3R7CA

The structure of a hexahestidine-tagged form of augmenter of liver regeneration reveals a novel cd(2)cl(4)o(6) cluster that aids in crystal packing
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
111
structure length
111
Chain Sequence
b'DCPQDREELGRNTWAFLHTLAAYYPDMPTPEQQQDMAQFIHIFSKFYPCEECAEDIRKRIDRSQPDTSTRVSFSQWLCRLHNEVNRKLGKPDFDCSRVDERWRDGWKDGSC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAD-linked sulfhydryl oxidase ALR
publication title The structure of a hexahestidine-tagged form of augmenter of liver regeneration reveals a novel Cd(2)Cl(4)O(6) cluster that aids in crystal packing
rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
total genus 40
structure length 111
sequence length 111
chains with identical sequence B, C, D
ec nomenclature ec 1.8.3.2: Thiol oxidase.
pdb deposition date 2011-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04777 Evr1_Alr Erv1 / Alr family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.310 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) ERV/ALR sulfhydryl oxidase domain 3r7cA00
4LDKA 1JR8A 3GWLA 1JRAA 3LLIA 3GWNA 4E0IA 2HJ3A 3MBGA 3W4YA 4E0HA 3TK0A 1OQCA 3TD7A 3LLKA 3U2LA 3O55A 3U2MA 3U5SA 3R7CA
chains in the Genus database with same CATH superfamily
3O39A 3B0VC 3FMSA 1TWGA 3ASOC 2IXMA 3IQTA 3KMIA 1ZW2A 2Q9AA 4DRJB 4L6RA 2XL6A 2KSFA 1G8XA 3PCVA 1HW2A 4JW1A 1A41A 2NUTB 1QQ3A 1EI7A 4O6NA 1A7VA 1OW6A 4BJ5A 4JCZA 4HEAJ 2B0HA 3FOPA 1T6UA 5T3WA 2DB4A 3U3FA 2VB6A 3EJNA 4JIOA 1M56C 3TOLA 4BJ6A 3V5XA 1M57C 3DD7A 3AG4C 4DRHB 1UFBA 1WN0A 2IXNA 3EG9A 2YLIA 1ZHZA 4AX2A 2YLGA 3ZC4A 5DLJA 2J9VA 3PHF2 4ZLDA 1LM3B 5L3VA 3U2LA 4E7SA 3C62A 3K1IC 3O55A 1NLXA 4ER9A 3U5SA 1ORSC 1ST6A 2WZLA 3MYFA 4JEBA 4R32A 2LFFA 4CIPA 4CSAC 1QPUA 2OQMA 2P7VA 2RSEB 1SF8A 4IGGA 2I15A 3E9VA 1LI5A 5KYXB 2FGYA 3RKOF 4U5HA 2EPOA 4O7GA 2YEVA 3GEEA 3GWLA 4O6YA 2Y39A 3U9JA 1LS4A 2CNWA 1JOGA 2A6EF 2L81A 2KC3A 3FXHA 4MNDA 5EGYA 3RQGA 2CYDA 3QW0A 2ETSA 5L0FA 3I5QA 3EQLF 3GWNA 4I1MA 5KYYB 5F28E 1E84A 2WVNA 1BR1A 2YWAA 4PJMA 1Z23A 1LKXA 1I5NA 1NZEA 5JSLA 3DXJF 4XTKA 3UMKA 3SP1A 4YL1A 3TJ6A 1RKEB 1D0ZA 3C8ZA 3K1IA 3AJMA 2NPUA 2VH3A 3RH3A 4DJ9A 1EQ1A 1NFNA 4Q4ZF 2HS5A 1K05A 1ZHXA 4P6IC 1R5ID 4MW8A 3U2MA 4YWQA 5DQZA 4CJGA 2HJMA 2LK4A 4CS7A 4PK4A 2YQYA 3EGDB 3AOUA 1OR2A 4BEMJ 4EIYA 3EHNA 4C3DA 3MLGA 1ZHYA 2GWWA 3DAFA 4U5CE 5JLIA 1RMVA 3NDBB 3JCUQ 3T4RA 2EINC 5DS6A 2Q7RA 1KU2A 3BRJA 4FESA 2OJQA 1I4ZA 2P1AA 3HKKA 1D0YA 3NMIA 4XEKA 