3IQTA

Structure of the hpt domain of sensor protein bara from escherichia coli cft073.
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
123
structure length
123
Chain Sequence
b'SNAVNEIVVNPNATLDWQLALRQAAGKTDLARDMLQMLLDFLPEVRNKVEEQLVGENPEGLVDLIHKLHGSCGYSGVPRMKNLCQLIEQQLRSGTKEEDLEPELLELLDEMDNVAREASKILG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Signal transduction histidine-protein kinase barA
publication title Structure of the HPT domain of Sensor protein barA from Escherichia coli CFT073.
rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 41
structure length 123
sequence length 123
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2009-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01627 Hpt Hpt domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.160 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) HPT domain 3iqtA01
1FR0A 1BDJB 3US6A 1Y6DA 4EUKB 1QSPA 1SR2A 1OXBA 2OOCA 4PACA 1C02A 1WN0A 1TQGA 2R25A 3KYIA 4G78A 1YVIA 3MYFA 3U3BA 3KYJA 1A0BA 1I5NA 1OXKA 2LCHA 2Q4FA 3IQTA 1C03A 2LP4A 2A0BA 2LD6A
chains in the Genus database with same CATH superfamily
2YLGA 2EPOA 2QLAA 5A6BA 1ORSC 1Y6DA 2NUTB 2XM0A 4EUKB 1WWPA 4NTAA 3RQGA 1CGOA 4PK4A 3C63A 2OJQA 3N2ZB 5KYYA 4O7GA 2YLDA 3QW1A 4CJGA 1NBBA 3SZRA 2BL2A 3VYWA 3ZTZA 4ULWA 4IRUA 1S7ZA 3N24A 5DVWA 2R9RB 1WOLA 1D0ZA 2EPKX 3M15A 2LFDA 1YYJA 2P6VA 1SF8A 2PBEA 5JSLA 5COFA 1AVOB 4YL3A 4IB4A 2WB7A 3AGUA 2L9JA 1QLEC 2JX0A 5T3TA 1YA9A 2LCHA 2QTVA 2CNWD 2Q4FA 3GM2A 1Y4CA 4G0HA 4JTDB 3WAQA 3DAFA 3SEOA 1T5OA 3FAPB 2Y39A 1Q0FA 1R5ID 2KYHA 4CDAA 3IPMO 3TJ5A 1ZHYA 4YWQA 3O10A 3S9OA 2DYSC 3FHDA 1OKKA 1K40A 3JT1A 1L7CA 3VM6A 3QZCA 2HS5A 4J7YA 5CIVA 4PACA 3TD7A 4DRJB 3RF3A 3LUTB 3QW0A 4W8PA 1LS1A 5K0IA 2HV7A 1ST6A 2R05A 1MNDA 1FTSA 3M79A 3FOPA 3DE9A 3AQCA 4DRIB 2VCCA 4HEAJ 5A6KA 2FGYA 1PV3A 2DGJA 1KNYA 2A6HF 2C04A 4JCHA 2A69F 3K7DA 2LP4A 3JZ0A 4NCQA 3ZDLA 1HW2A 4G7ZF 1B68A 4CS8A 1K04A 3NKDA 3CQZA 5T3WA 1FNTc 2R7VA 3UNGC 2EPNA 3ZQVA 3G4ZA 4LDKA 1G4US 3SXYA 4OD4A 256BA 5CI9A 3Q7LA 3V5ZA 5JT4A 1D1AA 5DQTA 5KYWA 2R7QA 3BRJA 2VCAA 4JKVA 1TQGA 4DOZA 3LESA 4U5GA 3T6JA 3W8IA 5L3QA 1ZHWA 3AG3C 5E3AA 2IOQA 3T6GB 3ZVRA 4IAQA 4PFPA 5JP7A 4CBEA 1TKNA 3H2UA 1JRAA 3U3BA 3FAJA 2JPUA 4O6NA 4OIPF 3ABKC 3TULA 5DQZA 1ZHZA 1D0YA 1GQAA 3HNKA 1OCRC 2Y3DA 1VYKA 1J8MF 4PJJA 4U9DA 5KYWB 1WGWA 2WVOA 4OIRF 2W4MA 3C8GD 2B0HA 4PR9A 3IQCA 3ASNC 3EG9A 2EILC 4U5FE 3U2LA 3WHNA 4EBJA 4CIHA 4I1MA 1GGQA 2Q3TA 2R7UA 1VTMP 4JCZA 3M1CB 3RYLA 