3LS1A

Crystal structure of cyanobacterial psbq from synechocystis sp. pcc 6803 complexed with zn2+
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
133
structure length
133
Chain Sequence
GPLGSCSSPQVEIPTTYSPEKIAQLQVYVNPIAVARDGMEKRLQGLIADQNWVDTQTYIHGPLGQLRRDMLGLASSLLPKDQDKAKTLAKEVFGHLERLDAAAKDRNGSQAKIQYQEALADFDSFLNLLPQAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photosynthesis
molecule keywords Sll1638 protein
publication title Crystal Structure of PsbQ from Synechocystis sp. PCC 6803 at 1.8 A: Implications for Binding and Function in Cyanobacterial Photosystem II
pubmed doi rcsb
source organism Synechocystis sp.
total genus 50
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05757 PsbQ Oxygen evolving enhancer protein 3 (PsbQ)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.290 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3ls1A00
3LS1A 2MWQA 3ZSUA 3LS0A 1VYKA 1NZEA 3RFYA 3JCUQ
chains in the Genus database with same CATH superfamily
3S0XA 4C3DA 2LIGA 2L9JA 3I4UA 3WAQA 2NUPA 2H8AA 2R7QA 4YK5A 3RQFA 5DS5A 3B0UX 1EQ1A 1YVIA 1D0YA 1YZAA 2XLWA 1J8MF 1Y6DA 4MVOA 4CDVA 1E85A 2J8WA 1Q0FA 2J9UA 4RBNA 2FFHA 2Y3BA 4MVSA 2PBEA 3EH1A 1ZHWA 2XXAB 1YLMA 2R25A 4Q4ZF 1FMWA 3AG3C 3SXKA 1I5NA 3BEHA 2J46A 2YL3A 3HNIA 4EBBA 3OA1A 1E84A 2Q9AA 2KGOA 4AE4A 1SF8A 3GM1A 4FX5A 2X0CA 2VH3A 1JRAA 1HMDA 5GPGB 2WZFA 1Z5ZA 4I1OB 2NSGA 2LFDA 2P61A 2GFHA 1OCRC 5E2QA 2WVNA 4JRZA 3TQOA 2YL1A 3L0IA 4BJ5A 2WZLA 3A11A 3C18A 3DXJF 2Q4FA 3DAFA 2AU5A 3B71A 1F1MA 1D0XA 1APCA 2CNWA 2HJ3A 1T6UA 4EHPA 2R7XA 2HMQA 1T6IA 2X51A 3LLKA 4J32B 3M4CA 3LNRA 1WTYA 1Q0DA 4OD4A 1H9GA 2J0XA 3SP1A 3QW0A 1T01A 1OCZC 2HZ8A 4N6HA 3JSZA 5L0DA 2F22A 3FAPB 4DRJB 3VM6A 4CBEA 1HMOA 1OQCA 3Q7GA 4JEBA 3LEOA 4JKVA 4K7BA 3B0VC 2XL6A 1Q0KA 1YA9A 3AGTA 3WODF 4AL1A 4XLPF 3T4RA 4CSAC 1WGWA 2I8BA 1QLEC 2OJQA 2YLGA 3DI5A 4NTBA 4CX9A 3PDMP 1O3UA 2KNHA 3G4ZA 1ZW3A 4KNVA 4ANJA 3K66A 5KYYB 2GAQA 2YL7A 5A6BD 1UFBA 3CSKA 3DM9B 3JYHA 4U5FE 4ZLCA 5FCLA 2MWQA 3JRMO 3QVYA 2VCAA 2OOCA 2VB6A 1M2VB 3KMIA 3AG4C 3CZ6A 2DYSC 4DBRA 3R7CA 1E83A 3RYLA 3HJCA 1ORJA 3AGUA 1U89A 4CS9C 1U0BB 3ZC4A 4LLCA 4A2NB 4MVRA 1SYQA 2JD3A 2G3KA 1AEPA 1G4US 1MMAA 1BR1A 1YDIA 2PNOA 2YKZA 3LJBA 4U9DA 1FAPB 1DOWA 4JJGA 2KSFA 2NUTA 1MMNA 4N6CA 4JJFA 3H2VA 1FTSA 4YT8A 3LEVA 4PJJA 4DRHB 1ZHXA 3T6JA 1UG7A 4U5DE 5F5HA 1V55C 2MHRA 5BQHA 2G3VA 3HNKA 3M1CB 2Q7RA 5L3QA 5KYXB 4MW8A 1YZCA 4ONSA 5E3CA 5KYWA 4BJ6C 2YL0A 2PX0A 3B29A 3DMDA 3LUTB 3O6XA 2QUPA 4JEAA 5L0FA 3K1IC 2HKVA 3NYLA 4LERA 2ASRA 4Z9IA 1JAFA 1WOLA 3TOMA 2P1AA 1PD1A 2AWCA 2EINC 3U3BA 4QI2A 2CNWD 3DJUB 1MMDA 2XL8A 4XPWA 1TWGA 3MYIA 1YAUO 3DE9A 4CDYA 5KYWB 3SXMA 1SMYF 3EGDA 3SNHA 2XM0A 1HE9A 3NKEA 2HUJA 1NLXA 4JTCB 3T9OA 4NTAA 2R03A 3GWLA 4MTOA 4M63A 3TJ5A 2BC5A 4GQHA 2YWAA 3M15A 1BBHA 2LSEA 4J7TA 1Z7Qc 2PP4A 1NBBA 2GWWA 3RVZA 2RD9A 3U2MA 1EI7A 4ULWA 4E17A 2PF4E 3HTKC 5EGYA 3C63A 1LVKA 2Q9BA 4NC3A 4CSAA 2QLAA 1LS4A 2NG1A 2OEVA 4CS8A 4UDVA 1HW1A 1OCOC 1C03A 1H9TA 2MYSA 2J0WA 4H54A 1T6QA 5TJ5E 4Z9HA 2DB4A 3RFYA 3U8VA 2IXPA 5COMA 2QTVA 2R9RB 1HW2A 1JOGA 4NQFA 3V5ZA 3IQTA 5T3WA 2YLDA 3JT1A 3L8IA 3WG7C 3ASOC 2W4BA 4LACB 2QNLA 4YN0B 5DQTA 5L3VA 4E0HA 4MVMA 4U5CE 3S29A 3BRJA 3NYMA 2XXAA 1FMVA 2YQYA 1MNDA 5A69A 2A1DD 2B0HA 2HSQA 2W9YA 1NU9C 4CIHA 2LK4A 1NFOA 4LDKA 3S28A 2LFFA 4JTDB 4PK4A 4PACA 5L0CA 5B1BC 2J7PD 3NMKA 3GWNA 2ZXOA 3V5XA 1TR2A 3CEXA 3ECSA 2V3CC 4XPYA 2EPKX 4IWBA 5T3TA 3GEHA 4BJ6A 1ZHYA 1A7VA 1YYXA 1GGQA 2OU6A 4FAPB 5A6JA 2XS8A 