3IQTA

Structure of the hpt domain of sensor protein bara from escherichia coli cft073.
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
123
structure length
123
Chain Sequence
SNAVNEIVVNPNATLDWQLALRQAAGKTDLARDMLQMLLDFLPEVRNKVEEQLVGENPEGLVDLIHKLHGSCGYSGVPRMKNLCQLIEQQLRSGTKEEDLEPELLELLDEMDNVAREASKILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Signal transduction histidine-protein kinase barA
publication title Structure of the HPT domain of Sensor protein barA from Escherichia coli CFT073.
rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 41
structure length 123
sequence length 123
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2009-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01627 Hpt Hpt domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.160 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) HPT domain 3iqtA01
2OOCA 1A0BA 1TQGA 1YVIA 1FR0A 1OXKA 4PACA 3IQTA 1C03A 1C02A 1OXBA 1BDJB 1WN0A 3U3BA 2R25A 2Q4FA 1I5NA 3US6A 3MYFA 4G78A 4EUKB 2LD6A 2LP4A 1SR2A 1Y6DA 2A0BA 3KYIA 2LCHA 3KYJA 1QSPA
chains in the Genus database with same CATH superfamily
3EG9A 3NDBB 5F5FA 3ZQYA 2CGEA 1XZPA 3C8ZA 3CEXA 4JKVA 4LDQA 1TWCA 2LQGA 2Q9AA 4Z9IA 4MVQA 2HUJA 4NTAA 3NKDA 2Y69C 4GQHA 4Z9JA 3S84A 4MS2A 5DLJA 4PFPA 4CDYA 3U8VA 2A6EF 1Z5ZA 4Q5SF 4BG0A 1O87A 4AK9A 4I44A 1V55C 1OW6A 3QVZA 2LP4A 1YYJA 3DJUB 1M2VA 3KL4A 3MYIA 1CGME 3GWNA 4U5BE 3KYIA 5CIVA 3LNRA 2Y3BA 1AUEA 3GANA 1S7ZA 3KYJA 3FOPA 2L9JA 1DOWA 2WZGA 4CS9A 2G3KA 1KNYA 4KNVA 4AL1A 2YL7A 3L8IA 1OCOC 3QVYA 2IM8A 1YA9A 2NUPA 2YLDA 5JT4A 2R7TA 3ZDLA 1OKKD 3NMJA 4LLCA 4GEHA 2WVQA 5L0HA 5AGFA 1JRAA 5JLIA 2J9VA 4I1MA 1RCPA 1T01A 3HNKA 3V5XA 3M15A 2H7VC 5KYXA 2OQMA 2X0CA 1QKRA 4M63A 4P9FA 1FMVA 5CI9A 2PP4A 3MYFA 1OCZC 4JURI 3AG2C 2EIMC 2YZSA 3RQFA 3ZWIA 1VTMP 5KYNA 3UNGC 1MMGA 5D92A 2YEVA 4AX2A 3LUTB 1Y6DA 3EGXB 3KMIA 2OJED 4CX9A 4ONSA 4NCQA 4YWQA 3AG4C 3UMIA 1OW8A 1F1MA 2PX3A 2VASA 3NYJA 1ZHXA 3HJCA 2EILC 2H8AA 2XLMA 4N6HA 2J8WA 4DJ9A 4MVSA 3JRTA 3O6XA 1SYQA 3JSEO 4BEMJ 2G62A 3SXKA 1QVXA 1G4US 2WZFA 2XRHA 1K40A 4K1OA 3RFYA 5KYYB 1Z3IX 4AE4A 4P6IC 2ZXPA 3IQ6A 4HFKB 3JYYA 4BJ6C 1YZCA 2Q3TA 1G5ZA 2I8BA 3KKBA 3L1MA 2LFFA 2XSEA 2HJMA 1OCCC 3QZCA 5COFA 4Q4ZF 3C8GA 3DZAA 1M2VB 4MW3A 4CS7A 2CNWD 2QE9A 3I5PA 1V4AA 3LLIA 2B0HA 3DM9B 4LDKA 4XEVA 4YL3A 4ZLCA 3R2PA 1NLXA 3RW0A 5F28E 2V3CC 4OIPF 1PV3A 3LAYA 2NUPB 3FAPB 1Y4CA 2PBEA 3GODA 4LLEA 5A6KA 2J7PD 1LS4A 1WATA 2P0NA 3EQLF 3K6BA 1TWAA 1M6TA 5KYXB 1U89A 