1Z3IX 4K7BA 2DYRC 2IXOA 3AQBA 1V4AA 1AEPA 1LIHA 3PDMP 5L0CA 3T4RA 1QQ3A 4NY3A 1FMWA 1XZPA 1TWHA 4K1OA 1BR1A 3C8GA 1ZYRF 3K1HA 3R7CA 1S05A 3EG9B 2Y3HA 1LPEA 3KYIA 2YL0A 5AC4A 3MLGA 4E7ZA 3T9OA 5JUAA 2EIMC 2NUPA 5JLIA 1YYXA 4DBRA 1ORYA 2IXMA 3C7JA 2HJMA 3RVZA 3HTKC 1HY5A 1F1MA 1HE9A 1EA8A 3NYLA 4U5DE 4ANJA 1FR0A 3DZAA 3G50A 1V74B 3PMRA 4NTBA 4QDLA 3AG2C 1OW7A 3I5QA 3US6A 2JD3A 2XLEA 4P9FA 2HFIA 3U8PA 5KYNA 4U5BE 1M2VA 1RCPA 2WZFA 2GAQA 3LLIA 5CI8A 2J0XA 2EIJC 4AL0A 4B6IA 3ZIBA 1XZQA 2YWAA 4MVQA 5A6JA 1W2WA 2MWQA 4JC7A 1QVXA 3BEHA 1D1BA 3SXMA 4HE8D 3ZG1A 4N6CA 1ZU4A 3HLZA 4AE4B 5BQIA 1LKXA 2G3KA 5A6BD 2NUTA 2Q9BA 2CGEA 1PCXA 4E17A 5DS6A 5L0GA 4WGZA 3EHMA 1A0BA 3JSZA 4HFKB 3UR3C 2HZ8A 4N6HA 3EZHA 3Q7GA 3B0UX 4I3MA 1JR8A 2D5RB 3L8IA 2GA0A 1R4TA 1NFNA 4BJ1A 1UG7A 3W4YA 4D4NA 3AG4C 3NMIA 1VLSA 2OKUA 2H7VC 2XLVA 2PP4A 2F22A 1QSPA 3CEXA 3RKOF 1J8YF 3X1OA 4RDAA 4A2NB 4YT5A 1KU2A 1D1CA 3H2VA 5DS4A 4O6YA 2XL6A 4EBBA 4CX9A 4YT4A 4XEVA 1EQ1A 2GFHA 3U9JA 5TJ5E 1JMWA 3AG1C 3N0TA 3LS0A 2LSEA 3W2WA 4KC9A 4XWJA 2YHSA 5IY5C 4ZLDA 2KSFA 3B29A 1OKKD 3NG1A 4HFFB 2XLOA 2HJ3A 2YL3A 4YJWA 3EJNA 3IQ5A 1K05A 3IQTA 2A0UA 4N06A 4A4AA 1SZIA 3U3FA 1RMVA 2LD6A 2KC3A 5KYXB 4F4BA 3FXHA 1BDJB 3U9MA 3EFOA 1QKRA 1ZU5A 1ZW3A 3S29A 3GEHA 1OXBA 3LNMB 4IARA 5E3CA 4IWBA 2HMQA 1LM3B 1E2XA 1OR3A 3UMKA 3WG7C 4DXWA 1RJ9A 4CIPA 4KNVA 4JIOA 4AK9A 4CJOA 4OINF 4XEFA 5KYXA 4XLPF 4JZAA 4LLEA 4JRZA 5GPGB 5B1AC 2R25A 4C3DA 2HV6A 1RXQA 2WZGA 4LLCA 1LI7A 2H8AA 2J46A 2XRHA 2EPLX 2J7PA 3DM5A 1PD1A 1OR2A 3EFOB 3LNRA 3MYFA 1N1CA 3Q6NA 3QVZA 4J32B 1O5HA 2TMVP 5BQHA 4ZLCA 3JYYA 4C3EA 3NKEA 1GM5A 3DE8A 1OCZC 4XPXA 4JVSA 1RJ9B 3AJMA 3B0PA 2P7VA 4YK5A 5F5HA 1TWAA 2A0BA 1VMAA 1T6UA 2AU5A 2W45A 2EIKC 2QE9A 2ZD9A 2GDCA 3EQLF 2KJGA 4GYTA 2AVKA 1Z23A 4MTOA 4PJNA 1LE4A 4PJMA 5B1BC 4YT2A 3AGTA 1PD0A 2L6FA 3U8VA 4U5EE 1YARO 2FFHA 2G62A 2ZXWC 2HSBA 3SXKA 3VF0A 1YDIA 2Q9AA 4G7OF 1LS4A 2LQGA 4WJ0A 3GM3A 2RSEB 2DI3A 4MTGA 4P6IC 3ABMC 2ZXOA 1GS9A 1MQVA 3L1MA 3L0IA 4JW1A 4JJGA 4Z9IA 5F28E 1YZCA 4G78A 5T1DB 2HUJA 4BJ5C 3FDQA 3NMJA 2VCBA 1IW7F 2IXNA 3KYJA 3ZC4A 5AGFA 1TWCA 2HSQA 1QZXA 3OA1A 1I5NA 1H7IA 1HW1A 1TR2A 2WVQA 4XPYA 1T6QA 2CYDA 1YJGA 4BJ6C 4RBNA 1H9TA 3TK0A 1ZHTA 2I15A 3RVYA 3JYHA 4OIOF 3LEOA 2H7OA 2NSFA 2V3CC 1VK5A 4E0HA 3E70C 2CW0F 4CS9C 2OG2A 4U5HA 4M63A 5COGA 1RKCA 4LERA 1L3PA 1CPQA 4FX5A 1G4WR 2R02A 2NG1A 3QVYA 3A11A 5JRAA 3G4XA 1VYIA 4OD5A 2P61A 3LAYA 2PNOA 3OEOA 2Q9CA 4ER9A 2XL8A 2YRFA 2W4BA 2EPMX 4BEJA 1BZ4A 2LFFA 4JEAA 4DRHB 