4IAQA 1RCPA 2Z15A 4C3EA 2EPMX 4N4WA 4AX2A 5COFA 3TULA 1AUEA 3MX3A 5EK0A 1H7IA 3IQ6A 3EJNA 4G7ZF 2UUIA 3U3FA 3C7JA 3VAYA 1OKKD 4O6YA 4X0RA 4WGZA 3SZRA 2XLEA 1OW6A 1JR8A 1SR2A 4EUKB 1AVOB 3HNJA 4HEAJ 5KYUB 3FOPA 1J8YF 2C04A 4HE8D 3CQZA 1VB5A 5IY5C 1Z63A 5CIVA 3H2UA 1GQAA 3GM3A 1LIHA 2G62A 2AVKA 2WB7A 3LS1A 4LDRA 4RDAA 4U9EA 5E3AA 4EKWA 1HE1A 1Q0MA 3ZQYA 3F46A 2IXNA 2KYHA 5KYYA 4FESA 2A68F 4O7GA 1O5HA 1VMAA 4PJNA 1TWCA 5DQZA 1G8XA 3PCVA 1YYJA 1M2VA 4W8PA 3ZTMA 4YT2A 4Q7CA 2EIJC 3KYJA 3DJNB 4D4NA 2R02A 2NPUA 3EPVA 3KL4A 3OEOA 5HSWA 3FDQA 5DS4A 5BQIA 3US6A 4RD9A 3U0CA 2IBFA 1C17M 2LP4A 4Z9JA 4OIQF 3ZVRA 4YT5A 1ZHTA 2UUHA 2DGJA 3ZTZA 1W2WA 2ZXRA 2R7SA 3MLGA 4J7YA 1MNEA 2W4MA 5T1DB 5AGFA 1FFHA 1IW7F 3GEEA 1WN0A 1G5ZA 2XS1A 4QI0A 1S7ZA 2ZXPA 1S05A 3N24A 4WJ0A 2H7OA 4C7OA 1ZU5A 2QY9A 2EPNA 1TQGA 4EBKA 2L7AA 4P9FA 1ZVZA 3HKKA 3KPHA 2HFIA 4O79A 2PX3A 4PJLA 5KYXA 1D1CA 3ITFA 3ASNC 3X1OA 2KC3A 2XL4A 3RH3A 4DVZA 4G7OF 1RMVA 1VK5A 4GEHA 2EILC 4XEKA 2KW3C 2LQGA 4U5EE 3UR3C 3E9VA 4I44A 1D1AA 2GA0A 1L3PA 4C7OB 3QVZA 1WASA 3LNMB 4JVSA 2QE9A 3W8HA 3LLIA 1YARO 3AG1C 2V26A 2HMZA 1JMWA 2YLIA 5F5FA 2OCCC 4MTGA 4LDQA 3O55A 3MBGA 2GDCA 5COGA 1GM5A 3K6BA 1TFKB 1BZ4A 4K1OA 5DLJA 1KTMA 1VLSA 5BUOA 2P0NA 4Q5SF 4XEVA 2YZSA 4XQ1A 3DD7A 3U9JA 5K0IA 4PR9A 2PFDA 3C8GB 3NDBB 1D0ZA 2KK1A 1CGME 4U5HA 1FFTC 3B9QA 3RQGA 1OR3A 2WVQA 3FAJA 4YJWA 3NRHA 4XLNF 1E86A 2OQMA 4OIPF 1A41A 3ABLC 3EHNA 3KYIA 4MTFA 2P7VA 4U5BE 2XLDA 1K05A 4IRUA 4OIRF 2VCBA 3AJMA 4O6NA 4BEJA 4KBLA 4K0DA 5D91A 2A69F 2OJED 2HJMA 5DVWA 5L0JA 3ABKC 2D5RB 3O39A 4JE9A 1VYKA 4JIOA 4IGGA 3EFOB 4KI2A 1PD0A 1O87A 3JTLO 4BJ5C 5L0GA 4XEFA 5JP7A 3IQCA 3N0TA 4PFPA 4F4BA 2XLVA 4NTFA 4BJ1A 1LI7A 4JW1A 3SEOA 1ZYRF 2VCCA 5CI8A 4H4KC 1YA7O 1LPEA 2Y39A 2Q3TA 1FR0A 3K1HA 3R2PA 3JZ0A 4XWJA 4HFKB 4CS7A 5JVEA 2EIMC 2XLMA 1NZEA 4ULVA 1LI5A 2A6HF 5EHHA 4DRIB 4BG0A 1MQVA 1T9KA 2Q9CA 3Q7LA 1VTMP 1A7EA 3EG9B 3M4BA 2NSFA 3K33A 3EH2A 1LKXA 1I4YA 1QPUA 256BA 4CS9A 5JLIA 1M56C 3AG2C 1EA8A 3S84A 2XLHA 1C02A 1BR4A 3HNLA 1TFOB 2IYLD 2VC9A 3RIPA 2JX0A 4KC9A 3UGOA 3ZQVA 1V54C 2CCYA 2IOQA 1WATA 2J9WA 2R05A 2Q00A 2Y3GA 3RVYA 4MQ9F 1Q0GA 3UGPA 1NG1A 3TD7A 2JPUA 1TWHA 2J9VA 1OXBA 4G0HA 2ICWG 2CDQA 2LCHA 2XM4A 3DAGA 4PFOA 5F28E 3AOUA 5B1AC 3ZIBA 5A6BA 2M64A 4OINF 3UMKA 1CPQA 2R7RA 3GANA 1VYIA 3EGXB 1RJ9A 2ZD9A 4JURI 5KYUA 5HV9A 4CIPA 3J06A 5JRAA 4NY3A 5JT4A 1KNYA 1D1BA 1KU2A 3K1IA 1TKNA 1G4WR 5D92A 2CYDA 3ABMC 4JCZA 1ST6A 1XWJA 1RKCA 4IARA 4MVQA 3RQEA 3U5SA 1R4TA 4XPXA 3AQCA 3FOOA 1OXKA 4AK9A 4O6MA 1XZQA 2O9XA 3QZCA 1RJ9B 4BJTA 3M79A 4P6IC 1M57C 1YJGA 2A0BA 1Z6AA 2L6FA 3IPMO 4JZAA 2P6VA 1H6GA 2BL2A 1B68A 1SZIA 2CGEA 1TWAA 2J9BA 1GS9A 1L7CA 2OG2A 3VYWA 5CI9A 4CJOA 4BEMJ 4L6RA 2H7VC 3E70C 3LAYA 3H65A 4JCHA 3JSEO 2NUPB 3C62A 4E7ZA 3T6BA 3TOLA 1EKYA 5JUAA 1Z3IX 5FZTA 3S90A 2CW0F 2HV6A 3O10A 1QVXA 2C03A 3K7DA 3GEIA 3OWTA 1NU7D 4DJ9A 3L1MA 1HY5A 4LLEA 2YRFA 2A6EF 4XTKA 1LM3B 3PMRA 4AE4B 3S27A 3T6GB 3QTHA 4DXWA 2YEVA 3ATPA 3LS0A 4DBQA 4FWVA 2HV7A 2Y3DA 1BR2A 3UNGC 4EBJA 1M2OA 1Y4CA 3DE8A 1ORSC 2OEXA 1QKRA 2FAPB 1QSPA 3SXYA 3PHF2 4MW3A 2A0UA 4NCQA 3X2QC 1Z23A 5E33A 1ZW2A 3U9MA 5DS6A 1E2XA 2J45A 4CS8C 3ZG1A 4C3BA 2B0JA 2R7UA 3TK0A 5JSLA 1CPRA 3QW1A 1I4ZA 1ZZPA 2YVKA 4E18A 1N1CA 3C8GA 3GORA 3NKDA 3W4YA 4E7SA 1CGOA 4EWCA 3GODA 5KYNA 2ZPAA 5B3SC 5BQGA 5JS5A 3FMSA 2YHSA 4YL3A 2I15A 4P9TA 3UMIA 2KJGA 5AC4A 3POVA 2Y69C 3LESA 3L34A 1M6TA 3ZDLA 1ZU4A 3QMKA 3NMIA 4I1MA 4E0IA 3JCUQ 4OIOF 3G4XA 2Y3HA 3EHMA 4YL0A 1A7DA 4MVUA 