3LS1A

Crystal structure of cyanobacterial psbq from synechocystis sp. pcc 6803 complexed with zn2+
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
133
structure length
133
Chain Sequence
b'GPLGSCSSPQVEIPTTYSPEKIAQLQVYVNPIAVARDGMEKRLQGLIADQNWVDTQTYIHGPLGQLRRDMLGLASSLLPKDQDKAKTLAKEVFGHLERLDAAAKDRNGSQAKIQYQEALADFDSFLNLLPQAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sll1638 protein
publication title Crystal Structure of PsbQ from Synechocystis sp. PCC 6803 at 1.8 A: Implications for Binding and Function in Cyanobacterial Photosystem II
pubmed doi rcsb
source organism Synechocystis sp.
molecule tags Photosynthesis
total genus 50
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05757 PsbQ Oxygen evolving enhancer protein 3 (PsbQ)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.290 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3ls1A00
3ZSUA 3LS0A 3LS1A 3JCUQ 3RFYA 1NZEA 2MWQA 1VYKA
chains in the Genus database with same CATH superfamily
1WWPA 3R7CA 4YL3A 1Q0GA 4J7YA 1V4AA 3W2VA 4CS9A 4D4XA 1Z6AA 4BJ5C 4CIPA 1HE9A 2C03A 2AU5A 4Z9IA 1WGWA 4MNDA 2GFHA 5L0HA 3VYWA 4A2NB 1TWHA 3A11A 3FVYA 4E0IA 1UFBA 5KYYB 1E83A 3EGDB 4KI2A 3AQBA 1S05A 3HTKC 3U5SA 4EUKB 3KH2A 1PD0A 3C8GA 4MTGA 2LCHA 1MMGA 2QUPA 3U2LA 2H7BA 2YZSA 2BL2A 1T6UA 4IWBA 4JIOA 4N6CA 4Z9JA 3PDMP 4Q5SF 1KNYA 3JYYA 4BJ6C 3C8ZA 4ZLDA 3DJUB 3RQFA 3M79A 3QW1A 4OINF 3LS0A 3GWLA 1E85A 2WL8A 1HMDA 1W2WA 1GQAA 1SR2A 2WB7A 2OG2A 3IQ5A 3MYIA 2P61A 5B1BC 5A69A 2R05A 3ZDLA 4A4AA 4MVRA 4G7ZF 2ZXRA 2QTVA 2NSGA 5L3QA 1VOMA 5F5FA 4G78A 4NY3A 2NUTA 1MNEA 1VLTA 1IW7F 3JRTA 1WATA 2E87A 3L1MA 1VYKA 5L0GA 3EH2A 5KYWA 3C8GB 4Z9HA 3UGOA 3IQ6A 3T9OA 4W8KA 4U5BE 1Z7Qc 1H6GA 3TJ6A 2OU6A 4U5CE 3TD7A 5CIVA 4CS9C 3EG9A 2JPUA 2A0UA 2UUHA 3CAXA 4MQ9F 1T5OA 1OCOC 2Q9BA 1A41A 2YL0A 1O3UA 1RJ9B 2P0NA 4YL0A 5B1AC 3RVYA 3WHNA 2PX3A 2Y3HA 4U5EE 3CZ6A 2XLHA 3GANA 2L6HA 3TK0A 2YLIA 3DZAA 3EFOA 1K40A 1MMAA 3L8IA 4ZLCA 3RW0A 5L0DA 3A9CA 3FAJA 5JSLA 4PJNA 2XL4A 3NMIA 2I8BA 2J0XA 3WODF 1V54C 2OJQA 5KYWB 1LS1A 3G4XA 4GQHA 2QNLA 3Q7GA 1BDJB 1OKKD 2M64A 3MYFA 3SNHA 5E3AA 3AGTA 3UGPA 3EG9B 4C7OA 1G8XA 2EPOA 5DVWA 3F46A 2H8AA 1O87A 2MYSA 1Z23A 1AVOB 1ZHWA 1LE4A 1TKNA 2WZGA 5K0IA 4MVUA 4MVOA 3RFYA 1A7VA 2KGOA 4YL1A 2DI3A 1D1CA 4U5HA 2DGJA 3S28A 1V74B 1J8MF 2MHRA 3ZSUA 4CDVA 2W4BA 2QLAA 1AUEA 4YT5A 3B0VC 3JCUQ 4HFKB 3EQLF 4P6IC 3NMKA 3JTLO 4PJJA 3UMIA 4YT2A 1OW8A 2Q00A 2Y3DA 2EPMX 1VK5A 3JT1A 4CS8C 5CI9A 2KNHA 2WVQA 1M57C 2L81A 3JZ0A 2XLEA 4C7OB 1BZ4A 2L6GA 3V5YA 2NSFA 1C03A 256BA 3I4UA 3N0TA 3WAQA 3AG3C 5HV9A 4XLPF 2W4MA 3JSZA 4L6RA 5HSWA 5BQHA 3W4YA 2AVKA 2XL6A 4DBRA 4ER9A 3DAFA 4FWVA 5DS4A 1OCCC 1FTSA 3UMHA 1CGME 1M2VA 1SYQA 4PFOA 1YA7O 3RVZA 1OR3A 4E17A 4U5GA 2GDCA 2LSEA 2ZXOA 3Q7LA 3QVZA 4YWQA 1Q0KA 1QSPA 1YLMA 1K04A 1ST6A 2HJMA 3X2QC 4QI2A 2IXOA 1F1MA 1BBHA 2P1AA 1U0BB 3H2VA 4JC7A 1UG7A 3T6JA 1FFTC 1Q0MA 3LLKA 1Q0FA 4RBNA 3WG7C 5A6AA 1WTYA 1T6QA 3SXZA 2IYLD 4WGYA 3SXYA 2XLDA 3H65A 3NG1A 5EK0A 2IXNA 3RYLA 1YJGA 1M2VB 1DOWA 2KSFA 4D4NA 3B0PA 3EGDA 2YL3A 4DRIB 3DKAA 3M4CA 4AX2A 1OR2A 4MVZA 3CEXA 2HJ3A 2HKVA 4PK4A 2XLMA 4CS7A 3GM1A 3T4RA 5DS5A 1YDIA 3S9OA 4DOZA 3IHUA 3LAYA 3NYJA 4G7OF 3AGUA 2OEVA 2CNWA 4JEAA 5A6KA 3DWWA 1RKEA 2W45A 3UR3C 2FGYA 3FOPA 3S27A 1H9GA 3RQGA 1D0XA 4BPMA 2XS8A 3I5PA 4XPYA 3LLIA 5L3VA 1LVKA 4MVMA 3NKDA 1FMWA 4CDYA 1Z3IX 3E70C 3U3BA 1JPJA 1QVXA 1R5ID 2HFIA 3W8HA 1FR0A 2XLVA 5EHHA 2A0BA 3AG4C 3UMKA 3VAYA 1WOLA 3B9QA 4OIQF 1T01A 4DVZA 2YVKA 1NU9C 