3IQTA

Structure of the hpt domain of sensor protein bara from escherichia coli cft073.
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
123
structure length
123
Chain Sequence
SNAVNEIVVNPNATLDWQLALRQAAGKTDLARDMLQMLLDFLPEVRNKVEEQLVGENPEGLVDLIHKLHGSCGYSGVPRMKNLCQLIEQQLRSGTKEEDLEPELLELLDEMDNVAREASKILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Signal transduction histidine-protein kinase barA
publication title Structure of the HPT domain of Sensor protein barA from Escherichia coli CFT073.
rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 41
structure length 123
sequence length 123
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2009-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01627 Hpt Hpt domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.160 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) HPT domain 3iqtA01
4EUKB 2R25A 1Y6DA 1C02A 3US6A 3IQTA 2LP4A 4G78A 1QSPA 1OXBA 1SR2A 3KYIA 3KYJA 1FR0A 1A0BA 2LD6A 1WN0A 1C03A 2OOCA 1I5NA 1TQGA 2A0BA 4PACA 3U3BA 1YVIA 2Q4FA 3MYFA 2LCHA 1OXKA 1BDJB
chains in the Genus database with same CATH superfamily
3ABLC 2AVKA 3KMIA 1JMWA 2Q00A 3EFOA 3HNIA 2GA0A 2G3KA 3AG2C 3JRMO 4Q7CA 2DB4A 3K33A 4IWBA 1QSPA 1J8YF 4KI2A 3GEIA 2YL0A 2DI3A 4MVRA 4CIHA 2KW3C 4G7ZF 1T6QA 1H7IA 3L34A 4CS8C 2R7QA 1Z7Qc 5K0IA 3L0IA 3EGXA 4ULVA 1VB5A 1Z23A 4C3DA 3TJ5A 3MFNA 4YT4A 1SMYF 2C04A 3AG3C 4DBQA 2PBEA 5D92A 1TWGA 1LPEA 2PFDA 2NUPA 1A41A 3UMIA 4Z9IA 1NG1A 2IXPA 1LM3B 5TJ5E 3KL4A 3JZ0A 4O7GA 3W2VA 4YL0A 4U5EE 4BG0A 4JTDB 3ZQYA 4EIYA 4DJ9A 4FAPB 3K7DA 1HY5A 3X2QC 4DRJB 1DOWA 1B68A 4BEJA 1KU2A 2A6HF 3U5SA 5L0JA 2HJ3A 3EZHA 3X1OA 5BQHA 3KKBA 2B0JA 4NTFA 3RFYA 4D4XA 4U5FE 2KYHA 3J06A 4C3BA 1MMNA 5B3IA 3IPMO 4GQHA 5B3SC 2MHRA 1FFTC 4JURI 4MTFA 3GWNA 2A1DD 2EPKX 2EPLX 3HNLA 3A9CA 3NYJA 4E0IA 1XZQA 1ZHYA 4IJJA 3H2UA 1D1CA 1A7EA 3NRHA 4KNVA 4YL3A 5BQGA 4KC9A 5JRAA 1OW7A 3G4XA 4U5CE 2Z15A 3SEOA 4DVZA 1RXQA 1U89A 5COMA 5DS5A 4CDAA 1TWCA 2FGYA 3C8GA 2P6VA 1AUEA 1GGQA 3EFOB 4B6IA 1PD0A 3K66A 4G0HA 2CNWD 3ABMC 1OW6A 3KH2A 2J9UA 2XM4A 2PNOA 4YJWA 4AE4A 5A6AA 4XEVA 1GQAA 3M1CB 2BC5A 2W4BA 2VB6A 3IEEA 3L1MA 3DXJF 3EGXB 2YZSA 1UG7A 1N1CA 3SNHA 4XTKA 4DVYP 1Q0KA 2LSEA 5CI9A 2B0HA 4OINF 1SR2A 1YLMA 4PR9A 2GFHA 3NYLA 4BJ1A 1T5OA 2CGEA 3GM3A 4MW8A 2V26A 4PFOA 4WGYA 1CGOA 2A69F 3DE8A 3ATPA 4O6NA 4LACB 1O87A 5T1DB 2HV7A 2R7TA 3ASOC 3CZ6A 4QDLA 2MYSA 3ITFA 2HJMA 4MVOA 4I44A 4PJMA 5COGA 2D5RB 3ZIBA 2XM0A 4EBJA 5BUOA 4F4BA 1ZZPA 1ZU5A 