3LS1A

Crystal structure of cyanobacterial psbq from synechocystis sp. pcc 6803 complexed with zn2+
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
133
structure length
133
Chain Sequence
GPLGSCSSPQVEIPTTYSPEKIAQLQVYVNPIAVARDGMEKRLQGLIADQNWVDTQTYIHGPLGQLRRDMLGLASSLLPKDQDKAKTLAKEVFGHLERLDAAAKDRNGSQAKIQYQEALADFDSFLNLLPQAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of PsbQ from Synechocystis sp. PCC 6803 at 1.8 A: Implications for Binding and Function in Cyanobacterial Photosystem II
pubmed doi rcsb
source organism Synechocystis sp.
molecule tags Photosynthesis
molecule keywords Sll1638 protein
total genus 50
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05757 PsbQ Oxygen evolving enhancer protein 3 (PsbQ)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.290 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3ls1A00
1VYKA 3JCUQ 1NZEA 3LS1A 3RFYA 3ZSUA 3LS0A 2MWQA
chains in the Genus database with same CATH superfamily
4GQHA 2R7OA 4XWJA 1E85A 1Q0GA 3H65A 3GM2A 3W4YA 3TD7A 1WTYA 1LE2A 1WOLA 1DOWA 3PMRA 3JYYA 1E2XA 2RD9A 1ZW2A 4MTGA 3U9MA 3X2QC 4D4NA 3S0XA 5F5HA 3ZC4A 1C02A 2CYDA 2P7VA 4J7YA 3TOMA 3W8IA 3VF0A 3X1OA 1ZHXA 2WVOA 2PF4E 3RYLA 2HUJA 2YZSA 3UNGC 1FAPB 4YT2A 1D0XA 3ASNC 3MX3A 1VTMP 3O39A 1K40A 3IEEA 2XL8A 4CDVA 1PCXA 2R7WA 3OWTA 1CPQA 5JLIA 1XZQA 1YA7O 3C8GD 2XXAB 1TWCA 2VB6A 2JD3A 4Q5SF 5KYUA 1A7EA 1OXKA 2WVNA 1SR2A 3A11A 3NKDA 4DOZA 1T5OA 1MMNA 5GPGB 5JSLA 3L8IA 5EGYA 1SYQA 1K04A 1TQGA 1WGWA 1EA8A 4JCZA 4K1OA 2W9YA 3VRCA 4DJ9A 2PBEA 1NG1A 2CGEA 4OIQF 3QW0A 4Q7CA 5A6BD 4IWBA 1RJ9A 4U9DA 2Y3DA 4JEBA 3HNLA 4H4KC 3UGPA 1T01A 1I4ZA 3A9CA 3Q7LA 2R7TA 5HV9A 3PHF2 2WZFA 3U5SA 1CGNA 4YWQA 1NU9C 3DZAA 2OEVA 4U5CE 4DVZA 5DQZA 4BEJA 2CW0F 5DS5A 1Z7Qc 2R05A 3GM3A 3QMKA 3M4CA 1HE1A 3Q6MA 3C18A 4MVUA 1HW2A 3FVYA 4GEHA 3EHMA 5L3VA 2QE9A 3O10A 3N2ZB 4PJLA 2MYSA 1C17M 3T4RA 1GM5A 2X0CA 2BL2A 3SXKA 3C62A 4LDQA 3U2LA 2HJ3A 2A0UA 3RFYA 1H9GA 4IARA 4WGZA 1QSPA 4L6RA 4A4AA 1D0ZA 2XLHA 3QW1A 4XEKA 5KYUB 1WATA 4AE4B 2H7OA 3NRHA 2IXOA 1BDJB 5D92A 5TJ5E 2PFDA 4DXWA 1YA9A 1VYIA 3NYJA 4E17A 5L3QA 2C03A 4EBJA 5IY5C 4C7OB 2J9UA 3G4XA 2DI3A 4GYTA 3F46A 1ZYRF 2XS8A 4MW8A 5E2QA 1TKNA 2AP3A 4JJGA 2R9RB 4PJJA 5DS4A 2P61A 5FCLA 1FFTC 256BA 3PDMP 4FAPB 4JKVA 4XLPF 2XLEA 3POVA 1MMDA 1NBBA 2HKVA 4P9FA 2NUTB 2F22A 1CGOA 2EIKC 2QY9A 1T6UA 1Z6AA 3Q7GA 3L0IA 4HEAJ 3RKOF 5E3CA 5JRAA 2HS5A 4M63A 1RKEB 2J9VA 2HV7A 3B0VC 4JVSA 1BR2A 3N24A 1OW7A 3EGDA 4U5BE 3ZTMA 2EPNA 1ZU5A 4EWCA 4EBKA 3V5XA 4DBQA 4CS9C 2Q7RA 1VYKA 2J46A 5COFA 5L0CA 2HSQA 2KK1A 2OU6A 5KYYA 2X51A 3LS1A 2GAQA 4I1MA 1U89A 3L1MA 1FNTc 4BJ6C 1LKXA 3U8VA 1E84A 2DYSC 3O55A 1R5ID 1ZHZA 2VC9A 1LIHA 2IYLD 4A2NB 3I4UA 4DRJB 3K6BA 5L0JA 5KYYB 1JRAA 3C63A 4YT5A 3SXMA 2WZGA 3GEIA 2XM0A 1M2VA 1AVOB 1HE9A 2XS1A 4E7SA 2WZLA 2R03A 2VCCA 1G8XA 1AUEA 3MYIA 2Y69C 5L0HA 5L0GA 3TK0A 4BJ5C 2YHSA 2R25A 3SNHA 1Q0FA 3DD7A 3U9JA 3E9VA 4MVZA 3KH2A 1LI5A 1G4US 2J9BA 4OD4A 3ZVRA 2L6FA 5T3WA 5KYNA 1G5ZA 3VM6A 3LLKA 2RSEB 2DGJA 3ITFA 3B71A 1O3UA 4XTKA 5B1AC 4D4XA 5BQIA 4IAOA 2J8WA 2AWCA 3R2PA 2LFFA 4U5EE 1LM3B 4CIHA 1OQCA 1PD0A 1APCA 4CDYA 4J30B 5HSWA 4ANJA 4XEVA 2VCAA 4XPYA 3VAYA 4CSAA 5DVWA 2NSGA 2GDCA 1M57C 2G3VA 2KQ9A 5DS6A 1VMAA 1ZHYA 1EQ1A 2FGYA 4KNVA 4H54A 1RKCA 1ORJA 1Q0MA 1TFKB 1V54C 1Z23A 4IJJA 4XPWA 5CI8A 1SMYF 3ZDLA 2EPMX 2E87A 3GEHA 3EZHA 4Z9JA 3DI5A 3RVZA 4AL0A 1OR2A 3ZQYA 1WASA 3TQOA 5AC4A 3T6GB 4CX9A 1VK5A 2NSFA 3ZG1A 2H7BA 5B3SC 1LS4A 2XLWA 4CS8A 4PFPA 4Q4ZF 