2R7VA 2L6GA 2R7OA 4EIYA 1R5ID 2OKUA 1U6HA 3V5YA 3A9CA 3MYFA 3EFOA 3FXHA 2FGYA 3U8PA 2R7WA 2J7PA 1V74B 4J30B 1OW7A 1PV3A 3FHDA 3JRTA 5A6KA 3EZHA 2VASA 3DKAA 3DM5A 4N06A 1OW8A 2L6HA 2IXMA 4IB4A 1QQ3A 2NUTB 3EQLF 3NG1A 3JYYA 4JC7A 3Q6NA 4WGYA 1VLTA 3CAXA 4IAOA 4MVZA 2WZGA 3S9OA 4DOZA 3V7OA 2ZXWC 3EG9A 2RSEB 5B3IA 5L0IA 3Q6MA 2WVOA 4YL1A 3G50A 1OKKA 1NFNA 4G78A 4WABA 4D4XA 2EIKC 4IJJA 1K04A 3NMJA 2IM8A 3GM2A 2D4UA 2XLOA 2E87A 1ZHZA 4A4AA 3I5PA 1LE4A 1ORYA 1DOVA 1JPJA 1LE2A 2DYRC 1CGNA 2HS5A 3DZAA 3RF3A 2DI3A 2ETSA 1RXQA 3DWWA 2WL8A 3U2LA 3FVYA 2W45A 1WWPA 3I5QA 4I3MA 4B6IA 3IHUA 4CJGA 4ER9A 4YWQA 5L0HA 3B0PA 1NSGB 1T5OA 2HSBA 3KH2A 3N2ZB 3TJ6A 4U5GA 4W8KA 1V4AA 1OCCC 2XRHA 3EGDB 3EGXA 1LS1A 2L81A 2BE5F 3NYJA 4JTAB 4MS2A 3ZSUA 4DVYP 3SYNA 3C8ZA 3RKOF 1K40A 3RW0A 1PCXA 1FNTc 2XSEA 4G7HF 2IXOA 3VRCA 2R7TA 4CDAA 3AQBA 2KQ9A 3HLZA 1JPNA 2EPOA 3IQ5A 1QZXA 4KNWA 4PJMA 3SXZA 3F47A 3L8JA 1RKEA 4YT4A 3C8GD 4R32A 3W8IA 2TMVP 3WHNA 5A6AA 1VOMA 2H7BA 2LD6A 3W2WA 3VF0A 4AL0A 4BPMA 4GYTA 4QDLA 1OR2A 5AC5A 3KKBA 4ZLDA 3W2VA 1A0BA 4MNDA 2M4EA 1MMGA 3ZWIA 1BDJB 4HFFB 3UMHA 2EPLX 1XZPA 3IEEA 4OD5A 2AP3A 1IZMA 3MFNA 2AWYA 3EZIA 1RKEB
chains in the Genus database with same CATH topology
3S0XA 4C3DA 5KYNA 2L9JA 3I4UA 5DS5A 2NUPA 2R7QA 3B0UX 1D0YA 1J8MF 4RBNA 2J9UA 2FFHA 2Y3BA 3EH1A 1ZHWA 2XXAB 4Q4ZF 1FMWA 3AG3C 2J46A 3OA1A 2Q9AA 2KGOA 4AE4A 1SF8A 4FX5A 2VH3A 3S28A 4XLPF 2WZFA 1Z5ZA 2GFHA 1OCRC 5E2QA 2WVNA 3L0IA 4BJ5A 2WZLA 3DXJF 3DAFA 1D0XA 2CNWA 2R7XA 3LLKA 2X51A 4J32B 3LNRA 4OD4A 2J0XA 3SP1A 1OCZC 3JSZA 4CBEA 3Q7GA 4K7BA 3B0VC 3WODF 3T4RA 4CSAC 1WGWA 2I8BA 1QLEC 2KNHA 4KNVA 4ANJA 3K66A 5KYYB 3CSKA 4U5FE 3DM9B 3JYHA 4ZLCA 5FCLA 2MWQA 2VB6A 1M2VB 3KMIA 3AG4C 3CZ6A 2DYSC 4DBRA 3RYLA 3HJCA 4CS9C 3ZC4A 4LLCA 4A2NB 2JD3A 2G3KA 1MMAA 1BR1A 3LJBA 4JJGA 2NUTA 1MMNA 4JJFA 1FTSA 4YT8A 3LEVA 4PJJA 1ZHXA 3T6JA 4U5DE 5F5HA 1V55C 2G3VA 5L3QA 5KYXB 5KYWA 5E3CA 4BJ6C 2PX0A 3DMDA 3O6XA 3K1IC 3NYLA 4LERA 1PD1A 2EINC 4QI2A 2CNWD 3DJUB 1MMDA 1TWGA 5KYWB 1SMYF 3EGDA 3SNHA 3NKEA 4M63A 2LSEA 2PP4A 4ULWA 2PF4E 3HTKC 5EGYA 1LVKA 2Q9BA 4CSAA 2NG1A 4CS8A 1OCOC 2MYSA 2J0WA 3RFYA 2IXPA 2QTVA 5T3WA 3JT1A 3WG7C 4EBBA 3ASOC 2W4BA 4LACB 5DQTA 4YN0B 5L3VA 4U5CE 3S29A 3NYMA 2XXAA 1FMVA 1MNDA 2A1DD 2W9YA 1NU9C 4CIHA 4PK4A 5B1BC 2J7PD 2ZXOA 2V3CC 1TR2A 3ECSA 4IWBA 5T3TA 4BJ6A 1ZHYA 2Z15A 4C3EA 4AX2A 3MX3A 3EJNA 4G7ZF 3VAYA 1OKKD 4O6YA 4X0RA 3SZRA 4HEAJ 5KYUB 1J8YF 2C04A 4HE8D 3CQZA 5IY5C 3LS1A 4RDAA 2G62A 2WB7A 5E3AA 3F46A 2IXNA 5KYYA 4FESA 2A68F 4O7GA 1O5HA 1VMAA 4PJNA 1TWCA 5DQZA 1G8XA 1M2VA 4YT2A 4Q7CA 2EIJC 3DJNB 5HSWA 3OEOA 3FDQA 3EPVA 3KL4A 5DS4A 4RD9A 4OIQF 3ZVRA 4YT5A 1ZHTA 2R7SA 2DGJA 1W2WA 2ZXRA 3MLGA 1MNEA 2W4MA 5T1DB 1FFHA 1IW7F 4QI0A 1S7ZA 2ZXPA 3N24A 4WJ0A 2H7OA 4C7OA 1ZU5A 2QY9A 4O79A 2PX3A 4PJLA 5KYXA 1D1CA 3ITFA 3ASNC 3X1OA 4G7OF 2XL4A 3RH3A 4DVZA 1VK5A 4GEHA 2EILC 2KW3C 4U5EE 3UR3C 3E9VA 4I44A 1D1AA 4C7OB 4JVSA 4YT4A 5F5FA 3LLIA 3AG1C 2V26A 2OCCC 3K6BA 5DLJA 5BUOA 4Q5SF 2YZSA 3DD7A 2PFDA 3NDBB 1D0ZA 4U5HA 1FFTC 3B9QA 2WVQA 3FAJA 4YJWA 3NRHA 4XLNF 3ABLC 3EHNA 2P7VA 4U5BE 4IRUA 4OIRF 4O6NA 4BEJA 4KBLA 4K0DA 5D91A 2A69F 5DVWA 3ABKC 2D5RB 3O39A 1VYKA 3EFOB 4KI2A 1PD0A 1O87A 4BJ5C 3N0TA 4PFPA 4F4BA 4BJ1A 4JW1A 3SEOA 1ZYRF 5CI8A 4H4KC 2Y39A 2Q3TA 3K1HA 4XWJA 4HFKB 4CS7A 2EIMC 1NZEA 2A6HF 5EHHA 4BG0A 2Q9CA 3Q7LA 3EG9B 3K33A 3EH2A 1LKXA 4CS9A 1M56C 3AG2C 1BR4A 2IYLD 3RIPA 4KC9A 3UGOA 1V54C 2IOQA 2J9WA 2Y3GA 4MQ9F 1NG1A 3TD7A 1TWHA 2J9VA 4G0HA 4PFOA 