4YT8A

Semet-labelled hmdii from methanocaldococcus jannaschii
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
344
structure length
344
Chain Sequence
DNMKVSVYGAGNQNLYINKLNLPEKFGGEPPYGGSRMAIEFAEAGHDVVLAEPNKNIMSDDLWKKVEDAGVKVVSDDVEAAKHGEIHVLFTPFGKATFRIAKTIIEHVPENAVICNTCTVSPVVLYYSLEPILRTKRKDVGISSMHPAAVPGTPQHGHYVIGGKTTDGKELATEEQIKKAVELAKSAGKEAYVVPADVSSVVADMGSLVTAVALSGVLDYYTVGRKIINAPKKMIEQQVIMTLQTMASLVETSGIEGMVKALNPELLIRSASSMKLLDRQKDLDAALEILQNLDETLKAEVEKAEIKPTTLVAAQSLVKEIKTLIGGAAAEGAIKRSARKLFEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Towards a functional identification of catalytically inactive [Fe]-hydrogenase paralogs.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Metal binding protein
molecule keywords H(2)-forming methylenetetrahydromethanopterin dehydrogenase-
total genus 114
structure length 344
sequence length 344
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03201 HMD H2-forming N5,N10-methylene-tetrahydromethanopterin dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1300 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4yt8A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4yt8A01
4BO4A 5KNLA 1B8UA 3I9NA 4ZQGA 1I3NA 3TRIA 5HRUA 3ROPA 2PY6A 2C29D 2CVZA 1GQQA 2WM3A 3JCZA 5AXCA 3F5SA 3QVTA 1NQAO 5U1PA 2GUGA 4AJLA 3AFMA 3X2FA 1F14A 1AE1A 1Z7EA 1YO6A 3PHHA 4Z0HO 4D7AA 2GYYA 2Q49A 3TL2A 1IZ9A 2RH8A 4GQAA 4WNCA 5L9AA 1NPTO 1G0OA 4YAGA 1HE5A 2W2KB 4E3ZA 1K2WA 4WASA 5TT0A 1PS0A 1EMDA 2NU9A 4DC1A 3GT0A 4CV2A 6ADHA 3IKVA 1HDZA 4WLUA 5JDIC 2VOEA 1PJCA 2OGUA 4PVDA 2WJPA 1T1RA 2FSSA 1C14A 3ZNQA 2PZMA 3JQFA 4FQ8A 4MO2A 3C8MA 3O9ZA 2AHRA 2R00A 2VWQA 1KBZA 2FPGA 5KVQA 3FD8A 4TRJA 2YFQA 4MIOA 1V3UA 1TXGA 2DPGA 1HRDA 3ANLA 3OJLA 2JFFA 4BKOA 5F21A 3PWZA 2X7HA 1GUZA 2GZ2A 3ZWNA 