1Y4CA 3F47A 4XPXA 1A7VA 1D0YA 3T6JA 5EK0A 3HLZA 4W8PA 4C3DA 4UDVA 3JYHA 4E7ZA 1FMWA 2YL3A 1QPUA 1NFNA 1YJGA 3FAJA 4PK4A 3ATPA 4N4WA 3L8JA 4WABA 3HNKA 3FHDA 3IPMO 3Q6NA 2XXAA 1VLTA 3KPHA 4YL3A 1PD1A 1YLMA 4U5DE 2VASA 1WWPA 4PR9A 3UMKA 3FDQA 1VOMA 3EH2A 3C8ZA 3V5ZA 3LLIA 2LSEA 1FMVA 1BBHA 3HTKC 2OQMA 2YLDA 3TULA 4U5FE 1V74B 1JMWA 4FX5A 4WJ0A 3DMDA 2FAPB 1TWAA 5BQHA 2DYRC 3BRJA 2PNOA 1A0BA 3ABKC 1I4YA 4AX2A 5AC5A 5T1DB 4ONSA 4QI2A 1ORYA 2IBFA 3SP1A 2QLAA 1OKKA 3E70C 4U9EA 4WGYA 3WG7C 1M2OA 3R7CA 1FR0A 4JCHA 4MVMA 1MQVA 4P6IC 1JPNA 3RW0A 4CS8C 3IQTA 2KNHA 2UUHA 1JAFA 4O6MA 4E0IA 1OR3A 1PV3A 1T9KA 3UMHA 4KI2A 3DKAA 2R7XA 2KGOA 3AOUA 2Y3HA 3TJ6A 2KSFA 3DM5A 5E3AA 1G4WR 1ZU4A 4JE9A 3ZIBA 5A69A 5F5FA 3SZRA 3DWWA 1HW1A 1OCCC 1OKKD 2KJGA 3GWLA 1CPRA 3T9OA 3TOLA 3W2VA 5DQTA 2LFDA 1L3PA 2I15A 3UMIA 4JTDB 3DJNB 1GS9A 2EPLX 1JPJA 2IM8A 1J8MF 2XRHA 1O87A 4LLCA 5AGFA 4EIYA 1TR2A 3SXYA 1NU7D 3C8GB 4ER9A 2XSEA 3U0CA 2LK4A 3SYNA 1Q0KA 3AG1C 4IB4A 4O6YA 2MHRA 2HV6A 2YLGA 4U5GA 2EPOA 4HFKB 3JTLO 2ZXRA 3GORA 5KYWB 4JJFA 4LERA 4CJGA 3G50A 4C3EA 2CNWA 3ZWIA 1WN0A 2QNLA 4MQ9F 2NUPB 2WVQA 3EHNA 3CAXA 3CSKA 2TMVP 1TWHA 3NMIA 2A1DD 1NFOA 5D91A 1YZCA 2WL8A 2OJQA 3JSZA 4AE4A 4BG0A 3UGOA 1RMVA 4K7BA 3K33A 2IXMA 3B0UX 1ORSC 2IOQA 3AGUA 3FOOA 4CSAC 3ZQVA 4JRZA 1T6QA 1JOGA 3K1HA 2R7RA 4DRHB 1HMOA 2XLVA 3AGTA 4BJ5A 4ULVA 3HKKA 3RQFA 4RD9A 1F1MA 1RJ9B 2KYHA 2YEVA 2XL4A 1OW6A 2P0NA 2HSBA 2L9JA 4IGGA 4X0RA 2P6VA 4XEFA 4BJ6A 4YL0A 1CGME 2GA0A 3RF3A 3M79A 4DRIB 3NKEA 2HMZA 1ZHTA 5DLJA 1V55C 1O5HA 3G4ZA 5BQGA 1TFOB 4OINF 4DBRA 1IW7F 4JTCB 4J7TA 4MVQA 3ASOC 3EPVA 3IQ5A 2PX0A 2XLMA 4MVOA 2XM4A 4E0HA 2Z15A 1NZEA 4CS9A 2GWWA 1VLSA 4HFFB 2L81A 3AG2C 3S27A 1B68A 2YL7A 3DJUB 1Y6DA 2WB7A 4J32B 1E86A 2R7VA 1LPEA 4CDAA 1YVIA 3RQEA 3NYLA 3ABLC 3EFOA 1Q0DA 1LI7A 3EGXB 1FFHA 4I44A 3FOPA 3VYWA 4EHPA 4DVYP 4BEMJ 2OKUA 3ABMC 4PJNA 2ZXOA 4KBLA 2ICWG 2Y3BA 1A7DA 2R7SA 5B3IA 3KYJA 2HZ8A 2NG1A 2J0WA 3C8GA 3EFOB 1H9TA 3H2VA 3EG9B 3PCVA 5KYXB 3K1IC 3MBGA 4C3BA 2Q00A 1Z5ZA 2YWAA 5JT4A 4LDRA 4MVSA 2YKZA 4I1OB 3JZ0A 4Z9IA 4NTFA 5BUOA 3DAGA 2EIJC 2LD6A 2HJMA 3AJMA 5JUAA 5COGA 4MVRA 4KNWA 1QKRA 2L6HA 3IHUA 1NLXA 2B0JA 5JS5A 1HMDA 1EI7A 1OCOC 4Z9HA 5JP7A 3LAYA 2OG2A 4NCQA 4OIRF 3RIPA 4CS7A 4OIPF 1KTMA 3BEHA 4C7OA 4EBBA 5KYWA 1QQ3A 3MLGA 4BPMA 4AK9A 1V4AA 4JTAB 3LESA 3U3FA 3J06A 1S7ZA 3EGDB 2EINC 4R32A 4YT4A 2XLDA 3K7DA 4MTFA 3UR3C 1YYJA 1YZAA 5B1BC 2AU5A 2R7QA 3EG9A 2IXNA 4PFOA 1LVKA 1XWJA 4XLNF 5T3TA 3FXHA 4G78A 2XLOA 4YN0B 5FZTA 3LEVA 1UFBA 2Q9AA 1YAUO 3WHNA 2EILC 2YL0A 3LS0A 4G0HA 2Q4FA 2H7VC 2Y39A 4FWVA 3NYMA 4QI0A 4MS2A 4NY3A 3S28A 3B29A 2HFIA 1U6HA 1QVXA 3JCUQ 1N1CA 1W2WA 3QVZA 4PJMA 5E33A 1K05A 1R4TA 3B9QA 4JURI 2Q3TA 3L34A 2BE5F 3LJBA 4LLEA 4G7HF 3OA1A 2J0XA 2W45A 2D5RB 2PX3A 3MYFA 2OEXA 3LNRA 3U8PA 1RKEA 4RBNA 3EQLF 2IXPA 2FFHA 2PP4A 4N6CA 3CQZA 4BJTA 1GQAA 2C04A 2J9WA 2GFHA 2A0BA 3I5QA 2I8BA 3NMKA 1AEPA 3JRTA 4EKWA 3W8HA 2YQYA 1JR8A 3K66A 4IAQA 4RDAA 3M1CB 4OD5A 2YRFA 3HNJA 3RH3A 3IQ6A 2AWYA 3ZTZA 3FMSA 1OXBA 2OOCA 3HNIA 4JEAA 3V7OA 1S05A 3C7JA 2YL1A 4JW1A 3WODF 3QZCA 4CIPA 1Z63A 4ULWA 4W8KA 4I3MA 4YK5A 2KC3A 3OEOA 1DOVA 5CIVA 2CCYA 4KC9A 4LACB 1C03A 2J7PA 1T6IA 3SEOA 5L0FA 2JPUA 5L0IA 1LE4A 1UG7A 4N6HA 1MNEA 1OCZC 2L7AA 2M4EA 1IZMA 1GGQA 3EZIA 1YARO 1D1AA 2OJED 2EPKX 4U5HA 4JIOA 3W2WA 1ZHWA 2QUPA 3I5PA 4XQ1A 2V3CC 1EKYA 3V5YA 3RQGA 4E18A 3GANA 4NTAA 2A6EF 1U0BB 1L7CA 4ZLDA 2ZD9A 1BR1A 1MNDA 2DB4A 3EGXA 3TJ5A 1KU2A 5K0IA 3M4BA 2A68F 1SZIA 3CZ6A 3AQBA 