2PF4E 3DD7A 4JTCB 1A41A 1VOMA 2H7BA 4ULVA 2YLIA 3U2MA 2VH3A 3K1IC 5B3SC 3NYJA 1NG1A 5F5FA 2OCCC 4IGGA 1ZW2A 1WASA 3X2QC 3DJNB 3HJCA 4AE4A 3LS1A 3S27A 2M4EA 4J30B 3V5YA 1M2OA 2CDQA 1RKEA 4KI2A 1CGME 5D91A 2J8WA 2VB6A 4XEKA 2C03A 2WVNA 1XWJA 3HNLA 4Z9JA 2ICWG 2YEVA 3ASOC 4XQ1A 1SMYF 3FVYA 3B9QA 3W8HA 2DB4A 2NSGA 1C02A 1V55C 1I4YA 2OEXA 2ASRA 2PX0A 2J0WA 1VB5A 2KW3C 5L3VA 2X51A 3POVA 3JRMO 5FCLA 3GANA 2R7WA 1CPRA 3ECSA 1YVIA 3S84A 3KH2A 2ETSA 1RKEB 4MS2A 4GQHA 4RD9A 3DM9B 3EH2A 1OW6A 1O87A 4DBQA 1VLTA 2R7OA 2XSEA 1JAFA 5E2QA 1JPNA 3LEVA 1DOVA 4JTAB 4X0RA 3KKBA 1NU9C 3IEEA 2IM8A 4MVMA 4JEBA 3M4BA 2A1DD 4P9TA 1M6TA 2KK1A 1EI7A 2A6EF 4LDRA 5KYUA 1MMDA 2Q00A 4JE9A 3EGXB 4YT8A 4PJLA 2XXAB 4KNWA 2P0NA 1E86A 2QNLA 2UUHA 2VC9A 3L8JA 4NQFA 1MMAA 2AWYA 4FWVA 4MW8A 3S28A 3IQ6A 3SYNA 5DS5A 1A7DA 3TQOA 1YA7O 2Y3BA 2Y69C 4Q5SF 1TWGA 1T9KA 1JPJA 4C7OA 2R7RA 4EKWA 3EZIA 1H6GA 2J45A 1ZZPA 4MVOA 2LIGA 3U5SA 2LK4A 3ZQYA 3F47A 2Y3GA 3SP1A 2J9BA 2PX3A 3DWWA 4GEHA 5FZTA 3WODF 5KYUB 3RH3A 1YLMA 4IAOA 2O9XA 4BPMA 4H54A 3C8ZA 4J7TA 4MW3A 2XL4A 1E84A 1YAUO 2OJED 2OEVA 4Q4ZF 3ABLC 2RD9A 2J9WA 1OQCA 1EKYA 1FFHA 3GODA 5JS5A 3T6BA 3JTLO 2A68F 2J7PD 1MMGA 2XLMA 2Q7RA 3MX3A 4O79A 4Q7CA 3LJBA 5HSWA 2G3VA 2CCYA 4AL1A 4XLNF 4CSAC 2R7SA 4U5CE 2YQYA 4BJ5A 5L0JA 4WABA 5L0HA 4ONSA 5COMA 4MVUA 4EWCA 1MNEA 3PHF2 3ATPA 3AOUA 4YL1A 4BJ6A 4R32A 5L0FA 3RW0A 1OW8A 2ZXRA 4YN0B 4LACB 2WL8A 3J06A 3QMKA 3S0XA 5KYYB 3UGOA 1YZAA 1ZVZA 2OQMA 4U9EA 3QTHA 3DI5A 1T01A 4CS7A 1E83A 4H4KC 1BBHA 1WATA 4QI0A 3NRHA 1C03A 4C3BA 5EK0A 3RFYA 2YZSA 4DVZA 2AP3A 3DAGA 4CS9A 4IJJA 1Q0GA 4JURI 3HNJA 2XS8A 3IHUA 4E18A 1Z5ZA 3MYIA 3EHNA 1TFOB 1H9GA 2YL7A 3NYMA 2CNWA 5A69A 2FAPB 1WN0A 3TJ6A 1Q0KA 1ZHXA 5DLJA 4E7SA 2MHRA 2YKZA 2R7XA 3KPHA 1SYQA 1U0BB 3ZWIA 3GWLA 3UMIA 2D4UA 2MYSA 3K1IA 3R2PA 3GEIA 3K6BA 4CDVA 4EIYA 1OCOC 2I8BA 3C18A 1CGNA 3O39A 3HNIA 2HKVA 3I4UA 1UFBA 3E9VA 3TOMA 2KGOA 1FMVA 1HMDA 1O3UA 3FMSA 3SXZA 5L0DA 1E85A 1C17M 2IYLD 2R03A 3RQFA 1D0XA 2W9YA 4BJTA 4WGYA 4MQ9F 4MTFA 3RIPA 2V26A 1IZMA 3B71A 4L6RA 1ORJA 1WTYA 1SR2A 3KL4A 2KQ9A 2OOCA 2OU6A 1M56C 5E33A 4UDVA 3MBGA 4C7OB 4XTKA 2AWCA 1QPUA 3NDBB 1A7EA 1JOGA 1G8XA 1LE2A 1OCCC 2L7AA 3GEEA 3O55A 1MMNA 3ITFA 2X0CA 2YVKA 1FAPB 4G7HF 3EPVA 4NTFA 3KMIA 2UUIA 3MFNA 2Z15A 4BEMJ 2B0JA 5BQGA 2ZXPA 1NZEA 4AX2A 2R7TA 1APCA 3K33A 5BUOA 3NMKA 5L0IA 5A6AA 3Q6MA 3HKKA 3ZTMA 2IBFA 4DVYP 2L81A 3PCVA 3LLKA 4XPWA 3H65A 4CDYA 2PFDA 5D92A 1A7VA 1NSGB 4QI2A 4OIQF 4E0IA 1DOWA 4NC3A 1I4ZA 2VASA 1Z7Qc 