3R7CA

The structure of a hexahestidine-tagged form of augmenter of liver regeneration reveals a novel cd(2)cl(4)o(6) cluster that aids in crystal packing
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
111
structure length
111
Chain Sequence
DCPQDREELGRNTWAFLHTLAAYYPDMPTPEQQQDMAQFIHIFSKFYPCEECAEDIRKRIDRSQPDTSTRVSFSQWLCRLHNEVNRKLGKPDFDCSRVDERWRDGWKDGSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of a hexahestidine-tagged form of augmenter of liver regeneration reveals a novel Cd(2)Cl(4)O(6) cluster that aids in crystal packing
rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
molecule keywords FAD-linked sulfhydryl oxidase ALR
total genus 40
structure length 111
sequence length 111
chains with identical sequence B, C, D
ec nomenclature ec 1.8.3.2: Thiol oxidase.
pdb deposition date 2011-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04777 Evr1_Alr Erv1 / Alr family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.310 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) ERV/ALR sulfhydryl oxidase domain 3r7cA00
3MBGA 3GWNA 3LLKA 3R7CA 1OQCA 3U2LA 4LDKA 3U2MA 1JRAA 3U5SA 3O55A 4E0IA 1JR8A 3W4YA 3TK0A 3TD7A 3LLIA 2HJ3A 3GWLA 4E0HA
chains in the Genus database with same CATH superfamily
2DB4A 5CI8A 3CQZA 1CGNA 4O79A 5JUAA 1ZVZA 1XZQA 3MFNA 1L7CA 2YKZA 3RKOF 1MMNA 2IXMA 3EGXA 3LESA 1UG7A 2R7OA 1Q0KA 1YZCA 1YLMA 1J8YF 1H9GA 3K7DA 4MVOA 3B71A 4U5GA 1PD1A 1Z23A 3C63A 3HKKA 3RFYA 4ZLCA 4G7OF 2CDQA 3RYLA 1F1MA 1Z6AA 3C8GB 3DAGA 3K66A 2PBEA 2TMVP 1Q0MA 4XEKA 4OIQF 1ORYA 3O55A 5GPGB 1MMDA 3NYJA 3LNMB 2IXNA 1EQ1A 2XLEA 2OCCC 2XLMA 4AE4B 3S90A 2A6EF 3WODF 3ZIBA 2WL8A 3PCVA 2AWCA 4NTBA 4BEJA 4I1OB 4XWJA 3EQLF 1OCOC 1QPUA 1RKEB 1VYIA 1VK5A 2AVKA 4CX9A 4EBJA 3KKBA 3U5SA 3L1MA 3QZCA 3EPVA 2H7OA 1KNYA 3AGTA 2G3KA 2G62A 1AUEA 2J0XA 2JPUA 3B9QA 4JC7A 3RF3A 2KW3C 3C8GA 3B29A 1AVOB 1SF8A 4W8PA 4YL0A 2WVQA 5FZTA 5KYWA 1MMAA 3ATPA 3TOLA 1Z7Qc 3S0XA 1OCRC 1SR2A 1YJGA 3F47A 1QSPA 3M4BA 2A1DD 2IBFA 5BUOA 2HMQA 1QQ3A 4IARA 4CDYA 1LE2A 4WGZA 1JRAA 4DOZA 1MNDA 3DD7A 1GS9A 4XEVA 1E85A 2IXOA 3Q7GA 4MW8A 4Z9HA 2FFHA 3AG2C 4AL0A 1T01A 3LLKA 1XWJA 1D1CA 3DE8A 4PR9A 1HW1A 3VM6A 3B0UX 3AG4C 2WB7A 4OIPF 1A0BA 5L3QA 2Y3DA 2VCCA 4XPXA 2X0CA 2VASA 5KYWB 3WAQA 4YJWA 3W2WA 4JEAA 3TD7A 1HE1A 1NFNA 4K7BA 4MTOA 1H9TA 2EINC 2R7QA 2YLIA 4U5DE 3U2LA 4C3DA 2R03A 4CS9A 5HSWA 3J06A 2Q3TA 1GGQA 1NBBA 1QKRA 3BEHA 2Q7RA 1FR0A 2I15A 2L9JA 3DXJF 3KYJA 4ULVA 4NCQA 1JR8A 1SYQA 