3IQTA

Structure of the hpt domain of sensor protein bara from escherichia coli cft073.
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
123
structure length
123
Chain Sequence
SNAVNEIVVNPNATLDWQLALRQAAGKTDLARDMLQMLLDFLPEVRNKVEEQLVGENPEGLVDLIHKLHGSCGYSGVPRMKNLCQLIEQQLRSGTKEEDLEPELLELLDEMDNVAREASKILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Signal transduction histidine-protein kinase barA
publication title Structure of the HPT domain of Sensor protein barA from Escherichia coli CFT073.
rcsb
source organism Escherichia coli
total genus 41
structure length 123
sequence length 123
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2009-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01627 Hpt Hpt domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.160 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) HPT domain 3iqtA01
1BDJB 3US6A 1A0BA 2LCHA 1WN0A 4PACA 1TQGA 3MYFA 1YVIA 1QSPA 3IQTA 4EUKB 3KYJA 2Q4FA 1Y6DA 1FR0A 2OOCA 1OXKA 3KYIA 2LD6A 2LP4A 1OXBA 2R25A 3U3BA 1C03A 1C02A 4G78A 1I5NA 1SR2A 2A0BA
chains in the Genus database with same CATH superfamily
2J45A 4U5HA 1QPUA 2AU5A 3G4ZA 3O39A 2EPKX 2YQYA 4PFPA 3HNIA 3HJCA 3CSKA 3GANA 3JSEO 4XEFA 1VMAA 2LK4A 5DS4A 4YL1A 2J9UA 3I4UA 5KYNA 1LE4A 2HSBA 4PR9A 2ZXOA 3Q6MA 3RKOF 1QLEC 3TQOA 4OINF 3ABLC 3JSZA 3QW0A 4BJ5C 1JOGA 5D91A 3R7CA 3QTHA 4YT8A 3C8GD 2Q4FA 2IBFA 3TD7A 5KYYB 3HNJA 3EFOA 2R7UA 2NUPB 2FAPB 3U3BA 3S90A 4F4BA 2R7RA 4U9DA 3C8GB 3QVZA 3LS0A 1F1MA 1M2VA 5HV9A 2EILC 1JPNA 2EPLX 4Z9JA 4ANJA 5DS6A 3QMKA 4O6MA 2QY9A 3CZ6A 3U5SA 5A6KA 3KL4A 1S7ZA 3ASNC 4JURI 3QW1A 3CQZA 1A0BA 1L7CA 1YA9A 3C7JA 3LLIA 2CYDA 4GQHA 3MFNA 3WODF 2IOQA 3FAJA 1SF8A 1VLSA 3S9OA 4D4XA 4UDVA 4J32B 4XLNF 3SNHA 1GM5A 2XL6A 3DJUB 4JC7A 5CIVA 2G62A 1OW6A 1U6HA 4JE9A 4KBLA 3U9JA 4XTKA 4GYTA 1RJ9B 2HKVA 4WGYA 4YT5A 2ASRA 3T6BA 3ZIBA 1OCZC 1Q0MA 2XXAA 1WOLA 2C03A 2G3KA 3RVYA 2EIJC 3IPMO 4JZAA 5JRAA 3DKAA 2HZ8A 2YZSA 1V54C 3W4YA 2MWQA 3FDQA 1OXKA 1NU9C 2ZXPA 4LDQA 4AL0A 5AC5A 3DI5A 4B6IA 2J0XA 2IM8A 2YLIA 3QZCA 4GEHA 5COMA 5B1AC 4E0IA 5FZTA 5A6JA 3POVA 2L6GA 2D4UA 2W4BA 1DOVA 1M57C 1ORJA 2XLDA 4O6YA 4OD5A 5CI9A 1K40A 1ZU5A 2AVKA 1J8MF 1JAFA 5JT4A 3LEVA 2GFHA 3RIPA 3B29A 4MVZA 1Q0KA 3U9MA 3NKDA 1YDIA 4E18A 3G50A 4MW3A 3EG9B 1T01A 5B1BC 1OCOC 2ICWG 2QLAA 4E7SA 3ZTZA 3DZAA 4DRHB 3EG9A 3S28A 3CAXA 4YT2A 3H2VA 4FAPB 3U3FA 3GWNA 2PX3A 4MS2A 1AEPA 4N4WA 4CS9A 2Q9CA 4FX5A 3IQ6A 2Q7RA 3SXKA 1SYQA 3TJ6A 3W8IA 4CDAA 4EBJA 5K0IA 1E85A 