2CDQA 3DAGA 5B1AC 3ZIBA 3UGPA 4OINF 2R7RA 3UMKA 3GANA 1VYIA 3EGXB 1RJ9A 4JURI 5KYUA 4NY3A 1KU2A 1D1BA 1TKNA 5D92A 3ABMC 1ST6A 3AQCA 4AK9A 4O6MA 2O9XA 3QZCA 1RJ9B 4BJTA 4P6IC 1Z63A 1M57C 4JZAA 1Z6AA 2P6VA 3M1CB 1SZIA 2CGEA 1TWAA 2OG2A 3VYWA 5CI9A 2H7VC 3E70C 3LAYA 3H65A 4JCHA 2NUPB 4E7ZA 3T6BA 1Z3IX 2CW0F 2HV6A 2C03A 3K7DA 3OWTA 1NU7D 4LLEA 2A6EF 4XTKA 4AE4B 3PMRA 3S27A 2YEVA 3LS0A 4DBQA 4FWVA 2HV7A 2Y3DA 1BR2A 3UNGC 1M2OA 3PHF2 3X2QC 1Z23A 5E33A 5DS6A 2J45A 4CS8C 3ZG1A 4C3BA 2B0JA 2R7UA 1N1CA 3NKDA 4E7SA 4EWCA 3GODA 2ZPAA 5B3SC 2YHSA 3UMIA 2KJGA 3POVA 2Y69C 3LESA 3L34A 1ZU4A 3QMKA 4I1MA 3JCUQ 4OIOF 2Y3HA 3EHMA 2R7VA 2R7OA 3EFOA 2FGYA 2R7WA 2J7PA 4J30B 3FHDA 3JRTA 3EZHA 2VASA 3DM5A 4N06A 2IXMA 2NUTB 3EQLF 3NG1A 3Q6NA 4IAOA 2WZGA 4DOZA 3V7OA 2ZXWC 3EG9A 3Q6MA 2WVOA 1OKKA 2EIKC 4IJJA 2E87A 1ZHZA 4OIPF 3I5PA 2DYRC 3DZAA 1JPJA 2WL8A 3FVYA 2W45A 3I5QA 4I3MA 4B6IA 4YWQA 3B0PA 3N2ZB 3KH2A 4U5GA 4W8KA 1OCCC 2XRHA 3EGDB 3EGXA 1LS1A 2L81A 2BE5F 3NYJA 3ZSUA 4DVYP 3SYNA 3RKOF 1PCXA 2XSEA 4G7HF 2IXOA 2R7TA 3AQBA 2KQ9A 3HLZA 1JPNA 1QZXA 4KNWA 4PJMA 3F47A 3W8IA 1VOMA 2H7BA 3W2WA 4GYTA 4QDLA 4ZLDA 3KKBA 3W2VA 4MNDA 2M4EA 1MMGA 4HFFB 3UMHA 4OD5A 3IEEA 1IZMA 4I1OB 3EZIA 3W8HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LS1 A;  2MWQ A;  3ZSU A;  3LS0 A;  1VYK A;  1NZE A;  3RFY A;  3JCU Q; 
#chains in the Genus database with same CATH topology
 3S0X A;  4C3D A;  2LIG A;  2L9J A;  3I4U A;  3WAQ A;  2NUP A;  2H8A A;  2R7Q A;  4YK5 A;  3RQF A;  5DS5 A;  3B0U X;  1EQ1 A;  1YVI A;  1D0Y A;  1YZA A;  2XLW A;  1J8M F;  1Y6D A;  4MVO A;  4CDV A;  1E85 A;  2J8W A;  1Q0F A;  2J9U A;  4RBN A;  2FFH A;  2Y3B A;  4MVS A;  2PBE A;  3EH1 A;  1ZHW A;  2XXA B;  1YLM A;  2R25 A;  4Q4Z F;  1FMW A;  3AG3 C;  3SXK A;  1I5N A;  3BEH A;  2J46 A;  2YL3 A;  3HNI A;  4EBB A;  3OA1 A;  1E84 A;  2Q9A A;  2KGO A;  4AE4 A;  1SF8 A;  3GM1 A;  4FX5 A;  2X0C A;  2VH3 A;  1JRA A;  1HMD A;  5GPG B;  2WZF A;  1Z5Z A;  4I1O B;  2NSG A;  2LFD A;  2P61 A;  2GFH A;  1OCR C;  5E2Q A;  2WVN A;  4JRZ A;  3TQO A;  2YL1 A;  3L0I A;  4BJ5 A;  2WZL A;  3A11 A;  3C18 A;  3DXJ F;  2Q4F A;  3DAF A;  2AU5 A;  3B71 A;  1F1M A;  1D0X A;  1APC A;  2CNW A;  2HJ3 A;  1T6U A;  4EHP A;  2R7X A;  2HMQ A;  1T6I A;  2X51 A;  3LLK A;  4J32 B;  3M4C A;  3LNR A;  1WTY A;  1Q0D A;  4OD4 A;  1H9G A;  2J0X A;  3SP1 A;  3QW0 A;  1T01 A;  1OCZ C;  2HZ8 A;  4N6H A;  3JSZ A;  5L0D A;  2F22 A;  3FAP B;  4DRJ B;  3VM6 A;  4CBE A;  1HMO A;  1OQC A;  3Q7G A;  4JEB A;  3LEO A;  4JKV A;  4K7B A;  3B0V C;  2XL6 A;  1Q0K A;  1YA9 A;  3AGT A;  3WOD F;  4AL1 A;  4XLP F;  3T4R A;  4CSA C;  1WGW A;  2I8B A;  1QLE C;  2OJQ A;  2YLG A;  3DI5 A;  4NTB A;  4CX9 A;  3PDM P;  1O3U A;  2KNH A;  3G4Z A;  1ZW3 A;  4KNV A;  4ANJ A;  3K66 A;  5KYY B;  2GAQ A;  2YL7 A;  5A6B D;  1UFB A;  3CSK A;  3DM9 B;  3JYH A;  4U5F E;  4ZLC A;  5FCL A;  2MWQ A;  3JRM O;  3QVY A;  2VCA A;  2OOC A;  2VB6 A;  1M2V B;  3KMI A;  3AG4 C;  3CZ6 A;  2DYS C;  4DBR A;  3R7C A;  1E83 A;  3RYL A;  3HJC A;  1ORJ A;  3AGU A;  1U89 A;  4CS9 C;  1U0B B;  3ZC4 A;  4LLC A;  4A2N B;  4MVR A;  1SYQ A;  2JD3 A;  2G3K A;  1AEP A;  1G4U S;  1MMA A;  1BR1 A;  1YDI A;  2PNO A;  2YKZ A;  3LJB A;  4U9D A;  1FAP B;  1DOW A;  4JJG A;  2KSF A;  2NUT A;  1MMN A;  4N6C A;  4JJF A;  3H2V A;  1FTS A;  4YT8 A;  3LEV A;  4PJJ A;  4DRH B;  1ZHX A;  3T6J A;  1UG7 A;  4U5D E;  5F5H A;  1V55 C;  2MHR A;  5BQH A;  2G3V A;  3HNK A;  3M1C B;  2Q7R A;  5L3Q