4RDAA 4OD5A 1ORJA 2GWWA 4RBNA 3EHMA 4DRJB 5L0CA 1FAPB 3L34A 2V26A 4JTDB 3R7CA 1T5OA 2YL0A 3NYLA 4Z9JA 4WGYA 3VYWA 3PDMP 4CSAC 2DI3A 4LDRA 3ZC4A 3ASOC 5BQHA 3JT1A 1VOMA 3UGOA 5L3VA 3ZDLA 1PCXA 3V7OA 2YRFA 5FCLA 2HZ8A 3EGDA 3HNIA 1ZHYA 2MWQA 4CS8A 2R7SA 4NY3A 1ZHWA 4PK4A 2JX0A 256BA 1HMDA 1YARO 4H4KC 2KK1A 2GFHA 3F46A 3RQEA 5EGYA 2PNOA 3WHNA 3FOPA 2XM4A 5JT4A 4IJJA 3ZVRA 3US6A 4U5FE 3FAJA 1GQAA 1AEPA 3IHUA 4X0RA 4AX2A 4BJ6A 1YA7O 2XL8A 3NRHA 3NYMA 3VAYA 1Q0DA 3L8JA 4E18A 4JJGA 5DQZA 3B0PA 3AJMA 3QTHA 2PX0A 1L3PA 4KNVA 3G4ZA 2OU6A 3Q7LA 4MQ9F 2HV7A 3NG1A 2R02A 4F4BA 1FMVA 2XLDA 3GM2A 3SXKA 4XLNF 1OW6A 3CEXA 2YL1A 1LS4A 2J7PD 4DVZA 1BR4A 1MNEA 2HJMA 2YWAA 3FXHA 1M6TA 1I4ZA 2XRHA 3JRTA 3OA1A 1JMWA 4A2NB 2QE9A 2V3CC 2XLWA 4BJTA 3N2ZB 4CS9C 2AWYA 4QI0A 3UMHA 1K40A 2HUJA 3E9VA 3JSEO 2LCHA 1ORSC 2H8AA 2Q9CA 3GM3A 2P7VA 4Q7CA 4XPYA 4BPMA 2Y39A 3FHDA 2J9WA 4JEBA 2D4UA 3DAFA 4FX5A 4NTFA 4PACA 1RJ9B 2NG1A 2Z15A 3EZIA 2LIGA 1NG1A 4JCHA 3SEOA 1OW8A 5AGFA 2NUTA 2J9BA 1BR1A 2YHSA 3S29A 3IQ5A 4P9TA 2AU5A 1CGME 4BJ1A 3DE9A 4YN0B 5IY5C 1TWHA 3T6GB 2J9VA 1WATA 2OG2A 3DM5A 1OKKA 4H54A 2NPUA 1W2WA 1T9KA 4J7YA 1HE9A 3MYFA 2WZLA 1R4TA 4E17A 2R7VA 3G4XA 5DVWA 1LPEA 3RQGA 1RJ9A 2ICWG 1G8XA 2QTVA 2HV6A 3AGUA 2E87A 3DJNB 2R7WA 1GM5A 3NKEA 1OQCA 4M63A 2NUTB 1JAFA 4XPWA 2J0WA 2KYHA 2EPOA 2KGOA 4LERA 4J7TA 2GAQA 3S9OA 4CDAA 1VLSA 2P1AA 4CJOA 3NMIA 1CPQA 1LM3B 2CCYA 1WASA 1TWGA 1B68A 2A0UA 4PFPA 5KYXA 3GWLA 1UFBA 4RD9A 4PJJA 4NTAA 4CIHA 1A7VA 5DS6A 4U5CE 4IWBA 2AP3A 4Q5SF 2XS1A 3EGDB 3R2PA 4J30B 3GEHA 4NQFA 5L0HA 2C04A 3DKAA 4JVSA 1LS1A 5COFA 4YL3A 3V5YA 1Y4CA 1D0YA 2DYRC 3HNKA 3TK0A 1O87A 3KYIA 1QVXA 1EA8A 2WZGA 2LSEA 4O6NA 2RSEB 5D92A 3ZTMA 3EFOA 1FFHA 3SYNA 2H7BA 1IZMA 1MQVA 2EILC 2FGYA 3O10A 1Y6DA 4WABA 4JCZA 4BEMJ 5E33A 2Q9BA 2J8WA 4MS2A 3MX3A 4PJNA 2R7RA 2B0JA 3CAXA 3L0IA 4MVSA 5F5HA 2YL7A 1OXKA 5HV9A 4EUKB 2Y69C 3EZHA 5DLJA 2QNLA 3GWNA 3LAYA 4EKWA 5CIVA 3U8PA 2W45A 4YT2A 2J7PA 2XL6A 4FWVA 4BJ5C 3PMRA 1H6GA 2YEVA 3LNRA 4MVUA 4JKVA 1LKXA 1NZEA 3I5QA 2L6FA 3EFOB 3JTLO 4DXWA 4I1MA 2QUPA 4HFFB 3C8ZA 4HFKB 4C3BA 1ZHXA 2HS5A 3GODA 3SXMA 3DM9B 5E3AA 1O5HA 5A6BA 4LDQA 4FAPB 4JW1A 1K05A 4U5EE 5COMA 2CNWA 1TFKB 3SNHA 4AL1A 1VMAA 2EIKC 1FMWA 2HMZA 3AQCA 4K0DA 4MTGA 4N6HA 4QDLA 1TKNA 2EIJC 4YT5A 3RVZA 3W8HA 4ZLDA 4YK5A 2XLHA 1HW2A 3JSZA 5COGA 3M1CB 1FTSA 1WTYA 4JE9A 4MTFA 4XLPF 1NLXA 4O6MA 2HJ3A 3LJBA 1I5NA 2UUIA 3HTKC 1A7DA 2CYDA 4ANJA 3ZQYA 2R25A 2LP4A 2CW0F 2C03A 3I4UA 2FAPB 1DOWA 2ASRA 