4IRUA 1TWGA 2R02A 5A6JA 2EIMC 3EH1A 3B0PA 3GWNA 4MTOA 1YDIA 4O79A 1NSGB 4YL1A 3GM1A 3GODA 4CJOA 2JX0A 1BZ4A 3LNMB 5A6BA 2Q9BA 3KMIA 3KKBA 3K1IA 5KYXA 3LUTB 4O6NA 3S90A 4NC3A 2YLIA 2QTVA 4YJWA 5A6KA 5EHHA 3AG3C 1BR4A 1RCPA 5A6AA 2R7UA 2CNWD 1ZW3A 2LQGA 2G62A 2O9XA 3U3BA 1M6TA 4F4BA 2D4UA 2J7PD 3QTHA 1M56C 3S29A 2XL6A 3M15A 2YVKA 2ZXWC 3GEEA 3FAPB 2CDQA 4JC7A 2NUTA 1H7IA 1D1CA 2HMQA 4FESA 1YYXA 4QDLA 5L0DA 5COMA 3ZSUA 3RVYA 4G7ZF 1OW8A 2BC5A 4MW3A 2KW3C 4ZLCA 2NUPA 1FTSA 3JSEO 4MNDA 4B6IA 2AVKA 3HJCA 1Z3IX 2V26A 2M64A 1QZXA 3NG1A 4EUKB 1MMGA 4K0DA 2MWQA 3DXJF 3JT1A 3DE9A 1LS1A 2UUIA 3DE8A 4LDKA 4YT8A 5CI9A 1OCRC 1A41A 3NDBB 4BJ1A 4NTBA 3T6BA 3LEOA 3JRMO 1XZPA 3CEXA 1KNYA 2ETSA 4OIOF 3S9OA 4P9TA 2A6HF 1D1BA 2LCHA 3ECSA 1SF8A 4NQFA 2A69F 1VB5A 2NPUA 2ZXPA 2VCBA 2P1AA 3US6A 3NMJA 2W4BA 3DAFA 4HE8D 1H6GA 4PACA 1RXQA 2VH3A 5F28E 2L6GA 1HY5A 2Q9CA 5JVEA 4AL1A 1ST6A 3O6XA 3WAQA 3KL4A 2ASRA 2ZPAA 2G3KA 1ZZPA 3MFNA 2LP4A 1ZVZA 2H8AA 4O7GA 1MMAA 3SXZA 4CBEA 3S84A 2LIGA 3KYIA 2Y3GA 4G7OF 3AG4C 1M2VB 2OCCC 2W4MA 3IQCA 1E83A 3H2UA 3QVYA 3EJNA 3U2MA 1J8YF 3N0TA 4JZAA 3DM9B 2J45A 4N06A 3AQCA 1QLEC 2B0HA 1I5NA
chains in the Genus database with same CATH topology
2R7OA 4XWJA 3H65A 3TD7A 3PMRA 3X2QC 3S0XA 5F5HA 3ZC4A 2P7VA 3W8IA 3X1OA 1ZHXA 2WVOA 2PF4E 3RYLA 2YZSA 3UNGC 4YT2A 1D0XA 3ASNC 3MX3A 3O39A 2R7WA 3IEEA 1PCXA 3OWTA 2XXAB 1TWCA 2VB6A 2JD3A 4Q5SF 5KYUA 2WVNA 3NKDA 4DOZA 1MMNA 5EGYA 1WGWA 2W9YA 4OIQF 1NG1A 2CGEA 4Q7CA 4IWBA 1RJ9A 2Y3DA 4H4KC 3UGPA 3Q7LA 2R7TA 3PHF2 2WZFA 4YWQA 1NU9C 3DZAA 4U5CE 4DVZA 5DQZA 4BEJA 2CW0F 5DS5A 3QMKA 3Q6MA 3FVYA 4GEHA 3EHMA 5L3VA 3T4RA 3N2ZB 4PJLA 2MYSA 3RFYA 1D0ZA 5KYUB 4AE4B 2H7OA 3NRHA 2IXOA 5D92A 2PFDA 1VYIA 3NYJA 4C7OB 5L3QA 2C03A 5IY5C 2J9UA 4GYTA 3F46A 1ZYRF 5E2QA 1TKNA 4PJJA 4JJGA 5DS4A 5FCLA 1FFTC 4XLPF 3POVA 1MMDA 3Q7GA 2NUTB 2EIKC 2QY9A 1Z6AA 3RKOF 4HEAJ 3L0IA 5E3CA 3B0VC 4M63A 2J9VA 2HV7A 4JVSA 1BR2A 3N24A 4U5BE 3EGDA 1ZU5A 4EWCA 4DBQA 4CS9C 1VYKA 2J46A 5KYYA 2X51A 3LS1A 4I1MA 4BJ6C 1LKXA 2DYSC 1ZHZA 4A2NB 2IYLD 3I4UA 3K6BA 5KYYB 4YT5A 2WZGA 4E7SA 1M2VA 2WZLA 1G8XA 2Y69C 4BJ5C 2YHSA 3SNHA 3DD7A 3E9VA 3KH2A 3ZVRA 4OD4A 5T3WA 5KYNA 3LLKA 2DGJA 3ITFA 4XTKA 5B1AC 4IAOA 4U5EE 4CIHA 1PD0A 4J30B 5HSWA 4ANJA 3VAYA 4CSAA 5DVWA 1M57C 2G3VA 2KQ9A 5DS6A 1VMAA 1ZHYA 2FGYA 4KNVA 1V54C 1Z23A 4IJJA 5CI8A 1SMYF 2E87A 3EZHA 1VK5A 3ZG1A 2H7BA 5B3SC 4CS8A 4PFPA 4Q4ZF 3F47A 1D0YA 3T6JA 3HLZA 4C3DA 3JYHA 4E7ZA 1FMWA 3FAJA 4PK4A 3FHDA 3Q6NA 2XXAA 1PD1A 4U5DE 2VASA 3UMKA 3FDQA 1VOMA 3EH2A 3LLIA 2LSEA 1FMVA 3HTKC 4U5FE 4FX5A 4WJ0A 3DMDA 1TWAA 2DYRC 3ABKC 4AX2A 5T1DB 4QI2A 3SP1A 3WG7C 1OKKA 3E70C 1M2OA 4JCHA 4P6IC 1JPNA 4CS8C 2KNHA 4O6MA 3UMHA 4KI2A 2R7XA 2KGOA 2Y3HA 3DM5A 5E3AA 5F5FA 1ZU4A 3ZIBA 3SZRA 1OCCC 3W2VA 1OKKD 2KJGA 5DQTA 3UMIA 3DJNB 1JPJA 4LLCA 1Z63A 2XRHA 1J8MF 1O87A 1TR2A 1NU7D 2XSEA 3SYNA 3AG1C 4O6YA 2HV6A 4U5GA 4HFKB 2ZXRA 5KYWB 4JJFA 4LERA 4C3EA 2CNWA 4MQ9F 2NUPB 2WVQA 3EHNA 3CSKA 1TWHA 2A1DD 5D91A 3JSZA 2WL8A 4AE4A 4BG0A 3B0UX 4K7BA 3K33A 2IXMA 2IOQA 4CSAC 3K1HA 2R7RA 4BJ5A 4RD9A 1RJ9B 2YEVA 2XL4A 4X0RA 2L9JA 2P6VA 4BJ6A 3NKEA 1ZHTA 5DLJA 1V55C 1O5HA 4OINF 4DBRA 1IW7F 3ASOC 3EPVA 2PX0A 2Z15A 1NZEA 4CS9A 4HFFB 2L81A 3AG2C 3S27A 3DJUB 2WB7A 4J32B 2R7VA 3NYLA 3ABLC 3EFOA 4DVYP 4I44A 3EGXB 1FFHA 3VYWA 3ABMC 4PJNA 2ZXOA 4KBLA 2Y3BA 2R7SA 2NG1A 2J0WA 3EFOB 3EG9B 5KYXB 3K1IC 4C3BA 1Z5ZA 4I1OB 5BUOA 3DAGA 2EIJC 4KNWA 2B0JA 1OCOC 4OIRF 3LAYA 2OG2A 3RIPA 4CS7A 4OIPF 4C7OA 4EBBA 5KYWA 