5KYUA 1NSGB 1AEPA 5A69A 1CGNA 1Q0DA 4QI0A 1PD1A 1RKEA 3VYWA 3AGUA 4J30B 5L3VA 3IHUA 1EA8A 3Q7GA 2NPUA 5A6JA 3R7CA 4JW1A 5AGFA 2AWCA 1OXBA 3ZG1A 3EHNA 3RQGA 4ULWA 2IXNA 2VCAA 3WHNA 5L3QA 5DS6A 1G4WR 3M15A 3NMKA 1A0BA 3LNMB 2KC3A 4YT2A 1LS4A 3C8GB 4A2NB 5T3TA 4OIRF 1JR8A 4LLCA 1MNEA 1Q0MA 3U9JA 1C03A 2J7PA 5CIVA 3EH2A 4XPYA 4AE4B 1E83A 2WVNA 2WZLA 2M64A 5F28E 3UMKA 3WODF 2HKVA 1EKYA 1G5ZA 1CGME 2NSFA 4UDVA 1A7VA 1BDJB 4XPXA 2JPUA 1FMVA 3DAFA 2R9RB 4XLNF 2A6EF 3ECSA 2HMQA 2HSQA 5EK0A 3G50A 3JSZA 3E9VA 1ORSC 2WVOA 2WZFA 2WB7A 2XL8A 1V54C 4JE9A 1GS9A 2YEVA 3TK0A 5A6BD 2R7WA 3KYIA 1GM5A 1BR4A 1T01A 2ZXRA 4LERA 1M57C 2IBFA 1ZHTA 2XL4A 3TOLA 5L0HA 2J7PD 1WN0A 3DWWA 3NMIA 4A4AA 3ZVRA 1WWPA 2X51A 1MMAA 5KYUB 2EIKC 4CS9C 3NYMA 1VMAA 3B71A 3VRCA 1WATA 3IQ6A 1RKEB 1V74B 3N24A 2UUHA 4KBLA 2W45A 4NY3A 2IOQA 1D1AA 2OU6A 3LUTB 2QLAA 3HJCA 4N4WA 2YRFA 1HE9A 4J7YA 4G7OF 1EI7A 2KGOA 4XPWA 4OIQF 3JCUQ 4EWCA 4FX5A 2HZ8A 4PJLA 3UGOA 3NMJA 1VLTA 5F5HA 4H4KC 3LS1A 1ZW3A 4E7SA 2ASRA 3UGPA 1VYIA 4I3MA 1HMDA 1XZPA 4CS8A 3JYHA 2R05A 1K05A 3DE9A 1TQGA 1G4US 3DJNB 1EQ1A 2EPMX 1YA7O 2EIJC 4XQ1A 3RQFA 1YVIA 3RYLA 4BJ5C 4C3EA 1H9TA 2Q4FA 1OW8A 3HTKC 3NG1A 2YKZA 5JSLA 3F46A 2YL7A 3FHDA 1QPUA 4GYTA 1M2OA 2XLMA 4NQFA 4RDAA 4CDYA 2VCBA 3C8ZA 4NC3A 1FTSA 2CNWA 5FCLA 3IQTA 5L0GA 1Z6AA 1E85A 2BL2A 2LQGA 1NLXA 2ZXPA 3CSKA 2GWWA 2WVQA 2L6HA 3DD7A 3PCVA 3FAPB 4BEMJ 4FESA 1YDIA 2Y3BA 4MVZA 4DOZA 4IRUA 3LAYA 2XXAA 2I15A 1FAPB 2HFIA 2RD9A 1L7CA 2LD6A 3FOOA 5E2QA 3GM2A 3U8PA 4W8KA 2PX0A 5L0DA 3MLGA 4P9FA 4X0RA 4Q4ZF 3QW0A 3NDBB 1F1MA 2Q3TA 2A0BA 1BBHA 3U3BA 1VLSA 5EGYA 1HW2A 2PF4E 3UNGC 5HSWA 2F22A 1ZW2A 1Q0GA 3F47A 5T3WA 5KYNA 1NFNA 3O10A 2KQ9A 1MQVA 4OD4A 2M4EA 2Q9BA 3U0CA 2OJED 4JKVA 2P0NA 2FAPB 2D4UA 4PJJA 3IQCA 4BPMA 3AGTA 3TJ6A 2Y3DA 2L6GA 4YWQA 1YARO 2HMZA 2X0CA 5DQTA 4C7OA 2EINC 4DRHB 2YLIA 1O3UA 3EH1A 3GM1A 4JCZA 5L0FA 2H7BA 3ZSUA 1TFOB 1ZHZA 3JSEO 5CI8A 1TFKB 3GANA 1LE2A 4PJNA 2NUPB 4I1MA 1XWJA 3C18A 3B9QA 2ZD9A 3Q6NA 2A0UA 4RBNA 5KYXA 2JD3A 5FZTA 2QUPA 4MVMA 1WTYA 5DLJA 5JUAA 2QNLA 3I4UA 4LLEA 2HS5A 2J9WA 4NTBA 3B0UX 1UFBA 4E17A 4MTOA 2P7VA 3ZTZA 3QVZA 3L8IA 3M4BA 2GDCA 4P9TA 2OEVA 3CAXA 3FXHA 3K1IA 1APCA 4PFPA 2VC9A 5D91A 5B1BC 2R7SA 2C03A 4JTCB 5KYWA 3LEOA 4EHPA 2XLWA 3VF0A 1LS1A 3DZAA 1CPQA 4E7ZA 2XXAB 1YZCA 3G4ZA 4U9DA 4EBBA 4GEHA 3B0VC 4J32B 1A7DA 3EGDA 1Q0FA 5JLIA 3MBGA 2L6FA 4ER9A 3KYJA 1QQ3A 3O55A 2R02A 3EG9A 4JJFA 3RVZA 1WGWA 2FFHA 2EPOA 3U3FA 3WAQA 1YAUO 3B29A 4CJGA 1OCCC 2VCCA 4U9EA 3SYNA 