1E2XA 3RH3A 3M79A 3S28A 1HMOA 1LIHA 1C17M 1J8MF 1QLEC 1M2OA 4EWCA 3NDBB 4JJFA 1EI7A 3IQTA 3EJNA 1N1CA 3V5ZA 4G0HA 4JTAB 3U8VA 2M4EA 4CDVA 1WN0A 4D4XA 5L0JA 1Z3IX 2OEXA 4GEHA 3GM1A 2MYSA 4DVYP 2KSFA 2EPLX 2P61A 3AQBA 3RVYA 1M56C 2LFFA 1YA9A 2YQYA 3DMDA 3JYYA 4KNWA 4YT8A 3KH2A 1WWPA 2HKVA 5L0DA 4CSAA 2O9XA 3IQCA 4I3MA 4QI2A 4MVMA 2IOQA 2J46A 3KL4A 3LEOA 1BR2A 1G5ZA 5A6JA 4OINF 3U0CA 2L81A 2A0BA 3V5XA 4E7SA 1WOLA 1APCA 5T3TA 5KYXB 1U89A 2NSGA 1TR2A 3OWTA 3X2QC 4DBRA 1I4YA 4EHPA 5L0GA 2XS8A 2PF4E 4J32B 5E2QA 3TOMA 1ST6A 2ZXOA 3QMKA 2P6VA 4IAOA 1Q0GA 3ZTZA 1T6QA 4EIYA 3K6BA 2DYSC 2NSFA 3EH1A 4KBLA 2ZPAA 1ZHTA 1T6IA 3EH2A 3KMIA 1M57C 1ZU5A 4U9DA 5EHHA 3HNLA 1A41A 3K1HA 2R7TA 2XL4A 5D91A 2YLDA 1IW7F 2G3VA 3NMKA 4CJGA 1OXBA 5DS4A 1HY5A 2ZXWC 3H2VA 4G78A 1PV3A 4JZAA 4N06A 4U5BE 4DRIB 1JPJA 2OQMA 3GEIA 5B3IA 4PFOA 5BQIA 1TQGA 3W8IA 1YYJA 2UUHA 3ASNC 3QVYA 5T1DB 2ZXRA 4IAQA 4DBQA 3DZAA 3HNJA 4G7ZF 3DJUB 2W9YA 2NUPA 2HSQA 3LEVA 3GORA 3VF0A 4E0IA 3K1IC 2PP4A 2BE5F 3ZG1A 2VC9A 2EPNA 1NFOA 3N24A 5AC5A 5AC4A 3G50A 3QW1A 4G7HF 2W4BA 1OR3A 2OOCA 1BZ4A 4N6CA 3K33A 4FESA 4Z9IA 1A7EA 5KYUA 3RW0A 2PX3A 1RMVA 2OKUA 3ECSA 1LI7A 2LQGA 4C7OB 1D0XA 2IXPA 2MHRA 4MVRA 4E0HA 1O3UA 2WVNA 4GQHA 5L0FA 1C03A 2J9UA 2Q4FA 3M4CA 3S27A 2XLOA 2L6GA 1V54C 2WZFA 4LLEA 1OCZC 3U3BA 1QZXA 3RIPA 2VB6A 1G4WR 1BBHA 5A69A 4I44A 2EPMX 3ABMC 3ZQVA 3T6BA 2KJGA 3CZ6A 2EPKX 2OEVA 3GANA 2J45A 1FNTc 2CNWD 3JYHA 3E70C 3C62A 1VYKA 5TJ5E 5JRAA 1PD0A 5KYUB 3T9OA 1D0ZA 4MNDA 4D4NA 5DQTA 3KPHA 4Q4ZF 2DGJA 3AG1C 5KYYA 5B1BC 4C7OA 3U3FA 3GEEA 3O39A 3FAPB 1M2VB 1SMYF 4GYTA 3SXYA 3ZWIA 1YYXA 1V55C 1CPRA 3LS0A 4BJ6C 3ABKC 3VRCA 4LACB 1VLTA 1WGWA 5E3CA 3TJ6A 4AK9A 1KTMA 3W2VA 1SZIA 3I5PA 4XTKA 3SXZA 2P0NA 3UGPA 2ZD9A 4JTCB 4B6IA 1LE4A 3IQ6A 4MW3A 1LVKA 3HJCA 3TULA 2PFDA 2QY9A 1OCCC 4C3EA 1E83A 3CSKA 2Y3BA 4CBEA 2OJQA 1Q0FA 2R05A 5KYYB 2JD3A 1CGOA 3WG7C 3PHF2 1ZU4A 4XQ1A 3N0TA 4JRZA 2D5RB 2XM0A 4CS7A 3SZRA 5EK0A 2GDCA 4ULWA 3X1OA 1U0BB 1OW7A 3JRMO 1ZYRF 1VB5A 2A68F 2M64A 2VH3A 2YVKA 3NMJA 4PJMA 4EBKA 2I8BA 5B1AC 4E7ZA 4HE8D 5A6BD 1VTMP 2R7UA 5B3SC 2R7XA 1TWAA 2A69F 2BL2A 1D1AA 2WVOA 4W8KA 4DJ9A 2KQ9A 3W4YA 4KC9A 3A9CA 2BC5A 1D1BA 3MYIA 4IB4A 4N4WA 2GA0A 2X51A 5BQGA 4LDKA 4YL1A 2Y3HA 3B0VC 2XXAB 4O6YA 3A11A 2VCBA 2CGEA 3RQFA 3IPMO 3LUTB 4OIRF 2LD6A 3MBGA 1ZZPA 3QW0A 4K1OA 2XXAA 1JOGA 2LK4A 4EBBA 2HSBA 1FFTC 3FMSA 2Q9AA 4YWQA 2XSEA 1Z63A 1YAUO 4NC3A 1RKEA 3AG3C 2H7VC 2NUPB 3JZ0A 2RD9A 4P6IC 2LFDA 1YDIA 2Y3GA 3EG9A 1TWCA 