A;  5KYX B;  4MW8 A;  1YZC A;  4ONS A;  5E3C A;  5KYW A;  4BJ6 C;  2YL0 A;  2PX0 A;  3B29 A;  3DMD A;  3LUT B;  3O6X A;  2QUP A;  4JEA A;  5L0F A;  3K1I C;  2HKV A;  3NYL A;  4LER A;  2ASR A;  4Z9I A;  1JAF A;  1WOL A;  3TOM A;  2P1A A;  1PD1 A;  2AWC A;  2EIN C;  3U3B A;  4QI2 A;  2CNW D;  3DJU B;  1MMD A;  2XL8 A;  4XPW A;  1TWG A;  3MYI A;  1YAU O;  3DE9 A;  4CDY A;  5KYW B;  3SXM A;  1SMY F;  3EGD A;  3SNH A;  2XM0 A;  1HE9 A;  3NKE A;  2HUJ A;  1NLX A;  4JTC B;  3T9O A;  4NTA A;  2R03 A;  3GWL A;  4MTO A;  4M63 A;  3TJ5 A;  2BC5 A;  4GQH A;  2YWA A;  3M15 A;  1BBH A;  2LSE A;  4J7T A;  1Z7Q c;  2PP4 A;  1NBB A;  2GWW A;  3RVZ A;  2RD9 A;  3U2M A;  1EI7 A;  4ULW A;  4E17 A;  2PF4 E;  3HTK C;  5EGY A;  3C63 A;  1LVK A;  2Q9B A;  4NC3 A;  4CSA A;  2QLA A;  1LS4 A;  2NG1 A;  2OEV A;  4CS8 A;  4UDV A;  1HW1 A;  1OCO C;  1C03 A;  1H9T A;  2MYS A;  2J0W A;  4H54 A;  1T6Q A;  5TJ5 E;  4Z9H A;  2DB4 A;  3RFY A;  3U8V A;  2IXP A;  5COM A;  2QTV A;  2R9R B;  1HW2 A;  1JOG A;  4NQF A;  3V5Z A;  3IQT A;  5T3W A;  2YLD A;  3JT1 A;  3L8I A;  3WG7 C;  3ASO C;  2W4B A;  4LAC B;  2QNL A;  4YN0 B;  5DQT A;  5L3V A;  4E0H A;  4MVM A;  4U5C E;  3S29 A;  3BRJ A;  3NYM A;  2XXA A;  1FMV A;  2YQY A;  1MND A;  5A69 A;  2A1D D;  2B0H A;  2HSQ A;  2W9Y A;  1NU9 C;  4CIH A;  2LK4 A;  1NFO A;  4LDK A;  3S28 A;  2LFF A;  4JTD B;  4PK4 A;  4PAC A;  5L0C A;  5B1B C;  2J7P D;  3NMK A;  3GWN A;  2ZXO A;  3V5X A;  1TR2 A;  3CEX A;  3ECS A;  2V3C C;  4XPY A;  2EPK X;  4IWB A;  5T3T A;  3GEH A;  4BJ6 A;  1ZHY A;  1A7V A;  1YYX A;  1GGQ A;  2OU6 A;  4FAP B;  5A6J A;  2XS8 A;  4IAQ A;  1RCP A;  2Z15 A;  4C3E A;  2EPM X;  4N4W A;  4AX2 A;  5COF A;  3TUL A;  1AUE A;  3MX3 A;  5EK0 A;  1H7I A;  3IQ6 A;  3EJN A;  4G7Z F;  2UUI A;  3U3F A;  3C7J A;  3VAY A;  1OKK D;  4O6Y A;  4X0R A;  4WGZ A;  3SZR A;  2XLE A;  1OW6 A;  1JR8 A;  1SR2 A;  4EUK B;  1AVO B;  3HNJ A;  4HEA J;  5KYU B;  3FOP A;  1J8Y F;  2C04 A;  4HE8 D;  3CQZ A;  1VB5 A;  5IY5 C;  1Z63 A;  5CIV A;  3H2U A;  1GQA A;  3GM3 A;  1LIH A;  2G62 A;  2AVK A;  2WB7 A;  3LS1 A;  4LDR A;  4RDA A;  4U9E A;  5E3A A;  4EKW A;  1HE1 A;  1Q0M A;  3ZQY A;  3F46 A;  2IXN A;  2KYH A;  5KYY A;  4FES A;  2A68 F;  4O7G A;  1O5H A;  1VMA A;  4PJN A;  1TWC A;  5DQZ A;  1G8X A;  3PCV A;  1YYJ A;  1M2V A;  4W8P A;  3ZTM A;  4YT2 A;  4Q7C A;  2EIJ C;  3KYJ A;  3DJN B;  4D4N A;  2R02 A;  2NPU A;  3EPV A;  3KL4 A;  3OEO A;  5HSW A;  3FDQ A;  5DS4 A;  5BQI A;  3US6 A;  4RD9 A;  3U0C A;  2IBF A;  1C17 M;  2LP4 A;  4Z9J A;  4OIQ F;  3ZVR A;  4YT5 A;  1ZHT A;  2UUH A;  2DGJ A;  3ZTZ A;  1W2W A;  2ZXR A;  2R7S A;  3MLG A;  4J7Y A;  1MNE A;  2W4M A;  5T1D B;  5AGF A;  1FFH A;  1IW7 F;  3GEE A;  1WN0 A;  1G5Z A;  2XS1 A;  4QI0 A;  1S7Z A;  2ZXP A;  1S05 A;  3N24 A;  4WJ0 A;  2H7O A;  4C7O A;  1ZU5 A;  2QY9 A;  2EPN A;  1TQG A;  4EBK A;  2L7A A;  4P9F A;  1ZVZ A;  3HKK A;  3KPH A;  2HFI A;  4O79 A;  2PX3 A;  4PJL A;  5KYX A;  1D1C A;  3ITF A;  3ASN C;  3X1O A;  2KC3 A;  2XL4 A;  3RH3 A;  4DVZ A;  4G7O F;  1RMV A;  1VK5 A;  4GEH A;  2EIL C;  4XEK A;  2KW3 C;  2LQG A;  4U5E E;  3UR3 C;  3E9V A;  4I44 A;  1D1A A;  2GA0 A;  1L3P A;  4C7O B;  3QVZ A;  1WAS A;  3LNM B;  4JVS A;  2QE9 A;  3W8H A;  3LLI A;  1YAR O;  3AG1 C;  2V26 A;  2HMZ A;  1JMW A;  2YLI A;  5F5F A;  2OCC C;  4MTG A;  4LDQ A;  3O55 A;  3MBG A;  2GDC A;  5COG A;  1GM5 A;  3K6B A;  1TFK B;  1BZ4 A;  4K1O A;  5DLJ A;  1KTM A;  1VLS A;  5BUO A;  2P0N