3R7CA

The structure of a hexahestidine-tagged form of augmenter of liver regeneration reveals a novel cd(2)cl(4)o(6) cluster that aids in crystal packing
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
111
structure length
111
Chain Sequence
DCPQDREELGRNTWAFLHTLAAYYPDMPTPEQQQDMAQFIHIFSKFYPCEECAEDIRKRIDRSQPDTSTRVSFSQWLCRLHNEVNRKLGKPDFDCSRVDERWRDGWKDGSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords FAD-linked sulfhydryl oxidase ALR
publication title The structure of a hexahestidine-tagged form of augmenter of liver regeneration reveals a novel Cd(2)Cl(4)O(6) cluster that aids in crystal packing
rcsb
source organism Rattus norvegicus
total genus 40
structure length 111
sequence length 111
chains with identical sequence B, C, D
ec nomenclature ec 1.8.3.2: Thiol oxidase.
pdb deposition date 2011-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04777 Evr1_Alr Erv1 / Alr family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.310 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) ERV/ALR sulfhydryl oxidase domain 3r7cA00
3GWNA 3GWLA 3LLIA 3TK0A 3U2LA 3U2MA 1JR8A 3O55A 2HJ3A 3LLKA 3U5SA 3MBGA 3TD7A 3R7CA 4LDKA 1OQCA 4E0IA 4E0HA 1JRAA 3W4YA
chains in the Genus database with same CATH superfamily
4Z9HA 3C8GD 4NQFA 4HFFB 2J9WA 1NLXA 2IM8A 1ZYRF 2J8WA 1Q0KA 2KQ9A 4XWJA 2XLVA 2O9XA 1FAPB 2R7WA 4U5EE 5EGYA 1WN0A 1NU9C 3ZC4A 2YRFA 1MNDA 2B0HA 1PD0A 1MMGA 5L0HA 1RJ9B 2HUJA 1QQ3A 1WOLA 4JVSA 4PJJA 5JP7A 3RQFA 3U9JA 3KL4A 1E2XA 3UGPA 3I5QA 3V5ZA 4MVZA 1Q0GA 4BJ6A 2H8AA 5L0GA 4U5FE 2YL0A 2OEXA 3H2VA 2IXOA 4R32A 1RKCA 2DGJA 1CPRA 2EPKX 2KC3A 5FZTA 3V5XA 2ICWG 1GM5A 2HV7A 1T6UA 2MWQA 3B0UX 3GM1A 4I1MA 3M15A 1C17M 2KSFA 1D0XA 3ZQYA 3DZAA 2VCCA 1AUEA 3DJNB 3V7OA 3JTLO 1J8YF 2OCCC 4QI0A 2YWAA 1G4US 2HS5A 3PHF2 5KYYB 4AL0A 1OKKA 1J8MF 3KMIA 4PACA 2P7VA 3AOUA 3GEIA 4XPXA 3RH3A 3U8VA 2XLDA 4MW3A 2QE9A 1Z6AA 1E83A 1L7CA 4QI2A 1D1AA 4W8KA 1KNYA 5EK0A 3N0TA 1RCPA 3K1IC 4EIYA 3LUTB 2A1DD 2R7VA 1XZQA 3Q7GA 3T6GB 4MNDA 1M6TA 1M2VB 1UFBA 3S27A 3SXKA 3X1OA 4CS9A 4PJMA 5T3WA 2NUTB 2Y3BA 3AJMA 2XL6A 3IEEA 2KK1A 3NRHA 3PCVA 1CGME 2R02A 3DM9B 3ASNC 1YZCA 3GORA 2XXAB 3M1CB 2EPNA 4G0HA 5BQIA 2P61A 3NKEA 2QNLA 2XS8A 1OCCC 3FVYA 3QVYA 5JSLA 1Z7Qc 1ZVZA 3EG9A 3TK0A 1MMNA 4A2NB 1A0BA 1H6GA 1EA8A 2IOQA 3N24A 5FCLA 4WGZA 1M2OA 3T9OA 4BPMA 1SF8A 1WASA 2PFDA 1E85A 3DE8A 1I5NA 1LM3B 4RDAA 4JC7A 1T01A 3TQOA 1YYJA 5BQHA 4K7BA 4DVYP 3AG1C 2TMVP 2YLGA 3EFOB 4YWQA 4RBNA 4U5DE 