3EGDA 4YL0A 3ABKC 2LD6A 3G4XA 3L1MA 1C03A 1HW1A 3KH2A 3DD7A 4Q4ZF 2LSEA 4MVUA 1SR2A 2OG2A 1VYKA 3F47A 3GEHA 3K1IA 3T6JA 2R7XA 3E9VA 4NTBA 4W8KA 4JIOA 1T9KA 3MBGA 3Q6NA 2A0UA 2UUIA 2WL8A 2XSEA 3SXMA 3TOLA 1WASA 4IARA 2XL4A 2Y3DA 2DYRC 5COFA 1GGQA 2PF4E 4OIQF 3NYJA 2OJQA 3VF0A 4PJNA 2GWWA 3JTLO 4JJFA 1KNYA 4I44A 5F28E 4A2NB 4Q5SF 2WZLA 3RW0A 1IW7F 1FR0A 2O9XA 4U5FE 4C7OB 4BJ6A 4NTFA 2DB4A 3KYIA 2L81A 5KYUA 4YWQA 5L0FA 3TJ5A 2P0NA 3JYYA 2Y3HA 5KYWB 2WVQA 1HE1A 1T5OA 2PNOA 3DM5A 2M4EA 1UFBA 1CGNA 1ZHWA 3MX3A 2MHRA 2DYSC 2H7OA 1Z7Qc 2NG1A 3A11A 3LUTB 1NBBA 3ZWIA 2EPNA 2P1AA 1ZVZA 3MYIA 3A9CA 1EKYA 2R7OA 2L6HA 4KNWA 1FFTC 4DBRA 3I5PA 5B3SC 3K33A 1Z5ZA 1M2OA 4O6NA 5F5HA 2E87A 3LEOA 5COGA 3B71A 3EH2A 1Z3IX 2A6EF 2KJGA 2XS1A 1BR2A 3C62A 3HLZA 3T6GB 3V5XA 4CS8C 2HJMA 1E83A 2X0CA 3W8HA 5FCLA 1FTSA 4JRZA 1WATA 4JTAB 2B0JA 2ZD9A 3AGTA 2PP4A 3B9QA 2YHSA 5E2QA 3SP1A 3LAYA 2R7SA 3EZIA 3ZC4A 3O6XA 2GA0A 1E86A 1TFOB 4ONSA 3PDMP 2XM4A 4OIPF 3L8JA 1VK5A 2C04A 2H7BA 4C3BA 3SYNA 2PBEA 4IB4A 3F46A 3NYLA 4E7ZA 4Z9HA 2G3VA 1YVIA 3M4CA 3AQBA 3IQTA 3HKKA 3W2WA 4YT4A 4CS9C 3LNMB 4XPYA 3V5YA 1RMVA 1ZHTA 4CS7A 2Q00A 4CBEA 1Y6DA 1OQCA 5T3TA 5T3WA 1K05A 2LP4A 2YL1A 2F22A 1XWJA 4DRJB 1HE9A 5KYYA 1NSGB 4G78A 1D1AA 1Z63A 4CIHA 1LE2A 1TWAA 3K1IC 2NUPA 3DMDA 3JZ0A 4J30B 1Y4CA 2EPMX 2XLWA 1D0XA 1D1CA 4JEBA 5JS5A 1TKNA 3C8GA 4J7TA 3N0TA 1NFNA 2HV7A 4RBNA 3RVZA 2KGOA 3OEOA 4LLCA 4X0RA 3SXZA 3NMJA 3QVYA 4BEJA 1EA8A 2A6HF 4PACA 3EHMA 3VRCA 1PV3A 1T6UA 1TQGA 2VCCA 4CX9A 3WAQA 2RD9A 5JSLA 1ZHZA 4HFFB 1VTMP 2AWYA 2YKZA 3C18A 1HMDA 3EJNA 2AP3A 3TOMA 3OWTA 1O5HA 2A1DD 4BJ6C 1MMNA 1RJ9A 4ULWA 3GM1A 1U0BB 2OOCA 1YLMA 5JVEA 4PK4A 2AWCA 2HSQA 4MNDA 2QUPA 1R5ID 2OU6A 2QTVA 2KW3C 1LVKA 1WGWA 4XEKA 1LS4A 2I8BA 1YAUO 3S0XA 4U9EA 1BDJB 1RKEB 3US6A 1H7IA 1TWHA 4I3MA 4AX2A 1H9TA 3FHDA 2LIGA 1ZZPA 1A41A 2EPOA 4U5GA 4AL1A 1WTYA 1YYXA 2L7AA 3IQCA 1V74B 5B3IA 5EHHA 2H8AA 3ZG1A 4BG0A 1C17M 3ABMC 4BEMJ 4KNVA 1LI7A 1MNEA 3EPVA 3KPHA 1S05A 4XQ1A 3ZQVA 4JCHA 4WJ0A 1NLXA 3RH3A 4U5CE 3ZSUA 1EQ1A 1CPQA 3I5QA 3X2QC 3W2VA 1ORYA 2V26A 2HFIA 4YJWA 2OEXA 3AGUA 3R2PA 3NMKA 1MMAA 1QVXA 1ST6A 1V4AA 3GODA 4HEAJ 3S84A 2KYHA 2VB6A 2CNWD 4MQ9F 3FOOA 4DRIB 4Q7CA 1I4ZA 4JEAA 4JTCB 1OCRC 3UGOA 4IAOA 3DAGA 1OR3A 3E70C 2QNLA 1OCCC 1IZMA 2KNHA 2YLDA 1HW2A 3NDBB 1M6TA 1J8YF 4PJMA 2LCHA 3U0CA 4H54A 1WN0A 2LQGA 1CPRA 4AK9A 2TMVP 3DAFA 1V55C 3PMRA 3C8ZA 1O87A 1JRAA 1M56C 4DJ9A 4DVYP 4EUKB 1LKXA 2KSFA 1VOMA 2R9RB 3JRMO 4HFKB 1A7VA 1E2XA 1T6QA 1ZHXA 2NUTB 