2EIMC 1H7IA 3T6GB 5BUOA 1YZCA 3W8IA 2J8WA 2HSBA 1J8YF 3L1MA 3HJCA 5B1AC 3X2QC 4E17A 3N0TA 1ZW3A 2W9YA 4U5DE 2AP3A 2IBFA 2CGEA 1E83A 3AG2C 3MX3A 4PACA 3GEHA 2IXOA 1WWPA 2L6GA 3KYJA 5KYWB 4G7HF 1G5ZA 3CQZA 3GANA 3Q7GA 2MWQA 2ZXWC 3IQCA 1VLSA 2IOQA 3DE8A 4C7OA 3N24A 2R05A 1A7EA 2YRFA 1OCRC 1JR8A 4IRUA 3UNGC 4BJTA 1RJ9A 2Z15A 3EFOA 3K66A 5EK0A 3DMDA 3CZ6A 4NTFA 4J7YA 3RW0A 1CGME 3LLIA 2R25A 3LESA 1PD0A 3F47A 3BEHA 1CGOA 3HNIA 3U3BA 3ZTMA 3M4CA 3RVZA 4JVSA 2PFDA 4ZLCA 3SEOA 1W2WA 3NKEA 2J9BA 4H4KC 4QI0A 4YT5A 3ZQYA 1ORYA 4CS8C 3OEOA 4PFOA 2J7PD 3WODF 3LUTB 3UR3C 3DI5A 4GEHA 3V5ZA 3KL4A 2UUHA 2LQGA 4LLCA 4EBKA 2Q9BA 2JX0A 2ZXPA 5HSWA 3FDQA 2CCYA 1AEPA 1Z63A 2LCHA 3GM1A 5B3IA 2TMVP 1V4AA 2WL8A 3Q6MA 4CDYA 1LE4A 4M63A 1E86A 3S90A 1YDIA 2Q00A 1K40A 4RDAA 3DJNB 4EHPA 1YYXA 5COMA 1HW1A 5A6JA 1R4TA 2KYHA 3W8HA 4CS8A 3HNLA 3K1HA 4OINF 3SYNA 3GM3A 5L0GA 3X1OA 3C8GD 2HZ8A 4O6MA 2ZPAA 5CI9A 3HNJA 4F4BA 2XL4A 1E2XA 2Y3HA 4K7BA 1GQAA 1T9KA 3LLKA 4DOZA 4QI2A 1CPQA 3E70C 2EILC 4LERA 4PJNA 4G7ZF 4OD5A 3ASNC 2GFHA 1S05A 2EPLX 2NUPB 2DYSC 3OA1A 4XPXA 1U0BB 4CS9C 4NCQA 3S0XA 2R7WA 4G78A 3ZDLA 3K7DA 1T6QA 2CNWD 1G4WR 3FVYA 4YL3A 4XLPF 4C3BA 1ZYRF 2YHSA 1BR4A 4U9EA 5DS4A 4AL0A 4K0DA 5E3CA 3DAGA 1PV3A 1YJGA 3I5PA 1FTSA 2HJ3A 3S9OA 2P61A 2XLMA 1Z6AA 2ZXRA 1QSPA 2Q9CA 2PX0A 2XLHA 4JC7A 4U5GA 4OIRF 2WVOA 4JTCB 1Q0MA 2Q4FA 4MVOA 4XWJA 3ZIBA 5B3SC 4H54A 4U5BE 2V26A 1RXQA 1MMAA 2R7XA 1TFOB 4NC3A 4XEVA 4CS9A 4AL1A 1SR2A 3C8GA 4O79A 4XQ1A 3EGXA 4DBQA 3JYHA 3PMRA 3QW1A 4CJOA 5TJ5E 3QZCA 4JE9A 2R03A 1Q0DA 2XS8A 1Q0FA 4I44A 5E2QA 1T5OA 5JP7A 1NSGB 1SMYF 2O9XA 2J0XA 3I4UA 1J8MF 1M2VA 4MVZA 4U5EE 4ULWA 1GS9A 1MMGA 1OCCC 1Q0GA 4NQFA 1FR0A 5DVWA 4YN0B 5GPGB 1CPRA 1H9TA 2Y3GA 3SXKA 3SXYA 1MNDA 3B71A 4XPWA 4MS2A 3H2VA 4JRZA 1QLEC 2Y69C 1AVOB 2HMZA 4WABA 2ICWG 1LS1A 2H8AA 3IPMO 2XXAA 3W4YA 4AE4B 5JVEA 1RCPA 2FAPB 3KH2A 5FCLA 5E3AA 2QNLA 2GAQA 2QY9A 3KPHA 4E18A 4BJ1A 5A6KA 4YJWA 3L8JA 4MVQA 4ONSA 4UDVA 5FZTA 1GGQA 2VCBA 3JYYA 3US6A 4CSAA 2LIGA 5T1DB 2J46A 4CX9A 4KNVA 1JPNA 5AGFA 1YA9A 3GORA 3VRCA 2H7VC 4Z9JA 4KI2A 4MW3A 3EH2A 5L0JA 4XEFA 4OD4A 1M6TA 4JKVA 1JMWA 4YT2A 1IZMA 1D1CA 3RF3A 4PR9A 4RBNA 1OW8A 3EG9B 4YT8A 1YLMA 1NG1A 2KW3C 1YARO 4KC9A 1GM5A 2A0UA 3B0UX 2P6VA 2EPNA 4YK5A 2AWYA 3EGXB 2OG2A 1U89A 3FAJA 3KKBA 1ZU4A 256BA 2BC5A 4P9TA 3JT1A 4B6IA 5CIVA 2HV6A 3M79A 3RFYA 3T6BA 3QVZA 2PNOA 4IAOA 3TULA 3G4XA 1K04A 1M2OA 3CEXA 4EKWA 1IW7F 1APCA 2EPMX 2HV7A 2XRHA 3S29A 3ZSUA 2OEXA 2XLOA 5T3TA 3QTHA 