;  3DXJ F;  4J32 B;  2PX0 A;  3EG9 B;  3RH3 A;  2KJG A;  4XWJ A;  2Y3D A;  3MLG A;  4I1M A;  4BG0 A;  4YT8 A;  1ZHT A;  2EIN C;  2R7W A;  2WZF A;  2WZL A;  3I5P A;  3EQL F;  1ZU5 A;  4I1O B;  1Z6A A;  3PHF 2;  2Y3G A;  4KNV A;  3SP1 A;  2KGO A;  2WVQ A;  2G3K A;  1JPJ A;  4IJJ A;  4OIO F;  3DAG A;  3V7O A;  1M2O A;  1N1C A;  3MX3 A;  2IXP A;  3F46 A;  1JPN A;  2GFH A;  2P7V A;  1MND A;  4U5G A;  2EIK C;  1VYK A;  2G62 A;  3WOD F;  3KKB A;  4LER A;  2MWQ A;  2WVN A;  2VB6 A;  3EFO A;  3EPV A;  3LEV A;  2R7T A;  4U5H A;  3ASO C;  1OCZ C;  1PD0 A;  4ZLD A;  3LS0 A;  5EGY A;  1M56 C;  5E3A A;  4O6Y A;  3KH2 A;  4CIH A;  2H7O A;  3Q7L A;  4YJW A;  4QI0 A;  4CSA C;  4O6N A;  4PJJ A;  1M57 C;  1QLE C;  3H65 A;  2CDQ A;  4G0H A;  2HV6 A;  4DVY P;  4LLC A;  3UNG C;  3HTK C;  1ZU4 A;  1OCR C;  1MMD A;  3E70 C;  4BJ6 C;  4F4B A;  3S27 A;  5DQT A;  4O79 A;  5D91 A;  2Q9A A;  2C03 A;  1TKN A;  2KNH A;  4LAC B;  1RJ9 B;  5KYX B;  3HJC A;  1BR4 A;  2R7S A;  4KI2 A;  3T6B A;  3VYW A;  5B1B C;  2NG1 A;  3ZVR A;  4BEJ A;  4OD5 A;  3K6B A;  2J9W A;  1OKK A;  1D0Z A;  3RFY A;  2PF4 E;  2YHS A;  5E33 A;  1V54 C;  1D1C A;  3DJU B;  2W4M A;  2WB7 A;  1RJ9 A;  2H7V C;  2IXN A;  4ULW A;  3RYL A;  1Z5Z A;  2YZS A;  4N06 A;  2CNW A;  2Y3H A;  5E3C A;  3ZSU A;  1NZE A;  2R7U A;  3I4U A;  3ZG1 A;  3JCU Q;  3SZR A;  2LSE A;  5L3Q A;  3DZA A;  4EWC A;  5F5H A;  4ZLC A;  3DJN B;  3I5Q A;  4QI2 A;  1LVK A;  2EIJ C;  3FHD A;  3DMD A;  3EGX A;  4M63 A;  4U5E E;  1D0X A;  2Y39 A;  1MNE A;  4WJ0 A;  4ANJ A;  1Z23 A;  3W8H A;  3QZC A;  3JRT A;  3W2W A;  1ZYR F;  3K33 A;  3LLI A;  3JT1 A;  2Y69 C;  4CS9 C;  3CSK A;  4U5B E;  2CW0 F;  3LNR A;  4HFK B;  1VOM A;  4FWV A;  3B9Q A;  3O6X A;  2E87 A;  5IY5 C;  4OD4 A;  3EZI A;  2R7V A;  1MMA A;  3NDB B;  3N0T A;  5T3T A;  4JZA A;  1NU9 C;  4G7O F;  1W2W A;  2EIL C;  2Q3T A;  3NYL A;  1S7Z A;  2J7P D;  2ZXR A;  3K66 A;  4YN0 B;  2J9U A;  1D1A A;  4KNW A;  2J9V A;  3UR3 C;  5KYY A;  4AE4 B;  3NRH A;  4XLN F;  4XTK A;  4PJM A;  2W4B A;  3X2Q C;  1ZHZ A;  4OIN F;  2A1D D;  3NYM A;  4RDA A;  4BJ5 A;  2B0J A;  5BUO A;  4MND A;  2DYR C;  3EFO B;  4E7S A;  2PFD A;  4XLP F;  3UMI