1ZHZA 3M15A 4YT4A 3UNGC 1OR2A 2KNHA 1YVIA 3HLZA 1S05A 3H65A 5JLIA 3AOUA 3Q6MA 2Q00A 5A6KA 4L6RA 1RCPA 3NKDA 3FDQA 5JSLA 3JCUQ 3O6XA 4CIPA 4R32A 1MMGA 3IEEA 2XLVA 4BG0A 4U9EA 1E86A 4LLCA 1T6UA 3K1IA 3C8GD 4JURI 5F28E 3MLGA 1K04A 4P9FA 3C18A 3U9MA 3BRJA 4ONSA 3TJ5A 1BDJB 3EHNA 5T3WA 3TQOA 5A6AA 3POVA 1RKCA 4A4AA 1U6HA 3S84A 3L8IA 3U9JA 1V4AA 3LLIA 2ETSA 3EG9B 4OIOF 3FOOA 2OJED 1R5ID 2YL3A 1Z5ZA 3QVZA 4IGGA 4MVZA 1G4US 2F22A 2KC3A 4PJLA 1TFOB 4OD4A 3UMKA 4HEAJ 3UR3C 1NU7D 5JS5A 1KU2A 2YZSA 1M2VA 1YZAA 4JIOA 2YLGA 1XZPA 1V74B 2W4MA 3ABLC 5CI9A 3C7JA 2L7AA 1ZW3A 1JPNA 2IYLD 5JP7A 2R9RB 4XEFA 3T4RA 5JVEA 5F5FA 1DOVA 1NU9C 4ER9A 1E84A 3U2MA 1OKKD 2EIMC 5K0IA 3ZSUA 3OEOA 3DWWA 3FVYA 3DI5A 4U5HA 3EGXB 2B0HA 2ZXPA 4IRUA 4CS8C 3Q6NA 1NSGB 1EKYA 5KYNA 4WJ0A 1LI5A 3T6JA 4BJ5A 4KI2A 2L6HA 2A6HF 5DS5A 2QLAA 4UDVA 3H2UA 1ZW2A 4MVQA 3SP1A 3ITFA 2IM8A 4DRHB 3UMIA 1C02A 1H7IA 5L0IA 1RXQA 2VCAA 2HFIA 3LS1A 4O7GA 1S7ZA 4AE4A
chains in the Genus database with same CATH topology
3MBGA 3GWNA 3LLKA 3R7CA 1OQCA 3U2LA 4LDKA 3U2MA 1JRAA 3U5SA 3O55A 4E0IA 1JR8A 3W4YA 3TK0A 3TD7A 3LLIA 2HJ3A 3GWLA 4E0HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MBG A;  3GWN A;  3LLK A;  3R7C A;  1OQC A;  3U2L A;  4LDK A;  3U2M A;  1JRA A;  3U5S A;  3O55 A;  4E0I A;  1JR8 A;  3W4Y A;  3TK0 A;  3TD7 A;  3LLI A;  2HJ3 A;  3GWL A;  4E0H A; 
#chains in the Genus database with same CATH topology
 2DB4 A;  5CI8 A;  3CQZ A;  1CGN A;  4O79 A;  5JUA A;  1ZVZ A;  1XZQ A;  3MFN A;  1L7C A;  2YKZ A;  3RKO F;  1MMN A;  2IXM A;  3EGX A;  3LES A;  1UG7 A;  2R7O A;  1Q0K A;  1YZC A;  1YLM A;  1J8Y F;  1H9G A;  3K7D A;  4MVO A;  3B71 A;  4U5G A;  1PD1 A;  1Z23 A;  3C63 A;  3HKK A;  3RFY A;  4ZLC A;  4G7O F;  2CDQ A;  3RYL A;  1F1M A;  1Z6A A;  3C8G B;  3DAG A;  3K66 A;  2PBE A;  2TMV P;  1Q0M A;  4XEK A;  4OIQ F;  1ORY A;  3O55 A;  5GPG B;  1MMD A;  3NYJ A;  3LNM B;  2IXN A;  1EQ1 A;  2XLE A;  2OCC C;  2XLM A;  4AE4 B;  3S90 A;  2A6E F;  3WOD F;  3ZIB A;  2WL8 A;  3PCV A;  2AWC A;  4NTB A;  4BEJ A;  4I1O B;  4XWJ A;  3EQL F;  1OCO C;  1QPU A;  1RKE B;  1VYI A;  1VK5 A;  2AVK A;  4CX9 A;  4EBJ A;  3KKB A;  3U5S A;  3L1M A;  3QZC A;  3EPV A;  2H7O A;  1KNY A;  3AGT A;  2G3K A;  2G62 A;  1AUE A;  2J0X A;  2JPU A;  3B9Q A;  4JC7 A;  3RF3 A;  2KW3 C;  3C8G A;  3B29 A;  1AVO B;  1SF8 A;  4W8P A;  4YL0 A;  2WVQ A;  5FZT A;  5KYW A;  1MMA A;  3ATP A;  3TOL A;  1Z7Q c;  3S0X A;  1OCR C;  1SR2 A;  1YJG A;  3F47 