5JVEA 3SNHA 3M4CA 3B0VC 5EHHA 4CS8C 3GM1A 4O6MA 4MVZA 3U0CA 1NU7D 2YL1A 4PFOA 4MNDA 2L6GA 3VRCA 4BG0A 4K0DA 4D4XA 1U89A 2GWWA 3W2VA 5EGYA 4I1OB 2P1AA 2XXAA 3L34A 3EGXA 2WZLA 3EH1A 3JRTA 3JSEO 4W8KA 4Z9HA 3VAYA 3V5XA 3ZSUA 2E87A 3CSKA 4FESA 1NLXA 1NFOA 1KTMA 2XLHA 1TFKB 4YL0A 2KNHA 2QUPA 1HMOA 2IXPA 1V54C 2XLWA 1LVKA 2BC5A 2M64A 2XM4A 3TOLA 3C8GB 1HE1A 1FFTC 4EHPA 1Z63A 3FOOA 3OWTA 2L6HA 2QY9A 3F46A 1LI5A 4JJFA 4DJ9A 3DKAA 4CSAA 3O6XA 2XS1A 1Q0DA 2HMZA 2NUPB 1M57C 3I5PA 3JCUQ 2EINC 4MVRA 5AC5A 2XLDA 1Q0MA 3V7OA 3C62A 3UMHA 3GWNA 3S90A 5HV9A 1G5ZA 3EGDA 4KBLA 1T6IA 1U6HA 3GORA 3RQEA 5B3IA 2ZPAA 3DMDA 2J9VA 4FAPB 1AUEA 3UGPA 2BE5F 1BR4A 1M2VB 3DXJF 4MVSA 4N4WA 3CZ6A 1OXKA 1Z6AA 4LDQA 3K66A 1BR2A 2J9UA 3DJUB 4EBKA 3A9CA 4I44A 3CAXA 3EGDB 2NPUA
chains in the Genus database with same CATH topology
1FR0A 1BDJB 3US6A 1Y6DA 4EUKB 1QSPA 1SR2A 1OXBA 2OOCA 4PACA 1C02A 1WN0A 1TQGA 2R25A 3KYIA 4G78A 1YVIA 3MYFA 3U3BA 3KYJA 1A0BA 1I5NA 1OXKA 2LCHA 2Q4FA 3IQTA 1C03A 2LP4A 2A0BA 2LD6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FR0 A;  1BDJ B;  3US6 A;  1Y6D A;  4EUK B;  1QSP A;  1SR2 A;  1OXB A;  2OOC A;  4PAC A;  1C02 A;  1WN0 A;  1TQG A;  2R25 A;  3KYI A;  4G78 A;  1YVI A;  3MYF A;  3U3B A;  3KYJ A;  1A0B A;  1I5N A;  1OXK A;  2LCH A;  2Q4F A;  3IQT A;  1C03 A;  2LP4 A;  2A0B A;  2LD6 A; 
#chains in the Genus database with same CATH topology
 2YLG A;  2EPO A;  2QLA A;  5A6B A;  1ORS C;  1Y6D A;  2NUT B;  2XM0 A;  4EUK B;  1WWP A;  4NTA A;  3RQG A;  1CGO A;  4PK4 A;  3C63 A;  2OJQ A;  3N2Z B;  5KYY A;  4O7G A;  2YLD A;  3QW1 A;  4CJG A;  1NBB A;  3SZR A;  2BL2 A;  3VYW A;  3ZTZ A;  4ULW A;  4IRU A;  1S7Z A;  3N24 A;  5DVW A;  2R9R B;  1WOL A;  1D0Z A;  2EPK X;  3M15 A;  2LFD A;  1YYJ A;  2P6V A;  1SF8 A;  2PBE A;  5JSL A;  5COF A;  1AVO B;  4YL3 A;  4IB4 A;  2WB7 A;  3AGU A;  2L9J A;  1QLE C;  2JX0 A;  5T3T A;  1YA9 A;  2LCH A;  2QTV A;  2CNW D;  2Q4F A;  3GM2 A;  1Y4C A;  4G0H A;  4JTD B;  3WAQ A;  3DAF A;  3SEO A;  1T5O A;  3FAP B;  2Y39 A;  1Q0F A;  1R5I D;  2KYH A;  4CDA A;  3IPM O;  3TJ5 A;  1ZHY A;  4YWQ A;  3O10 A;  3S9O A;  2DYS C;  3FHD A;  1OKK A;  1K40 A;  3JT1 A;  1L7C A;  3VM6 A;  3QZC A;  2HS5 A;  4J7Y A;  5CIV A;  4PAC A;  3TD7 A;  4DRJ B;  3RF3 A;  3LUT B;  3QW0 A;  4W8P A;  1LS1 A;  5K0I A;  2HV7 A;  1ST6 A;  2R05 A;  1MND A;  1FTS A;  3M79 A;  3FOP A;  3DE9 A;  3AQC A;  4DRI B;  2VCC A;  4HEA J;  5A6K A;  2FGY A;  1PV3 A;  2DGJ A;  1KNY A;  2A6H F;  2C04 