2KYHA 2ZPAA 4MVUA 2Q00A 3EGXB 2Y69C 4KC9A 4OD4A 1LI5A 2CDQA 2EIKC 2XLHA 3UNGC 3EH2A 4ONSA 4CDYA 4EHPA 1BR1A 2C03A 3GWLA 2VH3A 1NG1A 3EQLF 3LLIA 4BJ6C 1JPNA 3B9QA 2J9BA 2OJQA 3GEEA 4CDAA 2IXNA 4HE8D 1TWCA 3JYYA 2Y3GA 3AGTA 3QW1A 2A69F 1VYIA 3C8GB 2XSEA 3DWWA 1MNEA 3MFNA 2YEVA 4LACB 2X0CA 4EWCA 1EQ1A 2W4MA 4Q7CA 1VLTA 1HY5A 4JJFA 1ZHWA 3BEHA 2E87A 3RVZA 5B1AC 2WZGA 2OKUA 2R7XA 4E0IA 3NYLA 2IXMA 4CDVA 4JTCB 1RKEB 4HEAJ 2R25A 2CNWD 1UG7A 3EGDB 4J7TA 2M64A 5DQZA 3UR3C 1FFTC 5DLJA 5HV9A 1YYXA 4O79A 1QPUA 1FFHA 4DBRA 3HJCA 1W2WA 3MYFA 2EILC 2L9JA 5A69A 2HJMA 3CQZA 3NKDA 4MVOA 2AWCA 5JLIA 1KTMA 1O3UA 4CS9C 1K05A 3L34A 2QUPA 2AWYA 3U2MA 1FMWA 2Y3DA 3T6BA 1H9TA 3FDQA 2EIJC 2H7VC 3O10A 5JT4A 2WL8A 3JSEO 5COGA 3UMHA 1HE9A 5JUAA 3HNKA 5E3CA 2DI3A 2ZXRA 3F46A 2WVNA 3B0PA 4PK4A 3QVZA 1FR0A 4WJ0A 5BQGA 2WZFA 3EPVA 3ZG1A 3K6BA 4NCQA 1CPQA 2V26A 4AE4A 1D1BA 1V54C 1ZU5A 2EPLX 1O87A 3RYLA 4ANJA 4OIOF 2Y39A 1DOWA 2YLDA 3E70C 3EJNA 3G4XA 5GPGB 3WODF 3PMRA 4MVQA 2H7BA 2KGOA 3OA1A 4FX5A 5KYXA 1YJGA 2XM0A 4IARA 1R5ID 3C8ZA 4EKWA 4CS8A 3EGDA 4Z9IA 4WABA 5L0DA 1SYQA 3SP1A 2MHRA 3W8HA 4EBJA 4P6IC 3IQ6A 3NG1A 2YKZA 5TJ5E 3NYMA 5KYWB 1M56C 3B29A 3MX3A 4IAQA 1WATA 2CYDA 2P6VA 2VC9A 5D92A 3VYWA 1E84A 1GGQA 2XL8A 1A7DA 4MVMA 2G3VA 3S84A 1ORJA 2HFIA 3JZ0A 1YA9A 4C7OA 1LS4A 4L6RA 4Z9JA 2XLWA 1OW8A 4CSAA 2YVKA 3JCUQ 1AVOB 1VK5A 2PBEA 2BC5A 3LEOA 1TKNA 1RXQA 4U9EA 3LESA 3U0CA 4I3MA 3C7JA 3VAYA 3CSKA 4JJGA 3DM5A 1IW7F 2R05A 1BR4A 4JZAA 3VRCA 5L0IA 3B0VC 4BJ1A 3N2ZB 1YZAA 2QTVA 1YARO 2Y3HA 3H65A 2OU6A 4H54A 3TULA 1U89A 2YLIA 2W9YA 2ZXWC 1TFKB 4MTOA 2W4BA 3IQTA 1S05A 1XZPA 3IHUA 3G4ZA 4O6NA 1Y6DA 3C62A 3X2QC 3KPHA 3O55A 4O6MA 2YL3A 1ZZPA 2HSBA 2JD3A 4H4KC 3U5SA 4MTGA 4YT8A 2WB7A 3LNMB 3M4CA 4KI2A 4NY3A 5L3QA 1RJ9A 1VYKA 2R03A 4LERA 4GQHA 4C3BA 4E7SA 3I4UA 4HFKB 4XQ1A 3TOMA 1NSGB 2A0BA 2JX0A 3AQBA 4LDRA 4E0HA 4MQ9F 4EUKB 4OIQF 1D0ZA 1HMOA 3M4BA 3ZQVA 3ZTMA 4PJLA 3EHNA 1JPJA 2FGYA 1Z5ZA 2UUHA 2XLMA 1YVIA 4CIPA 2ETSA 4G7OF 3B71A 3NMKA 2L7AA 1PD1A 3G50A 4C3DA 3CEXA 4N6HA 1Z23A 3W2VA 2NG1A 3AG2C 1ZHZA 4WGYA 1PV3A 2R7QA 1U0BB 1LPEA 3ZVRA 4EBKA 3ATPA 2Q3TA 2XRHA 4IRUA 4J7YA 2IXPA 4JKVA 2Z15A 2D5RB 1OW7A 1O5HA 1ZHTA 4CS8C 5KYYA 3EHMA 1OKKD 1JAFA 3NMJA 3ZIBA 4A4AA 4JE9A 3ABKC 3AQCA 4F4BA 1EI7A 2DYSC 2KJGA 4JURI 4UDVA 1LI7A 1D0YA 2ASRA 5CIVA 4U5CE 3FXHA 3ABLC 2B0JA 3OWTA 1M2VA 3EH1A 3KYJA 1BR2A 5DVWA 4O6YA 2NUTA 1MMAA 4JW1A 1G5ZA 4JEBA 2OOCA 2PP4A 1D1CA 4NC3A 2R9RB 3S28A 2LQGA 2D4UA 3L0IA 4PR9A 2ZD9A 