A;  1QSP A;  3M4B A;  2A1D D;  2IBF A;  5BUO A;  2HMQ A;  1QQ3 A;  4IAR A;  4CDY A;  1LE2 A;  4WGZ A;  1JRA A;  4DOZ A;  1MND A;  3DD7 A;  1GS9 A;  4XEV A;  1E85 A;  2IXO A;  3Q7G A;  4MW8 A;  4Z9H A;  2FFH A;  3AG2 C;  4AL0 A;  1T01 A;  3LLK A;  1XWJ A;  1D1C A;  3DE8 A;  4PR9 A;  1HW1 A;  3VM6 A;  3B0U X;  3AG4 C;  2WB7 A;  4OIP F;  1A0B A;  5L3Q A;  2Y3D A;  2VCC A;  4XPX A;  2X0C A;  2VAS A;  5KYW B;  3WAQ A;  4YJW A;  3W2W A;  4JEA A;  3TD7 A;  1HE1 A;  1NFN A;  4K7B A;  4MTO A;  1H9T A;  2EIN C;  2R7Q A;  2YLI A;  4U5D E;  3U2L A;  4C3D A;  2R03 A;  4CS9 A;  5HSW A;  3J06 A;  2Q3T A;  1GGQ A;  1NBB A;  1QKR A;  3BEH A;  2Q7R A;  1FR0 A;  2I15 A;  2L9J A;  3DXJ F;  3KYJ A;  4ULV A;  4NCQ A;  1JR8 A;  1SYQ A;  4RDA A;  4OD5 A;  1ORJ A;  2GWW A;  4RBN A;  3EHM A;  4DRJ B;  5L0C A;  1FAP B;  3L34 A;  2V26 A;  4JTD B;  3R7C A;  1T5O A;  2YL0 A;  3NYL A;  4Z9J A;  4WGY A;  3VYW A;  3PDM P;  4CSA C;  2DI3 A;  4LDR A;  3ZC4 A;  3ASO C;  5BQH A;  3JT1 A;  1VOM A;  3UGO A;  5L3V A;  3ZDL A;  1PCX A;  3V7O A;  2YRF A;  5FCL A;  2HZ8 A;  3EGD A;  3HNI A;  1ZHY A;  2MWQ A;  4CS8 A;  2R7S A;  4NY3 A;  1ZHW A;  4PK4 A;  2JX0 A;  256B A;  1HMD A;  1YAR O;  4H4K C;  2KK1 A;  2GFH A;  3F46 A;  3RQE A;  5EGY A;  2PNO A;  3WHN A;  3FOP A;  2XM4 A;  5JT4 A;  4IJJ A;  3ZVR A;  3US6 A;  4U5F E;  3FAJ A;  1GQA A;  1AEP A;  3IHU A;  4X0R A;  4AX2 A;  4BJ6 A;  1YA7 O;  2XL8 A;  3NRH A;  3NYM A;  3VAY A;  1Q0D A;  3L8J A;  4E18 A;  4JJG A;  5DQZ A;  3B0P A;  3AJM A;  3QTH A;  2PX0 A;  1L3P A;  4KNV A;  3G4Z A;  2OU6 A;  3Q7L A;  4MQ9 F;  2HV7 A;  3NG1 A;  2R02 A;  4F4B A;  1FMV A;  2XLD A;  3GM2 A;  3SXK A;  4XLN F;  1OW6 A;  3CEX A;  2YL1 A;  1LS4 A;  2J7P D;  4DVZ A;  1BR4 A;  1MNE A;  2HJM A;  2YWA A;  3FXH A;  1M6T A;  1I4Z A;  2XRH A;  3JRT A;  3OA1 A;  1JMW A;  4A2N B;  2QE9 A;  2V3C C;  2XLW A;  4BJT A;  3N2Z B;  4CS9 C;  2AWY A;  4QI0 A;  3UMH A;  1K40 A;  2HUJ A;  3E9V A;  3JSE O;  2LCH A;  1ORS C;  2H8A A;  2Q9C A;  3GM3 A;  2P7V A;  4Q7C A;  4XPY A;  4BPM A;  2Y39 A;  3FHD A;  2J9W A;  4JEB A;  2D4U A;  3DAF A;  4FX5 A;  4NTF A;  4PAC A;  1RJ9 B;  2NG1 A;  2Z15 A;  3EZI A;  2LIG A;  1NG1 A;  4JCH A;  3SEO A;  1OW8 A;  5AGF A;  2NUT A;  2J9B A;  1BR1 A;  2YHS A;  3S29 A;  3IQ5 A;  4P9T A;  2AU5 A;  1CGM E;  4BJ1 A;  3DE9 A;  4YN0 B;  5IY5 C;  1TWH A;  3T6G B;  2J9V A;  1WAT A;  2OG2 A;  3DM5 A;  1OKK A;  4H54 A;  2NPU A;  1W2W A;  1T9K A;  4J7Y A;  1HE9 A;  3MYF