2AWCA 3W2WA 1AEPA 3FVYA 3T4RA 5HV9A 5CI8A 4N4WA 3TD7A 1MMNA 4QDLA 1JMWA 3SXMA 1HY5A 3GM1A 1ZHYA 4JTDB 2F22A 2GFHA 4BPMA 4CS8C 4IWBA 4JZAA 1CPQA 4MTOA 1W2WA 1ORYA 5EK0A 5JP7A 1E84A 1UG7A 2R7XA 4XLPF 1SR2A 4E7ZA 2XXAA 3AQCA 4NTBA 3PMRA 1MMAA 4F4BA 3L0IA 4FAPB 2TMVP 2HKVA 4KI2A 1S05A 3LLKA 3DE8A 2M64A 4IAQA 4U5HA 5DVWA 1RMVA 5L0IA 3AOUA 2HSBA 2QUPA 4U5GA 4YJWA 3UMHA 2R03A 1HE1A 1EI7A 2YRFA 5T3WA 4DBQA 1Z6AA 3DWWA 1FR0A 4AE4B 3TJ6A 1VK5A 1GS9A 4X0RA 1BDJB 4QI0A 2ZPAA 1Z23A 2OEVA 1ORSC 1ZW3A 3HTKC 2MYSA 4XPWA 1H6GA 1T9KA 1RJ9B 3E70C 2HJ3A 2KK1A 2Y3HA 3OEOA 4J30B 3C8GB 2J9BA 3VRCA 5T3TA 4ANJA 4CIPA 3DMDA 1Q0MA 3N0TA 3RVYA 4JTAB 2A68F 2IXNA 2C03A 4G7ZF 2P7VA 1MQVA 2KSFA 1EQ1A 4RBNA 2HV6A 2W4BA 4RDAA 3U0CA 3C63A 5A6BD 1O5HA 3T6JA 1VYKA 4EBBA 4AL0A 4E0HA 4J7YA 2NUTB 3JTLO 2J9UA 3S9OA 5COGA 1A0BA 1OR2A 3U3FA 1JR8A 1LI7A 1T6IA 2EPMX 3M4CA 4PFOA 2IBFA 1YLMA 3F47A 3RIPA 3QMKA 3CAXA 2EIKC 1FNTc 2XM4A 4JJFA 2EPNA 5TJ5E 4CS9C 2R7UA 1LI5A 3SYNA 3T6GB 4N6CA 2OU6A 3QTHA 2JPUA 3TK0A 5B1AC 2B0JA 3US6A 1J8YF 3TOLA 5FCLA 2IXOA 3GEIA 2R7VA 1SMYF 5HSWA 3QW1A 3ZVRA 2YHSA 1E2XA 3A9CA 1RKEB 3ZTZA 3K1IA 3SXYA 5L0JA 2D5RB 3V5ZA 4KNWA 4YT2A 3AG1C 3EH2A 4I3MA 4Q7CA 3HNJA 4ULWA 5E3CA 4BJTA 4NTFA 3JRMO 5L3QA 1A41A 2EPLX 3HLZA 5F5HA 3I4UA 1KU2A 4BJ1A 2XM0A 1NFNA 1MNDA 3MFNA 3B71A 2AVKA 2R05A 3IPMO 2HSQA 3UMKA 1T6UA 4DVYP 1LE4A 5B3SC 2XS1A 2EPKX 4G7OF 2WB7A 3B0PA 2HS5A 4C7OA 2QLAA 1K05A 4CSAA 1Z7Qc 1TR2A 2VC9A 5KYWB 5BQHA 1IZMA 3G4ZA 1D1AA 2KGOA 2Y3GA 1ORJA 2Y39A 3JYHA 5JS5A 1GM5A 2YKZA 3U9JA 4WABA 3C18A 3LS0A 2BE5F 3ASOC 3AQBA 3DE9A 2A0BA 1Q0GA 2DB4A 3FOOA 1LS1A 4JVSA 4XTKA 2YLGA 3B0UX 4MVMA 5L0GA 2YL1A 2VCAA 3VYWA 2UUHA 3ZSUA 5AC4A 5L3VA 2IYLD 1EKYA 1YDIA 3EG9B 3HKKA 4EBJA 5EHHA 1CPRA 2XL4A 4O79A 1KTMA 1A7VA 2H7OA 3NYMA 3U8PA 1E85A 2O9XA 1CGNA 3C8GD 4JJGA 2W4MA 3DXJF 3ZTMA 1C03A 1V54C 1NG1A 3S28A 5GPGB 2OKUA 5DQTA 1AVOB 2P61A 2ZD9A 1VLSA 1BBHA 1OKKA 1OQCA 2Q4FA 3X2QC 5A69A 3QW0A 1WWPA 1NZEA 1D0ZA 1ZU5A 2WVOA 3GEEA 3EHNA 1NBBA 3M79A 2LD6A 4FWVA 3R7CA 4P9TA 4XQ1A 1BR1A 4XWJA 3K33A 3KPHA 3N2ZB 3Q7GA 2ICWG 1IW7F 2OCCC 2R9RB 3G4XA 1ZZPA 2FFHA 3OWTA 4K7BA 2Y3DA 4DRHB 4D4NA 1FFHA 3POVA 1PCXA 3L8JA 5E33A 3PCVA 4JEBA 1BR4A 2QNLA 3SEOA 1H9TA 2H7BA 1OXKA 1T5OA 2OJQA 4C7OB 1B68A 2LIGA 4YT4A 4WJ0A 2DGJA 3DKAA 3HNIA 2W9YA 2L6GA 1O3UA 4YL0A 1JPJA 5KYUA 2AP3A 1PD1A 3FMSA 5IY5C 3T9OA 4JCZA 3JZ0A 3LS1A 3UGPA 4G78A 2A6HF 3SZRA 3F46A 3L34A 5JUAA 2XLOA 1CGOA 2EPOA 4PJJA 2L81A 4IAOA 1VOMA 3B29A 4XEFA 3IEEA 1OR3A 4DRJB 