2HMQA 2J7PA 1OCRC 4JCZA 1MQVA 4CSAC 2EPMX 1QSPA 3Q6MA 1K40A 1OR3A 3I5PA 3FOOA 2XXAA 2F22A 2HKVA 3ASOC 3U9MA 3W2WA 1B68A 1T5OA 3DKAA 4OIRF 3SZRA 3WG7C 4E17A 4KNVA 1OXKA 2ZXOA 2CNWA 2P1AA 5A6BA 3LLKA 1EKYA 4Q4ZF 3C63A 5A6KA 4Q5SF 3HNLA 5KYUB 4MVRA 3JRMO 3NYJA 5F28E 4PFPA 1QLEC 1YLMA 1GQAA 2FAPB 5JVEA 2LK4A 3WHNA 4ZLDA 4ULWA 1E86A 1YAUO 3EFOA 4EBBA 1NBBA 5AC4A 2KW3C 3JT1A 2YQYA 3EGXA 2G3KA 1M57C 3PDMP 3HLZA 4XPYA 4YL1A 1NU7D 3M79A 1VLSA 3U2LA 4XLPF 4J32B 3U8PA 1JR8A 4ULVA 3JSZA 4YL3A 3GODA 3LS0A 1L3PA 2C04A 1LE4A 2HJ3A 1T9KA 1TWGA 2OEVA 1JOGA 4GYTA 3F47A 3SXMA 3EZIA 1ORSC 3GANA 4ER9A 4D4XA 1U6HA 3C8GA 3JYHA 1VMAA 3L8JA 2YHSA 4IAOA 1I4ZA 1I4YA 4JTAB 1TFOB 1ST6A 4KNWA 3SYNA 1WWPA 4BJ5A 4JRZA 2J46A 5A6AA 3SNHA 5CI8A 2PF4E 1DOVA 3GWNA 3SXZA 1F1MA 2IYLD 1RMVA 2Q9CA 1QKRA 3LNRA 5F5FA 2CGEA 4NTFA 4P9TA 2R7SA 1RKEA 3EZHA 4LDQA 3GM2A 4DRJB 3TJ6A 3US6A 4OD5A 4YJWA 1LKXA 2J9VA 4IJJA 3VF0A 4D4NA 4E7ZA 4E18A 1TQGA 3S90A 1Z63A 4AX2A 1FMVA 5DQTA 1NFNA 4DOZA 2PNOA 1HMDA 4M63A 2OG2A 1TWAA 3AG4C 4W8PA 4XTKA 1A41A 2VB6A 2V3CC 3AGUA 4JTDB 2L6FA 5B1BC 4MW8A 1MMDA 256BA 2H7OA 4N4WA 4XEKA 2XS1A 3TJ5A 4YK5A 3LJBA 4PFOA 4C3EA 4CJGA 2W45A 2EINC 3RKOF 4LDKA 1BZ4A 2AVKA 1IZMA 1OCZC 1OXBA 4JEAA 3U3FA 2OQMA 3HTKC 3L1MA 3MLGA 5E3AA 3S29A 2R7UA 2GDCA 5E2QA 3UMKA 4G7HF 4B6IA 2EPOA 2LSEA 1TWHA 5AGFA 2QY9A 2R7RA 1A7VA 2AU5A 2LP4A 4BEJA 1CGOA 4JCHA 5JRAA 1LS1A 2BL2A 3E9VA 2A6HF 4BEMJ 5IY5C 2HZ8A 1CGNA 2NUPB 2IBFA 2R7OA 3A9CA 3DJUB 3RFYA 3ZTZA 3C18A 2YL7A 1R4TA 4DVZA 1ZW2A 5L0FA 3QZCA 4YT4A 5E33A 4YT5A 3RIPA 1WGWA 4FESA 1H9GA 4K1OA 1Q0MA 2L81A 3IQ5A 3S9OA 1SR2A 3KYIA 3DE9A 3UMIA 3BRJA 1A7EA 2PX0A 2QLAA 3H2UA 4AL1A 5KYWA 3AG3C 3MBGA 4GEHA 3HNJA 4OINF 2A68F 4LLCA 4G7ZF 2WZLA 4IWBA 3T4RA 5AC5A 3A11A 3JRTA 3NMIA 1C03A 3ABMC 3CZ6A 4I44A 1V74B 3W4YA 3SXYA 5K0IA 4O7GA 3FMSA 1YDIA 3EG9B 2M4EA 2A0UA 5A6JA 2OJED 2WVOA 2I15A 4KBLA 1OW6A 1VOMA 4DJ9A 5T1DB 4MTFA 2RSEB 2YL1A 4IGGA 3RF3A 4BJ5C 1LVKA 3RW0A 3K66A 1V4AA 2VASA 2P0NA 2NSFA 2J45A 2NUPA 3FAPB 4N06A 1C02A 4U5HA 4XLNF 3DXJF 1Z3IX 2FFHA 2GFHA 3T6JA 3TOLA 3QTHA 1WTYA 3ITFA 2LFFA 3RQGA 4DRHB 3HNIA 4P9FA 2GA0A 4DRIB 3NDBB 4PJNA 2HSQA 1KU2A 1JMWA 4JIOA 2L6GA 2CW0F 4CJOA 3V5YA 1SMYF 3R2PA 1OCOC 1S7ZA 3K7DA 3QMKA 2NSGA 2I8BA 2Q9BA 4NTAA 3ZDLA 1ZU4A 3UGOA 1Y4CA 2Q9AA 4YN0B 3HKKA 1HE1A 2CCYA 4U5BE 4YT2A 5BUOA 3O6XA 1PCXA 3DAFA 4YL0A 3J06A 4XEFA 1SZIA 4MS2A 3GM3A 5B3IA 2DB4A 5L3VA 1GS9A 3CAXA 5HSWA 3LAYA 1ZHXA 4U9DA 5T3TA 2XLOA 2GAQA 3O39A 4J30B 3QW0A 