2YZSA 4LDKA 4MVSA 2C04A 4MVMA 3DM5A 4ULVA 2KJGA 5L0HA 3AQCA 1ZZPA 3NYJA 3JRTA 4HFFB 3W2WA 1EA8A 3K33A 1HY5A 3U8VA 1HE9A 2A69F 2HMQA 1LVKA 1U6HA 3WHNA 1O5HA 2NSFA 2W4BA 1MNEA 4WGYA 2XLWA 2VCAA 3MBGA 4JJGA 5B1BC 5JRAA 2M64A 3C63A 2J0WA 3L8IA 2WZFA 2M4EA 3AG3C 2KNHA 2PP4A 3T6JA 3V5YA 3VM6A 5F5FA 5E33A 4K1OA 1OCZC 1V55C 1L3PA 2OOCA 2WB7A 4MVUA 3TK0A 2FFHA 2XSEA 1S7ZA 1BR2A 1VK5A 3C7JA 4X0RA 3V7OA 4PFPA 4ANJA 2YVKA 4YL0A 4JTAB 1TWHA 4GYTA 2QE9A 1VMAA 1FMVA 3F46A 3O6XA 3UGPA 3ABMC 1H9GA 2R7UA 2YLDA 3N2ZB 5IY5C 4IB4A 2A0BA 1OKKD 1O87A 5K0IA 4MTOA 4LDQA 4E0IA 4DRIB 2IM8A 4FX5A 2JD3A 4HFKB 2G3KA 2H7BA 2J9WA 2XLVA 2Y3BA 3IQ5A 5D92A 4Z9IA 4LDRA 1VYKA 2E87A 4J32B 2NUTA 4EBJA 4W8KA 5EHHA 1WATA 3DM9B 1T01A 3VF0A 2PX3A 3HLZA 3ZQVA 1T6IA 3CSKA 1TWAA 4C7OB 1Y6DA 2X0CA 1HE1A 3FAPB 2AWCA 3NMJA 4DBRA 2IXPA 1RJ9B 2Q3TA 3EFOB 1Z3IX 3LNRA 3RQEA 1DOWA 2C03A 3DZAA 1XZQA 1SYQA 4JCHA 1E85A 3DKAA 5KYNA 2QUPA 2YKZA 5F5HA 2R7QA 1UG7A 3RVYA 4EBBA 3B0PA 2Y3DA 4YT4A 1ZU5A 1G4US 2AU5A 4Q7CA 2B0JA 1N1CA 2JPUA 2P0NA 3Q7LA 4KNWA 2L6FA 4W8PA 2R7OA 3AGUA 3QVYA 1Z7Qc 2A6HF 4JJFA 1OKKA 3NRHA 1D1BA 3R2PA 3U8PA 3ZTZA 3SNHA 3H2UA 3ITFA 1FFHA 1D0XA 3RQFA 3ATPA 3NYMA 3LAYA 4A2NB 3WG7C 2QLAA 3J06A 3NMKA 1C17M 3JSZA 4CDVA 2HFIA 3VYWA 1KTMA 4NTAA 3PDMP 5JT4A 4OIPF 4G0HA 4LACB 5L0DA 4MTGA 3A9CA 2R7TA 2HUJA 2D4UA 1RKEA 3IQ6A 2KK1A 3LEOA 4MVRA 2BE5F 2F22A 4IARA 5A69A 1VTMP 2HKVA 1LPEA 1WASA 2A68F 1OW7A 3AGTA 2OCCC 1NU9C 5BQIA 1ZHWA 2XM4A 4JTDB 3ZG1A 2XS1A 1OXBA 1YA7O 3MFNA 2LD6A 3SZRA 3EGDA 1TWCA 1Q0KA 1TQGA 4Z9HA 3LS0A 3S27A 3KYIA 5DQTA 1MMNA 2CW0F 4AK9A 1WGWA 4D4XA 4DXWA 1BZ4A 1PCXA 3VAYA 1Z5ZA 3DJUB 1AUEA 3HTKC 1VOMA 3M15A 3POVA 1I4YA 4IJJA 1FMWA 3ZVRA 2R9RB 2VASA 3EHMA 2MYSA 2LFDA 1XZPA 3B9QA 2OEVA 3IHUA 3ZWIA 4HE8D 1EKYA 1CGNA 3U0CA 4WGZA 1V54C 2J9UA 4I3MA 4MTFA 3WAQA 2G3VA 1KNYA 4OIQF 1TR2A 3JSEO 4EWCA 2R7RA 1YAUO 5KYWA 2W45A 1LIHA 1XWJA 1HMDA 3NG1A 4N6HA 2H7OA 1BDJB 4E7ZA 1QVXA 5JS5A 1OCOC 1YVIA 3GEIA 1PD1A 1TFKB 3M1CB 5BQHA 2A1DD 4LLEA 3EZHA 3RYLA 3GM2A 3FHDA 3L34A 3EPVA 2XL8A 3G4ZA 4N06A 3C8GB 5L0IA 3TOMA 1DOVA 3RIPA 2ZD9A 1H6GA 3AQBA 4PJJA 4CBEA 1OQCA 2AVKA 5COGA 4XLNF 1QZXA 3SXZA 3TD7A 3B29A 4J7TA 5AC5A 2V3CC 1M2VB 1VB5A 1NU7D 2DI3A 3ABKC 2UUIA 5D91A 4C3EA 1RKCA 2L7AA 2OU6A 2W4MA 1V74B 3R7CA 2EIKC 5L0CA 3JRMO 4FWVA 4BPMA 3LEVA 2R02A 3Q6NA 1B68A 5DS5A 2IYLD 5HV9A 3MYIA 2L6HA 2R7VA 1A7DA 2GA0A 2XXAB 1WTYA 3T9OA 1OXKA 1NBBA 4KBLA 1Y4CA 3ABLC 3K6BA 4IAQA 4DVZA 4BG0A 2OJED 2PBEA 1A0BA 1LE2A 3DE9A 