A;  4JCH A;  2A69 F;  3K7D A;  2LP4 A;  3JZ0 A;  4NCQ A;  3ZDL A;  1HW2 A;  4G7Z F;  1B68 A;  4CS8 A;  1K04 A;  3NKD A;  3CQZ A;  5T3W A;  1FNT c;  2R7V A;  3UNG C;  2EPN A;  3ZQV A;  3G4Z A;  4LDK A;  1G4U S;  3SXY A;  4OD4 A;  256B A;  5CI9 A;  3Q7L A;  3V5Z A;  5JT4 A;  1D1A A;  5DQT A;  5KYW A;  2R7Q A;  3BRJ A;  2VCA A;  4JKV A;  1TQG A;  4DOZ A;  3LES A;  4U5G A;  3T6J A;  3W8I A;  5L3Q A;  1ZHW A;  3AG3 C;  5E3A A;  2IOQ A;  3T6G B;  3ZVR A;  4IAQ A;  4PFP A;  5JP7 A;  4CBE A;  1TKN A;  3H2U A;  1JRA A;  3U3B A;  3FAJ A;  2JPU A;  4O6N A;  4OIP F;  3ABK C;  3TUL A;  5DQZ A;  1ZHZ A;  1D0Y A;  1GQA A;  3HNK A;  1OCR C;  2Y3D A;  1VYK A;  1J8M F;  4PJJ A;  4U9D A;  5KYW B;  1WGW A;  2WVO A;  4OIR F;  2W4M A;  3C8G D;  2B0H A;  4PR9 A;  3IQC A;  3ASN C;  3EG9 A;  2EIL C;  4U5F E;  3U2L A;  3WHN A;  4EBJ A;  4CIH A;  4I1M A;  1GGQ A;  2Q3T A;  2R7U A;  1VTM P;  4JCZ A;  3M1C B;  3RYL A;  1Z3I X;  4K7B A;  2DYR C;  2IXO A;  3AQB A;  1V4A A;  1AEP A;  1LIH A;  3PDM P;  5L0C A;  3T4R A;  1QQ3 A;  4NY3 A;  1FMW A;  1XZP A;  1TWH A;  4K1O A;  1BR1 A;  3C8G A;  1ZYR F;  3K1H A;  3R7C A;  1S05 A;  3EG9 B;  2Y3H A;  1LPE A;  3KYI A;  2YL0 A;  5AC4 A;  3MLG A;  4E7Z A;  3T9O A;  5JUA A;  2EIM C;  2NUP A;  5JLI A;  1YYX A;  4DBR A;  1ORY A;  2IXM A;  3C7J A;  2HJM A;  3RVZ A;  3HTK C;  1HY5 A;  1F1M A;  1HE9 A;  1EA8 A;  3NYL A;  4U5D E;  4ANJ A;  1FR0 A;  3DZA A;  3G50 A;  1V74 B;  3PMR A;  4NTB A;  4QDL A;  3AG2 C;  1OW7 A;  3I5Q A;  3US6 A;  2JD3 A;  2XLE A;  4P9F A;  2HFI A;  3U8P A;  5KYN A;  4U5B E;  1M2V A;  1RCP A;  2WZF A;  2GAQ A;  3LLI A;  5CI8 A;  2J0X A;  2EIJ C;  4AL0 A;  4B6I A;  3ZIB A;  1XZQ A;  2YWA A;  4MVQ A;  5A6J A;  1W2W A;  2MWQ A;  4JC7 A;  1QVX A;  3BEH A;  1D1B A;  3SXM A;  4HE8 D;  3ZG1 A;  4N6C A;  1ZU4 A;  3HLZ A;  4AE4 B;  5BQI A;  1LKX A;  2G3K A;  5A6B D;  2NUT A;  2Q9B A;  2CGE A;  1PCX A;  4E17 A;  5DS6 A;  5L0G A;  4WGZ A;  3EHM A;  1A0B A;  3JSZ A;  4HFK B;  3UR3 C;  2HZ8 A;  4N6H A;  3EZH A;  3Q7G A;  3B0U X;  4I3M A;  1JR8 A;  2D5R B;  3L8I A;  2GA0 A;  1R4T A;  1NFN A;  4BJ1 A;  1UG7 A;  3W4Y A;  4D4N A;  3AG4 C;  3NMI A;  1VLS A;  2OKU A;  2H7V C;  2XLV A;  2PP4 A;  2F22 A;  1QSP A;  3CEX A;  3RKO F;  1J8Y F;  3X1O A;  4RDA A;  4A2N B;  4YT5 A;  1KU2 A;  1D1C A;  3H2V A;  5DS4 A;  4O6Y A;  2XL6 A;  4EBB A;  4CX9 A;  4YT4 A;  4XEV A;  1EQ1 A;  2GFH A;  3U9J A;  5TJ5 E;  1JMW A;  3AG1 C;  3N0T A;  3LS0 A;  2LSE A;  3W2W A;  4KC9 