3V5ZA 5A6BA 1ZU4A 3EQLF 1VK5A 1I4YA 3LLKA 2J9VA 1L3PA 4MVUA 4Q5SF 3N0TA 4Z9JA 2Y3HA 3MYFA 5E33A 3TOMA 4XEFA 2AU5A 2VH3A 3GORA 1LE4A 3FAJA 4KNWA 4JIOA 4NTAA 5KYYA 2W4MA 3AG1C 3SZRA 4C7OB 1TR2A 1H6GA 3V5YA 2J8WA 1ZHXA 2KK1A 4FWVA 3E70C 4YT5A 4QI2A 1ZVZA 2W9YA 3B0PA 1LKXA 3C7JA 4AL0A 5COFA 2R03A 4DBRA 4PK4A 256BA 3TD7A 4LDKA 2DYRC 5KYXB 1JOGA 1MMGA 2R7UA 3QMKA 1E86A 4CSAC 1ORYA 3NKDA 2QTVA 2I8BA 2E87A 4EBKA 4OIOF 3RF3A 4MQ9F 5EHHA 2Q9AA 4BJ6C 1Z5ZA 5AC4A 2OOCA 4IB4A 4PACA 4I1OB 4Z9HA 3PHF2 1HMOA 1ZHWA 4J7TA 3S29A 3GODA 5KYWB 2YVKA 4BJTA 3SXKA 1AVOB 3EHMA 4XEKA 1Y4CA 3DKAA 3VAYA 1MMDA 3U9MA 2YLGA 1NFOA 2YLDA 1T9KA 1D0YA 2Y3GA 3C62A 3K6BA 3QW1A 4O6MA 3SP1A 2EIMC 2OQMA 3ZQVA 4HE8D 3EG9B 1JRAA 3RVYA 1WASA 3W4YA 2ZXWC 1D0XA 5JS5A 4JTAB 3PDMP 3POVA 1NZEA 3H65A 2WL8A 1T6IA 3M79A 2P61A 4E18A 4JJGA 4H54A 1TKNA 3LESA 5HV9A 3AJMA 3EPVA 4ZLCA 2LFFA 1O5HA 3ZDLA 5A6KA 2XSEA 3OEOA 2R7RA 3OWTA 3QTHA 3SXMA 3ZTMA 4G7HF 1KNYA 4MVSA 4D4NA 5KYYB 2YQYA 5B1AC 3LJBA 4W8PA 3RW0A 4AX2A 1KTMA 1V55C 3WG7C 5JT4A 1OXKA 2XLEA 1CPRA 4MVQA 2CDQA 3T6BA 4BJ5A 4ONSA 1SF8A 3W8HA 1QKRA 2ZXOA 4AK9A 3VM6A 1YYXA 3AQCA 3ZC4A 2XRHA 3JRTA 4O79A 3S84A 5DQZA 5L0IA 3FVYA 3EJNA 4K7BA 5GPGB 3MYIA 3SXYA 1J8MF 5E3AA 3GWLA 1M2VA 2IXMA 4U5BE 1I4ZA 1D0ZA 1E2XA 1T6UA 2Y39A 3GEEA 3IQ5A 1M6TA 2J0WA 1C17M 2KSFA 3BRJA 1Z63A 4ANJA 2LFDA 2CYDA 4WABA 2HV6A 1I5NA 4E0HA 4K1OA 3S9OA 3FDQA 1TWAA 2DGJA 3W8IA 2KJGA 2PX3A 1OCZC 2LCHA 2AP3A 2Q9CA 2CCYA 2RSEB 3QZCA 4YL1A 3LLIA 4JCHA 2OCCC 4HFFB 3R2PA 5IY5C 1JPNA 2HSBA 1BR2A 3DM9B 4MNDA 2GAQA 3U8VA 2NG1A 5BQIA 4OIPF 1TWHA 3US6A 2MWQA 5E3CA 2ICWG 1NU9C 3V5XA 3HKKA 1FNTc 1W2WA 1ST6A 3HNKA 1R4TA 1V4AA 2G62A 1LI7A 1U6HA 1R5ID 1BR1A 2G3VA 4P6IC 3RKOF 4MW3A 4CS7A 1NBBA 2IM8A 3A11A 3UMHA 1YJGA 4CJOA 4K0DA 3I5QA 2YHSA 2PP4A 3M4CA 3QVYA 3ZWIA 4CIPA 1QVXA 3DJUB 1OQCA 3FMSA 2JX0A 2KNHA 2J9BA 2YWAA 3CQZA 2R25A 4XWJA 1PCXA 2XLVA 2ZPAA 3I5PA 3O39A 2J46A 3KPHA 3H2VA 2R7XA 1S05A 1VOMA 2BE5F 3JYYA 3OA1A 4L6RA 2NUTA 2LK4A 3AQBA 1OR3A 4U5DE 1M2VB 2LIGA 1YZAA 3U2MA 1YA9A 4G78A 1IZMA 4MS2A 1RJ9A 1QZXA 3HLZA 1WOLA 3S27A 2R7OA 1HE1A 1JPJA 2Y69C 3N2ZB 2QE9A 2XLDA 1FR0A 2H7OA 1RCPA 1S7ZA 3UR3C 4JEBA 4R32A 4CBEA 3V7OA 4CS9A 2P1AA 3T6GB 3C8GD 3DI5A 3C63A 1H9GA 4IARA 1FFHA 2H8AA 4EKWA 4N6CA 3BEHA 3FOPA 3TULA 1K04A 3AG4C 2HUJA 4U5GA 4IGGA 3K1IC 4JC7A 4AL1A 1JAFA 4ZLDA 1YYJA 2WZGA 2L9JA 2NSGA 2XS1A 2EPNA 4JRZA 4LDQA 3S28A 5AC5A 2O9XA 2Q7RA 3Q7LA 1C02A 4XLPF 4HFKB 2H7VC 2LP4A 4NCQA 2OG2A 4O6YA 3L8JA 1LIHA 1VYKA 4OD5A 