2YL7A 3HNKA 4E0HA 2J45A 2VC9A 1ORJA 2NG1A 2WZGA 3L0IA 4NY3A 2XLDA 4J30B 5A6AA 4Q5SF 3IEEA 3NYLA 3UMHA 4EUKB 4WJ0A 2RD9A 2PF4E 3G50A 2ASRA 4XPYA 2YL3A 4N4WA 5KYUA 4NTBA 1YYJA 2KGOA 3LNMB 4CIHA 1WOLA 1QKRA 2DGJA 3M4BA 3H65A 1L7CA 3JZ0A 2NUPA 2R7SA 5JUAA 5AC4A 1FFTC 2MHRA 2VCCA 2BL2A 3W2VA 3S28A 1SZIA 1C02A 3GODA 1MMDA 1OR3A 4BEJA 2X51A 1HMOA 2OKUA 3C18A 4U9DA 4JZAA 5A6BD 3QMKA 2GDCA 5KYUB 1FNTc 3U9MA 3O10A 4IWBA 1TKNA 2YL1A 3CAXA 3ECSA 3AG1C 5COFA 5CI8A 2QTVA 1VYIA 3TJ5A 2D5RB 4QDLA 5BQGA 1NFOA 4OIOF 1LI7A 4FAPB 4U5FE 1O3UA 1C03A 1JRAA 1FAPB 4RD9A 2XLEA 2CDQA 2I8BA 3JTLO 1BBHA 2EPKX 2XM0A 4G7OF 1JAFA 4A4AA 3EH1A 3LJBA 4DVYP 1D1AA 2EIJC 5KYXA 2KQ9A 4JEAA 3DWWA 2L9JA 3A11A 3UMIA 4PJLA 3LS1A 3EZIA 4BJ5C 2HSQA 2DYRC 1JPJA 2ZXOA 4N6CA 2NSGA 2WVQA 3S84A 4GQHA 4CDAA 1YZAA 4I1OB 1VLTA 2G62A 2LSEA 2YL0A 4BJ6C 1F1MA 4P9FA 4JURI 1ZVZA 3UGOA 5KYYA 1ZHTA 4MQ9F 3FOOA 2J7PA 4D4NA 5A6BA 3NKDA 3TQOA 4AE4A 5L3QA 3SXMA 2LP4A 1MQVA 3OWTA
chains in the Genus database with same CATH topology
4LDKA 1JR8A 3GWLA 1JRAA 3LLIA 3GWNA 4E0IA 2HJ3A 3MBGA 3W4YA 4E0HA 3TK0A 1OQCA 3TD7A 3LLKA 3U2LA 3O55A 3U2MA 3U5SA 3R7CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LDK A;  1JR8 A;  3GWL A;  1JRA A;  3LLI A;  3GWN A;  4E0I A;  2HJ3 A;  3MBG A;  3W4Y A;  4E0H A;  3TK0 A;  1OQC A;  3TD7 A;  3LLK A;  3U2L A;  3O55 A;  3U2M A;  3U5S A;  3R7C A; 
#chains in the Genus database with same CATH topology
 3O39 A;  3B0V C;  3FMS A;  1TWG A;  3ASO C;  2IXM A;  3IQT A;  3KMI A;  1ZW2 A;  2Q9A A;  4DRJ B;  4L6R A;  2XL6 A;  2KSF A;  1G8X A;  3PCV A;  1HW2 A;  4JW1 A;  1A41 A;  2NUT B;  1QQ3 A;  1EI7 A;  4O6N A;  1A7V A;  1OW6 A;  4BJ5 A;  4JCZ A;  4HEA J;  2B0H A;  3FOP A;  1T6U A;  5T3W A;  2DB4 A;  3U3F A;  2VB6 A;  3EJN A;  4JIO A;  1M56 C;  3TOL A;  4BJ6 A;  3V5X A;  1M57 C;  3DD7 A;  3AG4 C;  4DRH B;  1UFB A;  1WN0 A;  2IXN A;  3EG9 A;  2YLI A;  1ZHZ A;  4AX2 A;  2YLG A;  3ZC4 A;  5DLJ A;  2J9V A;  3PHF 2;  4ZLD A;  1LM3 B;  5L3V A;  3U2L A;  4E7S A;  3C62 A;  3K1I C;  3O55 A;  1NLX A;  4ER9 A;  3U5S A;  1ORS C;  1ST6 A;  2WZL A;  3MYF A;  4JEB A;  4R32 A;  2LFF A;  4CIP A;  4CSA C;  1QPU A;  2OQM A;  2P7V A;  2RSE B;  1SF8 A;  4IGG A;  2I15 A;  3E9V A;  1LI5 A;  5KYX B;  2FGY A;  3RKO F;  4U5H A;  2EPO A;  4O7G A;  2YEV A;  3GEE A;  3GWL A;  4O6Y A;  2Y39 A;  3U9J A;  1LS4 A;  2CNW A;  1JOG A;  2A6E F;  2L81 A;  2KC3 A;  3FXH A;  4MND A;  5EGY A;  3RQG A;  2CYD A;  3QW0 A;  2ETS A;  5L0F