A;  4XWJ A;  2YHS A;  5IY5 C;  4ZLD A;  2KSF A;  3B29 A;  1OKK D;  3NG1 A;  4HFF B;  2XLO A;  2HJ3 A;  2YL3 A;  4YJW A;  3EJN A;  3IQ5 A;  1K05 A;  3IQT A;  2A0U A;  4N06 A;  4A4A A;  1SZI A;  3U3F A;  1RMV A;  2LD6 A;  2KC3 A;  5KYX B;  4F4B A;  3FXH A;  1BDJ B;  3U9M A;  3EFO A;  1QKR A;  1ZU5 A;  1ZW3 A;  3S29 A;  3GEH A;  1OXB A;  3LNM B;  4IAR A;  5E3C A;  4IWB A;  2HMQ A;  1LM3 B;  1E2X A;  1OR3 A;  3UMK A;  3WG7 C;  4DXW A;  1RJ9 A;  4CIP A;  4KNV A;  4JIO A;  4AK9 A;  4CJO A;  4OIN F;  4XEF A;  5KYX A;  4XLP F;  4JZA A;  4LLE A;  4JRZ A;  5GPG B;  5B1A C;  2R25 A;  4C3D A;  2HV6 A;  1RXQ A;  2WZG A;  4LLC A;  1LI7 A;  2H8A A;  2J46 A;  2XRH A;  2EPL X;  2J7P A;  3DM5 A;  1PD1 A;  1OR2 A;  3EFO B;  3LNR A;  3MYF A;  1N1C A;  3Q6N A;  3QVZ A;  4J32 B;  1O5H A;  2TMV P;  5BQH A;  4ZLC A;  3JYY A;  4C3E A;  3NKE A;  1GM5 A;  3DE8 A;  1OCZ C;  4XPX A;  4JVS A;  1RJ9 B;  3AJM A;  3B0P A;  2P7V A;  4YK5 A;  5F5H A;  1TWA A;  2A0B A;  1VMA A;  1T6U A;  2AU5 A;  2W45 A;  2EIK C;  2QE9 A;  2ZD9 A;  2GDC A;  3EQL F;  2KJG A;  4GYT A;  2AVK A;  1Z23 A;  4MTO A;  4PJN A;  1LE4 A;  4PJM A;  5B1B C;  4YT2 A;  3AGT A;  1PD0 A;  2L6F A;  3U8V A;  4U5E E;  1YAR O;  2FFH A;  2G62 A;  2ZXW C;  2HSB A;  3SXK A;  3VF0 A;  1YDI A;  2Q9A A;  4G7O F;  1LS4 A;  2LQG A;  4WJ0 A;  3GM3 A;  2RSE B;  2DI3 A;  4MTG A;  4P6I C;  3ABM C;  2ZXO A;  1GS9 A;  1MQV A;  3L1M A;  3L0I A;  4JW1 A;  4JJG A;  4Z9I A;  5F28 E;  1YZC A;  4G78 A;  5T1D B;  2HUJ A;  4BJ5 C;  3FDQ A;  3NMJ A;  2VCB A;  1IW7 F;  2IXN A;  3KYJ A;  3ZC4 A;  5AGF A;  1TWC A;  2HSQ A;  1QZX A;  3OA1 A;  1I5N A;  1H7I A;  1HW1 A;  1TR2 A;  2WVQ A;  4XPY A;  1T6Q A;  2CYD A;  1YJG A;  4BJ6 C;  4RBN A;  1H9T A;  3TK0 A;  1ZHT A;  2I15 A;  3RVY A;  3JYH A;  4OIO F;  3LEO A;  2H7O A;  2NSF A;  2V3C C;  1VK5 A;  4E0H A;  3E70 C;  2CW0 F;  4CS9 C;  2OG2 A;  4U5H A;  4M63 A;  5COG A;  1RKC A;  4LER A;  1L3P A;  1CPQ A;  4FX5 A;  1G4W R;  2R02 A;  2NG1 A;  3QVY A;  3A11 A;  5JRA A;  3G4X A;  1VYI A;  4OD5 A;  2P61 A;  3LAY A;  2PNO A;  3OEO A;  2Q9C A;  4ER9 A;  2XL8 A;  2YRF A;  2W4B A;  2EPM X;  4BEJ A;  1BZ4 A;  2LFF A;  4JEA A;  4DRH B;  2PF4 E;  3DD7 A;  4JTC B;  1A41 A;  1VOM A;  2H7B A;  4ULV A;  2YLI A;  3U2M A;  2VH3 A;  3K1I C;  5B3S C;  3NYJ A;  1NG1 A;  5F5F A;  2OCC C;  4IGG A;  1ZW2 A;  1WAS A;  3X2Q C;  3DJN B;  3HJC A;  4AE4 A;  3LS1 A;  3S27 A;  2M4E A;  4J30 B;  3V5Y A;  1M2O A;  2CDQ A;  1RKE A;  4KI2 A;  1CGM E;  