5DVWA 4YK5A 1E84A 3RQEA 1IW7F 3GEHA 3T9OA 1ZYRF 1U0BB 4RD9A 1SYQA 1G8XA 2V3CC 2TMVP 2J45A 3HNJA 4LDRA 1M56C 1PV3A 1LVKA 3ABKC 3RH3A 4CX9A 4M63A 4CSAA 4MTGA 3ASNC 3DAGA 4YT8A 1OKKA 2CW0F 2UUIA 4U5HA 3DMDA 1QLEC 1SZIA 2XL6A 4BJ6A 2NUTB 5DS4A 2IYLD 2XS8A 5JP7A 1OCOC 3AOUA 3JTLO 1BZ4A 4EUKB 1LI5A 2VASA 5L0CA 3S0XA 3S90A 4CDVA 1RJ9B 1FMWA 1Y6DA 3W2WA 3T6JA 3T4RA 5F5FA 3EGDB 1HW1A 1K40A 2AWYA 3CEXA 3U2LA 2L7AA 2OJQA 3SXZA 2OKUA 1DOVA 2ETSA 3LEVA 4N6HA 1RMVA 1NU7D 2IXOA 2J0XA 2DYSC 2YL1A 3NKEA 5JVEA 4DRIB 3RIPA 3TQOA 2EILC 4WJ0A 2R7VA 4JVSA 4JEAA 1RKCA 2A68F 1MNDA 1OR2A 1OKKD 2XLHA 2XLOA 2YL3A 3LNRA 3LS0A 3MX3A 3O6XA 3Q6MA 2L81A 4IAOA 1OCRC 1ORJA 4N06A 1Z3IX 4JZAA 3K1HA 4HEAJ 1D1BA 2QY9A 4DXWA 3PMRA 3EZIA 2OEXA 3JT1A 4YN0B 3DM5A 1VTMP 4IAQA 4WGZA
chains in the Genus database with same CATH topology
4EUKB 2R25A 1Y6DA 1C02A 3US6A 3IQTA 2LP4A 4G78A 1QSPA 1OXBA 1SR2A 3KYIA 3KYJA 1FR0A 1A0BA 2LD6A 1WN0A 1C03A 2OOCA 1I5NA 1TQGA 2A0BA 4PACA 3U3BA 1YVIA 2Q4FA 3MYFA 2LCHA 1OXKA 1BDJB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EUK B;  2R25 A;  1Y6D A;  1C02 A;  3US6 A;  3IQT A;  2LP4 A;  4G78 A;  1QSP A;  1OXB A;  1SR2 A;  3KYI A;  3KYJ A;  1FR0 A;  1A0B A;  2LD6 A;  1WN0 A;  1C03 A;  2OOC A;  1I5N A;  1TQG A;  2A0B A;  4PAC A;  3U3B A;  1YVI A;  2Q4F A;  3MYF A;  2LCH A;  1OXK A;  1BDJ B; 
#chains in the Genus database with same CATH topology
 3ABL C;  2AVK A;  3KMI A;  1JMW A;  2Q00 A;  3EFO A;  3HNI A;  2GA0 A;  2G3K A;  3AG2 C;  3JRM O;  4Q7C A;  2DB4 A;  3K33 A;  4IWB A;  1QSP A;  1J8Y F;  4KI2 A;  3GEI A;  2YL0 A;  2DI3 A;  4MVR A;  4CIH A;  2KW3 C;  4G7Z F;  1T6Q A;  1H7I A;  3L34 A;  4CS8 C;  2R7Q A;  1Z7Q c;  5K0I A;  3L0I A;  3EGX A;  4ULV A;  1VB5 A;  1Z23 A;  4C3D A;  3TJ5 A;  3MFN A;  4YT4 A;  1SMY F;  2C04 A;  3AG3 C;  4DBQ A;  2PBE A;  5D92 A;  1TWG A;  1LPE A;  2PFD A;  2NUP A;  1A41 A;  3UMI A;  4Z9I A;  1NG1 A;  2IXP A;  1LM3 B;  5TJ5 E;  3KL4 A;  3JZ0 A;  4O7G A;  3W2V A;  4YL0 A;  4U5E E;  4BG0 A;  4JTD B;  3ZQY A;  4EIY A;  4DJ9 A;  4FAP B;  3K7D A;  1HY5 A;  3X2Q C;  4DRJ B;  1DOW A;  1B68 A;  4BEJ A;  1KU2 A;  2A6H F;  3U5S A;  5L0J A;  2HJ3 A;  3EZH A;  3X1O A;  5BQH A;  3KKB A;  2B0J A;  4NTF A;  3RFY A;  4D4X A;  4U5F E;  2KYH A;  3J06 A;  4C3B A;  1MMN A;  5B3I A;  3IPM O;  4GQH A;  5B3S C;  2MHR A;  1FFT C;  4JUR I;  4MTF A;  3GWN A;  2A1D D;  2EPK X;  2EPL X;  3HNL A;  3A9C A;  3NYJ A;  4E0I A;  1XZQ A;  1ZHY A;  4IJJ A;  3H2U A;  1D1C A;  1A7E