1N1CA 5L0JA 2KNHA 2LCHA 4IB4A 1YA7O 1QVXA 1NFOA 5DS4A 2MYSA 2R7TA 1G8XA 3ECSA 1OQCA 4AK9A 4DBQA 3DI5A 3U3BA 1G4WR 3DD7A 4U5GA 4BG0A 4CIHA 2HMZA 3ZWIA 5DS5A 1ZHYA 1NZEA 1XWJA 4FWVA 5COFA 2WVQA 3L8IA 3POVA 3ZSUA 1BBHA 4DXWA 4ZLCA 1APCA 2XLEA 4XEVA 1TR2A 4MVSA 2L6HA 1FNTc 3Q7LA 3IQCA 3IPMO 3LS1A 4AE4B 2J7PD 2JPUA 3Q6NA 3S0XA 2YZSA 5EHHA 4CX9A 2AP3A 1T6QA 1V55C 5CI9A 5KYXB 4FAPB 2NPUA 2LIGA 4XPWA 2PX3A 3WAQA 5L0CA 4X0RA 2EIMC 5B3SC 5A6BD 2Q4FA 2LD6A 1QZXA 4RD9A 4BJTA 2XL4A 3KKBA 4G78A 4CBEA 5KYUA 3W8IA 1LIHA 4I1OB 3K33A 2UUIA 3RQEA 1BDJB 1HW1A 4NTBA 3DAGA 1H7IA 5JS5A 2VCAA 3K1IA 1OR2A 1Q0DA 3FOPA 3VM6A 1FTSA 1Q0FA 4K0DA 4LLEA 1HW2A 1LE2A 2ZXPA 3SEOA 1VTMP 4OIPF 5KYNA 1ZW3A 3LEVA 2J9UA 5COMA 3MYIA 4C7OB 3FHDA 1VB5A 2VCBA 3GEHA 4N6CA 1AEPA 3DMDA 3RVYA 2A6EF 2BE5F 2LFDA 3FAJA 5DS6A 2Q7RA 2GWWA 2J0XA 3TD7A 3OEOA 3R7CA 5F5HA 1T6IA 2X51A 5D91A 2XM4A 3K1HA 3KH2A 2DYRC 4QDLA 2RD9A 2G62A 1K04A 2HV6A 1ORYA 2J0WA 1JRAA 4CS7A
chains in the Genus database with same CATH topology
3GWNA 3GWLA 3LLIA 3TK0A 3U2LA 3U2MA 1JR8A 3O55A 2HJ3A 3LLKA 3U5SA 3MBGA 3TD7A 3R7CA 4LDKA 1OQCA 4E0IA 4E0HA 1JRAA 3W4YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GWN A;  3GWL A;  3LLI A;  3TK0 A;  3U2L A;  3U2M A;  1JR8 A;  3O55 A;  2HJ3 A;  3LLK A;  3U5S A;  3MBG A;  3TD7 A;  3R7C A;  4LDK A;  1OQC A;  4E0I A;  4E0H A;  1JRA A;  3W4Y A; 
#chains in the Genus database with same CATH topology
 4Z9H A;  3C8G D;  4NQF A;  4HFF B;  2J9W A;  1NLX A;  2IM8 A;  1ZYR F;  2J8W A;  1Q0K A;  2KQ9 A;  4XWJ A;  2XLV A;  2O9X A;  1FAP B;  2R7W A;  4U5E E;  5EGY A;  1WN0 A;  1NU9 C;  3ZC4 A;  2YRF A;  1MND A;  2B0H A;  1PD0 A;  1MMG A;  5L0H A;  1RJ9 B;  2HUJ A;  1QQ3 A;  1WOL A;  4JVS A;  4PJJ A;  5JP7 A;  3RQF A;  3U9J A;  3KL4 A;  1E2X A;  3UGP A;  3I5Q A;  3V5Z A;  4MVZ A;  1Q0G A;  4BJ6 A;  2H8A A;  5L0G A;  4U5F E;  2YL0 A;  2OEX A;  3H2V A;  2IXO A;  4R32 A;  1RKC A;  2DGJ A;  1CPR A;  2EPK X;  2KC3 A;  5FZT A;  3V5X A;  2ICW G;  1GM5 A;  2HV7 A;  1T6U A;  2MWQ A;  3B0U X;  3GM1 A;  4I1M A;  3M15 A;  1C17 M;  2KSF A;  1D0X A;  3ZQY A;  3DZA A;  2VCC A;  1AUE A;  3DJN B;  3V7O A;  3JTL O;  1J8Y F;  2OCC C;  4QI0 A;  2YWA A;  1G4U S;  2HS5 A;  3PHF 2;  5KYY B;  4AL0 A;  1OKK A;  1J8M F;  3KMI A;  4PAC A;  2P7V A;  3AOU A;  3GEI A;  4XPX A;  3RH3 A;  3U8V A;  2XLD A;  4MW3 A;  2QE9 A;  1Z6A A;  1E83 A;  1L7C A;  4QI2 A;  1D1A A;  4W8K A;  1KNY A;  5EK0 A;  3N0T A;  1RCP A;  3K1I C;  4EIY A;  3LUT