3MLGA 4AK9A 3LESA 1S7ZA 3EGDB 2EINC 4YT4A 3K7DA 3UR3C 5B1BC 2R7QA 3EG9A 2IXNA 4PFOA 1LVKA 4XLNF 5T3TA 4YN0B 3LEVA 2Q9AA 2EILC 3LS0A 4G0HA 2Y39A 2H7VC 4FWVA 4QI0A 3NYMA 4NY3A 3S28A 3JCUQ 1N1CA 1W2WA 5E33A 4PJMA 3B9QA 4JURI 2Q3TA 3L34A 2BE5F 3LJBA 4LLEA 4G7HF 3OA1A 2J0XA 2W45A 2D5RB 2PX3A 3LNRA 4RBNA 3EQLF 2IXPA 2PP4A 2FFHA 4BJTA 3CQZA 2C04A 2J9WA 2GFHA 3I5QA 2I8BA 3JRTA 3W8HA 3K66A 4RDAA 3M1CB 4OD5A 3RH3A 3V7OA 3WODF 4JW1A 3QZCA 4ULWA 4W8KA 4I3MA 3OEOA 4KC9A 4LACB 3SEOA 2J7PA 3UGOA 1MNEA 1OCZC 2M4EA 1IZMA 3EZIA 1D1AA 4U5HA 3W2WA 1ZHWA 3I5PA 2V3CC 3GANA 4ZLDA 2A6EF 1BR1A 1MNDA 3EGXA 1KU2A 2A68F 3CZ6A 1SZIA 3AQBA 4IRUA 1TWGA 2EIMC 3EH1A 3B0PA 4O79A 3GODA 2Q9BA 3KMIA 3KKBA 5KYXA 4O6NA 2QTVA 4YJWA 5EHHA 2R7UA 3AG3C 1BR4A 2CNWD 2G62A 2O9XA 4F4BA 2J7PD 1M56C 3S29A 2ZXWC 2CDQA 2NUTA 1D1CA 4FESA 4QDLA 4G7ZF 3ZSUA 2KW3C 4ZLCA 2NUPA 1FTSA 4MNDA 4B6IA 3HJCA 1Z3IX 2V26A 1QZXA 3NG1A 1MMGA 4K0DA 2MWQA 3DXJF 3JT1A 1LS1A 4YT8A 5CI9A 1OCRC 3NDBB 4BJ1A 3T6BA 4OIOF 2A6HF 1D1BA 3ECSA 1SF8A 2A69F 2ZXPA 2W4BA 3DAFA 4HE8D 2VH3A 2Q9CA 1ST6A 3O6XA 3KL4A 2ZPAA 2G3KA 4O7GA 1MMAA 4CBEA 4G7OF 2Y3GA 3AG4C 1M2VB 2OCCC 2W4MA 3EJNA 1J8YF 3N0TA 4JZAA 3DM9B 2J45A 4N06A 3AQCA 1QLEC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VYK A;  3JCU Q;  1NZE A;  3LS1 A;  3RFY A;  3ZSU A;  3LS0 A;  2MWQ A; 
#chains in the Genus database with same CATH topology
 4GQH A;  2R7O A;  4XWJ A;  1E85 A;  1Q0G A;  3H65 A;  3GM2 A;  3W4Y A;  3TD7 A;  1WTY A;  1LE2 A;  1WOL A;  1DOW A;  3PMR A;  3JYY A;  1E2X A;  2RD9 A;  1ZW2 A;  4MTG A;  3U9M A;  3X2Q C;  4D4N A;  3S0X A;  5F5H A;  3ZC4 A;  1C02 A;  2CYD A;  2P7V A;  4J7Y A;  3TOM A;  3W8I A;  3VF0 A;  3X1O A;  1ZHX A;  2WVO A;  2PF4 E;  3RYL A;  2HUJ A;  2YZS A;  3UNG C;  1FAP B;  4YT2 A;  1D0X A;  3ASN C;  3MX3 A;  1VTM P;  3O39 A;  1K40 A;  3IEE A;  2XL8 A;  4CDV A;  1PCX A;  2R7W A;  3OWT A;  1CPQ A;  5JLI A;  1XZQ A;  1YA7 O;  3C8G D;  2XXA B;  1TWC A;  2VB6 A;  2JD3 A;  4Q5S F;  5KYU A;  1A7E A;  1OXK A;  2WVN A;  1SR2 A;  3A11 A;  3NKD A;  4DOZ A;  1T5O A;  1MMN A;  5GPG B;  5JSL A;  3L8I A;  5EGY A;  1SYQ A;  1K04 A;  1TQG A;  1WGW A;  1EA8 A;  4JCZ A;  4K1O A;  2W9Y A;  3VRC A;  4DJ9 A;  2PBE A;  1NG1 A;  2CGE A;  4OIQ F;  3QW0 A;  4Q7C A;  5A6B D;  4IWB A;  1RJ9 A;  4U9D A;  2Y3D A;  4JEB A;  3HNL A;  4H4K C;  3UGP A;  1T01 A;  1I4Z A;  3A9C A;  3Q7L A;  2R7T A;  5HV9 A;  3PHF 2;  2WZF A;  3U5S A;  1CGN A;  4YWQ A;  1NU9 C;  3DZA A;  2OEV A;  4U5C E;  4DVZ A;  5DQZ A;  4BEJ A;  2CW0 F;  5DS5 A;  1Z7Q c;  2R05 A;  3GM3 A;  3QMK A;  3M4C A;  1HE1 A;  3Q6M A;  3C18 A;  4MVU A;  1HW2 A;  3FVY A;  4GEH A;  3EHM A;  5L3V A;  2QE9 A;  3O10 A;  3N2Z B;  4PJL A;  2MYS A;  1C17 M;  3T4R A;  1GM5 A;  2X0C A;  2BL2 A;  3SXK A;  3C62 A;  4LDQ A;  3U2L A;  2HJ3 A;  2A0U A;  3RFY A;  1H9G A;  4IAR A;  4WGZ A;  1QSP A;  4L6R A;  4A4A A;  1D0Z A;  2XLH A;  3QW1 A;  4XEK A;  5KYU B;  1WAT A;  4AE4 B;  2H7O A;  3NRH A;  2IXO A;  1BDJ B;  5D92 A;  5TJ5 E;  2PFD A;  4DXW A;  1YA9 A;  1VYI A;  3NYJ A;  4E17 A;  5L3Q A;  2C03 A;  4EBJ A;  5IY5 C;  4C7O B;  2J9U A;  3G4X A;  2DI3 A;  4GYT A;  3F46 A;  1ZYR F;  2XS8 A;  4MW8 A;  5E2Q A;  1TKN A;  2AP3 A;  4JJG A;  2R9R B;  4PJJ A;  5DS4 A;  2P61 A;  5FCL A;  1FFT C;  256B A;  3PDM P;  4FAP B;  4JKV A;  4XLP F;  2XLE A;  3POV A;  1MMD A;  1NBB A;  2HKV A;  4P9F A;  2NUT B;  2F22 A;  1CGO A;  2EIK C;  2QY9 A;  1T6U A;  1Z6A A;  3Q7G A;  3L0I A;  4HEA J;  3RKO F;  