A;  3NRH A;  4KNV A;  4YL3 A;  5BQG A;  4KC9 A;  5JRA A;  1OW7 A;  3G4X A;  4U5C E;  2Z15 A;  3SEO A;  4DVZ A;  1RXQ A;  1U89 A;  5COM A;  5DS5 A;  4CDA A;  1TWC A;  2FGY A;  3C8G A;  2P6V A;  1AUE A;  1GGQ A;  3EFO B;  4B6I A;  1PD0 A;  3K66 A;  4G0H A;  2CNW D;  3ABM C;  1OW6 A;  3KH2 A;  2J9U A;  2XM4 A;  2PNO A;  4YJW A;  4AE4 A;  5A6A A;  4XEV A;  1GQA A;  3M1C B;  2BC5 A;  2W4B A;  2VB6 A;  3IEE A;  3L1M A;  3DXJ F;  3EGX B;  2YZS A;  1UG7 A;  1N1C A;  3SNH A;  4XTK A;  4DVY P;  1Q0K A;  2LSE A;  5CI9 A;  2B0H A;  4OIN F;  1SR2 A;  1YLM A;  4PR9 A;  2GFH A;  3NYL A;  4BJ1 A;  1T5O A;  2CGE A;  3GM3 A;  4MW8 A;  2V26 A;  4PFO A;  4WGY A;  1CGO A;  2A69 F;  3DE8 A;  3ATP A;  4O6N A;  4LAC B;  1O87 A;  5T1D B;  2HV7 A;  2R7T A;  3ASO C;  3CZ6 A;  4QDL A;  2MYS A;  3ITF A;  2HJM A;  4MVO A;  4I44 A;  4PJM A;  5COG A;  2D5R B;  3ZIB A;  2XM0 A;  4EBJ A;  5BUO A;  4F4B A;  1ZZP A;  1ZU5 A;  5KYU A;  1NSG B;  1AEP A;  5A69 A;  1CGN A;  1Q0D A;  4QI0 A;  1PD1 A;  1RKE A;  3VYW A;  3AGU A;  4J30 B;  5L3V A;  3IHU A;  1EA8 A;  3Q7G A;  2NPU A;  5A6J A;  3R7C A;  4JW1 A;  5AGF A;  2AWC A;  1OXB A;  3ZG1 A;  3EHN A;  3RQG A;  4ULW A;  2IXN A;  2VCA A;  3WHN A;  5L3Q A;  5DS6 A;  1G4W R;  3M15 A;  3NMK A;  1A0B A;  3LNM B;  2KC3 A;  4YT2 A;  1LS4 A;  3C8G B;  4A2N B;  5T3T A;  4OIR F;  1JR8 A;  4LLC A;  1MNE A;  1Q0M A;  3U9J A;  1C03 A;  2J7P A;  5CIV A;  3EH2 A;  4XPY A;  4AE4 B;  1E83 A;  2WVN A;  2WZL A;  2M64 A;  5F28 E;  3UMK A;  3WOD F;  2HKV A;  1EKY A;  1G5Z A;  1CGM E;  2NSF A;  4UDV A;  1A7V A;  1BDJ B;  4XPX A;  2JPU A;  1FMV A;  3DAF A;  2R9R B;  4XLN F;  2A6E F;  3ECS A;  2HMQ A;  2HSQ A;  5EK0 A;  3G50 A;  3JSZ A;  3E9V A;  1ORS C;  2WVO A;  2WZF A;  2WB7 A;  2XL8 A;  1V54 C;  4JE9 A;  1GS9 A;  2YEV A;  3TK0 A;  5A6B D;  2R7W A;  3KYI A;  1GM5 A;  1BR4 A;  1T01 A;  2ZXR A;  4LER A;  1M57 C;  2IBF A;  1ZHT A;  2XL4 A;  3TOL A;  5L0H A;  2J7P D;  1WN0 A;  3DWW A;  3NMI A;  4A4A A;  3ZVR A;  1WWP A;  2X51 A;  1MMA A;  5KYU B;  2EIK C;  4CS9 C;  3NYM A;  1VMA A;  3B71 A;  3VRC A;  1WAT A;  3IQ6 A;  1RKE B;  1V74 B;  3N24 A;  2UUH A;  4KBL A;  2W45 A;  4NY3 A;  2IOQ A;  1D1A A;  2OU6 A;  3LUT B;  2QLA A;  3HJC A;  4N4W A;  2YRF A;  1HE9 A;  4J7Y A;  4G7O F;  1EI7 A;  2KGO A;  4XPW A;  4OIQ F;  3JCU Q;  4EWC A;  4FX5 A;  2HZ8 A;  4PJL A;  3UGO A;  3NMJ A;  1VLT A;  5F5H A;  4H4K C;  3LS1 A;  1ZW3 A;  4E7S A;  2ASR A;  3UGP A;  1VYI A;  4I3M A;  1HMD A;  1XZP A;  