3GEIA 5KYNA 1Q0DA 2VC9A 2Q9AA 3IPMO 2G3VA 4M63A 3HNJA 2NPUA 2CW0F 1FAPB 1RKEB 4YK5A 2PNOA 5A6JA 3GEHA 3U2MA 1RJ9A 3S0XA 2R7TA 2J7PA 3F47A 2G3KA 2XL8A 4CSAC 1RKCA 3G4ZA 4PACA 5L0CA 2KYHA 2YRFA 3DJNB 2WVOA 5L0IA 2XM4A 4LDKA 2H7VC 2LFDA 3EHMA 5DS6A 3Q6NA 4YJWA 1LS4A 3U9JA 3FAPB 3DM9B 5T1DB 2AWCA 3LNRA 3NMJA 2CGEA 4XTKA 1HMOA 4RDAA 4JCZA 1TWAA 3U3FA 4C3EA 5E2QA 2R7XA 2RD9A 1NU7D 4NTFA 1HY5A 2PX0A 2EPKX 5F28E 3C8GD 2IBFA 4NTBA 3SZRA 3QMKA 1E86A 1JOGA 2R03A 2ZXWC 3VF0A 3S90A 2LD6A 3FOOA 3QZCA 4AL1A 2IXMA 1TQGA 3LESA 4H54A 3M15A 3AG1C 4KBLA 4U5FE 4XPXA 5AC4A 2HUJA 5AGFA 5L0JA 1TWCA 2EPLX 2L9JA 1MMNA 2J7PD 2Y3GA 2W9YA 3KPHA 3B0UX 3GM3A 4O6NA 2JX0A 1ORYA 1LKXA 3DE9A 4MW3A 4EIYA 1LI5A 1JMWA 1ZZPA 4I3MA 1GGQA 5JRAA 3U0CA 3AOUA 1FMVA 1BR1A 4HEAJ 2P7VA 4JKVA 5E3CA 1GM5A 5DLJA 3B29A 3GM2A 3JRMO 1D1BA 4DXWA 4DBQA 2EPNA 3ABMC 1ZHYA 1M2OA 3K1IA 4QDLA 1HW1A 1M56C 2R25A 2OCCC 1YARO 3AJMA 3HLZA 3N24A 4JZAA 3TQOA 2AP3A 3V5ZA 5EGYA 2R7UA 1YZCA 1QQ3A 2G62A 1VTMP 2LP4A 2JD3A 4MW8A 4PR9A 3U9MA 4C3DA 4JEBA 2R7WA 1HE1A 1YYJA 2WZFA 3K1HA 1D1AA 3R2PA 4DVYP 2TMVP 2QY9A 2HMZA 4I1MA 2Y69C 2Q3TA 2HV6A 2KC3A 4JCHA 3X1OA 2KK1A 4WABA 2R02A 2XXAB 1OCZC 1TR2A 3ZVRA 1LPEA 2IM8A 2NG1A 1TFKB 1Y4CA 2VCAA 4MTOA 3ZIBA 4PJMA 5TJ5E 3G50A 3FHDA 3ABLC 4JJFA 4R32A 1G4US 2YWAA 2ZXPA 1YZAA 3O6XA 3T6GB 4BJTA 1VB5A 3DXJF 1BR4A 1A7DA 3Q6MA 5FZTA 4K1OA 1Z5ZA 4X0RA 1MQVA 3DM5A 5BQGA 2YLDA 3PMRA 3KKBA 4I1OB 1EQ1A 3DD7A 2DB4A 2B0JA 5A6BD 1DOVA 1NFNA 3DI5A 1RXQA 3JSEO 5T3TA 4N6HA 2NUPA 2XSEA 2A6EF 1RMVA 3ATPA 5BUOA 3K66A 4Q4ZF 3NKEA 2YL1A 4DRHB 4EHPA 2R9RB 3EH1A 3EZHA 5DQZA 4MVQA 4PJLA 2A68F 4ULVA 4EWCA 3I5QA 4CDAA 2ETSA 1CGOA 3NYMA 3L0IA 1JRAA 3FXHA 1R4TA 4EKWA 2OEXA 2KJGA 2RSEB 3LEVA 3CSKA 3OWTA 3O55A 3PHF2 3RKOF 4N06A 3O10A 4J32B 4CJGA 2IXPA 1TFOB 3QTHA 2D4UA 2NUPB 2WVNA 4BJ5A 2V26A 3V5XA 5T3WA 2KW3C 4ANJA 1ORJA 2DYSC 2LK4A 5E33A 3SXMA 1MNDA 4JW1A 5A6BA 5DQTA 4H4KC 1U6HA 4JTAB 1V55C 1NFOA 1QPUA 2LQGA 2L6FA 2Q4FA 3LNMB 2A1DD 2FFHA 5GPGB 1EA8A 3L8JA 3B71A 3ZQYA 1PCXA 4AE4A 4KNWA 4DJ9A 3GEEA 3QW0A 5BQIA 3ITFA 3NDBB 5B3SC 2PP4A 2Z15A 1KTMA 3ZC4A 4GEHA 4IAOA 3OA1A 2XLWA 3ZTZA 3M1CB 5COGA 4JTDB 2IOQA 4OD4A 1G5ZA 4LERA 2Q7RA 3ZWIA 4DRJB 2HS5A 3V7OA 2YQYA 4BEJA 4AL0A 1IZMA 2KQ9A 3NRHA 5KYUA 1U89A 3ECSA 3BRJA 1FFHA 1L3PA 4IAQA 1FNTc 4JRZA 4LLEA 3GWNA 4JVSA 3RIPA 3T6BA 1MMDA 3GORA 4P9TA 4W8PA 2GAQA 4XQ1A 5JS5A 1APCA 3DAGA 3MBGA 2CYDA 2J0WA 1I4YA 4AE4B 1OW7A 1AEPA 2J9UA 2VCBA 1JPNA 1OCRC 2X0CA 3ZG1A 2C04A 1I4ZA 3HNIA 4U9DA 3SP1A 2D5RB 1YAUO 1ZW2A 1OXKA 2EILC 3ASOC 3VRCA 4YT8A 3TOLA 1LM3B 4XEVA 5IY5C 5JVEA 1O5HA 1ZU4A 4JE9A 2CNWD 4Q7CA 2OOCA 4F4BA 5KYUB 2XS1A 2R7QA 3OEOA 3POVA 4G7HF 2M4EA 1B68A 3EZIA 3LEOA 3EPVA 3TJ5A 2CDQA 3K7DA 5JP7A 1S7ZA 4J7TA 4KNVA 1L7CA 5AC5A 4JJGA 2UUIA 5JLIA 1QZXA 5COMA 4RD9A 4XLNF 2VCCA 4XEKA 2DYRC 4HE8D 2HZ8A 3L34A 2HSQA 3TOMA 5KYXA 2R7VA 2J45A 2BC5A 2OKUA 2LIGA 5JT4A 5L0FA 1HW2A 2XM0A 1ZHXA 2EINC 2PFDA 1D0YA 1QKRA 1NLXA 4OIOF 1ZVZA 2R7OA 4EBJA 2PBEA 2J9BA 2XXAA 2X51A 4BG0A 1PV3A 4FAPB 3QVYA 1JR8A 4NCQA 1LI7A 2V3CC 2A6HF 3KL4A 1OKKA 2Q9CA 2L7AA 4O79A 2F22A 2HMQA 1PD1A 2ASRA 2ICWG 2ZPAA 1A0BA 4BEMJ 3J06A 2FAPB 5FCLA 4G0HA 1NSGB 1ORSC 1OQCA 1YA9A 4KC9A 1SF8A 5KYXB 3DMDA 2XLOA 3TULA 4MTFA 4EBKA 1XZPA 3AQCA 4CS8A 4O6YA 1SZIA 3RF3A 4OIPF 4OD5A 3IQTA 3BEHA 1YVIA 4OIRF 3ASNC 3MLGA 1LE2A 3C63A 4IGGA 1CPRA 3FMSA 2VB6A 4IRUA 4MVSA 4NC3A 3RQEA 3FDQA 4NTAA 1GS9A 3C62A 1ZHZA 4WJ0A 1C02A 2NUTB 3KMIA 3SXKA 3EJNA 2J46A 4IARA 3ZTMA 4LDRA 4LDQA 1C17M 