2W4MA 5AGFA 1MMGA 1G4WR 4J7YA 4QI0A 1Z23A 1SZIA 2L6FA 3LJBA 2R02A 3O55A 1Z6AA 1BR4A 1DOWA 5L3VA 2JX0A 1PD0A 3IQ5A 2R7WA 4C7OA 1HMOA 2NSGA 2D5RB 4P9TA 1N1CA 1GS9A 3H65A 3CEXA 3GM2A 3AQCA 4CJGA 3IEEA 5KYWA 3K1HA 4OD4A 2L9JA 1ZW2A 3EZHA 3RQFA 5DLJA 3PHF2 3NYMA 3MLGA 3GWLA 4K0DA 5KYXB 1G5ZA 1OKKD 2Q9AA 3MYFA 2R03A 5KYXA 4MVOA 1CGME 2YEVA 5AC4A 2P6VA 3WHNA 3NRHA 1APCA 3U2MA 1OKKA 2J9BA 1JR8A 4QDLA 3ZVRA 2Y69C 3LESA 1UG7A 1H6GA 3NMIA 3ECSA 5A6BD 3RFYA 2HUJA 3U2LA 4FWVA 4MVRA 3DE9A 2A0BA 4PJJA 1XZQA 1AVOB 1H9GA 2KC3A 3U8VA 4K1OA 4U5BE 1D0ZA 1FNTc 3AG1C 2YL0A 3RQEA 3S29A 5A6BA 2HJ3A 4LERA 4E0HA 4LLEA 1OR2A 4JCZA 1GQAA 2BE5F 4NCQA 4MVQA 2IXOA 3UGPA 3DWWA 4MTOA 2IXNA 4XPWA 4AE4B 1E84A 3AG4C 1FFHA 4YK5A 5EK0A 4Z9IA 1YARO 2J7PD 4MTGA 3HNLA 4MVSA 3ZQYA 5BQIA 1QZXA 3KYJA 2FGYA 3JYHA 1LM3B 4LDRA 4R32A 2YL3A 2XLEA 5CI8A 3T4RA 2A68F 3ZTMA 4FESA 2VCBA 3L34A 3DXJF 4YN0B 3VAYA 3X1OA 1WWPA 1A7EA 4CJOA 1QKRA 2J7PA 1FMWA 2M64A 1I4YA 2NSFA 3LS1A 5L0HA 5DS5A 2CCYA 3AOUA 4MW8A 3TK0A 2X51A 3J06A 5F5FA 2VC9A 1BR1A 2R7TA 3K7DA 3FOPA 3B0UX 3TULA 5IY5C 4G7HF 1TWCA 2EIMC 4LACB 1A7DA 3ZDLA 4EIYA 2GAQA 3H2UA 1FMVA 1VYIA 3JCUQ 4MTFA 4N06A 4LDKA 1LI5A 1YA7O 2WZFA 2P61A 4NY3A 2VH3A 4RDAA 3EFOB 2IYLD 1R4TA 2CGEA 4D4NA 4EKWA 3B0VC 1JMWA 2KK1A 3AG2C 4L6RA 4WABA 2HMQA 1M2VB 4NC3A 3KKBA 4G0HA 4PJLA 2ZPAA 2WB7A 3S27A 3VM6A 4G7ZF 3FAPB 4HE8D 4DXWA 2Q3TA 1B68A 4O7GA 4ULVA 1EI7A 1NG1A 4DVZA 3UR3C 4BPMA 1YZCA 3DJNB 2EINC 4KC9A 3UMKA 3DE8A 2XLMA 4BJ1A 1XZPA 1TWGA 2MYSA 3C63A 2Y3BA 2YL7A 1BZ4A 5DQZA 4KI2A 3KMIA 1RKEA 1SMYF 1ZHYA 2HV6A 2YVKA 2XM0A 1CGOA 4OIRF 2OKUA 3K6BA 2XXAB 5E33A 4CSAA 4QI2A 4JTDB 2CDQA 2DGJA 3GM3A 1MQVA 2KQ9A 3HNKA 1LIHA 1O3UA 3K66A 3OA1A 4I1MA 4NQFA 1MMDA 3JT1A 5A69A 1L3PA 4O79A 1D0YA 4JW1A 4U5EE 1Q0DA 1KU2A 3UMIA 1OW7A 4IWBA 2R25A 1OXBA 2B0HA 5JP7A 3ASOC 4CS8A 2R7VA 3V5ZA 3B0PA 3SXYA 3GORA 3T9OA 4XPXA 2A69F 3Q7GA 3N24A 4XWJA 3V7OA 2J9WA 2LFDA 2XRHA 4EWCA 2ZXWC 2ETSA 3NKEA 1ZW3A 2XS8A 1W2WA 5BQHA 2CNWA 3FVYA 3JRTA 5GPGB 4K7BA 4DBQA 4IAQA 3M4BA 4CDYA 4OIOF 4ZLDA 3GEEA 3M1CB 5L0GA 5HSWA 4E17A 1JPJA 1OW8A 2XLVA 3WG7C 4N6CA 1KTMA 1VB5A 4BJTA 4U5DE 3EGDB 2GDCA 3M79A 4ER9A 2R7QA 2J46A 4RD9A 5DQTA 3ITFA 1FAPB 4N6HA 4C3DA 2HMZA 2OCCC 3EHNA 4P6IC 4BJ5A 4CDVA 5L0JA 2NUTA 2VASA 2IXMA 2UUHA 2XLHA 4H4KC 1QQ3A 3AJMA 4JKVA 2BL2A 2YLGA 4W8PA 2XLOA 3UNGC 4EHPA 1TFKB 4NTAA 4EBKA 5EGYA 2QE9A 1NFOA 2WZGA 2ZXRA 5A6AA 5T1DB 5JUAA 5L0IA 1HY5A 3Q7LA 2J8WA 2Y3GA 1RKCA 2EIKC 5E3CA 3BEHA 2FFHA 3AG3C 1RXQA 4JVSA 5JLIA 3L8IA 3FXHA 1QSPA 3EH1A 4EBBA 1VLTA 2Z15A 3O10A 2J0WA 5KYUB 2CW0F 5BQGA 1Q0GA 2NPUA 2BC5A 2Y39A 1PCXA 2YWAA 2DI3A 1G8XA 4WGZA 2JD3A 1C02A 2VCAA 1ORSC 1I5NA 3EGXB 3EQLF 2OEVA 3U8PA 1G4US 5L0CA 1Q0FA 1RCPA 5D92A 5DVWA 2V3CC 2W45A 2WVOA 2YRFA 3EGXA 3ATPA 5E3AA 5TJ5E 5L0DA 2LFFA 1PD1A 3FMSA 3GEIA 3SZRA 2OQMA 4CSAC 2IXPA 2OJED 1BBHA 4PFOA 2PFDA 1YZAA 2WVNA 3IHUA 1ZYRF 2I15A 1NZEA 4IRUA 3RYLA 2JPUA 1LS1A 2Q9BA 4IJJA 4C3EA 1K04A 2XL8A 5BUOA 3L0IA 4G7OF 3N2ZB 1NU7D 1YJGA 5L3QA 2H7VC 4AE4A 4I1OB 4JJGA 4CIPA 1MNDA 4P9FA 3RF3A 1U89A 3VYWA 2PX0A 4DOZA 1TR2A 1D1BA 2RSEB 3LLKA 3M15A 3RQGA 4XLPF 3PCVA 3LNRA 2W9YA 2HS5A 1LPEA 3SEOA 4ZLCA 4MVMA 4A4AA 1AUEA 4YL3A 2R05A 3DM9B 3BRJA 3UMHA 2P7VA 3NG1A 256BA 2J9VA 3HTKC 4XEVA 1YYJA 4M63A 1ZU4A 1T6IA 4IGGA
chains in the Genus database with same CATH topology
1BDJB 3US6A 1A0BA 2LCHA 1WN0A 4PACA 1TQGA 3MYFA 1YVIA 1QSPA 3IQTA 4EUKB 3KYJA 2Q4FA 1Y6DA 1FR0A 2OOCA 1OXKA 3KYIA 2LD6A 2LP4A 1OXBA 2R25A 3U3BA 1C03A 1C02A 4G78A 1I5NA 1SR2A 2A0BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BDJ B;  3US6 A;  1A0B A;  2LCH A;  1WN0 A;  4PAC A;  1TQG A;  3MYF A;  1YVI A;  1QSP A;  3IQT A;  4EUK B;  3KYJ A;  2Q4F A;  1Y6D A;  1FR0 A;  2OOC A;  1OXK A;  3KYI A;  2LD6 A;  2LP4 A;  1OXB A;  2R25 A;  3U3B A;  1C03 A;  1C02 A;  4G78 A;  1I5N A;  1SR2 A;  2A0B A; 
#chains in the Genus database with same CATH topology
 2J45 A;  4U5H A;  1QPU A;  2AU5 A;  3G4Z A;  3O39 A;  2EPK X;  2YQY A;  4PFP A;  3HNI A;  3HJC A;  3CSK A;  3GAN A;  3JSE O;  4XEF A;  1VMA A;  2LK4 A;  5DS4 A;  4YL1 A;  2J9U A;  3I4U A;  5KYN A;  1LE4 A;  2HSB A;  4PR9 A;  2ZXO A;  3Q6M A;  3RKO F;  1QLE C;  3TQO A;  4OIN F;  3ABL C;  3JSZ A;  3QW0 A;  4BJ5 C;  1JOG A;  5D91 A;  3R7C A;  3QTH A;  4YT8 A;  3C8G D;  2Q4F A;  2IBF A;  3TD7 A;  5KYY B;  3HNJ A;  3EFO A;  2R7U A;  2NUP B;  2FAP B;  3U3B A;  3S90 A;  4F4B A;  2R7R A;  4U9D A;  3C8G B;  3QVZ A;  3LS0 A;  1F1M A;  1M2V A;  5HV9 A;  2EIL C;  1JPN A;  2EPL X;  4Z9J A;  4ANJ A;  5DS6 A;  3QMK A;  4O6M A;  2QY9 A;  3CZ6 A;  3U5S A;  5A6K A;  3KL4 A;  1S7Z A;  3ASN C;  4JUR I;  3QW1 A;  3CQZ A;  1A0B A;  1L7C A;  1YA9 A;  3C7J A;  3LLI A;  2CYD A;  4GQH A;  3MFN A;  3WOD F;  2IOQ A;  3FAJ A;  1SF8 A;  1VLS A;  3S9O A;  4D4X A;  4UDV A;  4J32 B;  4XLN F;  3SNH A;  1GM5 A;  2XL6 A;  3DJU B;  4JC7 A;  5CIV A;  2G62 A;  1OW6 A;  1U6H A;  4JE9 A;  4KBL A;  3U9J A;  4XTK A;  4GYT A;  1RJ9 B;  2HKV A;  4WGY A;  4YT5 A;  2ASR A;  3T6B A;  