B;  2A1D D;  2R7V A;  1XZQ A;  3Q7G A;  3T6G B;  4MND A;  1M6T A;  1M2V B;  1UFB A;  3S27 A;  3SXK A;  3X1O A;  4CS9 A;  4PJM A;  5T3W A;  2NUT B;  2Y3B A;  3AJM A;  2XL6 A;  3IEE A;  2KK1 A;  3NRH A;  3PCV A;  1CGM E;  2R02 A;  3DM9 B;  3ASN C;  1YZC A;  3GOR A;  2XXA B;  3M1C B;  2EPN A;  4G0H A;  5BQI A;  2P61 A;  3NKE A;  2QNL A;  2XS8 A;  1OCC C;  3FVY A;  3QVY A;  5JSL A;  1Z7Q c;  1ZVZ A;  3EG9 A;  3TK0 A;  1MMN A;  4A2N B;  1A0B A;  1H6G A;  1EA8 A;  2IOQ A;  3N24 A;  5FCL A;  4WGZ A;  1M2O A;  3T9O A;  4BPM A;  1SF8 A;  1WAS A;  2PFD A;  1E85 A;  3DE8 A;  1I5N A;  1LM3 B;  4RDA A;  4JC7 A;  1T01 A;  3TQO A;  1YYJ A;  5BQH A;  4K7B A;  4DVY P;  3AG1 C;  2TMV P;  2YLG A;  3EFO B;  4YWQ A;  4RBN A;  4U5D E;  2KYH A;  2ZPA A;  4MVU A;  2Q00 A;  3EGX B;  2Y69 C;  4KC9 A;  4OD4 A;  1LI5 A;  2CDQ A;  2EIK C;  2XLH A;  3UNG C;  3EH2 A;  4ONS A;  4CDY A;  4EHP A;  1BR1 A;  2C03 A;  3GWL A;  2VH3 A;  1NG1 A;  3EQL F;  3LLI A;  4BJ6 C;  1JPN A;  3B9Q A;  2J9B A;  2OJQ A;  3GEE A;  4CDA A;  2IXN A;  4HE8 D;  1TWC A;  3JYY A;  2Y3G A;  3AGT A;  3QW1 A;  2A69 F;  1VYI A;  3C8G B;  2XSE A;  3DWW A;  1MNE A;  3MFN A;  2YEV A;  4LAC B;  2X0C A;  4EWC A;  1EQ1 A;  2W4M A;  4Q7C A;  1VLT A;  1HY5 A;  4JJF A;  1ZHW A;  3BEH A;  2E87 A;  3RVZ A;  5B1A C;  2WZG A;  2OKU A;  2R7X A;  4E0I A;  3NYL A;  2IXM A;  4CDV A;  4JTC B;  1RKE B;  4HEA J;  2R25 A;  2CNW D;  1UG7 A;  3EGD B;  4J7T A;  2M64 A;  5DQZ A;  3UR3 C;  1FFT C;  5DLJ A;  5HV9 A;  1YYX A;  4O79 A;  1QPU A;  1FFH A;  4DBR A;  3HJC A;  1W2W A;  3MYF A;  2EIL C;  2L9J A;  5A69 A;  2HJM A;  3CQZ A;  3NKD A;  4MVO A;  2AWC A;  5JLI A;  1KTM A;  1O3U A;  4CS9 C;  1K05 A;  3L34 A;  2QUP A;  2AWY A;  3U2M A;  1FMW A;  2Y3D A;  3T6B A;  1H9T A;  3FDQ A;  2EIJ C;  2H7V C;  3O10 A;  5JT4 A;  2WL8 A;  3JSE O;  5COG A;  3UMH A;  1HE9 A;  5JUA A;  3HNK A;  5E3C A;  2DI3 A;  2ZXR A;  3F46 A;  2WVN A;  3B0P A;  4PK4 A;  3QVZ A;  1FR0 A;  4WJ0 A;  5BQG A;  2WZF A;  3EPV A;  3ZG1 A;  3K6B A;  4NCQ A;  1CPQ A;  2V26 A;  4AE4 A;  1D1B A;  1V54 C;  1ZU5 A;  2EPL X;  1O87 A;  3RYL A;  4ANJ A;  4OIO F;  2Y39 A;  1DOW A;  2YLD A;  3E70 C;  3EJN A;  3G4X A;  5GPG B;  3WOD F;  3PMR A;  4MVQ A;  2H7B A;  2KGO A;  3OA1 A;  4FX5 A;  5KYX A;  1YJG A;  2XM0 A;  4IAR A;  1R5I D;  3C8Z A;  4EKW A;  4CS8 A;  3EGD A;  4Z9I A;  4WAB A;  5L0D A;  1SYQ A;  3SP1 A;  2MHR A;  3W8H A;  4EBJ A;  4P6I C;  3IQ6 A;  3NG1 A;  2YKZ A;  5TJ5 E;  