1YYXA 1VLSA 2VASA 2ZD9A 3PCVA 5COFA 1OXBA 3MFNA 1ZU5A 1H7IA 2QE9A 2MWQA 3GODA 1EI7A 5F5HA 3M4BA 2VH3A 4HFFB 4K0DA 3U8VA 2H7OA 3LS1A 5B3IA 2J9WA 3IQCA 3KYJA 4E7SA 4EBBA 1VYIA 4C3BA 1SMYF 2O9XA 2BE5F 4I44A 2R7RA 1A7EA 2PF4E 4QI0A 3U8PA 3MX3A 1J8YF 1ZYRF 4FESA 4PFPA 1WASA 2J9VA 3EFOB 4U9EA 1TWGA 1LIHA 2HSBA 3RH3A 3W2WA 2WZLA 1RCPA 4IJJA 2HV7A 4FX5A 4N4WA 3N2ZB 1KU2A 4LLCA 1NZEA 3K1IC 1BR2A 4GYTA 1NBBA 4JURI 4E7ZA 3EHNA 5JUAA 1ZW3A 1T6IA 3ABKC 1Z63A 1CPQA 2YL7A 2AWYA 4U5DE 1Y6DA 1M6TA 1JAFA 4J30B 4XEFA 1XZQA 2OJED 3O39A 4XWJA 4CIHA 1K05A 3LJBA 1XWJA 4MS2A 3H2UA 5CI8A 1QLEC 3CQZA 4E18A 1OW6A 2EIKC 4P9FA 4ULWA 2EIJC 3HNKA 4B6IA 4BJ1A 4O6MA 4YT4A 1E2XA 4WGZA 1E84A 3US6A 3HNLA 3E9VA 3S29A 1NG1A 2I15A 3VM6A 2R7SA 5D92A 3HKKA 3LUTB 1EKYA 1CGNA 2GA0A 4AK9A 3AG2C 3SEOA 2A69F 4YN0B 3JYHA 3HJCA 3IEEA 3KYIA 2YHSA 3EGXA 4CJOA 1I5NA 2Y3BA 2P6VA 4O7GA 4CX9A 4JTCB 1T9KA 4IB4A 3K6BA 2Y39A 3C7JA 4BJ6A 1ZHTA 1G4WR 1VMAA 2B0HA 3C18A 5D91A 3S84A 1WN0A 3ZQVA 2YKZA 2CCYA 2J8WA 3NYLA 2YEVA 1H9TA 2EIMC 3SYNA 1N1CA 4LACB 3UNGC 5KYYA 4CSAA 4NQFA 4CBEA 2YLGA 4XPWA 2XRHA 3K33A 4ONSA 4UDVA 3W8IA 2LFFA 3EGXB 2OQMA 4K7BA 4E0HA 3DE8A 2GWWA 1D0ZA
chains in the Genus database with same CATH topology
3W2VA 4CS9A 1Z6AA 4BJ5C 2C03A 1WGWA 4MNDA 2GFHA 3VYWA 4A2NB 1TWHA 3FVYA 5KYYB 3EGDB 4KI2A 3AQBA 3HTKC 3KH2A 1PD0A 1MMGA 2H7BA 2YZSA 4IWBA 4Q5SF 4ZLDA 4BJ6C 3DJUB 4OINF 3LS0A 2WL8A 1W2WA 2WB7A 2OG2A 5B1BC 4G7ZF 2ZXRA 2QTVA 5L3QA 1VOMA 5F5FA 4NY3A 2NUTA 1MNEA 1IW7F 3JRTA 2E87A 1VYKA 3EH2A 5KYWA 3UGOA 4W8KA 4U5BE 4U5CE 3TD7A 4CS9C 3EG9A 4MQ9F 1OCOC 2Q9BA 1RJ9B 5B1AC 2PX3A 2Y3HA 4U5EE 3CZ6A 3GANA 3DZAA 3EFOA 1MMAA 4ZLCA 3FAJA 4PJNA 2XL4A 2I8BA 2J0XA 3WODF 1V54C 5KYWB 1LS1A 3Q7GA 1OKKD 3SNHA 5E3AA 3UGPA 3EG9B 4C7OA 1G8XA 5DVWA 3F46A 1O87A 2MYSA 1Z23A 1ZHWA 1TKNA 2WZGA 3RFYA 2KGOA 4U5HA 1D1CA 3S28A 2DGJA 1J8MF 3ZSUA 2W4BA 3B0VC 4YT5A 3JCUQ 4HFKB 3EQLF 4P6IC 4PJJA 3UMIA 4YT2A 2Y3DA 1VK5A 3JT1A 4CS8C 5CI9A 2KNHA 2WVQA 1M57C 2L81A 4C7OB 3N0TA 3I4UA 3AG3C 4XLPF 2W4MA 3JSZA 5HSWA 4DBRA 3DAFA 4FWVA 5DS4A 1OCCC 1FTSA 3UMHA 1M2VA 4PFOA 4U5GA 2LSEA 2ZXOA 3Q7LA 4YWQA 1ST6A 3X2QC 4QI2A 2IXOA 3T6JA 1FFTC 3LLKA 4RBNA 3WG7C 2IYLD 3H65A 3NG1A 2IXNA 3RYLA 1M2VB 3B0PA 3EGDA 4AX2A 4PK4A 4CS7A 5DS5A 3T4RA 4DOZA 3LAYA 3NYJA 2CNWA 2W45A 3UR3C 2FGYA 3S27A 1D0XA 3I5PA 3LLIA 5L3VA 1LVKA 3NKDA 1FMWA 1Z3IX 3E70C 1JPJA 3W8HA 5EHHA 3AG4C 3UMKA 3VAYA 3B9QA 4OIQF 4DVZA 1NU9C 5KYNA 2Q9AA 2G3VA 4M63A 2CW0F 1RJ9A 3S0XA 2R7TA 2J7PA 3F47A 2G3KA 4CSAC 3DJNB 2WVOA 2H7VC 3EHMA 5DS6A 3Q6NA 4YJWA 3DM9B 5T1DB 3LNRA 2CGEA 4XTKA 4RDAA 1TWAA 4C3EA 5E2QA 2R7XA 1NU7D 2PX0A 3SZRA 3QMKA 2ZXWC 3QZCA 2IXMA 3LESA 3AG1C 4KBLA 4U5FE 1TWCA 2L9JA 1MMNA 2J7PD 2Y3GA 2W9YA 3B0UX 4O6NA 1LKXA 4I3MA 1FMVA 1BR1A 4HEAJ 2P7VA 5E3CA 5DLJA 1D1BA 4DBQA 3ABMC 1ZHYA 1M2OA 4QDLA 1M56C 3HLZA 2OCCC 3N24A 5EGYA 4JZAA 2R7UA 2G62A 2JD3A 4C3DA 2R7WA 2WZFA 3K1HA 1D1AA 4DVYP 2QY9A 4I1MA 2Y69C 2Q3TA 2HV6A 4JCHA 3X1OA 1OCZC 1TR2A 3ZVRA 2NG1A 3ZIBA 4PJMA 3FHDA 3ABLC 4JJFA 2ZXPA 3O6XA 4BJTA 3DXJF 1BR4A 3Q6MA 1Z5ZA 4X0RA 3DM5A 3PMRA 3KKBA 4I1OB 3DD7A 2B0JA 5T3TA 2NUPA 2XSEA 2A6EF 5BUOA 3K66A 4Q4ZF 3NKEA 3EH1A 3EZHA 5DQZA 4PJLA 2A68F 4EWCA 3I5QA 3NYMA 3L0IA 2KJGA 3LEVA 3CSKA 3OWTA 3PHF2 3RKOF 4N06A 4J32B 2IXPA 2NUPB 2WVNA 4BJ5A 2V26A 5T3WA 2KW3C 4ANJA 2DYSC 5E33A 1MNDA 4JW1A 5DQTA 4H4KC 1V55C 2A1DD 2FFHA 4G7OF 4AE4A 1PCXA 4KNWA 3NDBB 3ITFA 5B3SC 2PP4A 2Z15A 3ZC4A 4GEHA 4IAOA 3OA1A 3M1CB 2IOQA 4OD4A 4LERA 3V7OA 4BEJA 1IZMA 2KQ9A 