5D91 A;  2J8W A;  2VB6 A;  4XEK A;  2C03 A;  2WVN A;  1XWJ A;  3HNL A;  4Z9J A;  2ICW G;  2YEV A;  3ASO C;  4XQ1 A;  1SMY F;  3FVY A;  3B9Q A;  3W8H A;  2DB4 A;  2NSG A;  1C02 A;  1V55 C;  1I4Y A;  2OEX A;  2ASR A;  2PX0 A;  2J0W A;  1VB5 A;  2KW3 C;  5L3V A;  2X51 A;  3POV A;  3JRM O;  5FCL A;  3GAN A;  2R7W A;  1CPR A;  3ECS A;  1YVI A;  3S84 A;  3KH2 A;  2ETS A;  1RKE B;  4MS2 A;  4GQH A;  4RD9 A;  3DM9 B;  3EH2 A;  1OW6 A;  1O87 A;  4DBQ A;  1VLT A;  2R7O A;  2XSE A;  1JAF A;  5E2Q A;  1JPN A;  3LEV A;  1DOV A;  4JTA B;  4X0R A;  3KKB A;  1NU9 C;  3IEE A;  2IM8 A;  4MVM A;  4JEB A;  3M4B A;  2A1D D;  4P9T A;  1M6T A;  2KK1 A;  1EI7 A;  2A6E F;  4LDR A;  5KYU A;  1MMD A;  2Q00 A;  4JE9 A;  3EGX B;  4YT8 A;  4PJL A;  2XXA B;  4KNW A;  2P0N A;  1E86 A;  2QNL A;  2UUH A;  2VC9 A;  3L8J A;  4NQF A;  1MMA A;  2AWY A;  4FWV A;  4MW8 A;  3S28 A;  3IQ6 A;  3SYN A;  5DS5 A;  1A7D A;  3TQO A;  1YA7 O;  2Y3B A;  2Y69 C;  4Q5S F;  1TWG A;  1T9K A;  1JPJ A;  4C7O A;  2R7R A;  4EKW A;  3EZI A;  1H6G A;  2J45 A;  1ZZP A;  4MVO A;  2LIG A;  3U5S A;  2LK4 A;  3ZQY A;  3F47 A;  2Y3G A;  3SP1 A;  2J9B A;  2PX3 A;  3DWW A;  4GEH A;  5FZT A;  3WOD F;  5KYU B;  3RH3 A;  1YLM A;  4IAO A;  2O9X A;  4BPM A;  4H54 A;  3C8Z A;  4J7T A;  4MW3 A;  2XL4 A;  1E84 A;  1YAU O;  2OJE D;  2OEV A;  4Q4Z F;  3ABL C;  2RD9 A;  2J9W A;  1OQC A;  1EKY A;  1FFH A;  3GOD A;  5JS5 A;  3T6B A;  3JTL O;  2A68 F;  2J7P D;  1MMG A;  2XLM A;  2Q7R A;  3MX3 A;  4O79 A;  4Q7C A;  3LJB A;  5HSW A;  2G3V A;  2CCY A;  4AL1 A;  4XLN F;  4CSA C;  2R7S A;  4U5C E;  2YQY A;  4BJ5 A;  5L0J A;  4WAB A;  5L0H A;  4ONS A;  5COM A;  4MVU A;  4EWC A;  1MNE A;  3PHF 2;  3ATP A;  3AOU A;  4YL1 A;  4BJ6 A;  4R32 A;  5L0F A;  3RW0 A;  1OW8 A;  2ZXR A;  4YN0 B;  4LAC B;  2WL8 A;  3J06 A;  3QMK A;  3S0X A;  5KYY B;  3UGO A;  1YZA A;  1ZVZ A;  2OQM A;  4U9E A;  3QTH A;  3DI5 A;  1T01 A;  4CS7 A;  1E83 A;  4H4K C;  1BBH A;  1WAT A;  4QI0 A;  3NRH A;  1C03 A;  4C3B A;  5EK0 A;  3RFY A;  2YZS A;  4DVZ A;  2AP3 A;  3DAG A;  4CS9 A;  4IJJ A;  1Q0G A;  4JUR I;  3HNJ A;  2XS8 A;  3IHU A;  4E18 A;  1Z5Z A;  3MYI A;  3EHN A;  1TFO B;  1H9G A;  2YL7 A;  3NYM A;  2CNW A;  5A69 A;  2FAP B;  1WN0 A;  3TJ6 A;  1Q0K A;  1ZHX A;  5DLJ A;  4E7S A;  2MHR A;  2YKZ A;  2R7X A;  3KPH A;  1SYQ A;  1U0B B;  3ZWI A;  3GWL A;  3UMI A;  2D4U A;  2MYS A;  3K1I A;  3R2P A;  3GEI A;  3K6B A;  4CDV A;  4EIY A;  1OCO C;  2I8B A;  3C18 A;  1CGN A;  3O39 A;  3HNI