3NYM A;  5KYW B;  1M56 C;  3B29 A;  3MX3 A;  4IAQ A;  1WAT A;  2CYD A;  2P6V A;  2VC9 A;  5D92 A;  3VYW A;  1E84 A;  1GGQ A;  2XL8 A;  1A7D A;  4MVM A;  2G3V A;  3S84 A;  1ORJ A;  2HFI A;  3JZ0 A;  1YA9 A;  4C7O A;  1LS4 A;  4L6R A;  4Z9J A;  2XLW A;  1OW8 A;  4CSA A;  2YVK A;  3JCU Q;  1AVO B;  1VK5 A;  2PBE A;  2BC5 A;  3LEO A;  1TKN A;  1RXQ A;  4U9E A;  3LES A;  3U0C A;  4I3M A;  3C7J A;  3VAY A;  3CSK A;  4JJG A;  3DM5 A;  1IW7 F;  2R05 A;  1BR4 A;  4JZA A;  3VRC A;  5L0I A;  3B0V C;  4BJ1 A;  3N2Z B;  1YZA A;  2QTV A;  1YAR O;  2Y3H A;  3H65 A;  2OU6 A;  4H54 A;  3TUL A;  1U89 A;  2YLI A;  2W9Y A;  2ZXW C;  1TFK B;  4MTO A;  2W4B A;  3IQT A;  1S05 A;  1XZP A;  3IHU A;  3G4Z A;  4O6N A;  1Y6D A;  3C62 A;  3X2Q C;  3KPH A;  3O55 A;  4O6M A;  2YL3 A;  1ZZP A;  2HSB A;  2JD3 A;  4H4K C;  3U5S A;  4MTG A;  4YT8 A;  2WB7 A;  3LNM B;  3M4C A;  4KI2 A;  4NY3 A;  5L3Q A;  1RJ9 A;  1VYK A;  2R03 A;  4LER A;  4GQH A;  4C3B A;  4E7S A;  3I4U A;  4HFK B;  4XQ1 A;  3TOM A;  1NSG B;  2A0B A;  2JX0 A;  3AQB A;  4LDR A;  4E0H A;  4MQ9 F;  4EUK B;  4OIQ F;  1D0Z A;  1HMO A;  3M4B A;  3ZQV A;  3ZTM A;  4PJL A;  3EHN A;  1JPJ A;  2FGY A;  1Z5Z A;  2UUH A;  2XLM A;  1YVI A;  4CIP A;  2ETS A;  4G7O F;  3B71 A;  3NMK A;  2L7A A;  1PD1 A;  3G50 A;  4C3D A;  3CEX A;  4N6H A;  1Z23 A;  3W2V A;  2NG1 A;  3AG2 C;  1ZHZ A;  4WGY A;  1PV3 A;  2R7Q A;  1U0B B;  1LPE A;  3ZVR A;  4EBK A;  3ATP A;  2Q3T A;  2XRH A;  4IRU A;  4J7Y A;  2IXP A;  4JKV A;  2Z15 A;  2D5R B;  1OW7 A;  1O5H A;  1ZHT A;  4CS8 C;  5KYY A;  3EHM A;  1OKK D;  1JAF A;  3NMJ A;  3ZIB A;  4A4A A;  4JE9 A;  3ABK C;  3AQC A;  4F4B A;  1EI7 A;  2DYS C;  2KJG A;  4JUR I;  4UDV A;  1LI7 A;  1D0Y A;  2ASR A;  5CIV A;  4U5C E;  3FXH A;  3ABL C;  2B0J A;  3OWT A;  1M2V A;  3EH1 A;  3KYJ A;  1BR2 A;  5DVW A;  4O6Y A;  2NUT A;  1MMA A;  4JW1 A;  1G5Z A;  4JEB A;  2OOC A;  2PP4 A;  1D1C A;  4NC3 A;  2R9R B;  3S28 A;  2LQG A;  2D4U A;  3L0I A;  4PR9 A;  2ZD9 A;  2HMQ A;  2J7P A;  1OCR C;  4JCZ A;  1MQV A;  4CSA C;  2EPM X;  1QSP A;  3Q6M A;  1K40 A;  1OR3 A;  3I5P A;  3FOO A;  2XXA A;  2F22 A;  2HKV A;  3ASO C;  3U9M A;  3W2W A;  1B68 A;  1T5O A;  3DKA A;  4OIR F;  3SZR A;  3WG7 C;  4E17 A;  4KNV A;  1OXK A;  2ZXO A;  2CNW A;  2P1A A;  5A6B A;  3LLK A;  1EKY A;  4Q4Z F;  3C63 A;  5A6K A;  4Q5S F;  3HNL A;  5KYU B;  4MVR A;  3JRM O;  3NYJ A;  5F28 E;  4PFP A;  1QLE C;  1YLM A;  1GQA A;  2FAP B;  5JVE A;  2LK4 A;  3WHN A;  