5E3C A;  5JRA A;  2HS5 A;  4M63 A;  1RKE B;  2J9V A;  2HV7 A;  3B0V C;  4JVS A;  1BR2 A;  3N24 A;  1OW7 A;  3EGD A;  4U5B E;  3ZTM A;  2EPN A;  1ZU5 A;  4EWC A;  4EBK A;  3V5X A;  4DBQ A;  4CS9 C;  2Q7R A;  1VYK A;  2J46 A;  5COF A;  5L0C A;  2HSQ A;  2KK1 A;  2OU6 A;  5KYY A;  2X51 A;  3LS1 A;  2GAQ A;  4I1M A;  1U89 A;  3L1M A;  1FNT c;  4BJ6 C;  1LKX A;  3U8V A;  1E84 A;  2DYS C;  3O55 A;  1R5I D;  1ZHZ A;  2VC9 A;  1LIH A;  2IYL D;  4A2N B;  3I4U A;  4DRJ B;  3K6B A;  5L0J A;  5KYY B;  1JRA A;  3C63 A;  4YT5 A;  3SXM A;  2WZG A;  3GEI A;  2XM0 A;  1M2V A;  1AVO B;  1HE9 A;  2XS1 A;  4E7S A;  2WZL A;  2R03 A;  2VCC A;  1G8X A;  1AUE A;  3MYI A;  2Y69 C;  5L0H A;  5L0G A;  3TK0 A;  4BJ5 C;  2YHS A;  2R25 A;  3SNH A;  1Q0F A;  3DD7 A;  3U9J A;  3E9V A;  4MVZ A;  3KH2 A;  1LI5 A;  1G4U S;  2J9B A;  4OD4 A;  3ZVR A;  2L6F A;  5T3W A;  5KYN A;  1G5Z A;  3VM6 A;  3LLK A;  2RSE B;  2DGJ A;  3ITF A;  3B71 A;  1O3U A;  4XTK A;  5B1A C;  4D4X A;  5BQI A;  4IAO A;  2J8W A;  2AWC A;  3R2P A;  2LFF A;  4U5E E;  1LM3 B;  4CIH A;  1OQC A;  1PD0 A;  1APC A;  4CDY A;  4J30 B;  5HSW A;  4ANJ A;  4XEV A;  2VCA A;  4XPY A;  3VAY A;  4CSA A;  5DVW A;  2NSG A;  2GDC A;  1M57 C;  2G3V A;  2KQ9 A;  5DS6 A;  1VMA A;  1ZHY A;  1EQ1 A;  2FGY A;  4KNV A;  4H54 A;  1RKC A;  1ORJ A;  1Q0M A;  1TFK B;  1V54 C;  1Z23 A;  4IJJ A;  4XPW A;  5CI8 A;  1SMY F;  3ZDL A;  2EPM X;  2E87 A;  3GEH A;  3EZH A;  4Z9J A;  3DI5 A;  3RVZ A;  4AL0 A;  1OR2 A;  3ZQY A;  1WAS A;  3TQO A;  5AC4 A;  3T6G B;  4CX9 A;  1VK5 A;  2NSF A;  3ZG1 A;  2H7B A;  5B3S C;  1LS4 A;  2XLW A;  4CS8 A;  4PFP A;  4Q4Z F;  1Y4C A;  3F47 A;  4XPX A;  1A7V A;  1D0Y A;  3T6J A;  5EK0 A;  3HLZ A;  4W8P A;  4C3D A;  4UDV A;  3JYH A;  4E7Z A;  1FMW A;  2YL3 A;  1QPU A;  1NFN A;  1YJG A;  3FAJ A;  4PK4 A;  3ATP A;  4N4W A;  3L8J A;  4WAB A;  3HNK A;  3FHD A;  3IPM O;  3Q6N A;  2XXA A;  1VLT A;  3KPH A;  4YL3 A;  1PD1 A;  1YLM A;  4U5D E;  2VAS A;  1WWP A;  4PR9 A;  3UMK A;  3FDQ A;  1VOM A;  3EH2 A;  3C8Z A;  3V5Z A;  3LLI A;  2LSE A;  1FMV A;  1BBH A;  3HTK C;  2OQM A;  2YLD A;  3TUL A;  4U5F E;  1V74 B;  1JMW A;  4FX5 A;  4WJ0 A;  3DMD A;  2FAP B;  1TWA A;  5BQH A;  2DYR C;  3BRJ A;  2PNO A;  1A0B A;  3ABK C;  1I4Y A;  4AX2 A;  5AC5 A;  5T1D B;  4ONS A;  4QI2 A;  1ORY A;  2IBF A;  3SP1 A;  2QLA A;  1OKK A;  3E70 C;  4U9E A;  4WGY A;  3WG7 C;  1M2O A;  3R7C A;  1FR0 A;  4JCH A;  4MVM A;  1MQV A;  4P6I C;  1JPN A;  3RW0 A;  4CS8 C;  3IQT A;  2KNH A;  2UUH A;  1JAF A;  4O6M A;  4E0I A;  1OR3 A;  1PV3 A;  1T9K A;  3UMH A;  4KI2 A;  3DKA A;  2R7X A;  2KGO A;  3AOU A;  2Y3H A;  3TJ6 A;  2KSF A;  3DM5 A;  5E3A A;  1G4W R;  1ZU4 A;  4JE9 A;  3ZIB A;  5A69 A;  5F5F A;  3SZR A;  3DWW A;  1HW1 A;  1OCC C;  1OKK D;  2KJG A;  3GWL A;  1CPR A;  3T9O A;  3TOL A;  3W2V A;  5DQT A;  2LFD A;  1L3P A;  2I15 A;  3UMI A;  4JTD B;  3DJN B;  1GS9 A;  2EPL X;  1JPJ A;  2IM8 A;  1J8M F;  2XRH A;  1O87 A;  4LLC A;  5AGF A;  4EIY A;  1TR2 A;  3SXY A;  1NU7 D;  3C8G B;  4ER9 A;  2XSE A;  3U0C A;  2LK4 A;  3SYN A;  1Q0K A;  3AG1 C;  4IB4 A;  4O6Y A;  2MHR A;  2HV6 A;  2YLG A;  4U5G A;  2EPO A;  4HFK B;  3JTL O;  2ZXR A;  3GOR A;  5KYW B;  4JJF A;  4LER A;  4CJG A;  3G50 A;  4C3E A;  2CNW A;  3ZWI A;  1WN0 A;  2QNL A;  4MQ9 F;  2NUP B;  2WVQ A;  3EHN A;  3CAX A;  3CSK A;  2TMV P;  1TWH A;  3NMI A;  2A1D D;  1NFO A;  5D91 A;  1YZC A;  2WL8 A;  2OJQ A;  3JSZ A;  4AE4 A;  4BG0 A;  3UGO A;  1RMV