3NRHA 5KYUA 3ECSA 1FFHA 4LLEA 4JVSA 3RIPA 3T6BA 1MMDA 3DAGA 2J0WA 4AE4B 2J9UA 3ZG1A 1JPNA 1OCRC 2C04A 3SP1A 2D5RB 2EILC 3ASOC 4YT8A 5IY5C 1O5HA 1ZU4A 2CNWD 4Q7CA 4F4BA 5KYUB 2R7QA 3OEOA 3POVA 4G7HF 2M4EA 3EZIA 3EPVA 2CDQA 3K7DA 1S7ZA 4KNVA 4JJGA 1QZXA 4XLNF 4RD9A 2DYRC 4HE8D 3L34A 5KYXA 2R7VA 2J45A 1ZHXA 2EINC 2PFDA 1D0YA 4OIOF 2R7OA 2XXAA 2X51A 4BG0A 2V3CC 2A6HF 3KL4A 1OKKA 2Q9CA 4O79A 2ZPAA 1PD1A 5FCLA 4G0HA 4KC9A 1SF8A 5KYXB 3DMDA 3AQCA 4CS8A 4O6YA 1SZIA 4OIPF 4OD5A 4OIRF 3ASNC 3MLGA 2XXAB 2VB6A 4IRUA 3FDQA 1ZHZA 4WJ0A 2NUTB 3KMIA 3EJNA 2J46A 2VASA 1ZU5A 2MWQA 3GODA 5F5HA 4HFFB 2VH3A 4K0DA 2H7OA 3LS1A 2J9WA 4E7SA 4EBBA 1VYIA 4C3BA 1SMYF 2O9XA 2BE5F 4I44A 2R7RA 2PF4E 4QI0A 3MX3A 1J8YF 1ZYRF 4FESA 4PFPA 3EFOB 2J9VA 1TWGA 3RH3A 3W2WA 2WZLA 4IJJA 2HV7A 4FX5A 3N2ZB 1KU2A 4LLCA 1NZEA 3K1IC 1BR2A 4GYTA 4JURI 4E7ZA 3EHNA 1Z63A 3ABKC 4U5DE 4J30B 3O39A 4XWJA 4CIHA 3LJBA 5CI8A 1QLEC 3CQZA 2EIKC 4ULWA 2EIJC 4B6IA 4BJ1A 4YT4A 4O6MA 3S29A 3E9VA 1NG1A 2R7SA 5D92A 4AK9A 3AG2C 3SEOA 2A69F 4YN0B 3JYHA 3IEEA 3HJCA 2YHSA 3EGXA 2Y3BA 2P6VA 4O7GA 3K6BA 2Y39A 4BJ6A 1ZHTA 1VMAA 5D91A 3NYLA 2YEVA 2EIMC 3SYNA 1N1CA 4LACB 3UNGC 5KYYA 4CSAA 4CBEA 2XRHA 3K33A 3W8IA 3EGXB 4K7BA 1D0ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZSU A;  3LS0 A;  3LS1 A;  3JCU Q;  3RFY A;  1NZE A;  2MWQ A;  1VYK A; 
#chains in the Genus database with same CATH topology
 1WWP A;  3R7C A;  4YL3 A;  1Q0G A;  4J7Y A;  1V4A A;  3W2V A;  4CS9 A;  4D4X A;  1Z6A A;  4BJ5 C;  4CIP A;  1HE9 A;  2C03 A;  2AU5 A;  4Z9I A;  1WGW A;  4MND A;  2GFH A;  5L0H A;  3VYW A;  4A2N B;  1TWH A;  3A11 A;  3FVY A;  4E0I A;  1UFB A;  5KYY B;  1E83 A;  3EGD B;  4KI2 A;  3AQB A;  1S05 A;  3HTK C;  3U5S A;  4EUK B;  3KH2 A;  1PD0 A;  3C8G A;  4MTG A;  2LCH A;  1MMG A;  2QUP A;  3U2L A;  2H7B A;  2YZS A;  2BL2 A;  1T6U A;  4IWB A;  4JIO A;  4N6C A;  4Z9J A;  3PDM P;  4Q5S F;  1KNY A;  3JYY A;  4BJ6 C;  3C8Z A;  4ZLD A;  3DJU B;  3RQF A;  3M79 A;  3QW1 A;  4OIN F;  3LS0 A;  3GWL A;  1E85 A;  2WL8 A;  1HMD A;  1W2W A;  1GQA A;  1SR2 A;  2WB7 A;  2OG2 A;  3IQ5 A;  3MYI A;  2P61 A;  5B1B C;  5A69 A;  2R05 A;  3ZDL A;  4A4A A;  4MVR A;  4G7Z F;  2ZXR A;  2QTV A;  2NSG A;  5L3Q A;  1VOM A;  5F5F A;  4G78 A;  4NY3 A;  2NUT A;  1MNE A;  1VLT A;  1IW7 F;  3JRT A;  1WAT A;  2E87 A;  3L1M A;  1VYK A;  5L0G A;  3EH2 A;  5KYW A;  3C8G B;  4Z9H A;  3UGO A;  3IQ6 A;  3T9O A;  4W8K A;  4U5B E;  1Z7Q c;  1H6G A;  3TJ6 A;  2OU6 A;  4U5C E;  3TD7 A;  5CIV A;  4CS9 C;  3EG9 A;  2JPU A;  2A0U A;  2UUH A;  3CAX A;  4MQ9 F;  1T5O A;  1OCO C;  2Q9B A;  1A41 A;  2YL0 A;  1O3U A;  1RJ9 B;  2P0N A;  4YL0 A;  5B1A C;  3RVY A;  3WHN A;  2PX3 A;  2Y3H A;  4U5E E;  3CZ6 A;  2XLH A;  3GAN A;  2L6H A;  3TK0 A;  2YLI A;  3DZA A;  3EFO A;  1K40 A;  1MMA A;  3L8I A;  4ZLC A;  3RW0 A;  5L0D A;  3A9C A;  3FAJ A;  5JSL A;  4PJN A;  2XL4 A;  3NMI A;  2I8B A;  2J0X A;  3WOD F;  1V54 C;  2OJQ A;  5KYW B;  1LS1 A;  3G4X A;  4GQH A;  2QNL A;  3Q7G A;  1BDJ B;  1OKK D;  2M64 A;  3MYF A;  3SNH A;  5E3A A;  3AGT A;  3UGP A;  3EG9 B;  4C7O A;  1G8X A;  2EPO A;  5DVW A;  3F46 A;  2H8A A;  1O87 A;  2MYS A;  1Z23 A;  1AVO B;  1ZHW A;  1LE4 A;  1TKN A;  2WZG A;  5K0I A;  4MVU A;  4MVO A;  3RFY A;  1A7V A;  2KGO A;  4YL1 A;  2DI3 A;  1D1C A;  4U5H A;  2DGJ A;  3S28 A;  1V74 B;  1J8M F;  2MHR A;  3ZSU A;  4CDV A;  2W4B A;  2QLA A;  1AUE A;  4YT5 A;  3B0V C;  3JCU Q;  4HFK B;  3EQL F;  4P6I C;  3NMK A;  3JTL O;  4PJJ A;  3UMI A;  4YT2 A;  1OW8 A;  2Q00 A;  2Y3D A;  2EPM X;  1VK5 A;  3JT1 A;  4CS8 C;  5CI9 A;  2KNH A;  2WVQ A;  1M57 C;  2L81 A;  3JZ0 A;  2XLE A;  4C7O B;  1BZ4 A;  2L6G A;  3V5Y A;  2NSF A;  1C03 A;  256B A;  3I4U A;  3N0T A;  3WAQ A;  3AG3 C;  5HV9 A;  4XLP F;  2W4M A;  3JSZ A;  4L6R A;  5HSW A;  5BQH A;  3W4Y A;  2AVK A;  2XL6 A;  4DBR A;  4ER9 A;  3DAF A;  4FWV A;  5DS4 A;  1OCC C;  1FTS A;  3UMH A;  1CGM E;  1M2V A;  1SYQ A;  4PFO A;  1YA7 O;  3RVZ A;  1OR3 A;  4E17 A;  4U5G A;  2GDC A;  2LSE A;  2ZXO A;  3Q7L A;  3QVZ A;  4YWQ A;  1Q0K A;  1QSP A;  1YLM A;  1K04 A;  1ST6 A;  2HJM A;  3X2Q C;  4QI2 A;  2IXO A;  1F1M A;  1BBH A;  2P1A A;  1U0B B;  3H2V A;  4JC7 A;  1UG7 A;  3T6J A;  1FFT C;  1Q0M A;  3LLK A;  1Q0F A;  4RBN A;  3WG7 C;  5A6A A;  1WTY A;  1T6Q A;  3SXZ A;  2IYL D;  4WGY A;  3SXY A;  2XLD A;  3H65 A;  3NG1 A;  5EK0 A;  2IXN A;  3RYL A;  1YJG A;  1M2V B;  1DOW A;  2KSF A;  4D4N A;  3B0P A;  3EGD A;  2YL3 A;  4DRI B;  3DKA A;  3M4C A;  4AX2 A;  1OR2 A;  4MVZ A;  3CEX A;  2HJ3 A;  2HKV A;  4PK4 A;  2XLM A;  4CS7 A;  3GM1 A;  3T4R A;  5DS5 A;  1YDI A;  3S9O A;  4DOZ A;  3IHU A;  3LAY A;  3NYJ A;  4G7O F;  3AGU A;  2OEV A;  2CNW A;  4JEA A;  5A6K A;  3DWW A;  1RKE A;  2W45 A;  3UR3 C;  2FGY A;  3FOP A;  3S27 A;  1H9G A;  3RQG A;  1D0X A;  4BPM A;  2XS8 A;  3I5P A;  4XPY A;  3LLI A;  5L3V A;  1LVK A;  4MVM A;  3NKD A;  1FMW A;  4CDY A;  1Z3I X;  3E70 C;  3U3B A;  1JPJ A;  1QVX A;  1R5I D;  2HFI A;  3W8H A;  1FR0 A;  2XLV A;  5EHH A;  2A0B A;  3AG4 C;  3UMK A;  3VAY A;  1WOL A;  3B9Q A;  4OIQ F;  1T01 A;  4DVZ A;  2YVK A;  1NU9 C;  3GEI A;  5KYN A;  1Q0D A;  2VC9 A;  2Q9A A;  3IPM O;  2G3V A;  4M63 A;  3HNJ A;  2NPU A;  2CW0 F;  1FAP B;  1RKE B;  4YK5 A;  2PNO A;  5A6J A;  3GEH A;  3U2M A;  1RJ9 A;  3S0X A;  2R7T A;  2J7P A;  3F47 A;  2G3K A;  2XL8 A;  4CSA C;  1RKC A;  3G4Z A;  4PAC A;  5L0C A;  2KYH A;  2YRF A;  3DJN B;  2WVO A;  5L0I A;  2XM4 A;  4LDK A;  2H7V C;  2LFD A;  3EHM A;  5DS6 A;  3Q6N A;  4YJW A;  1LS4 A;  3U9J A;  3FAP B;  3DM9 B;  5T1D B;  2AWC A;  3LNR A;  3NMJ A;  2CGE A;  4XTK A;  1HMO A;  4RDA A;  4JCZ A;  1TWA A;  3U3F A;  4C3E A;  5E2Q A;  2R7X A;  2RD9 A;  1NU7 D;  4NTF A;  1HY5 A;  2PX0 A;  2EPK X;  5F28 E;  3C8G D;  2IBF A;  4NTB A;  3SZR A;  3QMK A;  1E86 A;  1JOG A;  2R03 A;  2ZXW C;  3VF0 A;  3S90 A;  2LD6 A;  3FOO A;  3QZC A;  4AL1 A;  2IXM A;  1TQG A;  3LES A;  4H54 A;  3M15 A;  3AG1 C;  4KBL A;  4U5F E;  4XPX A;  5AC4 A;  2HUJ A;  5AGF A;  5L0J A;  1TWC A;  2EPL X;  2L9J A;  1MMN A;  2J7P D;  2Y3G A;  2W9Y A;  3KPH A;  3B0U X;  3GM3 A;  4O6N A;  2JX0 A;  1ORY A;  1LKX A;  3DE9 A;  4MW3 A;  4EIY A;  1LI5 A;  1JMW A;  1ZZP A;  4I3M A;  1GGQ A;  5JRA A;  3U0C A;  3AOU A;  1FMV A;  1BR1 A;  4HEA J;  2P7V A;  4JKV A;  5E3C A;  1GM5 A;  5DLJ A;  3B29 A;  3GM2 A;  3JRM O;  1D1B A;  4DXW A;  4DBQ A;  2EPN A;  3ABM C;  1ZHY A;  1M2O A;  3K1I A;  4QDL A;  1HW1 A;  1M56 C;  2R25 A;  2OCC C;  1YAR O;  3AJM A;  3HLZ A;  3N24 A;  4JZA A;  3TQO A;  2AP3 A;  3V5Z A;  5EGY A;  2R7U A;  1YZC A;  1QQ3 A;  2G62 A;  1VTM P;  2LP4 A;  2JD3 A;  4MW8 A;  4PR9 A;  3U9M A;  4C3D A;  4JEB A;  2R7W A;  1HE1 A;  1YYJ A;  2WZF A;  3K1H A;  1D1A A;  3R2P A;  4DVY P;  2TMV P;  2QY9 A;  2HMZ A;  4I1M A;  2Y69 C;  2Q3T A;  2HV6 A;  2KC3 A;  4JCH A;  3X1O A;  2KK1 A;  4WAB A;  2R02 A;  2XXA B;  1OCZ C;  1TR2 A;  3ZVR A;  1LPE A;  2IM8 A;  2NG1 A;  1TFK B;  1Y4C A;  2VCA A;  4MTO A;  3ZIB