A;  2XXA B;  3EHM A;  2Y3B A;  5FCL A;  5EHH A;  4AE4 A;  4BJ1 A;  3JYH A;  3F47 A;  3DM9 B;  3EH2 A;  1O87 A;  2XSE A;  5F5F A;  1TWC A;  5B3S C;  4JVS A;  3EGD B;  4AK9 A;  3UMK A;  5T3W A;  4HEA J;  4DBQ A;  3O39 A;  3JSZ A;  4C3D A;  2L81 A;  2XXA A;  1FMW A;  4C3E A;  2NUP A;  2J46 A;  3NKE A;  3EGD A;  2ZXW C;  2NUT A;  4YWQ A;  3IEE A;  3S28 A;  3B0V C;  2ZXP A;  4I44 A;  5KYW B;  2W9Y A;  1ZHX A;  3ZIB A;  4U5F E;  4CSA A;  2VH3 A;  2X51 A;  4KC9 A;  4QDL A;  4YT4 A;  3S0X A;  3B0U X;  4BJT A;  2A6E F;  4PK4 A;  3N24 A;  5CI8 A;  4E7Z A;  4DOZ A;  2CGE A;  1FFH A;  3EH1 A;  4EBB A;  3FVY A;  4BJ6 A;  4GYT A;  4X0R A;  3WG7 C;  4CS7 A;  1FTS A;  1IW7 F;  3ABK C;  3FAJ A;  3KL4 A;  5KYW A;  1PD1 A;  5D92 A;  3RKO F;  4Q4Z F;  3EGX B;  2R7O A;  3UGP A;  2IXO A;  2WZG A;  3LS1 A;  2Q9B A;  3EJN A;  1TR2 A;  4CS8 C;  2J0X A;  4K0D A;  2ZXO A;  2D5R B;  1M2V A;  2BE5 F;  1LS1 A;  3AG2 C;  3ECS A;  4K7B A;  3S29 A;  1QZX A;  4KBL A;  5L3V A;  3AQC A;  4Q7C A;  2A6H F;  2M4E A;  4MQ9 F;  4O7G A;  5DVW A;  2W45 A;  3DD7 A;  3EZH A;  2VAS A;  3ABL C;  5HSW A;  3AG4 C;  4IRU A;  5KYY B;  3RIP A;  2PP4 A;  3OWT A;  1ZHY A;  2DGJ A;  2ZPA A;  4CBE A;  4J30 B;  1ZHW A;  2C04 A;  2WVO A;  4B6I A;  3NG1 A;  1SMY F;  5KYN A;  4CS9 A;  3VAY A;  2DYS C;  1V55 C;  3W8I A;  1OCC C;  2QY9 A;  5B1A C;  1PCX A;  3EHN A;  1D1B A;  1MMN A;  2J0W A;  3T4R A;  3T6J A;  4G7H F;  4OIR F;  2WL8 A;  3OEO A;  4H4K C;  5E2Q A;  1MMG A;  1Z63 A;  3UMH A;  3GAN A;  1LKX A;  2OCC C;  3K1H A;  3ZC4 A;  4BJ5 C;  2MYS A;  4JJF A;  3UGO A;  3M1C B;  2Z15 A;  1Z3I X;  2L9J A;  2NUP B;  3LJB A;  3CQZ A;  3POV A;  3Q7G A;  4W8K A;  2R7Q A;  3PMR A;  3KMI A;  2G3V A;  4C3B A;  3SEO A;  4U5C E;  5CI9 A;  2R7R A;  1VMA A;  2NUT B;  2FGY A;  2FFH A;  3EG9 A;  3Q6M A;  4JUR I;  2Q9C A;  4PFO A;  1TWA A;  2O9X A;  3E9V A;  5DQZ A;  1TWH A;  3ABM C;  3OA1 A;  4HE8 D;  4PJL A;  2QTV A;  4DBR A;  3ITF A;  4O6M A;  5T1D B;  1IZM A;  2XRH A;  2KQ9 A;  2A68 F;  1NG1 A;  5DS6 A;  4NY3 A;  4G7Z F;  2XL4 A;  3L0I A;  4P6I C;  1FMV A;  1TWG A;  3NKD A;  1J8Y F;  1SZI A;  2KW3 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...