1S6YA 2ZYDA 2FR1A 4MVJA 2VRBA 4AJKA 5KJFA 3UW3A 2GZ3A 5TGDA 1HTBA 3NGXA 3E5RA 5GZ6A 4ZGWA 1EUDA 2PWZA 4DUPA 4DQVA 3IP1A 1ZK0A 2NSDA 3F4LA 3PFWO 4PCVA 2YW9A 2O2YA 4YEDA 4KTVE 3AY6A 1MG0A 4GMFA 3PQFA 3PHJA 3KOUA 5AXBA 1OZAA 1XU7A 2Y68A 5JDCC 4Z9XA 4YAJA 1T2DA 4DYDA 2P5UA 4PG5A 1JLLA 2GNAA 5HBRA 4LVUA 3Q3CA 1KIFA 5B4TA 2NACA 1O9BA 1XHLA 3OQBA 1ZK2A 3NTQA 3VHRA 4XDYA 1QXSA 1LDEA 2D3TA 3TOXA 5CG1A 3OA0A 1I32A 3VPGA 4IQ0A 3WMXA 3GUYA 3GY0A 3MTGA 2GGSA 4PG6A 3GHHA 4CLOB 4D3FA 1LDGA 3NRCA 3OEWA 3ZW9A 2X6TA 3QVSA 2DUWA 4JN6B 4TRNA 1K6XA 1RM3A 1HYEA 4PN3A 3RUHA 2BFMA 2BELA 5ENDA 5JSFA 1LDNA 1LUAA 1DBVO 3ONDA 4S1VA 1U2DA 4WLOA 4UVHA 3HJAA 4TVBA 3CKYA 5TRTA 3VZPA 2QIOA 3PZRA 4A27A 1PWXA 3NJ8A 1DIBA 1I10A 3ENKA 4XJSA 1BTOA 2HRBA 3DZFA 2VHYA 3OIGA 5C3MA 7MDHA 2DAPA 2EWMA 4BNXA 3Q2KA 1M75A 2O3QA 2VYVA 4GSLA 1Z75A 3VVCA 3TZKA 4BKUA 4NI5A 3FTNA 1IUKA 4R9SA 4FJ1A 4AJNA 1AXEA 1WAMA 2HMUA 3DAFA 2DKNA 1R4NB 3IS3A 4WOJA 2B5VA 3BTSA 1P9LA 1QYDA 2P9CA 4TSKA 4NU5A 4ID9A 3K8ZA 1DIAA 1P1RA 3VH2A 5KVCA 3BMOB 2Q2QA 1Q7GA 4IMPA 3JQ8A 2NADA 3INRA 4RDIA 4CMBA 1PS9A 4QXMA 3IP3A 3W4JA 4R54A 1YS4A 3C7CB 3WJ7A 1DC4A 5B37A 3FF4A 4RLSA 3ROQA 4P22A 2B0JA 3DMTA 3BMQA 1K5HA 1WMAA 2C7GA 3AOEC 4IXTA 3S2FA 3K2BA 1TT5A 1GU7A 3DB2A 3GVIA 3I52A 4Z3DA 1T4BA 4YAIA 1YXMA 1EFKA 4ILKA 5DCUA 1MFZA 1KERA 4X54A 3H7AA 2O50A 1O94A 2E6UX 2Q2VA 5JFOA 2BFOA 3PYLA 4WEQA 2X9VA 1PX0A 3BIOA 3QWAA 4MKZA 1VPDA 4AJIA 1LC0A 1M66A 1YQDA 1PWZA 4GBJA 4K6FA 2JD2A 5TJ9A 1ARZA 4XIYA 5TSDA 1DEHA 2Q2WA 1A71A 1D1SA 1GY8A 5FI5A 5L40A 3WDSA 4IS3A 3V2GA 3AU9A 2VN8A 3ZDFA 3D5QA 5THKA 4DC0A 3ZWCA 3M2TA 1E0DA 5JXWA 1DXYA 2Z1MA 4CM3A 4C7JA 4TRRA 1ZMOA 4Q3EA 1MC4A 4JBIA 2PD6A 5CAEA 4MOWA 1CETA 4OH1A 1BXGA 3LLSA 5ENVA 4OOFA 2NVUB 1EBUA 4HXYA 1LEHA 5TF4A 3DHEA 5I7FA 1X1TA 1B14A 1GFSA 2DBQA 