3ZIB A;  1OCZ C;  1Q0M A;  2XXA A;  1WOL A;  2C03 A;  2G3K A;  3RVY A;  2EIJ C;  3IPM O;  4JZA A;  5JRA A;  3DKA A;  2HZ8 A;  2YZS A;  1V54 C;  3W4Y A;  2MWQ A;  3FDQ A;  1OXK A;  1NU9 C;  2ZXP A;  4LDQ A;  4AL0 A;  5AC5 A;  3DI5 A;  4B6I A;  2J0X A;  2IM8 A;  2YLI A;  3QZC A;  4GEH A;  5COM A;  5B1A C;  4E0I A;  5FZT A;  5A6J A;  3POV A;  2L6G A;  2D4U A;  2W4B A;  1DOV A;  1M57 C;  1ORJ A;  2XLD A;  4O6Y A;  4OD5 A;  5CI9 A;  1K40 A;  1ZU5 A;  2AVK A;  1J8M F;  1JAF A;  5JT4 A;  3LEV A;  2GFH A;  3RIP A;  3B29 A;  4MVZ A;  1Q0K A;  3U9M A;  3NKD A;  1YDI A;  4E18 A;  3G50 A;  4MW3 A;  3EG9 B;  1T01 A;  5B1B C;  1OCO C;  2ICW G;  2QLA A;  4E7S A;  3ZTZ A;  3DZA A;  4DRH B;  3EG9 A;  3S28 A;  3CAX A;  4YT2 A;  3H2V A;  4FAP B;  3U3F A;  3GWN A;  2PX3 A;  4MS2 A;  1AEP A;  4N4W A;  4CS9 A;  2Q9C A;  4FX5 A;  3IQ6 A;  2Q7R A;  3SXK A;  1SYQ A;  3TJ6 A;  3W8I A;  4CDA A;  4EBJ A;  5K0I A;  1E85 A;  3EGD A;  4YL0 A;  3ABK C;  2LD6 A;  3G4X A;  3L1M A;  1C03 A;  1HW1 A;  3KH2 A;  3DD7 A;  4Q4Z F;  2LSE A;  4MVU A;  1SR2 A;  2OG2 A;  1VYK A;  3F47 A;  3GEH A;  3K1I A;  3T6J A;  2R7X A;  3E9V A;  4NTB A;  4W8K A;  4JIO A;  1T9K A;  3MBG A;  3Q6N A;  2A0U A;  2UUI A;  2WL8 A;  2XSE A;  3SXM A;  3TOL A;  1WAS A;  4IAR A;  2XL4 A;  2Y3D A;  2DYR C;  5COF A;  1GGQ A;  2PF4 E;  4OIQ F;  3NYJ A;  2OJQ A;  3VF0 A;  4PJN A;  2GWW A;  3JTL O;  4JJF A;  1KNY A;  4I44 A;  5F28 E;  4A2N B;  4Q5S F;  2WZL A;  3RW0 A;  1IW7 F;  1FR0 A;  2O9X A;  4U5F E;  4C7O B;  4BJ6 A;  4NTF A;  2DB4 A;  3KYI A;  2L81 A;  5KYU A;  4YWQ A;  5L0F A;  3TJ5 A;  2P0N A;  3JYY A;  2Y3H A;  5KYW B;  2WVQ A;  1HE1 A;  1T5O A;  2PNO A;  3DM5 A;  2M4E A;  1UFB A;  1CGN A;  1ZHW A;  3MX3 A;  2MHR A;  2DYS C;  2H7O A;  1Z7Q c;  2NG1 A;  3A11 A;  3LUT B;  1NBB A;  3ZWI A;  2EPN A;  2P1A A;  1ZVZ A;  3MYI A;  3A9C A;  1EKY A;  2R7O A;  2L6H A;  4KNW A;  1FFT C;  4DBR A;  3I5P A;  5B3S C;  3K33 A;  1Z5Z A;  1M2O A;  4O6N A;  5F5H A;  2E87 A;  3LEO A;  5COG A;  3B71 A;  3EH2 A;  1Z3I X;  2A6E F;  2KJG A;  2XS1 A;  1BR2 A;  3C62 A;  3HLZ A;  3T6G B;  3V5X A;  4CS8 C;  2HJM A;  1E83 A;  2X0C A;  3W8H A;  5FCL A;  1FTS A;  4JRZ A;  1WAT A;  4JTA B;  2B0J A;  2ZD9 A;  3AGT A;  2PP4 A;  3B9Q A;  2YHS A;  5E2Q A;  3SP1 A;  3LAY A;  2R7S A;  3EZI A;  3ZC4 A;  3O6X A;  2GA0 A;  1E86 A;  1TFO B;  4ONS A;  3PDM P;  2XM4 A;  4OIP F;  3L8J A;  1VK5 A;  2C04 A;  2H7B A;  4C3B A;  3SYN A;  2PBE A;  4IB4 A;  3F46 A;  3NYL A;  