A;  4Q5S F;  4XEV A;  2YZS A;  4XQ1 A;  3DD7 A;  3U9J A;  5K0I A;  4PR9 A;  2PFD A;  3C8G B;  3NDB B;  1D0Z A;  2KK1 A;  1CGM E;  4U5H A;  1FFT C;  3B9Q A;  3RQG A;  1OR3 A;  2WVQ A;  3FAJ A;  4YJW A;  3NRH A;  4XLN F;  1E86 A;  2OQM A;  4OIP F;  1A41 A;  3ABL C;  3EHN A;  3KYI A;  4MTF A;  2P7V A;  4U5B E;  2XLD A;  1K05 A;  4IRU A;  4OIR F;  2VCB A;  3AJM A;  4O6N A;  4BEJ A;  4KBL A;  4K0D A;  5D91 A;  2A69 F;  2OJE D;  2HJM A;  5DVW A;  5L0J A;  3ABK C;  2D5R B;  3O39 A;  4JE9 A;  1VYK A;  4JIO A;  4IGG A;  3EFO B;  4KI2 A;  1PD0 A;  1O87 A;  3JTL O;  4BJ5 C;  5L0G A;  4XEF A;  5JP7 A;  3IQC A;  3N0T A;  4PFP A;  4F4B A;  2XLV A;  4NTF A;  4BJ1 A;  1LI7 A;  4JW1 A;  3SEO A;  1ZYR F;  2VCC A;  5CI8 A;  4H4K C;  1YA7 O;  1LPE A;  2Y39 A;  2Q3T A;  1FR0 A;  3K1H A;  3R2P A;  3JZ0 A;  4XWJ A;  4HFK B;  4CS7 A;  5JVE A;  2EIM C;  2XLM A;  1NZE A;  4ULV A;  1LI5 A;  2A6H F;  5EHH A;  4DRI B;  4BG0 A;  1MQV A;  1T9K A;  2Q9C A;  3Q7L A;  1VTM P;  1A7E A;  3EG9 B;  3M4B A;  2NSF A;  3K33 A;  3EH2 A;  1LKX A;  1I4Y A;  1QPU A;  256B A;  4CS9 A;  5JLI A;  1M56 C;  3AG2 C;  1EA8 A;  3S84 A;  2XLH A;  1C02 A;  1BR4 A;  3HNL A;  1TFO B;  2IYL D;  2VC9 A;  3RIP A;  2JX0 A;  4KC9 A;  3UGO A;  3ZQV A;  1V54 C;  2CCY A;  2IOQ A;  1WAT A;  2J9W A;  2R05 A;  2Q00 A;  2Y3G A;  3RVY A;  4MQ9 F;  1Q0G A;  3UGP A;  1NG1 A;  3TD7 A;  2JPU A;  1TWH A;  2J9V A;  1OXB A;  4G0H A;  2ICW G;  2CDQ A;  2LCH A;  2XM4 A;  3DAG A;  4PFO A;  5F28 E;  3AOU A;  5B1A C;  3ZIB A;  5A6B A;  2M64 A;  4OIN F;  3UMK A;  1CPQ A;  2R7R A;  3GAN A;  1VYI A;  3EGX B;  1RJ9 A;  2ZD9 A;  4JUR I;  5KYU A;  5HV9 A;  4CIP A;  3J06 A;  5JRA A;  4NY3 A;  5JT4 A;  1KNY A;  1D1B A;  1KU2 A;  3K1I A;  1TKN A;  1G4W R;  5D92 A;  2CYD A;  3ABM C;  4JCZ A;  1ST6 A;  1XWJ A;  1RKC A;  4IAR A;  4MVQ A;  3RQE A;  3U5S A;  1R4T A;  4XPX A;  3AQC A;  3FOO A;  1OXK A;  4AK9 A;  4O6M A;  1XZQ A;  2O9X A;  3QZC A;  1RJ9 B;  4BJT A;  3M79 A;  4P6I C;  1M57 C;  1YJG A;  2A0B A;  1Z6A A;  2L6F A;  3IPM O;  4JZA A;  2P6V A;  1H6G A;  2BL2 A;  1B68 A;  1SZI A;  2CGE A;  1TWA A;  2J9B A;  1GS9 A;  1L7C A;  2OG2 A;  3VYW A;  5CI9 A;  4CJO A;  4BEM J;  4L6R A;  2H7V C;  3E70 C;  3LAY A;  3H65 A;  4JCH A;  3JSE O;  2NUP B;  3C62 A;  4E7Z A;  3T6B A;  3TOL A;  1EKY A;  5JUA A;  1Z3I X;  5FZT A;  3S90 A;  2CW0 F;  2HV6 A;  3O10 A;  1QVX A;  2C03 A;  3K7D A;  3GEI A;  3OWT A;  1NU7 D;  4DJ9 A;  3L1M A;  1HY5 A;  4LLE A;  2YRF A;  2A6E F;  4XTK A;  1LM3 B;  3PMR A;  4AE4 B;  3S27 A;  3T6G B;  3QTH A;  4DXW A;  2YEV A;  3ATP A;  3LS0 A;  4DBQ A;  4FWV A;  2HV7 A;  2Y3D A;  1BR2 A;  3UNG C;  4EBJ A;  1M2O A;  1Y4C A;  3DE8 A;  1ORS C;  2OEX A;  1QKR A;  2FAP B;  1QSP A;  3SXY A;  3PHF 2;  4MW3 A;  2A0U A;  4NCQ A;  3X2Q C;  1Z23 A;  5E33 A;  1ZW2 A;  3U9M A;  5DS6 A;  1E2X A;  2J45 A;  4CS8 C;  3ZG1 A;  4C3B A;  2B0J A;  2R7U A;  3TK0 A;  5JSL A;  1CPR A;  3QW1 A;  1I4Z A;  1ZZP A;  2YVK A;  4E18 A;  1N1C A;  3C8G A;  3GOR A;  3NKD A;  3W4Y A;  4E7S A;  1CGO A;  4EWC A;  3GOD A;  5KYN A;  2ZPA A;  5B3S C;  5BQG A;  5JS5 A;  3FMS A;  2YHS A;  4YL3 A;  2I15 A;  4P9T A;  3UMI A;  2KJG A;  5AC4 A;  3POV A;  2Y69 C;  3LES A;  3L34 A;  1M6T A;  3ZDL A;  1ZU4 A;  3QMK A;  3NMI A;  4I1M A;  4E0I A;  3JCU Q;  4OIO F;  3G4X A;  2Y3H A;  3EHM A;  4YL0 A;  1A7D A;  4MVU A;  2R7V A;  2L6G A;  2R7O A;  4EIY A;  1R5I D;  2OKU A;  1U6H A;  3V5Y A;  3A9C A;  3MYF A;  3EFO A;  3FXH A;  2FGY