A;  2WZL A;  1R4T A;  4E17 A;  2R7V A;  3G4X A;  5DVW A;  1LPE A;  3RQG A;  1RJ9 A;  2ICW G;  1G8X A;  2QTV A;  2HV6 A;  3AGU A;  2E87 A;  3DJN B;  2R7W A;  1GM5 A;  3NKE A;  1OQC A;  4M63 A;  2NUT B;  1JAF A;  4XPW A;  2J0W A;  2KYH A;  2EPO A;  2KGO A;  4LER A;  4J7T A;  2GAQ A;  3S9O A;  4CDA A;  1VLS A;  2P1A A;  4CJO A;  3NMI A;  1CPQ A;  1LM3 B;  2CCY A;  1WAS A;  1TWG A;  1B68 A;  2A0U A;  4PFP A;  5KYX A;  3GWL A;  1UFB A;  4RD9 A;  4PJJ A;  4NTA A;  4CIH A;  1A7V A;  5DS6 A;  4U5C E;  4IWB A;  2AP3 A;  4Q5S F;  2XS1 A;  3EGD B;  3R2P A;  4J30 B;  3GEH A;  4NQF A;  5L0H A;  2C04 A;  3DKA A;  4JVS A;  1LS1 A;  5COF A;  4YL3 A;  3V5Y A;  1Y4C A;  1D0Y A;  2DYR C;  3HNK A;  3TK0 A;  1O87 A;  3KYI A;  1QVX A;  1EA8 A;  2WZG A;  2LSE A;  4O6N A;  2RSE B;  5D92 A;  3ZTM A;  3EFO A;  1FFH A;  3SYN A;  2H7B A;  1IZM A;  1MQV A;  2EIL C;  2FGY A;  3O10 A;  1Y6D A;  4WAB A;  4JCZ A;  4BEM J;  5E33 A;  2Q9B A;  2J8W A;  4MS2 A;  3MX3 A;  4PJN A;  2R7R A;  2B0J A;  3CAX A;  3L0I A;  4MVS A;  5F5H A;  2YL7 A;  1OXK A;  5HV9 A;  4EUK B;  2Y69 C;  3EZH A;  5DLJ A;  2QNL A;  3GWN A;  3LAY A;  4EKW A;  5CIV A;  3U8P A;  2W45 A;  4YT2 A;  2J7P A;  2XL6 A;  4FWV A;  4BJ5 C;  3PMR A;  1H6G A;  2YEV A;  3LNR A;  4MVU A;  4JKV A;  1LKX A;  1NZE A;  3I5Q A;  2L6F A;  3EFO B;  3JTL O;  4DXW A;  4I1M A;  2QUP A;  4HFF B;  3C8Z A;  4HFK B;  4C3B A;  1ZHX A;  2HS5 A;  3GOD A;  3SXM A;  3DM9 B;  5E3A A;  1O5H A;  5A6B A;  4LDQ A;  4FAP B;  4JW1 A;  1K05 A;  4U5E E;  5COM A;  2CNW A;  1TFK B;  3SNH A;  4AL1 A;  1VMA A;  2EIK C;  1FMW A;  2HMZ A;  3AQC A;  4K0D A;  4MTG A;  4N6H A;  4QDL A;  1TKN A;  2EIJ C;  4YT5 A;  3RVZ A;  3W8H A;  4ZLD A;  4YK5 A;  2XLH A;  1HW2 A;  3JSZ A;  5COG A;  3M1C B;  1FTS A;  1WTY A;  4JE9 A;  4MTF A;  4XLP F;  1NLX A;  4O6M A;  2HJ3 A;  3LJB A;  1I5N A;  2UUI A;  3HTK C;  1A7D A;  2CYD A;  4ANJ A;  3ZQY A;  2R25 A;  2LP4 A;  2CW0 F;  2C03 A;  3I4U A;  2FAP B;  1DOW A;  2ASR A;  1E2X A;  3RH3 A;  3M79 A;  3S28 A;  1HMO A;  1LIH A;  1C17 M;  1J8M F;  1QLE C;  1M2O A;  4EWC A;  3NDB B;  4JJF A;  1EI7 A;  3IQT A;  3EJN A;  1N1C A;  3V5Z A;  4G0H A;  4JTA B;  3U8V A;  2M4E A;  4CDV A;  1WN0 A;  4D4X A;  5L0J A;  1Z3I X;  2OEX A;  4GEH A;  3GM1 A;  2MYS A;  4DVY P;  2KSF A;  2EPL X;  2P61 A;  3AQB A;  3RVY A;  1M56 C;  2LFF A;  1YA9 A;  2YQY A;  3DMD A;  3JYY A;  4KNW A;  4YT8 A;  3KH2 A;  1WWP A;  2HKV A;  5L0D A;  4CSA A;  2O9X A;  3IQC A;  