4E7Z A;  4Z9H A;  2G3V A;  1YVI A;  3M4C A;  3AQB A;  3IQT A;  3HKK A;  3W2W A;  4YT4 A;  4CS9 C;  3LNM B;  4XPY A;  3V5Y A;  1RMV A;  1ZHT A;  4CS7 A;  2Q00 A;  4CBE A;  1Y6D A;  1OQC A;  5T3T A;  5T3W A;  1K05 A;  2LP4 A;  2YL1 A;  2F22 A;  1XWJ A;  4DRJ B;  1HE9 A;  5KYY A;  1NSG B;  4G78 A;  1D1A A;  1Z63 A;  4CIH A;  1LE2 A;  1TWA A;  3K1I C;  2NUP A;  3DMD A;  3JZ0 A;  4J30 B;  1Y4C A;  2EPM X;  2XLW A;  1D0X A;  1D1C A;  4JEB A;  5JS5 A;  1TKN A;  3C8G A;  4J7T A;  3N0T A;  1NFN A;  2HV7 A;  4RBN A;  3RVZ A;  2KGO A;  3OEO A;  4LLC A;  4X0R A;  3SXZ A;  3NMJ A;  3QVY A;  4BEJ A;  1EA8 A;  2A6H F;  4PAC A;  3EHM A;  3VRC A;  1PV3 A;  1T6U A;  1TQG A;  2VCC A;  4CX9 A;  3WAQ A;  2RD9 A;  5JSL A;  1ZHZ A;  4HFF B;  1VTM P;  2AWY A;  2YKZ A;  3C18 A;  1HMD A;  3EJN A;  2AP3 A;  3TOM A;  3OWT A;  1O5H A;  2A1D D;  4BJ6 C;  1MMN A;  1RJ9 A;  4ULW A;  3GM1 A;  1U0B B;  2OOC A;  1YLM A;  5JVE A;  4PK4 A;  2AWC A;  2HSQ A;  4MND A;  2QUP A;  1R5I D;  2OU6 A;  2QTV A;  2KW3 C;  1LVK A;  1WGW A;  4XEK A;  1LS4 A;  2I8B A;  1YAU O;  3S0X A;  4U9E A;  1BDJ B;  1RKE B;  3US6 A;  1H7I A;  1TWH A;  4I3M A;  4AX2 A;  1H9T A;  3FHD A;  2LIG A;  1ZZP A;  1A41 A;  2EPO A;  4U5G A;  4AL1 A;  1WTY A;  1YYX A;  2L7A A;  3IQC A;  1V74 B;  5B3I A;  5EHH A;  2H8A A;  3ZG1 A;  4BG0 A;  1C17 M;  3ABM C;  4BEM J;  4KNV A;  1LI7 A;  1MNE A;  3EPV A;  3KPH A;  1S05 A;  4XQ1 A;  3ZQV A;  4JCH A;  4WJ0 A;  1NLX A;  3RH3 A;  4U5C E;  3ZSU A;  1EQ1 A;  1CPQ A;  3I5Q A;  3X2Q C;  3W2V A;  1ORY A;  2V26 A;  2HFI A;  4YJW A;  2OEX A;  3AGU A;  3R2P A;  3NMK A;  1MMA A;  1QVX A;  1ST6 A;  1V4A A;  3GOD A;  4HEA J;  3S84 A;  2KYH A;  2VB6 A;  2CNW D;  4MQ9 F;  3FOO A;  4DRI B;  4Q7C A;  1I4Z A;  4JEA A;  4JTC B;  1OCR C;  3UGO A;  4IAO A;  3DAG A;  1OR3 A;  3E70 C;  2QNL A;  1OCC C;  1IZM A;  2KNH A;  2YLD A;  1HW2 A;  3NDB B;  1M6T A;  1J8Y F;  4PJM A;  2LCH A;  3U0C A;  4H54 A;  1WN0 A;  2LQG A;  1CPR A;  4AK9 A;  2TMV P;  3DAF A;  1V55 C;  3PMR A;  3C8Z A;  1O87 A;  1JRA A;  1M56 C;  4DJ9 A;  4DVY P;  4EUK B;  1LKX A;  2KSF A;  1VOM A;  2R9R B;  3JRM O;  4HFK B;  1A7V A;  1E2X A;  1T6Q A;  1ZHX A;  2NUT B;  2W4M A;  5AGF A;  1MMG A;  1G4W R;  4J7Y A;  4QI0 A;  1Z23 A;  1SZI A;  2L6F A;  3LJB A;  2R02 A;  3O55 A;  1Z6A A;  1BR4 A;  1DOW A;  5L3V A;  2JX0 A;  1PD0 A;  3IQ5 A;  2R7W A;  4C7O A;  1HMO A;  2NSG A;  2D5R B;  4P9T A;  1N1C A;  1GS9 A;  3H65 A;  3CEX A;  3GM2 A;  3AQC A;  4CJG A;  3IEE