4ZLD A;  4ULW A;  1E86 A;  1YAU O;  3EFO A;  4EBB A;  1NBB A;  5AC4 A;  2KW3 C;  3JT1 A;  2YQY A;  3EGX A;  2G3K A;  1M57 C;  3PDM P;  3HLZ A;  4XPY A;  4YL1 A;  1NU7 D;  3M79 A;  1VLS A;  3U2L A;  4XLP F;  4J32 B;  3U8P A;  1JR8 A;  4ULV A;  3JSZ A;  4YL3 A;  3GOD A;  3LS0 A;  1L3P A;  2C04 A;  1LE4 A;  2HJ3 A;  1T9K A;  1TWG A;  2OEV A;  1JOG A;  4GYT A;  3F47 A;  3SXM A;  3EZI A;  1ORS C;  3GAN A;  4ER9 A;  4D4X A;  1U6H A;  3C8G A;  3JYH A;  1VMA A;  3L8J A;  2YHS A;  4IAO A;  1I4Z A;  1I4Y A;  4JTA B;  1TFO B;  1ST6 A;  4KNW A;  3SYN A;  1WWP A;  4BJ5 A;  4JRZ A;  2J46 A;  5A6A A;  3SNH A;  5CI8 A;  2PF4 E;  1DOV A;  3GWN A;  3SXZ A;  1F1M A;  2IYL D;  1RMV A;  2Q9C A;  1QKR A;  3LNR A;  5F5F A;  2CGE A;  4NTF A;  4P9T A;  2R7S A;  1RKE A;  3EZH A;  4LDQ A;  3GM2 A;  4DRJ B;  3TJ6 A;  3US6 A;  4OD5 A;  4YJW A;  1LKX A;  2J9V A;  4IJJ A;  3VF0 A;  4D4N A;  4E7Z A;  4E18 A;  1TQG A;  3S90 A;  1Z63 A;  4AX2 A;  1FMV A;  5DQT A;  1NFN A;  4DOZ A;  2PNO A;  1HMD A;  4M63 A;  2OG2 A;  1TWA A;  3AG4 C;  4W8P A;  4XTK A;  1A41 A;  2VB6 A;  2V3C C;  3AGU A;  4JTD B;  2L6F A;  5B1B C;  4MW8 A;  1MMD A;  256B A;  2H7O A;  4N4W A;  4XEK A;  2XS1 A;  3TJ5 A;  4YK5 A;  3LJB A;  4PFO A;  4C3E A;  4CJG A;  2W45 A;  2EIN C;  3RKO F;  4LDK A;  1BZ4 A;  2AVK A;  1IZM A;  1OCZ C;  1OXB A;  4JEA A;  3U3F A;  2OQM A;  3HTK C;  3L1M A;  3MLG A;  5E3A A;  3S29 A;  2R7U A;  2GDC A;  5E2Q A;  3UMK A;  4G7H F;  4B6I A;  2EPO A;  2LSE A;  1TWH A;  5AGF A;  2QY9 A;  2R7R A;  1A7V A;  2AU5 A;  2LP4 A;  4BEJ A;  1CGO A;  4JCH A;  5JRA A;  1LS1 A;  2BL2 A;  3E9V A;  2A6H F;  4BEM J;  5IY5 C;  2HZ8 A;  1CGN A;  2NUP B;  2IBF A;  2R7O A;  3A9C A;  3DJU B;  3RFY A;  3ZTZ A;  3C18 A;  2YL7 A;  1R4T A;  4DVZ A;  1ZW2 A;  5L0F A;  3QZC A;  4YT4 A;  5E33 A;  4YT5 A;  3RIP A;  1WGW A;  4FES A;  1H9G A;  4K1O A;  1Q0M A;  2L81 A;  3IQ5 A;  3S9O A;  1SR2 A;  3KYI A;  3DE9 A;  3UMI A;  3BRJ A;  1A7E A;  2PX0 A;  2QLA A;  3H2U A;  4AL1 A;  5KYW A;  3AG3 C;  3MBG A;  4GEH A;  3HNJ A;  4OIN F;  2A68 F;  4LLC A;  4G7Z F;  2WZL A;  4IWB A;  3T4R A;  5AC5 A;  3A11 A;  3JRT A;  3NMI A;  1C03 A;  3ABM C;  3CZ6 A;  4I44 A;  1V74 B;  3W4Y A;  3SXY A;  5K0I A;  4O7G A;  3FMS A;  1YDI A;  3EG9 B;  2M4E A;  2A0U A;  5A6J A;  2OJE D;  2WVO A;  2I15 A;  4KBL A;  1OW6 A;  1VOM A;  4DJ9 A;  5T1D B;  4MTF A;  2RSE B;  2YL1 A;  4IGG A;  3RF3 A;  4BJ5 C;  1LVK A;  3RW0 A;  3K66 A;  1V4A A;  2VAS A;  2P0N A;  