1VLTA 3WHNA 1M2OA 1SZIA 2YL3A 3H65A 2I15A 4EBKA 2CNWA 4I1OB 1HW2A 3LEVA 4ULVA 3DAFA 2Q00A 1R4TA 4OD4A 1EA8A 2XLDA 3IHUA 4L6RA 4CDAA 1G4WR 1ZU4A 4FX5A 4BEJA 5BQGA 1YVIA 4IRUA 3SP1A 3MX3A 2WZLA 5KYYA 1JOGA 4YL1A 2L7AA 4BJ5A 3NMKA 3ABKC 4JCHA 3V7OA 1I4YA 1I4ZA 2J7PA 3U3BA 1ZW2A 1WOLA 2P1AA 2HMZA 2CDQA 2X51A 4PK4A 3RQEA 3UGOA 4J32B 4DBRA 2YL0A 3S0XA 3RF3A 4MTFA 3W4YA 4CJGA 2JD3A 1YJGA 3GWLA 2XS8A 3EPVA 3CQZA 1XWJA 3FAJA 1TFKB 2DYRC 3LJBA 4MQ9F 3S27A 3SNHA 1NSGB 1WASA 3U9MA 4G7HF 2Z15A 3K66A 4EIYA 2C04A 1LE2A 4DRIB 3GM2A 2OEXA 2ZXRA 4A2NB 4O7GA 1TQGA 1N1CA 1QZXA 2HMQA 3LESA 3WODF 3DI5A 2GA0A 5L0DA 3VF0A 3K1IC 4E17A 2KC3A 1VYIA 2CCYA 4OD5A 1D0XA 2J9WA 2LSEA 1WN0A 3AGUA 2DI3A 4JEAA 4U5FE 2R25A 4KC9A 2EINC 4IB4A 1SF8A 3M4BA 2PNOA 3EGDA 3MLGA 5DQZA 2QTVA 4E0IA 3W8IA 3TOMA 4PJNA 1XZQA 4C3EA 4JE9A 3GM3A 1L7CA 4U5CE 2XXAB 3N24A 3EFOA 4O6NA 3U5SA 1C17M 2LCHA 4JC7A 4C3DA 2A69F 1ZHZA 1A7DA 1BR2A 1NFOA 3EJNA 4GYTA 4IGGA 3GEHA 4CSAC 4C3BA 1QSPA 3ZQVA 4CJOA 1HE9A 1Q0FA 2A1DD 2WVNA 3K1HA 5A6AA 4CBEA 4E7SA 3LNMB 2Q9BA 3DD7A 4JTCB 3NKEA 2P6VA 4XPYA 4YK5A 3HNLA 1MNEA 4XPXA 3GORA 4PR9A 3V5YA 1M56C 1UFBA 2YQYA 3BEHA 3ABLC 4W8PA 2CW0F 4WGYA 3RYLA 3W2VA 4O6MA 3ZG1A 5A6BA 4LDRA 3E9VA 1OXBA 1ST6A 3JCUQ 4DVZA 3J06A 2ASRA 4NC3A 1QPUA 4MVUA 2MWQA 3AJMA 4H4KC 4R32A 4CIHA 1YA7O 1Z63A 256BA 4JW1A 2GAQA 1I5NA 2XLHA 2IXPA 2NPUA 3Q6NA 3DJNB 2J45A 4OIQF 1FTSA 1LKXA 4LACB 2BC5A 3FHDA 2M4EA 3TULA 1FAPB 1U6HA 3AG3C 1M57C 2GWWA 2YVKA 3I5QA 4W8KA 2Q9CA 2D4UA 5BQIA 2GDCA 1V74B 2LK4A 5BUOA 1VMAA 2DYSC 3EH1A 3ZC4A 3WAQA 1GQAA 4PJMA 1D1CA 5A6JA 3CSKA 4ER9A 2QY9A 1JAFA 4EKWA 3Q6MA 2IOQA 1HMOA 2V26A 1D1BA 2G3VA 3EGDB 2VH3A 1NU9C 4EWCA 4MVOA 3EZHA 2MHRA 1ZHWA 2W45A 2XLEA 4XEKA 2OG2A 3RH3A 1T6QA 2KYHA 2L6HA 3M1CB 1TFOB 4HFFB 4HEAJ 1Q0DA 3ITFA 4PJLA 3ZIBA 1QQ3A 4DXWA 3ATPA 3EFOB 1YYXA 4HE8D 4MVZA 5T1DB 4OINF 5JRAA 1JPNA 2CYDA 3VM6A 3TJ5A 2KW3C 4D4XA 2HFIA 4E18A 2RD9A 2A0UA 4EHPA 2AU5A 2FGYA 4YN0B 2KQ9A 5DS5A 3B9QA 4MW8A 4J7TA 4FESA 5EGYA 1TWGA 2NG1A 3ASNC 1YARO 1PD0A 4NQFA 2J46A 3T6BA 3PHF2 3EHMA 1RKCA 2R02A 2HV7A 2WL8A 4ZLDA 5K0IA 4YT8A 3MBGA 2R7WA 5L0FA 3DAGA 2YWAA 4N06A 1C02A 1OW7A 3EZIA 1ZVZA 4A4AA 1HW1A 1J8MF 4MTGA 4JRZA 4U9DA 1LPEA 1APCA 4MVRA 4QI2A 3TQOA 1Q0KA 1RJ9A 3X1OA 2XLWA 1NU7D 2R7QA 3FXHA 3IQ5A 4EUKB 1GGQA 3ECSA 2NSGA 4WGZA 1E86A 2J0XA 3O39A 4B6IA 2XL6A 3VAYA 1ZYRF 2E87A 3KH2A 4BJ5C 1G8XA 1LVKA 2PFDA 2VCCA 1H7IA 1QLEC 2J0WA 3NG1A 4BJ6A 1HMDA 1E83A 5L0CA 1TWHA 4UDVA 2FAPB 3C62A 3IQCA 3W8HA 1WTYA 1FMWA 