4YCAA 2X9GA 3AW9A 3RFXA 1DRUA 4P38A 3T4EA 4NBTA 3KEQA 1A7AA 5BNIA 4NJOA 1P44A 3AY7A 1DHRA 1N1EA 4OKIA 1IPFA 1HSZA 2CSUA 3VH4A 1KVTA 5G0TA 1I2CA 5EQFA 4J3FA 1NFFA 2WYUA 4R1SA 4J0FA 1HDGO 2CUKA 5LDGA 3KSUA 1B26A 4WKGA 1EQ2A 3RUEA 1B3BA 1EZ4A 4INAA 1SNYA 2VZ9A 1NNUA 3DC2A 3WGYA 3DFUA 1X7GA 4JBHA 2ZATA 2WD7A 2HU2A 1XEAA 3V2UA 1P1HA 3UCFA 3VH3A 2RIRA 1UXGA 3QLJA 4J2HA 4XYGA 4N54A 4MIEA 3PHGA 3WXBA 4MP6A 1WDMA 3ZI0A 4CQMB 4FS3A 2C2YA 2PR2A 3GK3A 4B4VA 4ND3A 3C1TA 3GNTA 3LC1O 4EJ0A 1IPEA 4G65A 3JQDA 4XB1A 2D5AA 3LQFA 2AQ8A 1WMBA 1YBMA 4CQMD 4EUFA 5KJ6A 2CD9A 1YB4A 3D5TA 3DXFA 3GEMA 1DC5A 4Y67A 3EC7A 2Q1UA 3HSKA 1VLLA 3I9OA 4GLOA 2GN6A 4R5HA 4YQZA 4IM7A 4ZQEA 3WGHA 4I5GA 1Y5MA 4RDHA 2AE2A 4LSMA 5DBGA 4M54A 5DBFA 2X0IA 3F5QA 1XWFA 4LRSB 4FFLA 3I5MA 4B4OA 2NTJA 4M1QA 4NFHA 1D7OA 3SLKA 3NT2A 1A9YA 3H2SA 2CDBA 2GASA 1MXFA 4OIMA 2HCTA 4FR5A 5CHEA 1GQ2A 5AVOA 1VKNA 2IXBA 3VZRA 4BNLA 3BMCA 1EFLA 4Z9FA 1PJ3A 3QW2A 2PH3A 2VTEA 4NIMA 3JD1A 2C5AA 4K1LA 2E37A 1QG6A 4ZD6A 2G17A 3GEGA 3TZ6A 3LF2A 4M86A 4WCDA 5LDHA 3F1LA 3DTTA 5H81A 2Q3EA 3DBLB 2BI7A 3K2EA 3RAJA 4YBZA 2AXQA 3FI9A 4BNTA 3SJ7A 1U5AA 1MB4A 3G0OA 3N74A 1WW8A 3PYXA 2YQ5A 2JAPA 3CMCO 3AY3A 4BNMA 1PGOA 4JP2A 4RF5A 4CL3A 5K9ZA 1PJBA 1Q2XA 1ZBQA 4BNZA 2G82A 1E3SA 1PL6A 4R16A 4D44A 1LRJA 1P1FA 2H1SA 5LC1A 1HSOA 2EF1A 4IJWA 1H6BA 4W7HA 4Y8VA 1J5PA 4K9DA 4CMIA 3U09A 1SEVA 3MZ0A 1PQWA 4E0BA 3E9MA 3FCOA 2EG9A 2Y1EA 3QRWA 4PG4A 2AEFA 1X1EA 4J7CA 3C3XA 1VJ1A 1FJHA 1UJMA 1WNTA 3OETA 5JO9A 3UOGA 5JY6A 4NBUA 2AG5A 1N8KA 1C0KA 2P4HX 4L9RA 1U3UA 1UZNA 4Q3DA 2CZCA 3CXRA 2ZYAA 1I3KA 3U4HA 3W6ZA 1HLDA 1LSOA 2B37A 2FY8A 4F3YA 5KCZA 1E6UA 4IIVA 4AFNA 3W4KA 4CR8A 5KVSA 1NQTA 1V8BA 2DFVA 1GYRA 2Y67A 1R4MA 3KB6A 3UAGA 3D3WA 4Z0PA 2A4KA 3G3EA 1BMDA 1NX6A 1W0CA 4D79A 3ZHYA 4D46A 2XF8A 1U3TA 