A;  4K7B A;  3K33 A;  2IXM A;  3B0U X;  1ORS C;  2IOQ A;  3AGU A;  3FOO A;  4CSA C;  3ZQV A;  4JRZ A;  1T6Q A;  1JOG A;  3K1H A;  2R7R A;  4DRH B;  1HMO A;  2XLV A;  3AGT A;  4BJ5 A;  4ULV A;  3HKK A;  3RQF A;  4RD9 A;  1F1M A;  1RJ9 B;  2KYH A;  2YEV A;  2XL4 A;  1OW6 A;  2P0N A;  2HSB A;  2L9J A;  4IGG A;  4X0R A;  2P6V A;  4XEF A;  4BJ6 A;  4YL0 A;  1CGM E;  2GA0 A;  3RF3 A;  3M79 A;  4DRI B;  3NKE A;  2HMZ A;  1ZHT A;  5DLJ A;  1V55 C;  1O5H A;  3G4Z A;  5BQG A;  1TFO B;  4OIN F;  4DBR A;  1IW7 F;  4JTC B;  4J7T A;  4MVQ A;  3ASO C;  3EPV A;  3IQ5 A;  2PX0 A;  2XLM A;  4MVO A;  2XM4 A;  4E0H A;  2Z15 A;  1NZE A;  4CS9 A;  2GWW A;  1VLS A;  4HFF B;  2L81 A;  3AG2 C;  3S27 A;  1B68 A;  2YL7 A;  3DJU B;  1Y6D A;  2WB7 A;  4J32 B;  1E86 A;  2R7V A;  1LPE A;  4CDA A;  1YVI A;  3RQE A;  3NYL A;  3ABL C;  3EFO A;  1Q0D A;  1LI7 A;  3EGX B;  1FFH A;  4I44 A;  3FOP A;  3VYW A;  4EHP A;  4DVY P;  4BEM J;  2OKU A;  3ABM C;  4PJN A;  2ZXO A;  4KBL A;  2ICW G;  2Y3B A;  1A7D A;  2R7S A;  5B3I A;  3KYJ A;  2HZ8 A;  2NG1 A;  2J0W A;  3C8G A;  3EFO B;  1H9T A;  3H2V A;  3EG9 B;  3PCV A;  5KYX B;  3K1I C;  3MBG A;  4C3B A;  2Q00 A;  1Z5Z A;  2YWA A;  5JT4 A;  4LDR A;  4MVS A;  2YKZ A;  4I1O B;  3JZ0 A;  4Z9I A;  4NTF A;  5BUO A;  3DAG A;  2EIJ C;  2LD6 A;  2HJM A;  3AJM A;  5JUA A;  5COG A;  4MVR A;  4KNW A;  1QKR A;  2L6H A;  3IHU A;  1NLX A;  2B0J A;  5JS5 A;  1HMD A;  1EI7 A;  1OCO C;  4Z9H A;  5JP7 A;  3LAY A;  2OG2 A;  4NCQ A;  4OIR F;  3RIP A;  4CS7 A;  4OIP F;  1KTM A;  3BEH A;  4C7O A;  4EBB A;  5KYW A;  1QQ3 A;  3MLG A;  4BPM A;  4AK9 A;  1V4A A;  4JTA B;  3LES A;  3U3F A;  3J06 A;  1S7Z A;  3EGD B;  2EIN C;  4R32 A;  4YT4 A;  2XLD A;  3K7D A;  4MTF A;  3UR3 C;  1YYJ A;  1YZA A;  5B1B C;  2AU5 A;  2R7Q A;  3EG9 A;  2IXN A;  4PFO A;  1LVK A;  1XWJ A;  4XLN F;  5T3T A;  3FXH A;  4G78 A;  2XLO A;  4YN0 B;  5FZT A;  3LEV A;  1UFB A;  2Q9A A;  1YAU O;  3WHN A;  2EIL C;  2YL0 A;  3LS0 A;  4G0H A;  2Q4F A;  2H7V C;  2Y39 A;  4FWV A;  3NYM A;  4QI0 A;  4MS2 A;  4NY3 A;  3S28 A;  3B29 A;  2HFI A;  1U6H A;  1QVX A;  3JCU Q;  1N1C A;  1W2W A;  3QVZ A;  4PJM A;  5E33 A;  1K05 A;  1R4T A;  3B9Q A;  4JUR I;  2Q3T A;  3L34 A;  2BE5 F;  3LJB A;  4LLE A;  4G7H F;  3OA1 A;  2J0X A;  2W45 A;  2D5R B;  2PX3 A;  3MYF A;  2OEX A;  3LNR A;  3U8P A;  1RKE A;  4RBN A;  3EQL F;  2IXP A;  2FFH A;  2PP4 A;  4N6C A;  3CQZ A;  4BJT A;  1GQA A;  2C04 A;  2J9W A;  2GFH A;  2A0B A;  3I5Q A;  2I8B A;  3NMK A;  1AEP A;  3JRT A;  4EKW A;  3W8H A;  2YQY A;  1JR8 A;  3K66 A;  4IAQ A;  4RDA A;  3M1C B;  4OD5 A;  2YRF A;  3HNJ A;  3RH3 A;  3IQ6 A;  2AWY A;  3ZTZ A;  3FMS A;  1OXB A;  2OOC A;  3HNI A;  4JEA A;  3V7O A;  1S05 A;  3C7J A;  2YL1 A;  4JW1 A;  3WOD F;  3QZC A;  4CIP A;  1Z63 A;  4ULW A;  4W8K A;  4I3M A;  4YK5 A;  2KC3 A;  3OEO A;  1DOV A;  5CIV A;  2CCY A;  4KC9 A;  4LAC B;  1C03 A;  2J7P A;  1T6I A;  3SEO A;  5L0F A;  2JPU A;  5L0I A;  1LE4 A;  1UG7 A;  4N6H A;  1MNE A;  1OCZ C;  2L7A A;  2M4E A;  1IZM A;  1GGQ A;  3EZI A;  1YAR O;  1D1A A;  2OJE D;  2EPK X;  4U5H A;  4JIO A;  3W2W A;  1ZHW A;  2QUP A;  3I5P A;  4XQ1 A;  2V3C C;  1EKY A;  3V5Y A;  3RQG A;  4E18 A;  3GAN A;  4NTA A;  2A6E F;  1U0B B;  1L7C A;  4ZLD A;  2ZD9 A;  1BR1 A;  1MND A;  2DB4 A;  3EGX A;  3TJ5 A;  1KU2 A;  5K0I A;  3M4B A;  2A68 F;  1SZI A;  3CZ6 A;  3AQB A;  4IRU A;  1TWG A;  2R02 A;  5A6J A;  2EIM C;  3EH1 A;  3B0P A;  3GWN A;  4MTO A;  1YDI A;  4O79 