2ZXOA 3U2MA 4DOZA 2NSFA 2UUIA 4MNDA 2ETSA 2R7OA 2NUTA 3LEOA 1ZHTA 3A11A 4IJJA 3DM5A 2VCBA 1R5ID 4PACA 3UR3C 3NRHA 3BRJA 3WG7C 4U9EA 4JIOA 2PX0A 2XL8A 2JX0A 2XLVA 1LM3B 1WGWA 1YAUO 2VB6A 1U0BB 4H54A 1OCRC 1YZAA 1DOVA 1D0YA 1BZ4A 2IXMA 1RKEA 5DS6A 4O6YA 3RQGA 4Z9HA 5B1BC 3ABMC 4K0DA 1RXQA 2AWYA 1H9GA 3OA1A 2BL2A 3FDQA 5E2QA 3JSZA 2Q7RA 2LFDA 3NYLA 2OOCA 4RD9A 5FZTA 4CS8A 1TKNA 2KJGA 4U5DE 4IARA 2R7RA 3RKOF 3H2UA 4YT5A 1LIHA 4G0HA 5D91A 3PDMP 3AGTA 3IQTA 5JVEA 3G50A 2RSEB 1A7EA 2HZ8A 3CZ6A 3O55A 4XLNF 5AC5A 3K7DA 1MMDA 1VB5A 2KNHA 2ZXWC 4OIRF 4LERA 4U5EE 3JT1A 3SXZA 5COMA 5B3IA 2YLIA 5KYUB 3S29A 1K04A 1FFTC 2PF4E 4NY3A 1L3PA 2EIJC 4KBLA 5KYWA 5E3AA 4OIOF 5JSLA 4CDVA 2L6FA 3B0VC 3H2VA 3C7JA 3NMIA 3Q7LA 2R7SA 3S90A 3EGXA 3RVZA 3O10A 3U2LA 5DS4A
chains in the Genus database with same CATH topology
2OOCA 1A0BA 1TQGA 1YVIA 1FR0A 1OXKA 4PACA 3IQTA 1C03A 1C02A 1OXBA 1BDJB 1WN0A 3U3BA 2R25A 2Q4FA 1I5NA 3US6A 3MYFA 4G78A 4EUKB 2LD6A 2LP4A 1SR2A 1Y6DA 2A0BA 3KYIA 2LCHA 3KYJA 1QSPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OOC A;  1A0B A;  1TQG A;  1YVI A;  1FR0 A;  1OXK A;  4PAC A;  3IQT A;  1C03 A;  1C02 A;  1OXB A;  1BDJ B;  1WN0 A;  3U3B A;  2R25 A;  2Q4F A;  1I5N A;  3US6 A;  3MYF A;  4G78 A;  4EUK B;  2LD6 A;  2LP4 A;  1SR2 A;  1Y6D A;  2A0B A;  3KYI A;  2LCH A;  3KYJ A;  1QSP A; 
#chains in the Genus database with same CATH topology
 3EG9 A;  3NDB B;  5F5F A;  3ZQY A;  2CGE A;  1XZP A;  3C8Z A;  3CEX A;  4JKV A;  4LDQ A;  1TWC A;  2LQG A;  2Q9A A;  4Z9I A;  4MVQ A;  2HUJ A;  4NTA A;  3NKD A;  2Y69 C;  4GQH A;  4Z9J A;  3S84 A;  4MS2 A;  5DLJ A;  4PFP A;  4CDY A;  3U8V A;  2A6E F;  1Z5Z A;  4Q5S F;  4BG0 A;  1O87 A;  4AK9 A;  4I44 A;  1V55 C;  1OW6 A;  3QVZ A;  2LP4 A;  1YYJ A;  3DJU B;  1M2V A;  3KL4 A;  3MYI A;  1CGM E;  3GWN A;  4U5B E;  3KYI A;  5CIV A;  3LNR A;  2Y3B A;  1AUE A;  3GAN A;  1S7Z A;  3KYJ A;  3FOP A;  2L9J A;  1DOW A;  2WZG A;  4CS9 A;  2G3K A;  1KNY A;  4KNV A;  4AL1 A;  2YL7 A;  3L8I A;  1OCO C;  3QVY A;  2IM8 A;  1YA9 A;  2NUP A;  2YLD A;  5JT4 A;  2R7T A;  3ZDL A;  1OKK D;  3NMJ A;  4LLC A;  4GEH A;  2WVQ A;  5L0H A;  5AGF A;  1JRA A;  5JLI A;  2J9V A;  4I1M A;  1RCP A;  1T01 A;  3HNK A;  3V5X A;  3M15 A;  2H7V C;  5KYX A;  2OQM A;  2X0C A;  1QKR A;  4M63 A;  4P9F A;  1FMV A;  5CI9 A;  2PP4 A;  3MYF A;  1OCZ C;  4JUR I;  3AG2 C;  2EIM C;  2YZS A;  3RQF A;  3ZWI A;  1VTM P;  5KYN A;  3UNG C;  1MMG A;  5D92 A;  2YEV A;  4AX2 A;  3LUT B;  1Y6D