1HZJA 4W7IA 3HUDA 5A03A 2BFPA 5DNAA 4RQUA 3GPDG 1LQUA 4AL4A 2P91A 3VPHA 1XIVA 2PA3A 4F6CA 2FN7A 3C7AA 3U4IA 4HKTA 3E8XA 3A14A 3T7CA 2E82A 3BTOA 5KJEA 3SVTA 3BMNA 4YRDA 2YV2A 3MJSA 3HNPA 1P31A 1K6JA 3MCVA 4ZJUA 5IXYA 1FDSA 3DBVO 3DOCA 4E33A 4I1IA 3RVDA 3WWZA 1YB5A 1LSSA 2OUIA 2B69A 1A7KA 4D43A 4ZA2A 3DONA 1E77A 1HL3A 1Y6JA 3FHLA 3IDSA 4QFDA 4BNFA 5IDQA 2X86A 4FFRA 4ALKA 1NHWA 4JCOA 2GRAA 4I08A 4B7XA 5G4KB 2VHVA 3TL3A 4LCEA 4U6SA 3CINA 3KO8A 5KTKA 1VJ0A 4CM5A 4QQRA 1J6UA 5T57A 3WNQA 3RUFA 4BIIA 5FI3A 4CM1A 3PDUA 1GV0A 1XLTA 3IKTA 1TB4A 1BDMA 4IGFA 5IXSA 1MGOA 4Q39A 1IYZA 2O3TA 5HS4A 3ZWMA 2NVWA 2GSDA 4DA9A 2BFAA 3L4BC 4WLNA 2C54A 3CPSA 2O3UA 2JCVA 5COQA 4YYZA 3AWDA 1UDBA 4JNKA 2J5KA 5TQVA 1GUFA 2H5LA 3FN4A 1GV1A 3D4PA 1ULSA 2BF7A 1P0CA 4MKRA 2E48A 3ANMA 3PJDA 4ROSA 3MTJA 1ISMA 1DLIA 1NAIA 1ZUD1 4WLEA 1JWBB 2Y99A 5JCJD 2RAFA 3JQAD 3Q9NA 4IJVA 4D0SA 3HB5X 4W9NA 1R12A 5G0SA 3ROMA 4II3A 5L3ZA 3UN1A 1PR3A 4R1NA 4KUHA 5EPOA 4P8RA 5EQDA 2JKVA 5KKCA 3JQCA 1ADFA 5B4VA 4MINA 3DMYA 4DQUA 1DIGA 4L74A 1D4FA 1QRRA 3QSGA 5HTOA 4JLWA 1OOEA 4JQCA 3BAZA 2PZKA 2VZ8A 3JQ9C 4H15A 4BB5A 2YHIB 4EYEA 5B1YA 4RL6A 2GDZA 2O7SA 4RPLA 3OFSA 1P1JA 1AXGA 1KC1A 3ZWXA 4IZIA 1W73A 2QX7A 2EHDA 3V1UA 2F1KA 1GDHA 3A9WA 3IAHA 3OJOA 4FFNA 4XD2A 5JMPA 3ZW8A 2POQX 5C7LO 1DLJA 2I3GA 1R4NA 2VRCA 3CZMA 3SX2A 4BGEA 3DBRA 4CM4B 4O5OA 4JK3A 2I5PO 4DLAA 2R6JA 3GG9A 4UVGA 1TI7A 3RKRA 2JHFA 3ZU3A 2I65A 3WYEA 2ZTMA 3ETDA 1BSVA 5JCJA 1U7TA 3ZHBA 5CFZA 1F8GA 3PTZA 2VT3A 3WIEA 4Z6KA 2X4GA 3NAQA 2OL4A 3M2PA 3ONFA 1Y9AA 2D1YA 3BMQB 4WEOA 4KP7A 2EP7A 3BA1A 1MA0A 4PVCA 2OO5A 4KUEA 4EEZA 1B8PA 1XDWA 1YJ8A 2O2SA 2B83A 3GAFA 1NQ5A 3Q11A 4BO1A 4W6ZA 3C7DB 4XEHA 3ZNOA 4F45A 1SEPA 3EDMA 1H2BA 2EGHA 2PGLA 3L9XA 3LT1A 3PXXA 8LDHA 5JAIA 4B3IA 4CM4A 1Y8QB 4R5MA 4BO6A 1JN0A 