A;  3I5Q A;  3EQL F;  3GWN A;  4I1M A;  5KYY B;  5F28 E;  1E84 A;  2WVN A;  1BR1 A;  2YWA A;  4PJM A;  1Z23 A;  1LKX A;  1I5N A;  1NZE A;  5JSL A;  3DXJ F;  4XTK A;  3UMK A;  3SP1 A;  4YL1 A;  3TJ6 A;  1RKE B;  1D0Z A;  3C8Z A;  3K1I A;  3AJM A;  2NPU A;  2VH3 A;  3RH3 A;  4DJ9 A;  1EQ1 A;  1NFN A;  4Q4Z F;  2HS5 A;  1K05 A;  1ZHX A;  4P6I C;  1R5I D;  4MW8 A;  3U2M A;  4YWQ A;  5DQZ A;  4CJG A;  2HJM A;  2LK4 A;  4CS7 A;  4PK4 A;  2YQY A;  3EGD B;  3AOU A;  1OR2 A;  4BEM J;  4EIY A;  3EHN A;  4C3D A;  3MLG A;  1ZHY A;  2GWW A;  3DAF A;  4U5C E;  5JLI A;  1RMV A;  3NDB B;  3JCU Q;  3T4R A;  2EIN C;  5DS6 A;  2Q7R A;  1KU2 A;  3BRJ A;  4FES A;  2OJQ A;  1I4Z A;  2P1A A;  3HKK A;  1D0Y A;  3NMI A;  4XEK A;  2EIM C;  1H7I A;  3T6G B;  5BUO A;  1YZC A;  3W8I A;  2J8W A;  2HSB A;  1J8Y F;  3L1M A;  3HJC A;  5B1A C;  3X2Q C;  4E17 A;  3N0T A;  1ZW3 A;  2W9Y A;  4U5D E;  2AP3 A;  2IBF A;  2CGE A;  1E83 A;  3AG2 C;  3MX3 A;  4PAC A;  3GEH A;  2IXO A;  1WWP A;  2L6G A;  3KYJ A;  5KYW B;  4G7H F;  1G5Z A;  3CQZ A;  3GAN A;  3Q7G A;  2MWQ A;  2ZXW C;  3IQC A;  1VLS A;  2IOQ A;  3DE8 A;  4C7O A;  3N24 A;  2R05 A;  1A7E A;  2YRF A;  1OCR C;  1JR8 A;  4IRU A;  3UNG C;  4BJT A;  1RJ9 A;  2Z15 A;  3EFO A;  3K66 A;  5EK0 A;  3DMD A;  3CZ6 A;  4NTF A;  4J7Y A;  3RW0 A;  1CGM E;  3LLI A;  2R25 A;  3LES A;  1PD0 A;  3F47 A;  3BEH A;  1CGO A;  3HNI A;  3U3B A;  3ZTM A;  3M4C A;  3RVZ A;  4JVS A;  2PFD A;  4ZLC A;  3SEO A;  1W2W A;  3NKE A;  2J9B A;  4H4K C;  4QI0 A;  4YT5 A;  3ZQY A;  1ORY A;  4CS8 C;  3OEO A;  4PFO A;  2J7P D;  3WOD F;  3LUT B;  3UR3 C;  3DI5 A;  4GEH A;  3V5Z A;  3KL4 A;  2UUH A;  2LQG A;  4LLC A;  4EBK A;  2Q9B A;  2JX0 A;  2ZXP A;  5HSW A;  3FDQ A;  2CCY A;  1AEP A;  1Z63 A;  2LCH A;  3GM1 A;  5B3I A;  2TMV P;  1V4A A;  2WL8 A;  3Q6M A;  4CDY A;  1LE4 A;  4M63 A;  1E86 A;  3S90 A;  1YDI A;  2Q00 A;  1K40 A;  4RDA A;  3DJN B;  4EHP A;  1YYX A;  5COM A;  1HW1 A;  5A6J A;  1R4T A;  2KYH A;  3W8H A;  4CS8 A;  3HNL A;  3K1H A;  4OIN F;  3SYN A;  3GM3 A;  5L0G A;  3X1O A;  3C8G D;  2HZ8 A;  4O6M A;  2ZPA A;  5CI9 A;  3HNJ A;  4F4B A;  2XL4 A;  1E2X A;  2Y3H A;  4K7B A;  1GQA A;  1T9K A;  3LLK A;  4DOZ A;  4QI2 A;  1CPQ A;  3E70 C;  2EIL C;  4LER A;  4PJN A;  4G7Z F;  4OD5 A;  3ASN C;  2GFH A;  1S05 A;  2EPL X;  2NUP B;  2DYS C;  3OA1 A;  4XPX A;  1U0B B;  4CS9 C;  4NCQ A;  3S0X A;  2R7W A;  4G78 A;  3ZDL A;  3K7D A;  1T6Q A;  2CNW D;  1G4W R;  3FVY A;  4YL3 