A;  3EGX B;  3KMI A;  2OJE D;  4CX9 A;  4ONS A;  4NCQ A;  4YWQ A;  3AG4 C;  3UMI A;  1OW8 A;  1F1M A;  2PX3 A;  2VAS A;  3NYJ A;  1ZHX A;  3HJC A;  2EIL C;  2H8A A;  2XLM A;  4N6H A;  2J8W A;  4DJ9 A;  4MVS A;  3JRT A;  3O6X A;  1SYQ A;  3JSE O;  4BEM J;  2G62 A;  3SXK A;  1QVX A;  1G4U S;  2WZF A;  2XRH A;  1K40 A;  4K1O A;  3RFY A;  5KYY B;  1Z3I X;  4AE4 A;  4P6I C;  2ZXP A;  3IQ6 A;  4HFK B;  3JYY A;  4BJ6 C;  1YZC A;  2Q3T A;  1G5Z A;  2I8B A;  3KKB A;  3L1M A;  2LFF A;  2XSE A;  2HJM A;  1OCC C;  3QZC A;  5COF A;  4Q4Z F;  3C8G A;  3DZA A;  1M2V B;  4MW3 A;  4CS7 A;  2CNW D;  2QE9 A;  3I5P A;  1V4A A;  3LLI A;  2B0H A;  3DM9 B;  4LDK A;  4XEV A;  4YL3 A;  4ZLC A;  3R2P A;  1NLX A;  3RW0 A;  5F28 E;  2V3C C;  4OIP F;  1PV3 A;  3LAY A;  2NUP B;  3FAP B;  1Y4C A;  2PBE A;  3GOD A;  4LLE A;  5A6K A;  2J7P D;  1LS4 A;  1WAT A;  2P0N A;  3EQL F;  3K6B A;  1TWA A;  1M6T A;  5KYX B;  1U89 A;  2AWC A;  3W2W A;  1AEP A;  3FVY A;  3T4R A;  5HV9 A;  5CI8 A;  4N4W A;  3TD7 A;  1MMN A;  4QDL A;  1JMW A;  3SXM A;  1HY5 A;  3GM1 A;  1ZHY A;  4JTD B;  2F22 A;  2GFH A;  4BPM A;  4CS8 C;  4IWB A;  4JZA A;  1CPQ A;  4MTO A;  1W2W A;  1ORY A;  5EK0 A;  5JP7 A;  1E84 A;  1UG7 A;  2R7X A;  4XLP F;  1SR2 A;  4E7Z A;  2XXA A;  3AQC A;  4NTB A;  3PMR A;  1MMA A;  4F4B A;  3L0I A;  4FAP B;  2TMV P;  2HKV A;  4KI2 A;  1S05 A;  3LLK A;  3DE8 A;  2M64 A;  4IAQ A;  4U5H A;  5DVW A;  1RMV A;  5L0I A;  3AOU A;  2HSB A;  2QUP A;  4U5G A;  4YJW A;  3UMH A;  2R03 A;  1HE1 A;  1EI7 A;  2YRF A;  5T3W A;  4DBQ A;  1Z6A A;  3DWW A;  1FR0 A;  4AE4 B;  3TJ6 A;  1VK5 A;  1GS9 A;  4X0R A;  1BDJ B;  4QI0 A;  2ZPA A;  1Z23 A;  2OEV A;  1ORS C;  1ZW3 A;  3HTK C;  2MYS A;  4XPW A;  1H6G A;  1T9K A;  1RJ9 B;  3E70 C;  2HJ3 A;  2KK1 A;  2Y3H A;  3OEO A;  4J30 B;  3C8G B;  2J9B A;  3VRC A;  5T3T A;  4ANJ A;  4CIP A;  3DMD A;  1Q0M A;  3N0T A;  3RVY A;  4JTA B;  2A68 F;  2IXN A;  2C03 A;  4G7Z F;  2P7V A;  1MQV A;  2KSF A;  1EQ1 A;  4RBN A;  2HV6 A;  2W4B A;  4RDA A;  3U0C A;  3C63 A;  5A6B D;  1O5H A;  3T6J A;  1VYK A;  4EBB A;  4AL0 A;  4E0H A;  4J7Y A;  2NUT B;  3JTL O;  2J9U A;  3S9O A;  5COG A;  1A0B A;  1OR2 A;  3U3F A;  1JR8 A;  1LI7 A;  1T6I A;  2EPM X;  3M4C A;  4PFO A;  2IBF A;  1YLM A;  3F47 A;  3RIP A;  3QMK A;  3CAX A;  2EIK C;  1FNT c;  2XM4 A;  4JJF A;  2EPN A;  5TJ5 E;  4CS9 C;  2R7U A;  1LI5 A;  3SYN A;  3T6G B;  4N6C A;  2OU6 A;  3QTH A;  2JPU A;  3TK0 A;  5B1A C;  2B0J A;  3US6 A;  1J8Y F;  