4CS8 A;  3JYH A;  2R05 A;  1K05 A;  3DE9 A;  1TQG A;  1G4U S;  3DJN B;  1EQ1 A;  2EPM X;  1YA7 O;  2EIJ C;  4XQ1 A;  3RQF A;  1YVI A;  3RYL A;  4BJ5 C;  4C3E A;  1H9T A;  2Q4F A;  1OW8 A;  3HTK C;  3NG1 A;  2YKZ A;  5JSL A;  3F46 A;  2YL7 A;  3FHD A;  1QPU A;  4GYT A;  1M2O A;  2XLM A;  4NQF A;  4RDA A;  4CDY A;  2VCB A;  3C8Z A;  4NC3 A;  1FTS A;  2CNW A;  5FCL A;  3IQT A;  5L0G A;  1Z6A A;  1E85 A;  2BL2 A;  2LQG A;  1NLX A;  2ZXP A;  3CSK A;  2GWW A;  2WVQ A;  2L6H A;  3DD7 A;  3PCV A;  3FAP B;  4BEM J;  4FES A;  1YDI A;  2Y3B A;  4MVZ A;  4DOZ A;  4IRU A;  3LAY A;  2XXA A;  2I15 A;  1FAP B;  2HFI A;  2RD9 A;  1L7C A;  2LD6 A;  3FOO A;  5E2Q A;  3GM2 A;  3U8P A;  4W8K A;  2PX0 A;  5L0D A;  3MLG A;  4P9F A;  4X0R A;  4Q4Z F;  3QW0 A;  3NDB B;  1F1M A;  2Q3T A;  2A0B A;  1BBH A;  3U3B A;  1VLS A;  5EGY A;  1HW2 A;  2PF4 E;  3UNG C;  5HSW A;  2F22 A;  1ZW2 A;  1Q0G A;  3F47 A;  5T3W A;  5KYN A;  1NFN A;  3O10 A;  2KQ9 A;  1MQV A;  4OD4 A;  2M4E A;  2Q9B A;  3U0C A;  2OJE D;  4JKV A;  2P0N A;  2FAP B;  2D4U A;  4PJJ A;  3IQC A;  4BPM A;  3AGT A;  3TJ6 A;  2Y3D A;  2L6G A;  4YWQ A;  1YAR O;  2HMZ A;  2X0C A;  5DQT A;  4C7O A;  2EIN C;  4DRH B;  2YLI A;  1O3U A;  3EH1 A;  3GM1 A;  4JCZ A;  5L0F A;  2H7B A;  3ZSU A;  1TFO B;  1ZHZ A;  3JSE O;  5CI8 A;  1TFK B;  3GAN A;  1LE2 A;  4PJN A;  2NUP B;  4I1M A;  1XWJ A;  3C18 A;  3B9Q A;  2ZD9 A;  3Q6N A;  2A0U A;  4RBN A;  5KYX A;  2JD3 A;  5FZT A;  2QUP A;  4MVM A;  1WTY A;  5DLJ A;  5JUA A;  2QNL A;  3I4U A;  4LLE A;  2HS5 A;  2J9W A;  4NTB A;  3B0U X;  1UFB A;  4E17 A;  4MTO A;  2P7V A;  3ZTZ A;  3QVZ A;  3L8I A;  3M4B A;  2GDC A;  4P9T A;  2OEV A;  3CAX A;  3FXH A;  3K1I A;  1APC A;  4PFP A;  2VC9 A;  5D91 A;  5B1B C;  2R7S A;  2C03 A;  4JTC B;  5KYW A;  3LEO A;  4EHP A;  2XLW A;  3VF0 A;  1LS1 A;  3DZA A;  1CPQ A;  4E7Z A;  2XXA B;  1YZC A;  3G4Z A;  4U9D A;  4EBB A;  4GEH A;  3B0V C;  4J32 B;  1A7D A;  3EGD A;  1Q0F A;  5JLI A;  3MBG A;  2L6F A;  4ER9 A;  3KYJ A;  1QQ3 A;  3O55 A;  2R02 A;  3EG9 A;  4JJF A;  3RVZ A;  1WGW A;  2FFH A;  2EPO A;  3U3F A;  3WAQ A;  1YAU O;  3B29 A;  4CJG A;  1OCC C;  2VCC A;  4U9E A;  3SYN A;  3V5Z A;  5A6B A;  1ZU4 A;  3EQL F;  1VK5 A;  1I4Y A;  3LLK A;  2J9V A;  1L3P A;  4MVU A;  4Q5S F;  3N0T A;  4Z9J A;  2Y3H A;  3MYF A;  5E33 A;  3TOM A;  4XEF A;  2AU5 A;  2VH3 A;  3GOR A;  1LE4 A;  3FAJ A;  4KNW A;  4JIO A;  4NTA A;  5KYY A;  2W4M A;  3AG1 C;  3SZR A;  4C7O B;  1TR2 A;  1H6G A;  