3DAPA 4TKMA 3M6IA 3EY4A 3OA2A 3GHYA 4Z0TA 4RORA 1ADCA 3OH8A 1X14A 1ZKMA 1E1MA 5AXAA 1DFGA 2D5CA 1V3VA 4Y9DA 3ZCXA 1QYVA 3ADOA 3ROKA 4J1SA 3F9IA 4MVJE 5A1TA 3H9UA 4E13A 1B8VA 5JAMA 3FNHA 3NYWA 4ALJA 1U5CA 3ETEA 4E31A 3RSHA 2IDZA 1W6UA 2B4TO 2EGGA 1VSUA 2IEDA 2V65A 3D4OA 4UEJA 5I9NA 1EE9A 5A9SB 4L8VA 1HDXA 4YR9A 1UZMA 2C07A 2UYYA 4BVAA 1ML3A 1ZSVA 1I33A 1DAPA 4UUNA 1I8TA 5BQFA 3QJ5A 1O5IA 1FK8A 1BXZA 4IJKA 3RJ5A 2TMDA 3LLVA 3H5RA 3GH3A 4HX5A 2GN4A 1L7EA 4IQGA 4JBGA 1HZZA 1Y8RA 3KYBA 2O4UX 1T2AA 3EGOA 3LK7A 2UAGA 5CDUA 5DZSA 2C2XA 4CLHA 4EGFA 4GAEA 1HE4A 4CUJA 1A72A 3NTOA 3PFFA 2XAAA 4BOYA 3QY9A 3HN2A 4OOEA 2AA3A 3GNQA 2UUPA 1T25A 2G1UA 2J5QA 1QR6A 4LSWA 4TQGA 3WYBA 2VRCD 2UDPA 1Y1PA 2DTEA 3D7LA 4B8WA 3WICA 1UAYA 4F46A 5DOVA 1YKFA 3TZCA 4UEOA 3STHA 4BNHA 2Y05A 4CR7A 1E3LA 1E3WB 3MJTA 3B1FA 4OAQA 5L4NA 4EUEA 2Y1CA 1I36A 3OECA 5CPFA 1F06A 4KWHA 1X0VA 3PP8A 4RVFA 3GGGA 4WECA 4XDZA 5T8KA 5JC8A 1NFQA 3GUCA 1UZLA 4C7KA 5IF3A 3TFQA 4BO7A 3DL2A 4YJHA 2OHXA 4FFOA 1Q7CA 1R66A 5HA5A 4FOSA 1CJCA 2OZPA 4HBGA 3OM9A 4DIOA 4U6QA 2X8LA 1MFPA 2HK8A 2IODA 2NTNA 2O7QA 1Y7TA 1IB6A 3O03A 1J49A 3RROA 1LLCA 4E2ZA 2YFHA 1NWCA 2E49A 2OORA 4EDFA 1C3VA 5IN5A 5CG2A 1R0LA 4FGSA 4Y98A 4MVJP 2C59A 3PIIA 5KKAA 4CQMA 3I4FA 1NYTA 4IDCA 1RWBA 4F6LA 4YRBA 5A06A 1DJNA 1DJQA 4OSPA 5ER9A 2AQHA 3JD3A 1E7MA 5U4QA 3FWZA 4A7PA 1KY4A 4XR9A 3WGQA 3WWYA 4WJZA 5ADHA 1LRLA 2Q1WA 1YL7A 4IQ8A 3BTUA 4LVCA 2B4RO 2D59A 1Z74A 2C0CA 2EJVA 2I99A 2RBEA 1IHXA 3DDNA 3OJ0A 2QQ5A 3I4CA 1MC5A 3KSDO 4BO2A 4EJMA 2W98A 3I9MA 3KXDA 4QX6A 3P19A 3PPIA 1YBVA 4WCFB 4E2YA 4KOAA 1PGJA 1TA4A 1PL8A 3ZV4A 5I9MA 3KHUA 4JROA 4PZDA 5CEEA 3C1OA 4LRTB 4AJ1A 4J9UE 3OICA 2XXBA 4DIBA 5TJHA 1A9ZA 5K6AA 5B4UA 3PHIA 3JYPA 3QVWA 3FNEA 3RJ9A 3QV1A 1A4IA 3E82A 3TJRA 4A03A 4PIVA 4OMUA 1OC2A 1N5DA 