3TOL A;  5FCL A;  2IXO A;  3GEI A;  2R7V A;  1SMY F;  5HSW A;  3QW1 A;  3ZVR A;  2YHS A;  1E2X A;  3A9C A;  1RKE B;  3ZTZ A;  3K1I A;  3SXY A;  5L0J A;  2D5R B;  3V5Z A;  4KNW A;  4YT2 A;  3AG1 C;  3EH2 A;  4I3M A;  4Q7C A;  3HNJ A;  4ULW A;  5E3C A;  4BJT A;  4NTF A;  3JRM O;  5L3Q A;  1A41 A;  2EPL X;  3HLZ A;  5F5H A;  3I4U A;  1KU2 A;  4BJ1 A;  2XM0 A;  1NFN A;  1MND A;  3MFN A;  3B71 A;  2AVK A;  2R05 A;  3IPM O;  2HSQ A;  3UMK A;  1T6U A;  4DVY P;  1LE4 A;  5B3S C;  2XS1 A;  2EPK X;  4G7O F;  2WB7 A;  3B0P A;  2HS5 A;  4C7O A;  2QLA A;  1K05 A;  4CSA A;  1Z7Q c;  1TR2 A;  2VC9 A;  5KYW B;  5BQH A;  1IZM A;  3G4Z A;  1D1A A;  2KGO A;  2Y3G A;  1ORJ A;  2Y39 A;  3JYH A;  5JS5 A;  1GM5 A;  2YKZ A;  3U9J A;  4WAB A;  3C18 A;  3LS0 A;  2BE5 F;  3ASO C;  3AQB A;  3DE9 A;  2A0B A;  1Q0G A;  2DB4 A;  3FOO A;  1LS1 A;  4JVS A;  4XTK A;  2YLG A;  3B0U X;  4MVM A;  5L0G A;  2YL1 A;  2VCA A;  3VYW A;  2UUH A;  3ZSU A;  5AC4 A;  5L3V A;  2IYL D;  1EKY A;  1YDI A;  3EG9 B;  3HKK A;  4EBJ A;  5EHH A;  1CPR A;  2XL4 A;  4O79 A;  1KTM A;  1A7V A;  2H7O A;  3NYM A;  3U8P A;  1E85 A;  2O9X A;  1CGN A;  3C8G D;  4JJG A;  2W4M A;  3DXJ F;  3ZTM A;  1C03 A;  1V54 C;  1NG1 A;  3S28 A;  5GPG B;  2OKU A;  5DQT A;  1AVO B;  2P61 A;  2ZD9 A;  1VLS A;  1BBH A;  1OKK A;  1OQC A;  2Q4F A;  3X2Q C;  5A69 A;  3QW0 A;  1WWP A;  1NZE A;  1D0Z A;  1ZU5 A;  2WVO A;  3GEE A;  3EHN A;  1NBB A;  3M79 A;  2LD6 A;  4FWV A;  3R7C A;  4P9T A;  4XQ1 A;  1BR1 A;  4XWJ A;  3K33 A;  3KPH A;  3N2Z B;  3Q7G A;  2ICW G;  1IW7 F;  2OCC C;  2R9R B;  3G4X A;  1ZZP A;  2FFH A;  3OWT A;  4K7B A;  2Y3D A;  4DRH B;  4D4N A;  1FFH A;  3POV A;  1PCX A;  3L8J A;  5E33 A;  3PCV A;  4JEB A;  1BR4 A;  2QNL A;  3SEO A;  1H9T A;  2H7B A;  1OXK A;  1T5O A;  2OJQ A;  4C7O B;  1B68 A;  2LIG A;  4YT4 A;  4WJ0 A;  2DGJ A;  3DKA A;  3HNI A;  2W9Y A;  2L6G A;  1O3U A;  4YL0 A;  1JPJ A;  5KYU A;  2AP3 A;  1PD1 A;  3FMS A;  5IY5 C;  3T9O A;  4JCZ A;  3JZ0 A;  3LS1 A;  3UGP A;  4G78 A;  2A6H F;  3SZR A;  3F46 A;  3L34 A;  5JUA A;  2XLO A;  1CGO A;  2EPO A;  4PJJ A;  2L81 A;  4IAO A;  1VOM A;  3B29 A;  4XEF A;  3IEE A;  1OR3 A;  4DRJ B;  1VLT A;  3WHN A;  1M2O A;  1SZI A;  2YL3 A;  3H65 A;  2I15 A;  4EBK A;  2CNW A;  4I1O B;  1HW2 A;  3LEV A;  4ULV A;  3DAF A;  2Q00 A;  1R4T A;  4OD4 A;  1EA8 A;  2XLD A;  3IHU A;  4L6R A;  4CDA A;  1G4W R;  1ZU4 A;  4FX5 A;  4BEJ A;  5BQG A;  1YVI A;  4IRU A;  3SP1 A;  3MX3 A;  2WZL A;  5KYY A;  