3V5Y A;  2J8W A;  1ZHX A;  2KK1 A;  4FWV A;  3E70 C;  4YT5 A;  4QI2 A;  1ZVZ A;  2W9Y A;  3B0P A;  1LKX A;  3C7J A;  4AL0 A;  5COF A;  2R03 A;  4DBR A;  4PK4 A;  256B A;  3TD7 A;  4LDK A;  2DYR C;  5KYX B;  1JOG A;  1MMG A;  2R7U A;  3QMK A;  1E86 A;  4CSA C;  1ORY A;  3NKD A;  2QTV A;  2I8B A;  2E87 A;  4EBK A;  4OIO F;  3RF3 A;  4MQ9 F;  5EHH A;  2Q9A A;  4BJ6 C;  1Z5Z A;  5AC4 A;  2OOC A;  4IB4 A;  4PAC A;  4I1O B;  4Z9H A;  3PHF 2;  1HMO A;  1ZHW A;  4J7T A;  3S29 A;  3GOD A;  5KYW B;  2YVK A;  4BJT A;  3SXK A;  1AVO B;  3EHM A;  4XEK A;  1Y4C A;  3DKA A;  3VAY A;  1MMD A;  3U9M A;  2YLG A;  1NFO A;  2YLD A;  1T9K A;  1D0Y A;  2Y3G A;  3C62 A;  3K6B A;  3QW1 A;  4O6M A;  3SP1 A;  2EIM C;  2OQM A;  3ZQV A;  4HE8 D;  3EG9 B;  1JRA A;  3RVY A;  1WAS A;  3W4Y A;  2ZXW C;  1D0X A;  5JS5 A;  4JTA B;  3PDM P;  3POV A;  1NZE A;  3H65 A;  2WL8 A;  1T6I A;  3M79 A;  2P61 A;  4E18 A;  4JJG A;  4H54 A;  1TKN A;  3LES A;  5HV9 A;  3AJM A;  3EPV A;  4ZLC A;  2LFF A;  1O5H A;  3ZDL A;  5A6K A;  2XSE A;  3OEO A;  2R7R A;  3OWT A;  3QTH A;  3SXM A;  3ZTM A;  4G7H F;  1KNY A;  4MVS A;  4D4N A;  5KYY B;  2YQY A;  5B1A C;  3LJB A;  4W8P A;  3RW0 A;  4AX2 A;  1KTM A;  1V55 C;  3WG7 C;  5JT4 A;  1OXK A;  2XLE A;  1CPR A;  4MVQ A;  2CDQ A;  3T6B A;  4BJ5 A;  4ONS A;  1SF8 A;  3W8H A;  1QKR A;  2ZXO A;  4AK9 A;  3VM6 A;  1YYX A;  3AQC A;  3ZC4 A;  2XRH A;  3JRT A;  4O79 A;  3S84 A;  5DQZ A;  5L0I A;  3FVY A;  3EJN A;  4K7B A;  5GPG B;  3MYI A;  3SXY A;  1J8M F;  5E3A A;  3GWL A;  1M2V A;  2IXM A;  4U5B E;  1I4Z A;  1D0Z A;  1E2X A;  1T6U A;  2Y39 A;  3GEE A;  3IQ5 A;  1M6T A;  2J0W A;  1C17 M;  2KSF A;  3BRJ A;  1Z63 A;  4ANJ A;  2LFD A;  2CYD A;  4WAB A;  2HV6 A;  1I5N A;  4E0H A;  4K1O A;  3S9O A;  3FDQ A;  1TWA A;  2DGJ A;  3W8I A;  2KJG A;  2PX3 A;  1OCZ C;  2LCH A;  2AP3 A;  2Q9C A;  2CCY A;  2RSE B;  3QZC A;  4YL1 A;  3LLI A;  4JCH A;  2OCC C;  4HFF B;  3R2P A;  5IY5 C;  1JPN A;  2HSB A;  1BR2 A;  3DM9 B;  4MND A;  2GAQ A;  3U8V A;  2NG1 A;  5BQI A;  4OIP F;  1TWH A;  3US6 A;  2MWQ A;  5E3C A;  2ICW G;  1NU9 C;  3V5X A;  3HKK A;  1FNT c;  1W2W A;  1ST6 A;  3HNK A;  1R4T A;  1V4A A;  2G62 A;  1LI7 A;  1U6H A;  1R5I D;  1BR1 A;  2G3V A;  4P6I C;  3RKO F;  4MW3 A;  4CS7 A;  1NBB A;  2IM8 A;  3A11 A;  3UMH A;  1YJG A;  4CJO A;  4K0D A;  3I5Q A;  2YHS A;  2PP4 A;  3M4C A;  3QVY A;  3ZWI A;  4CIP A;  1QVX A;  3DJU B;  1OQC A;  3FMS A;  2JX0 A;  2KNH A;  2J9B A;  2YWA A;  3CQZ A;  2R25 