A;  4XLP F;  4C3B A;  1ZYR F;  2YHS A;  1BR4 A;  4U9E A;  5DS4 A;  4AL0 A;  4K0D A;  5E3C A;  3DAG A;  1PV3 A;  1YJG A;  3I5P A;  1FTS A;  2HJ3 A;  3S9O A;  2P61 A;  2XLM A;  1Z6A A;  2ZXR A;  1QSP A;  2Q9C A;  2PX0 A;  2XLH A;  4JC7 A;  4U5G A;  4OIR F;  2WVO A;  4JTC B;  1Q0M A;  2Q4F A;  4MVO A;  4XWJ A;  3ZIB A;  5B3S C;  4H54 A;  4U5B E;  2V26 A;  1RXQ A;  1MMA A;  2R7X A;  1TFO B;  4NC3 A;  4XEV A;  4CS9 A;  4AL1 A;  1SR2 A;  3C8G A;  4O79 A;  4XQ1 A;  3EGX A;  4DBQ A;  3JYH A;  3PMR A;  3QW1 A;  4CJO A;  5TJ5 E;  3QZC A;  4JE9 A;  2R03 A;  1Q0D A;  2XS8 A;  1Q0F A;  4I44 A;  5E2Q A;  1T5O A;  5JP7 A;  1NSG B;  1SMY F;  2O9X A;  2J0X A;  3I4U A;  1J8M F;  1M2V A;  4MVZ A;  4U5E E;  4ULW A;  1GS9 A;  1MMG A;  1OCC C;  1Q0G A;  4NQF A;  1FR0 A;  5DVW A;  4YN0 B;  5GPG B;  1CPR A;  1H9T A;  2Y3G A;  3SXK A;  3SXY A;  1MND A;  3B71 A;  4XPW A;  4MS2 A;  3H2V A;  4JRZ A;  1QLE C;  2Y69 C;  1AVO B;  2HMZ A;  4WAB A;  2ICW G;  1LS1 A;  2H8A A;  3IPM O;  2XXA A;  3W4Y A;  4AE4 B;  5JVE A;  1RCP A;  2FAP B;  3KH2 A;  5FCL A;  5E3A A;  2QNL A;  2GAQ A;  2QY9 A;  3KPH A;  4E18 A;  4BJ1 A;  5A6K A;  4YJW A;  3L8J A;  4MVQ A;  4ONS A;  4UDV A;  5FZT A;  1GGQ A;  2VCB A;  3JYY A;  3US6 A;  4CSA A;  2LIG A;  5T1D B;  2J46 A;  4CX9 A;  4KNV A;  1JPN A;  5AGF A;  1YA9 A;  3GOR A;  3VRC A;  2H7V C;  4Z9J A;  4KI2 A;  4MW3 A;  3EH2 A;  5L0J A;  4XEF A;  4OD4 A;  1M6T A;  4JKV A;  1JMW A;  4YT2 A;  1IZM A;  1D1C A;  3RF3 A;  4PR9 A;  4RBN A;  1OW8 A;  3EG9 B;  4YT8 A;  1YLM A;  1NG1 A;  2KW3 C;  1YAR O;  4KC9 A;  1GM5 A;  2A0U A;  3B0U X;  2P6V A;  2EPN A;  4YK5 A;  2AWY A;  3EGX B;  2OG2 A;  1U89 A;  3FAJ A;  3KKB A;  1ZU4 A;  256B A;  2BC5 A;  4P9T A;  3JT1 A;  4B6I A;  5CIV A;  2HV6 A;  3M79 A;  3RFY A;  3T6B A;  3QVZ A;  2PNO A;  4IAO A;  3TUL A;  3G4X A;  1K04 A;  1M2O A;  3CEX A;  4EKW A;  1IW7 F;  1APC A;  2EPM X;  2HV7 A;  2XRH A;  3S29 A;  3ZSU A;  2OEX A;  2XLO A;  5T3T A;  3QTH A;  2YZS A;  4LDK A;  4MVS A;  2C04 A;  4MVM A;  3DM5 A;  4ULV A;  2KJG A;  5L0H A;  3AQC A;  1ZZP A;  3NYJ A;  3JRT A;  4HFF B;  3W2W A;  1EA8 A;  3K33 A;  1HY5 A;  3U8V A;  1HE9 A;  2A69 F;  2HMQ A;  1LVK A;  1U6H A;  3WHN A;  1O5H A;  2NSF A;  2W4B A;  1MNE A;  4WGY A;  2XLW A;  2VCA A;  3MBG A;  4JJG A;  5B1B C;  5JRA A;  2M64 A;  3C63 A;  2J0W A;  3L8I A;  2WZF A;  2M4E A;  3AG3 C;  2KNH A;  2PP4 A;  3T6J A;  3V5Y A;  3VM6 A;  5F5F A;  5E33 A;  4K1O A;  1OCZ C;  1V55 C;  1L3P