1JOG A;  4YL1 A;  2L7A A;  4BJ5 A;  3NMK A;  3ABK C;  4JCH A;  3V7O A;  1I4Y A;  1I4Z A;  2J7P A;  3U3B A;  1ZW2 A;  1WOL A;  2P1A A;  2HMZ A;  2CDQ A;  2X51 A;  4PK4 A;  3RQE A;  3UGO A;  4J32 B;  4DBR A;  2YL0 A;  3S0X A;  3RF3 A;  4MTF A;  3W4Y A;  4CJG A;  2JD3 A;  1YJG A;  3GWL A;  2XS8 A;  3EPV A;  3CQZ A;  1XWJ A;  3FAJ A;  1TFK B;  2DYR C;  3LJB A;  4MQ9 F;  3S27 A;  3SNH A;  1NSG B;  1WAS A;  3U9M A;  4G7H F;  2Z15 A;  3K66 A;  4EIY A;  2C04 A;  1LE2 A;  4DRI B;  3GM2 A;  2OEX A;  2ZXR A;  4A2N B;  4O7G A;  1TQG A;  1N1C A;  1QZX A;  2HMQ A;  3LES A;  3WOD F;  3DI5 A;  2GA0 A;  5L0D A;  3VF0 A;  3K1I C;  4E17 A;  2KC3 A;  1VYI A;  2CCY A;  4OD5 A;  1D0X A;  2J9W A;  2LSE A;  1WN0 A;  3AGU A;  2DI3 A;  4JEA A;  4U5F E;  2R25 A;  4KC9 A;  2EIN C;  4IB4 A;  1SF8 A;  3M4B A;  2PNO A;  3EGD A;  3MLG A;  5DQZ A;  2QTV A;  4E0I A;  3W8I A;  3TOM A;  4PJN A;  1XZQ A;  4C3E A;  4JE9 A;  3GM3 A;  1L7C A;  4U5C E;  2XXA B;  3N24 A;  3EFO A;  4O6N A;  3U5S A;  1C17 M;  2LCH A;  4JC7 A;  4C3D A;  2A69 F;  1ZHZ A;  1A7D A;  1BR2 A;  1NFO A;  3EJN A;  4GYT A;  4IGG A;  3GEH A;  4CSA C;  4C3B A;  1QSP A;  3ZQV A;  4CJO A;  1HE9 A;  1Q0F A;  2A1D D;  2WVN A;  3K1H A;  5A6A A;  4CBE A;  4E7S A;  3LNM B;  2Q9B A;  3DD7 A;  4JTC B;  3NKE A;  2P6V A;  4XPY A;  4YK5 A;  3HNL A;  1MNE A;  4XPX A;  3GOR A;  4PR9 A;  3V5Y A;  1M56 C;  1UFB A;  2YQY A;  3BEH A;  3ABL C;  4W8P A;  2CW0 F;  4WGY A;  3RYL A;  3W2V A;  4O6M A;  3ZG1 A;  5A6B A;  4LDR A;  3E9V A;  1OXB A;  1ST6 A;  3JCU Q;  4DVZ A;  3J06 A;  2ASR A;  4NC3 A;  1QPU A;  4MVU A;  2MWQ A;  3AJM A;  4H4K C;  4R32 A;  4CIH A;  1YA7 O;  1Z63 A;  256B A;  4JW1 A;  2GAQ A;  1I5N A;  2XLH A;  2IXP A;  2NPU A;  3Q6N A;  3DJN B;  2J45 A;  4OIQ F;  1FTS A;  1LKX A;  4LAC B;  2BC5 A;  3FHD A;  2M4E A;  3TUL A;  1FAP B;  1U6H A;  3AG3 C;  1M57 C;  2GWW A;  2YVK A;  3I5Q A;  4W8K A;  2Q9C A;  2D4U A;  5BQI A;  2GDC A;  1V74 B;  2LK4 A;  5BUO A;  1VMA A;  2DYS C;  3EH1 A;  3ZC4 A;  3WAQ A;  1GQA A;  4PJM A;  1D1C A;  5A6J A;  3CSK A;  4ER9 A;  2QY9 A;  1JAF A;  4EKW A;  3Q6M A;  2IOQ A;  1HMO A;  2V26 A;  1D1B A;  2G3V A;  3EGD B;  2VH3 A;  1NU9 C;  4EWC A;  4MVO A;  3EZH A;  2MHR A;  1ZHW A;  2W45 A;  2XLE A;  4XEK A;  2OG2 A;  3RH3 A;  1T6Q A;  2KYH A;  2L6H A;  3M1C B;  1TFO B;  4HFF B;  4HEA J;  1Q0D A;  3ITF A;  4PJL A;  3ZIB A;  1QQ3 A;  4DXW A;  3ATP A;  3EFO B;  1YYX A;  4HE8 D;  4MVZ A;  5T1D B;  4OIN F;  5JRA A;  1JPN A;  2CYD