A;  4PJM A;  5TJ5 E;  3G50 A;  3FHD A;  3ABL C;  4JJF A;  4R32 A;  1G4U S;  2YWA A;  2ZXP A;  1YZA A;  3O6X A;  3T6G B;  4BJT A;  1VB5 A;  3DXJ F;  1BR4 A;  1A7D A;  3Q6M A;  5FZT A;  4K1O A;  1Z5Z A;  4X0R A;  1MQV A;  3DM5 A;  5BQG A;  2YLD A;  3PMR A;  3KKB A;  4I1O B;  1EQ1 A;  3DD7 A;  2DB4 A;  2B0J A;  5A6B D;  1DOV A;  1NFN A;  3DI5 A;  1RXQ A;  3JSE O;  5T3T A;  4N6H A;  2NUP A;  2XSE A;  2A6E F;  1RMV A;  3ATP A;  5BUO A;  3K66 A;  4Q4Z F;  3NKE A;  2YL1 A;  4DRH B;  4EHP A;  2R9R B;  3EH1 A;  3EZH A;  5DQZ A;  4MVQ A;  4PJL A;  2A68 F;  4ULV A;  4EWC A;  3I5Q A;  4CDA A;  2ETS A;  1CGO A;  3NYM A;  3L0I A;  1JRA A;  3FXH A;  1R4T A;  4EKW A;  2OEX A;  2KJG A;  2RSE B;  3LEV A;  3CSK A;  3OWT A;  3O55 A;  3PHF 2;  3RKO F;  4N06 A;  3O10 A;  4J32 B;  4CJG A;  2IXP A;  1TFO B;  3QTH A;  2D4U A;  2NUP B;  2WVN A;  4BJ5 A;  2V26 A;  3V5X A;  5T3W A;  2KW3 C;  4ANJ A;  1ORJ A;  2DYS C;  2LK4 A;  5E33 A;  3SXM A;  1MND A;  4JW1 A;  5A6B A;  5DQT A;  4H4K C;  1U6H A;  4JTA B;  1V55 C;  1NFO A;  1QPU A;  2LQG A;  2L6F A;  2Q4F A;  3LNM B;  2A1D D;  2FFH A;  5GPG B;  1EA8 A;  3L8J A;  3B71 A;  3ZQY A;  1PCX A;  4AE4 A;  4KNW A;  4DJ9 A;  3GEE A;  3QW0 A;  5BQI A;  3ITF A;  3NDB B;  5B3S C;  2PP4 A;  2Z15 A;  1KTM A;  3ZC4 A;  4GEH A;  4IAO A;  3OA1 A;  2XLW A;  3ZTZ A;  3M1C B;  5COG A;  4JTD B;  2IOQ A;  4OD4 A;  1G5Z A;  4LER A;  2Q7R A;  3ZWI A;  4DRJ B;  2HS5 A;  3V7O A;  2YQY A;  4BEJ A;  4AL0 A;  1IZM A;  2KQ9 A;  3NRH A;  5KYU A;  1U89 A;  3ECS A;  3BRJ A;  1FFH A;  1L3P A;  4IAQ A;  1FNT c;  4JRZ A;  4LLE A;  3GWN A;  4JVS A;  3RIP A;  3T6B A;  1MMD A;  3GOR A;  4P9T A;  4W8P A;  2GAQ A;  4XQ1 A;  5JS5 A;  1APC A;  3DAG A;  3MBG A;  2CYD A;  2J0W A;  1I4Y A;  4AE4 B;  1OW7 A;  1AEP A;  2J9U A;  2VCB A;  1JPN A;  1OCR C;  2X0C A;  3ZG1 A;  2C04 A;  1I4Z A;  3HNI A;  4U9D A;  3SP1 A;  2D5R B;  1YAU O;  1ZW2 A;  1OXK A;  2EIL C;  3ASO C;  3VRC A;  4YT8 A;  3TOL A;  1LM3 B;  4XEV A;  5IY5 C;  5JVE A;  1O5H A;  1ZU4 A;  4JE9 A;  2CNW D;  4Q7C A;  2OOC A;  4F4B A;  5KYU B;  2XS1 A;  2R7Q A;  3OEO A;  3POV A;  4G7H F;  2M4E A;  1B68 A;  3EZI A;  3LEO A;  3EPV A;  3TJ5 A;  2CDQ A;  3K7D A;  5JP7 A;  1S7Z A;  4J7T A;  4KNV A;  1L7C A;  5AC5 A;  4JJG A;  2UUI A;  5JLI A;  1QZX A;  5COM A;  4RD9 A;  4XLN F;  2VCC A;  4XEK A;  2DYR C;  4HE8 D;  2HZ8 A;  3L34 A;  2HSQ A;  3TOM A;  5KYX A;  2R7V A;  2J45 A;  2BC5 A;  2OKU A;  2LIG A;  5JT4 A;  5L0F A;  1HW2 A;  2XM0 A;  1ZHX A;  2EIN C;  2PFD A;  1D0Y A;  1QKR A;  1NLX A;  4OIO F;  1ZVZ A;  2R7O A;  4EBJ A;  2PBE A;  2J9B A;  2XXA A;  2X51 A;  4BG0 A;  1PV3 A;  4FAP B;  3QVY A;  1JR8 A;  4NCQ A;  1LI7 A;  2V3C C;  2A6H F;  3KL4 A;  1OKK A;  2Q9C A;  2L7A A;  4O79 A;  2F22 A;  2HMQ A;  1PD1 A;  2ASR A;  2ICW G;  2ZPA A;  1A0B A;  4BEM J;  3J06 A;  2FAP B;  5FCL A;  4G0H A;  1NSG B;  1ORS C;  1OQC A;  1YA9 A;  4KC9 A;  1SF8 A;  5KYX B;  3DMD A;  2XLO A;  3TUL A;  4MTF A;  4EBK A;  1XZP A;  3AQC A;  4CS8 A;  4O6Y A;  1SZI A;  3RF3 A;  4OIP F;  4OD5 A;  3IQT A;  3BEH A;  1YVI A;  4OIR F;  3ASN C;  3MLG A;  1LE2 A;  3C63 A;  4IGG A;  1CPR A;  3FMS A;  2VB6 A;  4IRU A;  4MVS A;  4NC3 A;  3RQE A;  3FDQ A;  4NTA A;  1GS9 A;  3C62 A;  1ZHZ A;  4WJ0 A;  1C02 A;  2NUT B;  3KMI A;  3SXK A;  3EJN A;  2J46 A;  4IAR A;  3ZTM A;  4LDR A;  4LDQ A;  1C17 M;  1YYX A;  1VLS A;  2VAS A;  2ZD9 A;  3PCV A;  5COF A;  1OXB A;  3MFN A;  1ZU5 A;  1H7I A;  2QE9 A;  2MWQ A;  3GOD