A;  1NSG B;  4YL1 A;  3GM1 A;  3GOD A;  4CJO A;  2JX0 A;  1BZ4 A;  3LNM B;  5A6B A;  2Q9B A;  3KMI A;  3KKB A;  3K1I A;  5KYX A;  3LUT B;  4O6N A;  3S90 A;  4NC3 A;  2YLI A;  2QTV A;  4YJW A;  5A6K A;  5EHH A;  3AG3 C;  1BR4 A;  1RCP A;  5A6A A;  2R7U A;  2CNW D;  1ZW3 A;  2LQG A;  2G62 A;  2O9X A;  3U3B A;  1M6T A;  4F4B A;  2D4U A;  2J7P D;  3QTH A;  1M56 C;  3S29 A;  2XL6 A;  3M15 A;  2YVK A;  2ZXW C;  3GEE A;  3FAP B;  2CDQ A;  4JC7 A;  2NUT A;  1H7I A;  1D1C A;  2HMQ A;  4FES A;  1YYX A;  4QDL A;  5L0D A;  5COM A;  3ZSU A;  3RVY A;  4G7Z F;  1OW8 A;  2BC5 A;  4MW3 A;  2KW3 C;  4ZLC A;  2NUP A;  1FTS A;  3JSE O;  4MND A;  4B6I A;  2AVK A;  3HJC A;  1Z3I X;  2V26 A;  2M64 A;  1QZX A;  3NG1 A;  4EUK B;  1MMG A;  4K0D A;  2MWQ A;  3DXJ F;  3JT1 A;  3DE9 A;  1LS1 A;  2UUI A;  3DE8 A;  4LDK A;  4YT8 A;  5CI9 A;  1OCR C;  1A41 A;  3NDB B;  4BJ1 A;  4NTB A;  3T6B A;  3LEO A;  3JRM O;  1XZP A;  3CEX A;  1KNY A;  2ETS A;  4OIO F;  3S9O A;  4P9T A;  2A6H F;  1D1B A;  2LCH A;  3ECS A;  1SF8 A;  4NQF A;  2A69 F;  1VB5 A;  2NPU A;  2ZXP A;  2VCB A;  2P1A A;  3US6 A;  3NMJ A;  2W4B A;  3DAF A;  4HE8 D;  1H6G A;  4PAC A;  1RXQ A;  2VH3 A;  5F28 E;  2L6G A;  1HY5 A;  2Q9C A;  5JVE A;  4AL1 A;  1ST6 A;  3O6X A;  3WAQ A;  3KL4 A;  2ASR A;  2ZPA A;  2G3K A;  1ZZP A;  3MFN A;  2LP4 A;  1ZVZ A;  2H8A A;  4O7G A;  1MMA A;  3SXZ A;  4CBE A;  3S84 A;  2LIG A;  3KYI A;  2Y3G A;  4G7O F;  3AG4 C;  1M2V B;  2OCC C;  2W4M A;  3IQC A;  1E83 A;  3H2U A;  3QVY A;  3EJN A;  3U2M A;  1J8Y F;  3N0T A;  4JZA A;  3DM9 B;  2J45 A;  4N06 A;  3AQC A;  1QLE C;  2B0H A;  1I5N A; 
#chains in the Genus database with same CATH homology
 2R7O A;  4XWJ A;  3H65 A;  3TD7 A;  3PMR A;  3X2Q C;  3S0X A;  5F5H A;  3ZC4 A;  2P7V A;  3W8I A;  3X1O A;  1ZHX A;  2WVO A;  2PF4 E;  3RYL A;  2YZS A;  3UNG C;  4YT2 A;  1D0X A;  3ASN C;  3MX3 A;  3O39 A;  2R7W A;  3IEE A;  1PCX A;  3OWT A;  2XXA B;  1TWC A;  2VB6 A;  2JD3 A;  4Q5S F;  5KYU A;  2WVN A;  3NKD A;  4DOZ A;  1MMN A;  5EGY A;  1WGW A;  2W9Y A;  4OIQ F;  1NG1 A;  2CGE A;  4Q7C A;  4IWB A;  1RJ9 A;  2Y3D A;  4H4K C;  3UGP A;  3Q7L A;  2R7T A;  3PHF 2;  2WZF A;  4YWQ A;  1NU9 C;  3DZA A;  4U5C E;  4DVZ A;  5DQZ A;  4BEJ A;  2CW0 F;  5DS5 A;  3QMK A;  3Q6M A;  3FVY A;  4GEH A;  3EHM A;  5L3V A;  3T4R A;  3N2Z B;  4PJL A;  2MYS A;  3RFY A;  1D0Z A;  5KYU B;  4AE4 B;  2H7O A;  3NRH A;  2IXO A;  5D92 A;  2PFD A;  1VYI A;  3NYJ A;  4C7O B;  5L3Q A;  2C03 A;  5IY5 C;  2J9U A;  4GYT A;  3F46 A;  1ZYR F;  5E2Q A;  1TKN A;  4PJJ A;  4JJG A;  5DS4 A;  5FCL A;  1FFT C;  4XLP F;  3POV A;  1MMD A;  3Q7G A;  2NUT B;  2EIK C;  2QY9 A;  1Z6A A;  3RKO F;  4HEA J;  3L0I A;  5E3C A;  3B0V C;  4M63 A;  2J9V A;  2HV7 A;  4JVS A;  1BR2 A;  3N24 A;  4U5B E;  3EGD A;  1ZU5 A;  4EWC A;  4DBQ A;  4CS9 C;  1VYK A;  2J46 A;  5KYY A;  2X51 A;  3LS1 A;  4I1M A;  4BJ6 C;  1LKX A;  2DYS C;  1ZHZ A;  4A2N B;  2IYL D;  3I4U A;  3K6B A;  5KYY B;  4YT5 A;  2WZG A;  4E7S A;  1M2V A;  2WZL A;  1G8X A;  2Y69 C;  4BJ5 C;  2YHS A;  3SNH A;  3DD7 A;  3E9V A;  3KH2 A;  3ZVR A;  4OD4 A;  5T3W A;  5KYN A;  3LLK A;  2DGJ A;  3ITF A;  4XTK A;  5B1A C;  4IAO A;  4U5E E;  4CIH A;  1PD0 A;  4J30 B;  5HSW A;  4ANJ A;  3VAY A;  4CSA A;  5DVW A;  1M57 C;  2G3V A;  2KQ9 A;  5DS6 A;  1VMA A;  1ZHY A;  2FGY A;  4KNV A;  1V54 C;  1Z23 A;  4IJJ A;  5CI8 A;  1SMY F;  2E87 A;  3EZH A;  1VK5 A;  3ZG1 A;  2H7B A;  5B3S C;  4CS8 A;  4PFP A;  4Q4Z F;  