A;  2OOC A;  2WB7 A;  4MVU A;  3TK0 A;  2FFH A;  2XSE A;  1S7Z A;  1BR2 A;  1VK5 A;  3C7J A;  4X0R A;  3V7O A;  4PFP A;  4ANJ A;  2YVK A;  4YL0 A;  4JTA B;  1TWH A;  4GYT A;  2QE9 A;  1VMA A;  1FMV A;  3F46 A;  3O6X A;  3UGP A;  3ABM C;  1H9G A;  2R7U A;  2YLD A;  3N2Z B;  5IY5 C;  4IB4 A;  2A0B A;  1OKK D;  1O87 A;  5K0I A;  4MTO A;  4LDQ A;  4E0I A;  4DRI B;  2IM8 A;  4FX5 A;  2JD3 A;  4HFK B;  2G3K A;  2H7B A;  2J9W A;  2XLV A;  2Y3B A;  3IQ5 A;  5D92 A;  4Z9I A;  4LDR A;  1VYK A;  2E87 A;  4J32 B;  2NUT A;  4EBJ A;  4W8K A;  5EHH A;  1WAT A;  3DM9 B;  1T01 A;  3VF0 A;  2PX3 A;  3HLZ A;  3ZQV A;  1T6I A;  3CSK A;  1TWA A;  4C7O B;  1Y6D A;  2X0C A;  1HE1 A;  3FAP B;  2AWC A;  3NMJ A;  4DBR A;  2IXP A;  1RJ9 B;  2Q3T A;  3EFO B;  1Z3I X;  3LNR A;  3RQE A;  1DOW A;  2C03 A;  3DZA A;  1XZQ A;  1SYQ A;  4JCH A;  1E85 A;  3DKA A;  5KYN A;  2QUP A;  2YKZ A;  5F5H A;  2R7Q A;  1UG7 A;  3RVY A;  4EBB A;  3B0P A;  2Y3D A;  4YT4 A;  1ZU5 A;  1G4U S;  2AU5 A;  4Q7C A;  2B0J A;  1N1C A;  2JPU A;  2P0N A;  3Q7L A;  4KNW A;  2L6F A;  4W8P A;  2R7O A;  3AGU A;  3QVY A;  1Z7Q c;  2A6H F;  4JJF A;  1OKK A;  3NRH A;  1D1B A;  3R2P A;  3U8P A;  3ZTZ A;  3SNH A;  3H2U A;  3ITF A;  1FFH A;  1D0X A;  3RQF A;  3ATP A;  3NYM A;  3LAY A;  4A2N B;  3WG7 C;  2QLA A;  3J06 A;  3NMK A;  1C17 M;  3JSZ A;  4CDV A;  2HFI A;  3VYW A;  1KTM A;  4NTA A;  3PDM P;  5JT4 A;  4OIP F;  4G0H A;  4LAC B;  5L0D A;  4MTG A;  3A9C A;  2R7T A;  2HUJ A;  2D4U A;  1RKE A;  3IQ6 A;  2KK1 A;  3LEO A;  4MVR A;  2BE5 F;  2F22 A;  4IAR A;  5A69 A;  1VTM P;  2HKV A;  1LPE A;  1WAS A;  2A68 F;  1OW7 A;  3AGT A;  2OCC C;  1NU9 C;  5BQI A;  1ZHW A;  2XM4 A;  4JTD B;  3ZG1 A;  2XS1 A;  1OXB A;  1YA7 O;  3MFN A;  2LD6 A;  3SZR A;  3EGD A;  1TWC A;  1Q0K A;  1TQG A;  4Z9H A;  3LS0 A;  3S27 A;  3KYI A;  5DQT A;  1MMN A;  2CW0 F;  4AK9 A;  1WGW A;  4D4X A;  4DXW A;  1BZ4 A;  1PCX A;  3VAY A;  1Z5Z A;  3DJU B;  1AUE A;  3HTK C;  1VOM A;  3M15 A;  3POV A;  1I4Y A;  4IJJ A;  1FMW A;  3ZVR A;  2R9R B;  2VAS A;  3EHM A;  2MYS A;  2LFD A;  1XZP A;  3B9Q A;  2OEV A;  3IHU A;  3ZWI A;  4HE8 D;  1EKY A;  1CGN A;  3U0C A;  4WGZ A;  1V54 C;  2J9U A;  4I3M A;  4MTF A;  3WAQ A;  2G3V A;  1KNY A;  4OIQ F;  1TR2 A;  3JSE O;  4EWC A;  2R7R A;  1YAU O;  5KYW A;  2W45 A;  1LIH A;  1XWJ A;  1HMD A;  3NG1 A;  4N6H A;  2H7O A;  1BDJ B;  4E7Z A;  1QVX A;  5JS5 A;  1OCO C;  1YVI A;  3GEI A;  1PD1 A;  1TFK B;  3M1C B;  5BQH A;  2A1D