A;  1EI7 A;  5F5H A;  3M4B A;  2VH3 A;  4HFF B;  4K0D A;  3U8V A;  2H7O A;  3LS1 A;  5B3I A;  2J9W A;  3IQC A;  3KYJ A;  4E7S A;  4EBB A;  1VYI A;  4C3B A;  1SMY F;  2O9X A;  2BE5 F;  4I44 A;  2R7R A;  1A7E A;  2PF4 E;  4QI0 A;  3U8P A;  3MX3 A;  1J8Y F;  1ZYR F;  4FES A;  4PFP A;  1WAS A;  2J9V A;  3EFO B;  4U9E A;  1TWG A;  1LIH A;  2HSB A;  3RH3 A;  3W2W A;  2WZL A;  1RCP A;  4IJJ A;  2HV7 A;  4FX5 A;  4N4W A;  3N2Z B;  1KU2 A;  4LLC A;  1NZE A;  3K1I C;  1BR2 A;  4GYT A;  1NBB A;  4JUR I;  4E7Z A;  3EHN A;  5JUA A;  1ZW3 A;  1T6I A;  3ABK C;  1Z63 A;  1CPQ A;  2YL7 A;  2AWY A;  4U5D E;  1Y6D A;  1M6T A;  1JAF A;  4J30 B;  4XEF A;  1XZQ A;  2OJE D;  3O39 A;  4XWJ A;  4CIH A;  1K05 A;  3LJB A;  1XWJ A;  4MS2 A;  3H2U A;  5CI8 A;  1QLE C;  3CQZ A;  4E18 A;  1OW6 A;  2EIK C;  4P9F A;  4ULW A;  2EIJ C;  3HNK A;  4B6I A;  4BJ1 A;  4O6M A;  4YT4 A;  1E2X A;  4WGZ A;  1E84 A;  3US6 A;  3HNL A;  3E9V A;  3S29 A;  1NG1 A;  2I15 A;  3VM6 A;  2R7S A;  5D92 A;  3HKK A;  3LUT B;  1EKY A;  1CGN A;  2GA0 A;  4AK9 A;  3AG2 C;  3SEO A;  2A69 F;  4YN0 B;  3JYH A;  3HJC A;  3IEE A;  3KYI A;  2YHS A;  3EGX A;  4CJO A;  1I5N A;  2Y3B A;  2P6V A;  4O7G A;  4CX9 A;  4JTC B;  1T9K A;  4IB4 A;  3K6B A;  2Y39 A;  3C7J A;  4BJ6 A;  1ZHT A;  1G4W R;  1VMA A;  2B0H A;  3C18 A;  5D91 A;  3S84 A;  1WN0 A;  3ZQV A;  2YKZ A;  2CCY A;  2J8W A;  3NYL A;  2YEV A;  1H9T A;  2EIM C;  3SYN A;  1N1C A;  4LAC B;  3UNG C;  5KYY A;  4CSA A;  4NQF A;  4CBE A;  2YLG A;  4XPW A;  2XRH A;  3K33 A;  4ONS A;  4UDV A;  3W8I A;  2LFF A;  3EGX B;  2OQM A;  4K7B A;  4E0H A;  3DE8 A;  2GWW A;  1D0Z A; 
#chains in the Genus database with same CATH homology
 3W2V A;  4CS9 A;  1Z6A A;  4BJ5 C;  2C03 A;  1WGW A;  4MND A;  2GFH A;  3VYW A;  4A2N B;  1TWH A;  3FVY A;  5KYY B;  3EGD B;  4KI2 A;  3AQB A;  3HTK C;  3KH2 A;  1PD0 A;  1MMG A;  2H7B A;  2YZS A;  4IWB A;  4Q5S F;  4ZLD A;  4BJ6 C;  3DJU B;  4OIN F;  3LS0 A;  2WL8 A;  1W2W A;  2WB7 A;  2OG2 A;  5B1B C;  4G7Z F;  2ZXR A;  2QTV A;  5L3Q A;  1VOM A;  5F5F A;  4NY3 A;  2NUT A;  1MNE A;  1IW7 F;  3JRT A;  2E87 A;  1VYK A;  3EH2 A;  5KYW A;  3UGO A;  4W8K A;  4U5B E;  4U5C E;  3TD7 A;  4CS9 C;  3EG9 A;  4MQ9 F;  1OCO C;  2Q9B A;  1RJ9 B;  5B1A C;  2PX3 A;  2Y3H A;  4U5E E;  3CZ6 A;  3GAN A;  3DZA A;  3EFO A;  1MMA A;  4ZLC A;  3FAJ A;  4PJN A;  2XL4 A;  2I8B A;  2J0X A;  3WOD F;  1V54 C;  5KYW B;  1LS1 A;  3Q7G A;  1OKK D;  3SNH A;  5E3A A;  3UGP A;  3EG9 B;  4C7O A;  1G8X A;  5DVW A;  3F46 A;  1O87 A;  2MYS A;  1Z23 A;  1ZHW A;  1TKN A;  2WZG A;  3RFY A;  2KGO A;  4U5H A;  1D1C A;  3S28 A;  2DGJ A;  1J8M F;  3ZSU A;  2W4B A;  3B0V C;  4YT5 A;  3JCU Q;  4HFK B;  3EQL F;  4P6I C;  4PJJ A;  3UMI A;  4YT2 A;  2Y3D A;  1VK5 A;  3JT1 A;  4CS8 C;  5CI9 A;  2KNH A;  2WVQ A;  1M57 C;  2L81 A;  4C7O B;  3N0T A;  3I4U A;  3AG3 C;  4XLP F;  2W4M A;  3JSZ A;  5HSW A;  4DBR A;  3DAF A;  4FWV A;  5DS4 A;  1OCC C;  1FTS A;  3UMH A;  1M2V A;  4PFO A;  4U5G A;  2LSE A;  2ZXO A;  3Q7L A;  4YWQ A;  1ST6 A;  3X2Q C;  4QI2 A;  2IXO A;  3T6J A;  1FFT C;  3LLK A;  4RBN A;  3WG7 C;  2IYL D;  3H65 A;  3NG1 A;  2IXN A;  3RYL A;  1M2V B;  3B0P A;  3EGD A;  4AX2 A;  4PK4 A;  4CS7 A;  5DS5 A;  3T4R A;  4DOZ A;  3LAY A;  3NYJ A;  2CNW A;  2W45 A;  3UR3 C;  2FGY A;  3S27 A;  1D0X A;  3I5P A;  3LLI A;  5L3V A;  1LVK A;  3NKD A;  1FMW A;  1Z3I X;  3E70 C;  1JPJ A;  3W8H A;  5EHH A;  3AG4 C;  3UMK A;  3VAY A;  3B9Q A;  4OIQ F;  4DVZ A;  1NU9 C;  5KYN A;  2Q9A A;  2G3V A;  4M63 A;  2CW0 F;  1RJ9 A;  3S0X A;  2R7T A;  2J7P A;  3F47 A;  2G3K A;  4CSA C;  3DJN B;  2WVO A;  2H7V C;  3EHM A;  5DS6 A;  3Q6N A;  4YJW A;  3DM9 B;  5T1D B;  3LNR A;  2CGE A;  4XTK A;  4RDA A;  1TWA A;  4C3E A;  5E2Q A;  2R7X A;  1NU7 D;  2PX0 A;  3SZR A;  3QMK A;  2ZXW C;  3QZC A;  2IXM A;  3LES A;  3AG1 C;  4KBL A;  4U5F E;  1TWC A;  2L9J A;  1MMN A;  2J7P D;  2Y3G A;  2W9Y A;  3B0U X;  4O6N A;  1LKX A;  4I3M A;  1FMV A;  1BR1 A;  4HEA J;  2P7V A;  5E3C A;  5DLJ A;  1D1B A;  4DBQ A;  3ABM C;  1ZHY A;  1M2O A;  4QDL A;  1M56 C;  3HLZ A;  2OCC C;  3N24 A;  5EGY A;  4JZA A;  2R7U A;  2G62 A;  2JD3 A;  4C3D A;  2R7W A;  2WZF A;  3K1H A;  1D1A A;  4DVY P;  2QY9 A;  4I1M A;  2Y69 C;  2Q3T A;  2HV6 A;  4JCH A;  3X1O A;  1OCZ C;  1TR2 A;  3ZVR A;  2NG1 A;  3ZIB A;  4PJM A;  3FHD A;  3ABL C;  4JJF A;  2ZXP A;  3O6X A;  4BJT A;  3DXJ F;  1BR4 A;  3Q6M A;  1Z5Z A;  4X0R A;  3DM5 A;  3PMR A;  3KKB A;  4I1O B;  3DD7 A;  2B0J A;  5T3T A;  2NUP A;  2XSE A;  2A6E F;  5BUO A;  3K66 A;  4Q4Z F;  3NKE A;  3EH1 A;  3EZH A;  5DQZ A;  4PJL A;  2A68 F;  4EWC A;  3I5Q A;  3NYM A;  3L0I A;  2KJG A;  3LEV A;  3CSK A;  3OWT A;  3PHF 2;  3RKO F;  4N06 A;  4J32 B;  2IXP A;  2NUP B;  2WVN A;  4BJ5 A;  2V26 A;  5T3W A;  2KW3 C;  4ANJ A;  2DYS C;  5E33 A;  1MND A;  4JW1 A;  5DQT A;  4H4K C;  1V55 C;  2A1D D;  2FFH A;  4G7O F;  4AE4 A;  1PCX A;  4KNW A;  3NDB B;  3ITF A;  5B3S C;  2PP4 A;  2Z15 A;  3ZC4 A;  4GEH A;  4IAO A;  3OA1 A;  3M1C B;  2IOQ A;  4OD4 A;  4LER A;  3V7O A;  4BEJ A;  1IZM A;  2KQ9 A;  3NRH A;  5KYU A;  3ECS A;  1FFH A;  4LLE A;  4JVS A;  3RIP A;  3T6B A;  1MMD A;  3DAG A;  2J0W A;  4AE4 B;  2J9U A;  3ZG1 A;  1JPN A;  1OCR C;  2C04 A;  3SP1 A;  2D5R B;  2EIL C;  3ASO C;  4YT8 A;  5IY5 C;  1O5H A;  1ZU4 A;  2CNW D;  4Q7C A;  4F4B A;  5KYU B;  2R7Q A;  3OEO A;  3POV A;  4G7H F;  2M4E A;  3EZI A;  3EPV A;  2CDQ A;  3K7D A;  1S7Z A;  4KNV A;  4JJG A;  1QZX A;  4XLN F;  4RD9 A;  2DYR C;  4HE8 D;  3L34 A;  5KYX A;  2R7V A;  2J45 A;  1ZHX A;  2EIN C;  2PFD A;  1D0Y A;  4OIO F;  2R7O A;  2XXA A;  2X51 A;  4BG0 A;  2V3C C;  2A6H F;  3KL4 A;  1OKK A;  2Q9C A;  4O79 A;  2ZPA A;  1PD1 A;  5FCL A;  4G0H A;  4KC9 A;  1SF8 A;  5KYX B;  3DMD A;  3AQC A;  4CS8 A;  4O6Y A;  1SZI A;  4OIP F;  4OD5 A;  4OIR F;  3ASN C;  3MLG A;  2XXA B;  2VB6 A;  4IRU A;  3FDQ A;  1ZHZ A;  4WJ0 A;  2NUT B;  3KMI A;  3EJN A;  2J46 A;  2VAS A;  1ZU5 A;  2MWQ A;  3GOD A;  5F5H A;  4HFF B;  2VH3 A;  4K0D A;  2H7O A;  3LS1 A;  2J9W A;  4E7S A;  4EBB A;  1VYI A;  4C3B A;  1SMY F;  2O9X A;  2BE5 F;  4I44 A;  2R7R A;  2PF4 E;  4QI0 A;  3MX3 A;  1J8Y F;  1ZYR F;  4FES A;  4PFP A;  3EFO B;  2J9V A;  1TWG A;  3RH3 A;  3W2W A;  2WZL A;  4IJJ A;  2HV7 A;  4FX5 A;  3N2Z B;  1KU2 A;  4LLC A;  1NZE A;  3K1I C;  1BR2 A;  4GYT A;  4JUR I;  4E7Z A;  3EHN A;  1Z63 A;  3ABK C;  4U5D E;  4J30 B;  3O39 A;  4XWJ A;  4CIH A;  3LJB A;  5CI8 A;  1QLE C;  3CQZ A;  2EIK C;  4ULW A;  2EIJ C;  4B6I A;  4BJ1 A;  4YT4 A;  4O6M A;  3S29 A;  3E9V A;  1NG1 A;  2R7S A;  5D92 A;  4AK9 A;  3AG2 C;  3SEO A;  2A69 F;  4YN0 B;  3JYH A;  3IEE A;  3HJC A;  2YHS A;  3EGX A;  2Y3B A;  2P6V A;  4O7G A;  3K6B A;  2Y39 A;  4BJ6 A;  1ZHT A;  1VMA A;  5D91 A;  3NYL A;  2YEV A;  2EIM C;  3SYN A;  1N1C A;  4LAC B;  3UNG C;  5KYY A;  4CSA A;  4CBE A;  2XRH A;  3K33 A;  3W8I A;  3EGX B;  4K7B A;  1D0Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...