A;  5KYW A;  3K1H A;  4OD4 A;  2L9J A;  1ZW2 A;  3EZH A;  3RQF A;  5DLJ A;  3PHF 2;  3NYM A;  3MLG A;  3GWL A;  4K0D A;  5KYX B;  1G5Z A;  1OKK D;  2Q9A A;  3MYF A;  2R03 A;  5KYX A;  4MVO A;  1CGM E;  2YEV A;  5AC4 A;  2P6V A;  3WHN A;  3NRH A;  1APC A;  3U2M A;  1OKK A;  2J9B A;  1JR8 A;  4QDL A;  3ZVR A;  2Y69 C;  3LES A;  1UG7 A;  1H6G A;  3NMI A;  3ECS A;  5A6B D;  3RFY A;  2HUJ A;  3U2L A;  4FWV A;  4MVR A;  3DE9 A;  2A0B A;  4PJJ A;  1XZQ A;  1AVO B;  1H9G A;  2KC3 A;  3U8V A;  4K1O A;  4U5B E;  1D0Z A;  1FNT c;  3AG1 C;  2YL0 A;  3RQE A;  3S29 A;  5A6B A;  2HJ3 A;  4LER A;  4E0H A;  4LLE A;  1OR2 A;  4JCZ A;  1GQA A;  2BE5 F;  4NCQ A;  4MVQ A;  2IXO A;  3UGP A;  3DWW A;  4MTO A;  2IXN A;  4XPW A;  4AE4 B;  1E84 A;  3AG4 C;  1FFH A;  4YK5 A;  5EK0 A;  4Z9I A;  1YAR O;  2J7P D;  4MTG A;  3HNL A;  4MVS A;  3ZQY A;  5BQI A;  1QZX A;  3KYJ A;  2FGY A;  3JYH A;  1LM3 B;  4LDR A;  4R32 A;  2YL3 A;  2XLE A;  5CI8 A;  3T4R A;  2A68 F;  3ZTM A;  4FES A;  2VCB A;  3L34 A;  3DXJ F;  4YN0 B;  3VAY A;  3X1O A;  1WWP A;  1A7E A;  4CJO A;  1QKR A;  2J7P A;  1FMW A;  2M64 A;  1I4Y A;  2NSF A;  3LS1 A;  5L0H A;  5DS5 A;  2CCY A;  3AOU A;  4MW8 A;  3TK0 A;  2X51 A;  3J06 A;  5F5F A;  2VC9 A;  1BR1 A;  2R7T A;  3K7D A;  3FOP A;  3B0U X;  3TUL A;  5IY5 C;  4G7H F;  1TWC A;  2EIM C;  4LAC B;  1A7D A;  3ZDL A;  4EIY A;  2GAQ A;  3H2U A;  1FMV A;  1VYI A;  3JCU Q;  4MTF A;  4N06 A;  4LDK A;  1LI5 A;  1YA7 O;  2WZF A;  2P61 A;  4NY3 A;  2VH3 A;  4RDA A;  3EFO B;  2IYL D;  1R4T A;  2CGE A;  4D4N A;  4EKW A;  3B0V C;  1JMW A;  2KK1 A;  3AG2 C;  4L6R A;  4WAB A;  2HMQ A;  1M2V B;  4NC3 A;  3KKB A;  4G0H A;  4PJL A;  2ZPA A;  2WB7 A;  3S27 A;  3VM6 A;  4G7Z F;  3FAP B;  4HE8 D;  4DXW A;  2Q3T A;  1B68 A;  4O7G A;  4ULV A;  1EI7 A;  1NG1 A;  4DVZ A;  3UR3 C;  4BPM A;  1YZC A;  3DJN B;  2EIN C;  4KC9 A;  3UMK A;  3DE8 A;  2XLM A;  4BJ1 A;  1XZP A;  1TWG A;  2MYS A;  3C63 A;  2Y3B A;  2YL7 A;  1BZ4 A;  5DQZ A;  4KI2 A;  3KMI A;  1RKE A;  1SMY F;  1ZHY A;  2HV6 A;  2YVK A;  2XM0 A;  1CGO A;  4OIR F;  2OKU A;  3K6B A;  2XXA B;  5E33 A;  4CSA A;  4QI2 A;  4JTD B;  2CDQ A;  2DGJ A;  3GM3 A;  1MQV A;  2KQ9 A;  3HNK A;  1LIH A;  1O3U A;  3K66 A;  3OA1 A;  4I1M A;  4NQF A;  1MMD A;  3JT1 A;  5A69 A;  1L3P A;  4O79 A;  1D0Y A;  4JW1 A;  4U5E E;  1Q0D A;  1KU2 A;  3UMI A;  1OW7 A;  4IWB A;  2R25 A;  1OXB A;  2B0H A;  5JP7 A;  3ASO C;  4CS8 A;  2R7V A;  3V5Z A;  3B0P A;  3SXY A;  3GOR A;  3T9O