A;  3U8P A;  2R7W A;  2J7P A;  1V74 B;  4J30 B;  1OW7 A;  1PV3 A;  3FHD A;  3JRT A;  5A6K A;  3EZH A;  2VAS A;  3DKA A;  3DM5 A;  4N06 A;  1OW8 A;  2L6H A;  2IXM A;  4IB4 A;  1QQ3 A;  2NUT B;  3EQL F;  3NG1 A;  3JYY A;  4JC7 A;  3Q6N A;  4WGY A;  1VLT A;  3CAX A;  4IAO A;  4MVZ A;  2WZG A;  3S9O A;  4DOZ A;  3V7O A;  2ZXW C;  3EG9 A;  2RSE B;  5B3I A;  5L0I A;  3Q6M A;  2WVO A;  4YL1 A;  3G50 A;  1OKK A;  1NFN A;  4G78 A;  4WAB A;  4D4X A;  2EIK C;  4IJJ A;  1K04 A;  3NMJ A;  2IM8 A;  3GM2 A;  2D4U A;  2XLO A;  2E87 A;  1ZHZ A;  4A4A A;  3I5P A;  1LE4 A;  1ORY A;  1DOV A;  1JPJ A;  1LE2 A;  2DYR C;  1CGN A;  2HS5 A;  3DZA A;  3RF3 A;  2DI3 A;  2ETS A;  1RXQ A;  3DWW A;  2WL8 A;  3U2L A;  3FVY A;  2W45 A;  1WWP A;  3I5Q A;  4I3M A;  4B6I A;  3IHU A;  4CJG A;  4ER9 A;  4YWQ A;  5L0H A;  3B0P A;  1NSG B;  1T5O A;  2HSB A;  3KH2 A;  3N2Z B;  3TJ6 A;  4U5G A;  4W8K A;  1V4A A;  1OCC C;  2XRH A;  3EGD B;  3EGX A;  1LS1 A;  2L81 A;  2BE5 F;  3NYJ A;  4JTA B;  4MS2 A;  3ZSU A;  4DVY P;  3SYN A;  3C8Z A;  3RKO F;  1K40 A;  3RW0 A;  1PCX A;  1FNT c;  2XSE A;  4G7H F;  2IXO A;  3VRC A;  2R7T A;  4CDA A;  3AQB A;  2KQ9 A;  3HLZ A;  1JPN A;  2EPO A;  3IQ5 A;  1QZX A;  4KNW A;  4PJM A;  3SXZ A;  3F47 A;  3L8J A;  1RKE A;  4YT4 A;  3C8G D;  4R32 A;  3W8I A;  2TMV P;  3WHN A;  5A6A A;  1VOM A;  2H7B A;  2LD6 A;  3W2W A;  3VF0 A;  4AL0 A;  4BPM A;  4GYT A;  4QDL A;  1OR2 A;  5AC5 A;  3KKB A;  4ZLD A;  3W2V A;  1A0B A;  4MND A;  2M4E A;  1MMG A;  3ZWI A;  1BDJ B;  4HFF B;  3UMH A;  2EPL X;  1XZP A;  3IEE A;  4OD5 A;  2AP3 A;  1IZM A;  3MFN A;  2AWY A;  3EZI A;  1RKE B; 
#chains in the Genus database with same CATH homology
 3S0X A;  4C3D A;  5KYN A;  2L9J A;  3I4U A;  5DS5 A;  2NUP A;  2R7Q A;  3B0U X;  1D0Y A;  1J8M F;  4RBN A;  2J9U A;  2FFH A;  2Y3B A;  3EH1 A;  1ZHW A;  2XXA B;  4Q4Z F;  1FMW A;  3AG3 C;  2J46 A;  3OA1 A;  2Q9A A;  2KGO A;  4AE4 A;  1SF8 A;  4FX5 A;  2VH3 A;  3S28 A;  4XLP F;  2WZF A;  1Z5Z A;  2GFH A;  1OCR C;  5E2Q A;  2WVN A;  3L0I A;  4BJ5 A;  2WZL A;  3DXJ F;  3DAF A;  1D0X A;  2CNW A;  2R7X A;  3LLK A;  2X51 A;  4J32 B;  3LNR A;  4OD4 A;  2J0X A;  3SP1 A;  1OCZ C;  3JSZ A;  4CBE A;  3Q7G A;  4K7B A;  3B0V C;  3WOD F;  3T4R A;  4CSA C;  1WGW A;  2I8B A;  1QLE C;  2KNH A;  4KNV A;  4ANJ A;  3K66 A;  5KYY B;  3CSK A;  4U5F E;  3DM9 B;  3JYH A;  4ZLC A;  5FCL A;  2MWQ A;  2VB6 A;  1M2V B;  3KMI A;  3AG4 C;  3CZ6 A;  2DYS C;  4DBR A;  3RYL A;  3HJC A;  4CS9 C;  3ZC4 A;  4LLC A;  4A2N B;  2JD3 A;  2G3K A;  1MMA A;  1BR1 A;  3LJB A;  4JJG A;  2NUT A;  1MMN A;  4JJF A;  1FTS A;  4YT8 A;  3LEV A;  4PJJ A;  1ZHX A;  3T6J A;  4U5D E;  5F5H A;  1V55 C;  2G3V A;  5L3Q A;  5KYX B;  5KYW A;  5E3C A;  4BJ6 C;  2PX0 A;  3DMD A;  3O6X A;  3K1I C;  3NYL A;  4LER A;  1PD1 A;  2EIN C;  4QI2 A;  2CNW D;  3DJU B;  1MMD A;  1TWG A;  5KYW B;  1SMY F;  3EGD A;  3SNH A;  3NKE A;  4M63 A;  2LSE A;  2PP4 A;  4ULW A;  2PF4 E;  3HTK C;  5EGY A;  1LVK A;  2Q9B A;  4CSA A;  2NG1 A;  4CS8 A;  1OCO C;  2MYS A;  2J0W A;  3RFY A;  2IXP A;  2QTV A;  5T3W A;  3JT1 A;  3WG7 C;  4EBB A;  3ASO C;  2W4B A;  4LAC B;  5DQT A;  4YN0 B;  5L3V A;  4U5C E;  3S29 A;  3NYM A;  2XXA A;  1FMV A;  1MND A;  2A1D D;  2W9Y A;  1NU9 C;  4CIH A;  4PK4 A;  5B1B C;  2J7P D;  2ZXO A;  2V3C C;  1TR2 A;  3ECS A;  4IWB A;  5T3T A;  4BJ6 A;  1ZHY A;  2Z15 A;  4C3E A;  4AX2 A;  3MX3 A;  3EJN A;  4G7Z F;  3VAY A;  1OKK D;  4O6Y A;  4X0R A;  3SZR A;  4HEA J;  5KYU B;  1J8Y F;  2C04 A;  4HE8 D;  3CQZ A;  5IY5 C;  3LS1 A;  4RDA A;  2G62 A;  2WB7 A;  5E3A A;  3F46 A;  2IXN A;  5KYY A;  4FES A;  2A68 F;  4O7G A;  1O5H A;  1VMA A;  4PJN A;  1TWC A;  5DQZ A;  1G8X A;  1M2V A;  4YT2 A;  4Q7C A;  2EIJ C;  3DJN B;  5HSW A;  3OEO A;  3FDQ A;  3EPV A;  3KL4 A;  5DS4 A;  4RD9 A;  4OIQ F;  3ZVR A;  4YT5 A;  1ZHT A;  2R7S A;  2DGJ A;  1W2W A;  2ZXR A;  3MLG A;  1MNE A;  2W4M A;  5T1D B;  1FFH A;  1IW7 F;  4QI0 A;  1S7Z A;  2ZXP A;  3N24 A;  4WJ0 A;  2H7O A;  4C7O A;  1ZU5 A;  2QY9 A;  4O79 A;  2PX3 A;  4PJL A;  5KYX A;  1D1C A;  3ITF A;  3ASN C;  3X1O A;  4G7O F;  2XL4 A;  3RH3 A;  4DVZ A;  1VK5 A;  4GEH A;  2EIL C;  2KW3 C;  4U5E E;  3UR3 C;  3E9V A;  4I44 A;  1D1A A;  4C7O B;  4JVS A;  4YT4 A;  5F5F A;  3LLI A;  3AG1 C;  2V26 A;  2OCC C;  3K6B A;  5DLJ A;  5BUO A;  4Q5S F;  2YZS A;  3DD7 A;  2PFD A;  3NDB B;  1D0Z A;  4U5H A;  1FFT C;  3B9Q A;  2WVQ A;  3FAJ A;  4YJW A;  3NRH A;  4XLN F;  3ABL C;  3EHN A;  2P7V A;  4U5B E;  4IRU A;  4OIR F;  4O6N A;  4BEJ A;  4KBL A;  4K0D A;  5D91 A;  2A69 F;  5DVW A;  3ABK C;  2D5R B;  3O39 A;  1VYK A;  3EFO B;  4KI2 A;  1PD0 A;  1O87 A;  4BJ5 C;  3N0T A;  4PFP A;  4F4B A;  4BJ1 A;  4JW1 A;  3SEO A;  1ZYR F;  5CI8 A;  4H4K C;  2Y39 A;  2Q3T A;  3K1H A;  4XWJ A;  4HFK B;  4CS7 A;  2EIM C;  1NZE A;  2A6H F;  5EHH A;  4BG0 A;  2Q9C A;  3Q7L A;  3EG9 B;  3K33 A;  3EH2 A;  1LKX A;  4CS9 A;  1M56 C;  3AG2 C;  1BR4 A;  2IYL D;  3RIP A;  4KC9 A;  3UGO A;  1V54 C;  2IOQ A;  2J9W A;  2Y3G A;  4MQ9 F;  1NG1 A;  3TD7 A;  1TWH A;  2J9V A;  4G0H A;  4PFO A;  2CDQ A;  3DAG A;  5B1A C;  3ZIB A;  3UGP A;  4OIN F;  2R7R A;  3UMK A;  3GAN A;  1VYI A;  3EGX B;  1RJ9 A;  4JUR I;  5KYU A;  4NY3 A;  1KU2 A;  1D1B A;  1TKN A;  5D92 A;  3ABM C;  1ST6 A;  3AQC A;  4AK9 A;  4O6M A;  2O9X A;  3QZC A;  1RJ9 B;  4BJT A;  4P6I C;  1Z63 A;  1M57 C;  4JZA A;  1Z6A A;  2P6V A;  3M1C B;  1SZI A;  2CGE A;  1TWA A;  2OG2 A;  3VYW A;  5CI9 A;  2H7V C;  3E70 C;  3LAY A;  3H65 A;  4JCH A;  2NUP B;  4E7Z A;  3T6B A;  1Z3I X;  2CW0 F;  2HV6 A;  2C03 A;  3K7D A;  3OWT A;  1NU7 D;  4LLE A;  2A6E F;  4XTK A;  4AE4 B;  3PMR A;  3S27 A;  2YEV A;  3LS0 A;  4DBQ A;  4FWV A;  2HV7 A;  2Y3D A;  1BR2 A;  3UNG C;  1M2O A;  3PHF 2;  3X2Q C;  1Z23 A;  5E33 A;  5DS6 A;  2J45 A;  4CS8 C;  3ZG1 A;  4C3B A;  2B0J A;  2R7U A;  1N1C A;  3NKD A;  4E7S A;  4EWC A;  3GOD A;  2ZPA A;  5B3S C;  2YHS A;  3UMI A;  2KJG A;  3POV A;  2Y69 C;  3LES A;  3L34 A;  1ZU4 A;  3QMK A;  4I1M A;  3JCU Q;  4OIO F;  2Y3H A;  3EHM A;  2R7V A;  2R7O A;  3EFO A;  2FGY A;  2R7W A;  2J7P A;  4J30 B;  3FHD A;  3JRT A;  3EZH A;  2VAS A;  3DM5 A;  4N06 A;  2IXM A;  2NUT B;  3EQL F;  3NG1 A;  3Q6N A;  4IAO A;  2WZG A;  4DOZ A;  3V7O A;  2ZXW C;  3EG9 A;  3Q6M A;  2WVO A;  1OKK A;  2EIK C;  4IJJ A;  2E87 A;  1ZHZ A;  4OIP F;  3I5P A;  2DYR C;  3DZA A;  1JPJ A;  2WL8 A;  3FVY A;  2W45 A;  3I5Q A;  4I3M A;  4B6I A;  4YWQ A;  3B0P A;  3N2Z B;  3KH2 A;  4U5G A;  4W8K A;  1OCC C;  2XRH A;  3EGD B;  3EGX A;  1LS1 A;  2L81 A;  2BE5 F;  3NYJ A;  3ZSU A;  4DVY P;  3SYN A;  3RKO F;  1PCX A;  2XSE A;  4G7H F;  2IXO A;  2R7T A;  3AQB A;  2KQ9 A;  3HLZ A;  1JPN A;  1QZX A;  4KNW A;  4PJM A;  3F47 A;  3W8I A;  1VOM A;  2H7B A;  3W2W A;  4GYT A;  4QDL A;  4ZLD A;  3KKB A;  3W2V A;  4MND A;  2M4E A;  1MMG A;  4HFF B;  3UMH A;  4OD5 A;  3IEE A;  1IZM A;  4I1O B;  3EZI A;  3W8H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...