4I3M A;  4QI2 A;  4MVM A;  2IOQ A;  2J46 A;  3KL4 A;  3LEO A;  1BR2 A;  1G5Z A;  5A6J A;  4OIN F;  3U0C A;  2L81 A;  2A0B A;  3V5X A;  4E7S A;  1WOL A;  1APC A;  5T3T A;  5KYX B;  1U89 A;  2NSG A;  1TR2 A;  3OWT A;  3X2Q C;  4DBR A;  1I4Y A;  4EHP A;  5L0G A;  2XS8 A;  2PF4 E;  4J32 B;  5E2Q A;  3TOM A;  1ST6 A;  2ZXO A;  3QMK A;  2P6V A;  4IAO A;  1Q0G A;  3ZTZ A;  1T6Q A;  4EIY A;  3K6B A;  2DYS C;  2NSF A;  3EH1 A;  4KBL A;  2ZPA A;  1ZHT A;  1T6I A;  3EH2 A;  3KMI A;  1M57 C;  1ZU5 A;  4U9D A;  5EHH A;  3HNL A;  1A41 A;  3K1H A;  2R7T A;  2XL4 A;  5D91 A;  2YLD A;  1IW7 F;  2G3V A;  3NMK A;  4CJG A;  1OXB A;  5DS4 A;  1HY5 A;  2ZXW C;  3H2V A;  4G78 A;  1PV3 A;  4JZA A;  4N06 A;  4U5B E;  4DRI B;  1JPJ A;  2OQM A;  3GEI A;  5B3I A;  4PFO A;  5BQI A;  1TQG A;  3W8I A;  1YYJ A;  2UUH A;  3ASN C;  3QVY A;  5T1D B;  2ZXR A;  4IAQ A;  4DBQ A;  3DZA A;  3HNJ A;  4G7Z F;  3DJU B;  2W9Y A;  2NUP A;  2HSQ A;  3LEV A;  3GOR A;  3VF0 A;  4E0I A;  3K1I C;  2PP4 A;  2BE5 F;  3ZG1 A;  2VC9 A;  2EPN A;  1NFO A;  3N24 A;  5AC5 A;  5AC4 A;  3G50 A;  3QW1 A;  4G7H F;  2W4B A;  1OR3 A;  2OOC A;  1BZ4 A;  4N6C A;  3K33 A;  4FES A;  4Z9I A;  1A7E A;  5KYU A;  3RW0 A;  2PX3 A;  1RMV A;  2OKU A;  3ECS A;  1LI7 A;  2LQG A;  4C7O B;  1D0X A;  2IXP A;  2MHR A;  4MVR A;  4E0H A;  1O3U A;  2WVN A;  4GQH A;  5L0F A;  1C03 A;  2J9U A;  2Q4F A;  3M4C A;  3S27 A;  2XLO A;  2L6G A;  1V54 C;  2WZF A;  4LLE A;  1OCZ C;  3U3B A;  1QZX A;  3RIP A;  2VB6 A;  1G4W R;  1BBH A;  5A69 A;  4I44 A;  2EPM X;  3ABM C;  3ZQV A;  3T6B A;  2KJG A;  3CZ6 A;  2EPK X;  2OEV A;  3GAN A;  2J45 A;  1FNT c;  2CNW D;  3JYH A;  3E70 C;  3C62 A;  1VYK A;  5TJ5 E;  5JRA A;  1PD0 A;  5KYU B;  3T9O A;  1D0Z A;  4MND A;  4D4N A;  5DQT A;  3KPH A;  4Q4Z F;  2DGJ A;  3AG1 C;  5KYY A;  5B1B C;  4C7O A;  3U3F A;  3GEE A;  3O39 A;  3FAP B;  1M2V B;  1SMY F;  4GYT A;  3SXY A;  3ZWI A;  1YYX A;  1V55 C;  1CPR A;  3LS0 A;  4BJ6 C;  3ABK C;  3VRC A;  4LAC B;  1VLT A;  1WGW A;  5E3C A;  3TJ6 A;  4AK9 A;  1KTM A;  3W2V A;  1SZI A;  3I5P A;  4XTK A;  3SXZ A;  2P0N A;  3UGP A;  2ZD9 A;  4JTC B;  4B6I A;  1LE4 A;  3IQ6 A;  4MW3 A;  1LVK A;  3HJC A;  3TUL A;  2PFD A;  2QY9 A;  1OCC C;  4C3E A;  1E83 A;  3CSK A;  2Y3B A;  4CBE A;  2OJQ A;  1Q0F A;  2R05 A;  5KYY B;  2JD3 A;  1CGO A;  3WG7 C;  3PHF 2;  1ZU4 A;  4XQ1 A;  3N0T A;  4JRZ A;  2D5R B;  2XM0 A;  4CS7 A;  3SZR A;  5EK0 A;  2GDC A;  4ULW A;  3X1O A;  1U0B B;  1OW7 A;  