A;  4XPX A;  2A69 F;  3Q7G A;  3N24 A;  4XWJ A;  3V7O A;  2J9W A;  2LFD A;  2XRH A;  4EWC A;  2ZXW C;  2ETS A;  3NKE A;  1ZW3 A;  2XS8 A;  1W2W A;  5BQH A;  2CNW A;  3FVY A;  3JRT A;  5GPG B;  4K7B A;  4DBQ A;  4IAQ A;  3M4B A;  4CDY A;  4OIO F;  4ZLD A;  3GEE A;  3M1C B;  5L0G A;  5HSW A;  4E17 A;  1JPJ A;  1OW8 A;  2XLV A;  3WG7 C;  4N6C A;  1KTM A;  1VB5 A;  4BJT A;  4U5D E;  3EGD B;  2GDC A;  3M79 A;  4ER9 A;  2R7Q A;  2J46 A;  4RD9 A;  5DQT A;  3ITF A;  1FAP B;  4N6H A;  4C3D A;  2HMZ A;  2OCC C;  3EHN A;  4P6I C;  4BJ5 A;  4CDV A;  5L0J A;  2NUT A;  2VAS A;  2IXM A;  2UUH A;  2XLH A;  4H4K C;  1QQ3 A;  3AJM A;  4JKV A;  2BL2 A;  2YLG A;  4W8P A;  2XLO A;  3UNG C;  4EHP A;  1TFK B;  4NTA A;  4EBK A;  5EGY A;  2QE9 A;  1NFO A;  2WZG A;  2ZXR A;  5A6A A;  5T1D B;  5JUA A;  5L0I A;  1HY5 A;  3Q7L A;  2J8W A;  2Y3G A;  1RKC A;  2EIK C;  5E3C A;  3BEH A;  2FFH A;  3AG3 C;  1RXQ A;  4JVS A;  5JLI A;  3L8I A;  3FXH A;  1QSP A;  3EH1 A;  4EBB A;  1VLT A;  2Z15 A;  3O10 A;  2J0W A;  5KYU B;  2CW0 F;  5BQG A;  1Q0G A;  2NPU A;  2BC5 A;  2Y39 A;  1PCX A;  2YWA A;  2DI3 A;  1G8X A;  4WGZ A;  2JD3 A;  1C02 A;  2VCA A;  1ORS C;  1I5N A;  3EGX B;  3EQL F;  2OEV A;  3U8P A;  1G4U S;  5L0C A;  1Q0F A;  1RCP A;  5D92 A;  5DVW A;  2V3C C;  2W45 A;  2WVO A;  2YRF A;  3EGX A;  3ATP A;  5E3A A;  5TJ5 E;  5L0D A;  2LFF A;  1PD1 A;  3FMS A;  3GEI A;  3SZR A;  2OQM A;  4CSA C;  2IXP A;  2OJE D;  1BBH A;  4PFO A;  2PFD A;  1YZA A;  2WVN A;  3IHU A;  1ZYR F;  2I15 A;  1NZE A;  4IRU A;  3RYL A;  2JPU A;  1LS1 A;  2Q9B A;  4IJJ A;  4C3E A;  1K04 A;  2XL8 A;  5BUO A;  3L0I A;  4G7O F;  3N2Z B;  1NU7 D;  1YJG A;  5L3Q A;  2H7V C;  4AE4 A;  4I1O B;  4JJG A;  4CIP A;  1MND A;  4P9F A;  3RF3 A;  1U89 A;  3VYW A;  2PX0 A;  4DOZ A;  1TR2 A;  1D1B A;  2RSE B;  3LLK A;  3M15 A;  3RQG A;  4XLP F;  3PCV A;  3LNR A;  2W9Y A;  2HS5 A;  1LPE A;  3SEO A;  4ZLC A;  4MVM A;  4A4A A;  1AUE A;  4YL3 A;  2R05 A;  3DM9 B;  3BRJ A;  3UMH A;  2P7V A;  3NG1 A;  256B A;  2J9V A;  3HTK C;  4XEV A;  1YYJ A;  4M63 A;  1ZU4 A;  1T6I A;  4IGG A; 
#chains in the Genus database with same CATH homology
 1BDJ B;  3US6 A;  1A0B A;  2LCH A;  1WN0 A;  4PAC A;  1TQG A;  3MYF A;  1YVI A;  1QSP A;  3IQT A;  4EUK B;  3KYJ A;  2Q4F A;  1Y6D A;  1FR0 A;  2OOC A;  1OXK A;  3KYI A;  2LD6 A;  2LP4 A;  1OXB A;  2R25 A;  3U3B A;  1C03 A;  1C02 A;  4G78 A;  1I5N A;  1SR2 A;  2A0B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...