A;  3VM6 A;  3TJ5 A;  2KW3 C;  4D4X A;  2HFI A;  4E18 A;  2RD9 A;  2A0U A;  4EHP A;  2AU5 A;  2FGY A;  4YN0 B;  2KQ9 A;  5DS5 A;  3B9Q A;  4MW8 A;  4J7T A;  4FES A;  5EGY A;  1TWG A;  2NG1 A;  3ASN C;  1YAR O;  1PD0 A;  4NQF A;  2J46 A;  3T6B A;  3PHF 2;  3EHM A;  1RKC A;  2R02 A;  2HV7 A;  2WL8 A;  4ZLD A;  5K0I A;  4YT8 A;  3MBG A;  2R7W A;  5L0F A;  3DAG A;  2YWA A;  4N06 A;  1C02 A;  1OW7 A;  3EZI A;  1ZVZ A;  4A4A A;  1HW1 A;  1J8M F;  4MTG A;  4JRZ A;  4U9D A;  1LPE A;  1APC A;  4MVR A;  4QI2 A;  3TQO A;  1Q0K A;  1RJ9 A;  3X1O A;  2XLW A;  1NU7 D;  2R7Q A;  3FXH A;  3IQ5 A;  4EUK B;  1GGQ A;  3ECS A;  2NSG A;  4WGZ A;  1E86 A;  2J0X A;  3O39 A;  4B6I A;  2XL6 A;  3VAY A;  1ZYR F;  2E87 A;  3KH2 A;  4BJ5 C;  1G8X A;  1LVK A;  2PFD A;  2VCC A;  1H7I A;  1QLE C;  2J0W A;  3NG1 A;  4BJ6 A;  1HMD A;  1E83 A;  5L0C A;  1TWH A;  4UDV A;  2FAP B;  3C62 A;  3IQC A;  3W8H A;  1WTY A;  1FMW A;  2ZXO A;  3U2M A;  4DOZ A;  2NSF A;  2UUI A;  4MND A;  2ETS A;  2R7O A;  2NUT A;  3LEO A;  1ZHT A;  3A11 A;  4IJJ A;  3DM5 A;  2VCB A;  1R5I D;  4PAC A;  3UR3 C;  3NRH A;  3BRJ A;  3WG7 C;  4U9E A;  4JIO A;  2PX0 A;  2XL8 A;  2JX0 A;  2XLV A;  1LM3 B;  1WGW A;  1YAU O;  2VB6 A;  1U0B B;  4H54 A;  1OCR C;  1YZA A;  1DOV A;  1D0Y A;  1BZ4 A;  2IXM A;  1RKE A;  5DS6 A;  4O6Y A;  3RQG A;  4Z9H A;  5B1B C;  3ABM C;  4K0D A;  1RXQ A;  2AWY A;  1H9G A;  3OA1 A;  2BL2 A;  3FDQ A;  5E2Q A;  3JSZ A;  2Q7R A;  2LFD A;  3NYL A;  2OOC A;  4RD9 A;  5FZT A;  4CS8 A;  1TKN A;  2KJG A;  4U5D E;  4IAR A;  2R7R A;  3RKO F;  3H2U A;  4YT5 A;  1LIH A;  4G0H A;  5D91 A;  3PDM P;  3AGT A;  3IQT A;  5JVE A;  3G50 A;  2RSE B;  1A7E A;  2HZ8 A;  3CZ6 A;  3O55 A;  4XLN F;  5AC5 A;  3K7D A;  1MMD A;  1VB5 A;  2KNH A;  2ZXW C;  4OIR F;  4LER A;  4U5E E;  3JT1 A;  3SXZ A;  5COM A;  5B3I A;  2YLI A;  5KYU B;  3S29 A;  1K04 A;  1FFT C;  2PF4 E;  4NY3 A;  1L3P A;  2EIJ C;  4KBL A;  5KYW A;  5E3A A;  4OIO F;  5JSL A;  4CDV A;  2L6F A;  3B0V C;  3H2V A;  3C7J A;  3NMI A;  3Q7L A;  2R7S A;  3S90 A;  3EGX A;  3RVZ A;  3O10 A;  3U2L A;  5DS4 A; 
#chains in the Genus database with same CATH homology
 2OOC A;  1A0B A;  1TQG A;  1YVI A;  1FR0 A;  1OXK A;  4PAC A;  3IQT A;  1C03 A;  1C02 A;  1OXB A;  1BDJ B;  1WN0 A;  3U3B A;  2R25 A;  2Q4F A;  1I5N A;  3US6 A;  3MYF A;  4G78 A;  4EUK B;  2LD6 A;  2LP4 A;  1SR2 A;  1Y6D A;  2A0B A;  3KYI A;  2LCH A;  3KYJ A;  1QSP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...