3JRM O;  1ZYR F;  1VB5 A;  2A68 F;  2M64 A;  2VH3 A;  2YVK A;  3NMJ A;  4PJM A;  4EBK A;  2I8B A;  5B1A C;  4E7Z A;  4HE8 D;  5A6B D;  1VTM P;  2R7U A;  5B3S C;  2R7X A;  1TWA A;  2A69 F;  2BL2 A;  1D1A A;  2WVO A;  4W8K A;  4DJ9 A;  2KQ9 A;  3W4Y A;  4KC9 A;  3A9C A;  2BC5 A;  1D1B A;  3MYI A;  4IB4 A;  4N4W A;  2GA0 A;  2X51 A;  5BQG A;  4LDK A;  4YL1 A;  2Y3H A;  3B0V C;  2XXA B;  4O6Y A;  3A11 A;  2VCB A;  2CGE A;  3RQF A;  3IPM O;  3LUT B;  4OIR F;  2LD6 A;  3MBG A;  1ZZP A;  3QW0 A;  4K1O A;  2XXA A;  1JOG A;  2LK4 A;  4EBB A;  2HSB A;  1FFT C;  3FMS A;  2Q9A A;  4YWQ A;  2XSE A;  1Z63 A;  1YAU O;  4NC3 A;  1RKE A;  3AG3 C;  2H7V C;  2NUP B;  3JZ0 A;  2RD9 A;  4P6I C;  2LFD A;  1YDI A;  2Y3G A;  3EG9 A;  1TWC A;  1ZHZ A;  3M15 A;  4YT4 A;  3UNG C;  1OR2 A;  2KNH A;  1YVI A;  3HLZ A;  1S05 A;  3H65 A;  5JLI A;  3AOU A;  3Q6M A;  2Q00 A;  5A6K A;  4L6R A;  1RCP A;  3NKD A;  3FDQ A;  5JSL A;  3JCU Q;  3O6X A;  4CIP A;  4R32 A;  1MMG A;  3IEE A;  2XLV A;  4BG0 A;  4U9E A;  1E86 A;  4LLC A;  1T6U A;  3K1I A;  3C8G D;  4JUR I;  5F28 E;  3MLG A;  1K04 A;  4P9F A;  3C18 A;  3U9M A;  3BRJ A;  4ONS A;  3TJ5 A;  1BDJ B;  3EHN A;  5T3W A;  3TQO A;  5A6A A;  3POV A;  1RKC A;  4A4A A;  1U6H A;  3S84 A;  3L8I A;  3U9J A;  1V4A A;  3LLI A;  2ETS A;  3EG9 B;  4OIO F;  3FOO A;  2OJE D;  1R5I D;  2YL3 A;  1Z5Z A;  3QVZ A;  4IGG A;  4MVZ A;  1G4U S;  2F22 A;  2KC3 A;  4PJL A;  1TFO B;  4OD4 A;  3UMK A;  4HEA J;  3UR3 C;  1NU7 D;  5JS5 A;  1KU2 A;  2YZS A;  1M2V A;  1YZA A;  4JIO A;  2YLG A;  1XZP A;  1V74 B;  2W4M A;  3ABL C;  5CI9 A;  3C7J A;  2L7A A;  1ZW3 A;  1JPN A;  2IYL D;  5JP7 A;  2R9R B;  4XEF A;  3T4R A;  5JVE A;  5F5F A;  1DOV A;  1NU9 C;  4ER9 A;  1E84 A;  3U2M A;  1OKK D;  2EIM C;  5K0I A;  3ZSU A;  3OEO A;  3DWW A;  3FVY A;  3DI5 A;  4U5H A;  3EGX B;  2B0H A;  2ZXP A;  4IRU A;  4CS8 C;  3Q6N A;  1NSG B;  1EKY A;  5KYN A;  4WJ0 A;  1LI5 A;  3T6J A;  4BJ5 A;  4KI2 A;  2L6H A;  2A6H F;  5DS5 A;  2QLA A;  4UDV A;  3H2U A;  1ZW2 A;  4MVQ A;  3SP1 A;  3ITF A;  2IM8 A;  4DRH B;  3UMI A;  1C02 A;  1H7I A;  5L0I A;  1RXQ A;  2VCA A;  2HFI A;  3LS1 A;  4O7G A;  1S7Z A;  4AE4 A; 
#chains in the Genus database with same CATH homology
 3MBG A;  3GWN A;  3LLK A;  3R7C A;  1OQC A;  3U2L A;  4LDK A;  3U2M A;  1JRA A;  3U5S A;  3O55 A;  4E0I A;  1JR8 A;  3W4Y A;  3TK0 A;  3TD7 A;  3LLI A;  2HJ3 A;  3GWL A;  4E0H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...