A;  4XWJ A;  1PCX A;  2XLV A;  2ZPA A;  3I5P A;  3O39 A;  2J46 A;  3KPH A;  3H2V A;  2R7X A;  1S05 A;  1VOM A;  2BE5 F;  3JYY A;  3OA1 A;  4L6R A;  2NUT A;  2LK4 A;  3AQB A;  1OR3 A;  4U5D E;  1M2V B;  2LIG A;  1YZA A;  3U2M A;  1YA9 A;  4G78 A;  1IZM A;  4MS2 A;  1RJ9 A;  1QZX A;  3HLZ A;  1WOL A;  3S27 A;  2R7O A;  1HE1 A;  1JPJ A;  2Y69 C;  3N2Z B;  2QE9 A;  2XLD A;  1FR0 A;  2H7O A;  1RCP A;  1S7Z A;  3UR3 C;  4JEB A;  4R32 A;  4CBE A;  3V7O A;  4CS9 A;  2P1A A;  3T6G B;  3C8G D;  3DI5 A;  3C63 A;  1H9G A;  4IAR A;  1FFH A;  2H8A A;  4EKW A;  4N6C A;  3BEH A;  3FOP A;  3TUL A;  1K04 A;  3AG4 C;  2HUJ A;  4U5G A;  4IGG A;  3K1I C;  4JC7 A;  4AL1 A;  1JAF A;  4ZLD A;  1YYJ A;  2WZG A;  2L9J A;  2NSG A;  2XS1 A;  2EPN A;  4JRZ A;  4LDQ A;  3S28 A;  5AC5 A;  2O9X A;  2Q7R A;  3Q7L A;  1C02 A;  4XLP F;  4HFK B;  2H7V C;  2LP4 A;  4NCQ A;  2OG2 A;  4O6Y A;  3L8J A;  1LIH A;  1VYK A;  4OD5 A;  5DVW A;  4YK5 A;  1E84 A;  3RQE A;  1IW7 F;  3GEH A;  3T9O A;  1ZYR F;  1U0B B;  4RD9 A;  1SYQ A;  1G8X A;  2V3C C;  2TMV P;  2J45 A;  3HNJ A;  4LDR A;  1M56 C;  1PV3 A;  1LVK A;  3ABK C;  3RH3 A;  4CX9 A;  4M63 A;  4CSA A;  4MTG A;  3ASN C;  3DAG A;  4YT8 A;  1OKK A;  2CW0 F;  2UUI A;  4U5H A;  3DMD A;  1QLE C;  1SZI A;  2XL6 A;  4BJ6 A;  2NUT B;  5DS4 A;  2IYL D;  2XS8 A;  5JP7 A;  1OCO C;  3AOU A;  3JTL O;  1BZ4 A;  4EUK B;  1LI5 A;  2VAS A;  5L0C A;  3S0X A;  3S90 A;  4CDV A;  1RJ9 B;  1FMW A;  1Y6D A;  3W2W A;  3T6J A;  3T4R A;  5F5F A;  3EGD B;  1HW1 A;  1K40 A;  2AWY A;  3CEX A;  3U2L A;  2L7A A;  2OJQ A;  3SXZ A;  2OKU A;  1DOV A;  2ETS A;  3LEV A;  4N6H A;  1RMV A;  1NU7 D;  2IXO A;  2J0X A;  2DYS C;  2YL1 A;  3NKE A;  5JVE A;  4DRI B;  3RIP A;  3TQO A;  2EIL C;  4WJ0 A;  2R7V A;  4JVS A;  4JEA A;  1RKC A;  2A68 F;  1MND A;  1OR2 A;  1OKK D;  2XLH A;  2XLO A;  2YL3 A;  3LNR A;  3LS0 A;  3MX3 A;  3O6X A;  3Q6M A;  2L81 A;  4IAO A;  1OCR C;  1ORJ A;  4N06 A;  1Z3I X;  4JZA A;  3K1H A;  4HEA J;  1D1B A;  2QY9 A;  4DXW A;  3PMR A;  3EZI A;  2OEX A;  3JT1 A;  4YN0 B;  3DM5 A;  1VTM P;  4IAQ A;  4WGZ A; 
#chains in the Genus database with same CATH homology
 4EUK B;  2R25 A;  1Y6D A;  1C02 A;  3US6 A;  3IQT A;  2LP4 A;  4G78 A;  1QSP A;  1OXB A;  1SR2 A;  3KYI A;  3KYJ A;  1FR0 A;  1A0B A;  2LD6 A;  1WN0 A;  1C03 A;  2OOC A;  1I5N A;  1TQG A;  2A0B A;  4PAC A;  3U3B A;  1YVI A;  2Q4F A;  3MYF A;  2LCH A;  1OXK A;  1BDJ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...