3F47 A;  1D0Y A;  3T6J A;  3HLZ A;  4C3D A;  3JYH A;  4E7Z A;  1FMW A;  3FAJ A;  4PK4 A;  3FHD A;  3Q6N A;  2XXA A;  1PD1 A;  4U5D E;  2VAS A;  3UMK A;  3FDQ A;  1VOM A;  3EH2 A;  3LLI A;  2LSE A;  1FMV A;  3HTK C;  4U5F E;  4FX5 A;  4WJ0 A;  3DMD A;  1TWA A;  2DYR C;  3ABK C;  4AX2 A;  5T1D B;  4QI2 A;  3SP1 A;  3WG7 C;  1OKK A;  3E70 C;  1M2O A;  4JCH A;  4P6I C;  1JPN A;  4CS8 C;  2KNH A;  4O6M A;  3UMH A;  4KI2 A;  2R7X A;  2KGO A;  2Y3H A;  3DM5 A;  5E3A A;  5F5F A;  1ZU4 A;  3ZIB A;  3SZR A;  1OCC C;  3W2V A;  1OKK D;  2KJG A;  5DQT A;  3UMI A;  3DJN B;  1JPJ A;  4LLC A;  1Z63 A;  2XRH A;  1J8M F;  1O87 A;  1TR2 A;  1NU7 D;  2XSE A;  3SYN A;  3AG1 C;  4O6Y A;  2HV6 A;  4U5G A;  4HFK B;  2ZXR A;  5KYW B;  4JJF A;  4LER A;  4C3E A;  2CNW A;  4MQ9 F;  2NUP B;  2WVQ A;  3EHN A;  3CSK A;  1TWH A;  2A1D D;  5D91 A;  3JSZ A;  2WL8 A;  4AE4 A;  4BG0 A;  3B0U X;  4K7B A;  3K33 A;  2IXM A;  2IOQ A;  4CSA C;  3K1H A;  2R7R A;  4BJ5 A;  4RD9 A;  1RJ9 B;  2YEV A;  2XL4 A;  4X0R A;  2L9J A;  2P6V A;  4BJ6 A;  3NKE A;  1ZHT A;  5DLJ A;  1V55 C;  1O5H A;  4OIN F;  4DBR A;  1IW7 F;  3ASO C;  3EPV A;  2PX0 A;  2Z15 A;  1NZE A;  4CS9 A;  4HFF B;  2L81 A;  3AG2 C;  3S27 A;  3DJU B;  2WB7 A;  4J32 B;  2R7V A;  3NYL A;  3ABL C;  3EFO A;  4DVY P;  4I44 A;  3EGX B;  1FFH A;  3VYW A;  3ABM C;  4PJN A;  2ZXO A;  4KBL A;  2Y3B A;  2R7S A;  2NG1 A;  2J0W A;  3EFO B;  3EG9 B;  5KYX B;  3K1I C;  4C3B A;  1Z5Z A;  4I1O B;  5BUO A;  3DAG A;  2EIJ C;  4KNW A;  2B0J A;  1OCO C;  4OIR F;  3LAY A;  2OG2 A;  3RIP A;  4CS7 A;  4OIP F;  4C7O A;  4EBB A;  5KYW A;  3MLG A;  4AK9 A;  3LES A;  1S7Z A;  3EGD B;  2EIN C;  4YT4 A;  3K7D A;  3UR3 C;  5B1B C;  2R7Q A;  3EG9 A;  2IXN A;  4PFO A;  1LVK A;  4XLN F;  5T3T A;  4YN0 B;  3LEV A;  2Q9A A;  2EIL C;  3LS0 A;  4G0H A;  2Y39 A;  2H7V C;  4FWV A;  4QI0 A;  3NYM A;  4NY3 A;  3S28 A;  3JCU Q;  1N1C A;  1W2W A;  5E33 A;  4PJM A;  3B9Q A;  4JUR I;  2Q3T A;  3L34 A;  2BE5 F;  3LJB A;  4LLE A;  4G7H F;  3OA1 A;  2J0X A;  2W45 A;  2D5R B;  2PX3 A;  3LNR A;  4RBN A;  3EQL F;  2IXP A;  2PP4 A;  2FFH A;  4BJT A;  3CQZ A;  2C04 A;  2J9W A;  2GFH A;  3I5Q A;  2I8B A;  3JRT A;  3W8H A;  3K66 A;  4RDA A;  3M1C B;  4OD5 A;  3RH3 A;  3V7O A;  3WOD F;  4JW1 A;  3QZC A;  4ULW A;  4W8K A;  4I3M A;  3OEO A;  4KC9 A;  4LAC B;  3SEO A;  2J7P A;  3UGO A;  1MNE A;  1OCZ C;  2M4E A;  1IZM A;  3EZI A;  1D1A A;  4U5H A;  3W2W A;  1ZHW A;  3I5P A;  2V3C C;  3GAN A;  4ZLD A;  2A6E F;  1BR1 A;  1MND A;  3EGX A;  1KU2 A;  2A68 F;  3CZ6 A;  1SZI A;  3AQB A;  4IRU A;  1TWG A;  2EIM C;  3EH1 A;  3B0P A;  4O79 A;  3GOD A;  2Q9B A;  3KMI A;  3KKB A;  5KYX A;  4O6N A;  2QTV A;  4YJW A;  5EHH A;  2R7U A;  3AG3 C;  1BR4 A;  2CNW D;  2G62 A;  2O9X A;  4F4B A;  2J7P D;  1M56 C;  3S29 A;  2ZXW C;  2CDQ A;  2NUT A;  1D1C A;  4FES A;  4QDL A;  4G7Z F;  3ZSU A;  2KW3 C;  4ZLC A;  2NUP A;  1FTS A;  4MND A;  4B6I A;  3HJC A;  1Z3I X;  2V26 A;  1QZX A;  3NG1 A;  1MMG A;  4K0D A;  2MWQ A;  3DXJ F;  3JT1 A;  1LS1 A;  4YT8 A;  5CI9 A;  1OCR C;  3NDB B;  4BJ1 A;  3T6B A;  4OIO F;  2A6H F;  1D1B A;  3ECS A;  1SF8 A;  2A69 F;  2ZXP A;  2W4B A;  3DAF A;  4HE8 D;  2VH3 A;  2Q9C A;  1ST6 A;  3O6X A;  3KL4 A;  2ZPA A;  2G3K A;  4O7G A;  1MMA A;  4CBE A;  4G7O F;  2Y3G A;  3AG4 C;  1M2V B;  2OCC C;  2W4M A;  3EJN A;  1J8Y F;  3N0T A;  4JZA A;  3DM9 B;  2J45 A;  4N06 A;  3AQC A;  1QLE C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...