2NSF A;  2J45 A;  2NUP A;  3FAP B;  4N06 A;  1C02 A;  4U5H A;  4XLN F;  3DXJ F;  1Z3I X;  2FFH A;  2GFH A;  3T6J A;  3TOL A;  3QTH A;  1WTY A;  3ITF A;  2LFF A;  3RQG A;  4DRH B;  3HNI A;  4P9F A;  2GA0 A;  4DRI B;  3NDB B;  4PJN A;  2HSQ A;  1KU2 A;  1JMW A;  4JIO A;  2L6G A;  2CW0 F;  4CJO A;  3V5Y A;  1SMY F;  3R2P A;  1OCO C;  1S7Z A;  3K7D A;  3QMK A;  2NSG A;  2I8B A;  2Q9B A;  4NTA A;  3ZDL A;  1ZU4 A;  3UGO A;  1Y4C A;  2Q9A A;  4YN0 B;  3HKK A;  1HE1 A;  2CCY A;  4U5B E;  4YT2 A;  5BUO A;  3O6X A;  1PCX A;  3DAF A;  4YL0 A;  3J06 A;  4XEF A;  1SZI A;  4MS2 A;  3GM3 A;  5B3I A;  2DB4 A;  5L3V A;  1GS9 A;  3CAX A;  5HSW A;  3LAY A;  1ZHX A;  4U9D A;  5T3T A;  2XLO A;  2GAQ A;  3O39 A;  4J30 B;  3QW0 A;  1N1C A;  5L0J A;  2KNH A;  2LCH A;  4IB4 A;  1YA7 O;  1QVX A;  1NFO A;  5DS4 A;  2MYS A;  2R7T A;  1G8X A;  3ECS A;  1OQC A;  4AK9 A;  4DBQ A;  3DI5 A;  3U3B A;  1G4W R;  3DD7 A;  4U5G A;  4BG0 A;  4CIH A;  2HMZ A;  3ZWI A;  5DS5 A;  1ZHY A;  1NZE A;  1XWJ A;  4FWV A;  5COF A;  2WVQ A;  3L8I A;  3POV A;  3ZSU A;  1BBH A;  4DXW A;  4ZLC A;  1APC A;  2XLE A;  4XEV A;  1TR2 A;  4MVS A;  2L6H A;  1FNT c;  3Q7L A;  3IQC A;  3IPM O;  3LS1 A;  4AE4 B;  2J7P D;  2JPU A;  3Q6N A;  3S0X A;  2YZS A;  5EHH A;  4CX9 A;  2AP3 A;  1T6Q A;  1V55 C;  5CI9 A;  5KYX B;  4FAP B;  2NPU A;  2LIG A;  4XPW A;  2PX3 A;  3WAQ A;  5L0C A;  4X0R A;  2EIM C;  5B3S C;  5A6B D;  2Q4F A;  2LD6 A;  1QZX A;  4RD9 A;  4BJT A;  2XL4 A;  3KKB A;  4G78 A;  4CBE A;  5KYU A;  3W8I A;  1LIH A;  4I1O B;  3K33 A;  2UUI A;  3RQE A;  1BDJ B;  1HW1 A;  4NTB A;  3DAG A;  1H7I A;  5JS5 A;  2VCA A;  3K1I A;  1OR2 A;  1Q0D A;  3FOP A;  3VM6 A;  1FTS A;  1Q0F A;  4K0D A;  4LLE A;  1HW2 A;  1LE2 A;  2ZXP A;  3SEO A;  1VTM P;  4OIP F;  5KYN A;  1ZW3 A;  3LEV A;  2J9U A;  5COM A;  3MYI A;  4C7O B;  3FHD A;  1VB5 A;  2VCB A;  3GEH A;  4N6C A;  1AEP A;  3DMD A;  3RVY A;  2A6E F;  2BE5 F;  2LFD A;  3FAJ A;  5DS6 A;  2Q7R A;  2GWW A;  2J0X A;  3TD7 A;  3OEO A;  3R7C A;  5F5H A;  1T6I A;  2X51 A;  5D91 A;  2XM4 A;  3K1H A;  3KH2 A;  2DYR C;  4QDL A;  2RD9 A;  2G62 A;  1K04 A;  2HV6 A;  1ORY A;  2J0W A;  1JRA A;  4CS7 A; 
#chains in the Genus database with same CATH homology
 3GWN A;  3GWL A;  3LLI A;  3TK0 A;  3U2L A;  3U2M A;  1JR8 A;  3O55 A;  2HJ3 A;  3LLK A;  3U5S A;  3MBG A;  3TD7 A;  3R7C A;  4LDK A;  1OQC A;  4E0I A;  4E0H A;  1JRA A;  3W4Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...