D;  4LLE A;  3EZH A;  3RYL A;  3GM2 A;  3FHD A;  3L34 A;  3EPV A;  2XL8 A;  3G4Z A;  4N06 A;  3C8G B;  5L0I A;  3TOM A;  1DOV A;  3RIP A;  2ZD9 A;  1H6G A;  3AQB A;  4PJJ A;  4CBE A;  1OQC A;  2AVK A;  5COG A;  4XLN F;  1QZX A;  3SXZ A;  3TD7 A;  3B29 A;  4J7T A;  5AC5 A;  2V3C C;  1M2V B;  1VB5 A;  1NU7 D;  2DI3 A;  3ABK C;  2UUI A;  5D91 A;  4C3E A;  1RKC A;  2L7A A;  2OU6 A;  2W4M A;  1V74 B;  3R7C A;  2EIK C;  5L0C A;  3JRM O;  4FWV A;  4BPM A;  3LEV A;  2R02 A;  3Q6N A;  1B68 A;  5DS5 A;  2IYL D;  5HV9 A;  3MYI A;  2L6H A;  2R7V A;  1A7D A;  2GA0 A;  2XXA B;  1WTY A;  3T9O A;  1OXK A;  1NBB A;  4KBL A;  1Y4C A;  3ABL C;  3K6B A;  4IAQ A;  4DVZ A;  4BG0 A;  2OJE D;  2PBE A;  1A0B A;  1LE2 A;  3DE9 A;  2YL7 A;  3HNK A;  4E0H A;  2J45 A;  2VC9 A;  1ORJ A;  2NG1 A;  2WZG A;  3L0I A;  4NY3 A;  2XLD A;  4J30 B;  5A6A A;  4Q5S F;  3IEE A;  3NYL A;  3UMH A;  4EUK B;  4WJ0 A;  2RD9 A;  2PF4 E;  3G50 A;  2ASR A;  4XPY A;  2YL3 A;  4N4W A;  5KYU A;  4NTB A;  1YYJ A;  2KGO A;  3LNM B;  4CIH A;  1WOL A;  1QKR A;  2DGJ A;  3M4B A;  3H65 A;  1L7C A;  3JZ0 A;  2NUP A;  2R7S A;  5JUA A;  5AC4 A;  1FFT C;  2MHR A;  2VCC A;  2BL2 A;  3W2V A;  3S28 A;  1SZI A;  1C02 A;  3GOD A;  1MMD A;  1OR3 A;  4BEJ A;  2X51 A;  1HMO A;  2OKU A;  3C18 A;  4U9D A;  4JZA A;  5A6B D;  3QMK A;  2GDC A;  5KYU B;  1FNT c;  3U9M A;  3O10 A;  4IWB A;  1TKN A;  2YL1 A;  3CAX A;  3ECS A;  3AG1 C;  5COF A;  5CI8 A;  2QTV A;  1VYI A;  3TJ5 A;  2D5R B;  4QDL A;  5BQG A;  1NFO A;  4OIO F;  1LI7 A;  4FAP B;  4U5F E;  1O3U A;  1C03 A;  1JRA A;  1FAP B;  4RD9 A;  2XLE A;  2CDQ A;  2I8B A;  3JTL O;  1BBH A;  2EPK X;  2XM0 A;  4G7O F;  1JAF A;  4A4A A;  3EH1 A;  3LJB A;  4DVY P;  1D1A A;  2EIJ C;  5KYX A;  2KQ9 A;  4JEA A;  3DWW A;  2L9J A;  3A11 A;  3UMI A;  4PJL A;  3LS1 A;  3EZI A;  4BJ5 C;  2HSQ A;  2DYR C;  1JPJ A;  2ZXO A;  4N6C A;  2NSG A;  2WVQ A;  3S84 A;  4GQH A;  4CDA A;  1YZA A;  4I1O B;  1VLT A;  2G62 A;  2LSE A;  2YL0 A;  4BJ6 C;  1F1M A;  4P9F A;  4JUR I;  1ZVZ A;  3UGO A;  5KYY A;  1ZHT A;  4MQ9 F;  3FOO A;  2J7P A;  4D4N A;  5A6B A;  3NKD A;  3TQO A;  4AE4 A;  5L3Q A;  3SXM A;  2LP4 A;  1MQV A;  3OWT A; 
#chains in the Genus database with same CATH homology
 4LDK A;  1JR8 A;  3GWL A;  1JRA A;  3LLI A;  3GWN A;  4E0I A;  2HJ3 A;  3MBG A;  3W4Y A;  4E0H A;  3TK0 A;  1OQC A;  3TD7 A;  3LLK A;  3U2L A;  3O55 A;  3U2M A;  3U5S A;  3R7C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...