A;  2HKV A;  3I4U A;  1UFB A;  3E9V A;  3TOM A;  2KGO A;  1FMV A;  1HMD A;  1O3U A;  3FMS A;  3SXZ A;  5L0D A;  1E85 A;  1C17 M;  2IYL D;  2R03 A;  3RQF A;  1D0X A;  2W9Y A;  4BJT A;  4WGY A;  4MQ9 F;  4MTF A;  3RIP A;  2V26 A;  1IZM A;  3B71 A;  4L6R A;  1ORJ A;  1WTY A;  1SR2 A;  3KL4 A;  2KQ9 A;  2OOC A;  2OU6 A;  1M56 C;  5E33 A;  4UDV A;  3MBG A;  4C7O B;  4XTK A;  2AWC A;  1QPU A;  3NDB B;  1A7E A;  1JOG A;  1G8X A;  1LE2 A;  1OCC C;  2L7A A;  3GEE A;  3O55 A;  1MMN A;  3ITF A;  2X0C A;  2YVK A;  1FAP B;  4G7H F;  3EPV A;  4NTF A;  3KMI A;  2UUI A;  3MFN A;  2Z15 A;  4BEM J;  2B0J A;  5BQG A;  2ZXP A;  1NZE A;  4AX2 A;  2R7T A;  1APC A;  3K33 A;  5BUO A;  3NMK A;  5L0I A;  5A6A A;  3Q6M A;  3HKK A;  3ZTM A;  2IBF A;  4DVY P;  2L81 A;  3PCV A;  3LLK A;  4XPW A;  3H65 A;  4CDY A;  2PFD A;  5D92 A;  1A7V A;  1NSG B;  4QI2 A;  4OIQ F;  4E0I A;  1DOW A;  4NC3 A;  1I4Z A;  2VAS A;  1Z7Q c;  5JVE A;  3SNH A;  3M4C A;  3B0V C;  5EHH A;  4CS8 C;  3GM1 A;  4O6M A;  4MVZ A;  3U0C A;  1NU7 D;  2YL1 A;  4PFO A;  4MND A;  2L6G A;  3VRC A;  4BG0 A;  4K0D A;  4D4X A;  1U89 A;  2GWW A;  3W2V A;  5EGY A;  4I1O B;  2P1A A;  2XXA A;  3L34 A;  3EGX A;  2WZL A;  3EH1 A;  3JRT A;  3JSE O;  4W8K A;  4Z9H A;  3VAY A;  3V5X A;  3ZSU A;  2E87 A;  3CSK A;  4FES A;  1NLX A;  1NFO A;  1KTM A;  2XLH A;  1TFK B;  4YL0 A;  2KNH A;  2QUP A;  1HMO A;  2IXP A;  1V54 C;  2XLW A;  1LVK A;  2BC5 A;  2M64 A;  2XM4 A;  3TOL A;  3C8G B;  1HE1 A;  1FFT C;  4EHP A;  1Z63 A;  3FOO A;  3OWT A;  2L6H A;  2QY9 A;  3F46 A;  1LI5 A;  4JJF A;  4DJ9 A;  3DKA A;  4CSA A;  3O6X A;  2XS1 A;  1Q0D A;  2HMZ A;  2NUP B;  1M57 C;  3I5P A;  3JCU Q;  2EIN C;  4MVR A;  5AC5 A;  2XLD A;  1Q0M A;  3V7O A;  3C62 A;  3UMH A;  3GWN A;  3S90 A;  5HV9 A;  1G5Z A;  3EGD A;  4KBL A;  1T6I A;  1U6H A;  3GOR A;  3RQE A;  5B3I A;  2ZPA A;  3DMD A;  2J9V A;  4FAP B;  1AUE A;  3UGP A;  2BE5 F;  1BR4 A;  1M2V B;  3DXJ F;  4MVS A;  4N4W A;  3CZ6 A;  1OXK A;  1Z6A A;  4LDQ A;  3K66 A;  1BR2 A;  2J9U A;  3DJU B;  4EBK A;  3A9C A;  4I44 A;  3CAX A;  3EGD B;  2NPU A; 
#chains in the Genus database with same CATH homology
 1FR0 A;  1BDJ B;  3US6 A;  1Y6D A;  4EUK B;  1QSP A;  1SR2 A;  1OXB A;  2OOC A;  4PAC A;  1C02 A;  1WN0 A;  1TQG A;  2R25 A;  3KYI A;  4G78 A;  1YVI A;  3MYF A;  3U3B A;  3KYJ A;  1A0B A;  1I5N A;  1OXK A;  2LCH A;  2Q4F A;  3IQT A;  1C03 A;  2LP4 A;  2A0B A;  2LD6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...