1I5RA 4HADA 2JD0A 4NBWA 5JAQA 2PKQO 4K26A 2PH5A 2CMDA 3JQEA 4CV0A 4R51A 3BHIA 3W8FA 1ENYA 3DFZA 3GN2A 1UXHA 3AFNA 3ENNA 2JHGA 3RUDA 3RQSA 4DRYA 3CEAA 4RF4A 4NDNE 4CMKA 3KYCA 2NNLD 1GEGA 4FW8A 4FPXA 4J16A 1GCOA 2VYND 1ZIDA 1L1FA 1M2WA 4GL4A 4YAEA 3JQFC 3DMTC 3G79A 4PLYA 3O8QA 4CM9D 5L4SA 3MOIA 5DCYA 3F46A 3EZYA 1ZZEA 3P2YA 4NR0A 2GO1A 2JCYA 1AHHA 3E03A 4KQWA 4CLDA 2JL1A 1QYXA 4IMRA 4RZIA 1PGQA 2EXXA 3GDOA 1KEWA 4CMJA 4E5MA 4GI2A 2JJYA 1HDRA 3PEFA 2HLPA 2IZ1A 2NTVA 3AUTA 3TWOA 1IZ0A 4CM8B 1UDAA 3CMMA 1GYQA 3DHYA 3WG9A 2X0JA 2W2LA 5JO0A 3WBBA 4PLVA 1BG6A 1GAEO 4BS9A 3HE3A 1GZ6A 4FJ2A 2I6TA 4E2WA 1E7RA 3ASVA 4CR6A 3SEFA 2PGDA 4AVYA 1H6AA 4U7WA 2Y0DA 4YT4A 2P2SA 3DBRB 3ZWVA 4PLGA 1YH3A 4WPGA 5CEJA 3FRJA 1YBAA 1Q7BA 2B4QA 4AJ2A 2QRKA 1ONPA 4UREA 4O0LA 4UUPA 1V35A 2P68A 3HN7A 3EUWA 3KV3O 4E30A 4YA6A 3OSUA 4BL5A 5GY7A 3C24A 4JP3A 1LJ8A 1WWKA 5DCWA 2Y66A 3H3JA 4D42A 3A4VA 1NPDA 1SB9A 1Q0QA 2FHSA 4CV1A 3L9WA 4I5EA 3DO5A 4MVJF 3WGIA 9LDBA 3E48A 5KJ1A 1U28A 3GG2A 4GX2A 4M89A 3KYDA 4Y6RA 3OF2A 1QV7A 3TOZA 3GN1A 4L4RA 5TC4A 4BO5A 1Z82A 1MUUA 1WVGA 2F00A 1QV6A 4OO3A 1V9LA 4H16A 4LK3A 1V3TA 2FPPA 5G4KA 3WYCA 5B12A 2OP1A 1YRLA 3HQ4O 4M49A 4MJLA 4GWGA 1OI7A 1ENZA 2VOJA 5GMOA 3V1TC 4I9NA 1ZEMA 2GPTA 2YHUA 3GA0A 1CWUA 2IYPA 3E6AA 3M1AA 3H2ZA 1C1DA 2YUTA 1ZCJA 4YJDA 2X23A 1CDOA 1HYGA 4J90A 4E12A 3IQDB 4XYMA 1V6AA 1YL5A 4NG5A 4BGUA 1WXDA 2EEZA 3G1TA 4KWIA 4BNUA 1ZFNA 3INGA 1EDZA 5ILGA 4BKRA 1U8FO 4FBGA 1C0LA 4ZQFA 1C1DB 3ICPA 2I9PA 2LDXA 3L4BA 2PFGA 1PJSA 4K28A 2O3RA 4B4UA 2O48X 3ST7A 4WNIA 3FR7A 3RKUA 4WCFC 4M55A 4MPDA 4J7XA 1LDYA 2NM0A 4MVJD 4DPKA 3UFXA 5CDTA 2YQ4A 1QP8A 1ZNQO 2EKLA 4CQLB 1B7GO 1E92A 4EBFA 1R16A 3UHAA 1MX3A 4JJFA 4CMHA 5HWSA 1H0KA 1SMKA 4E32A 2SCUA 4CLXA 4RF3A 1DDOA 1IL0A 4CMEA 3VH1A 4J4HA 3VOSA 1LTHR 4TVOA 2GR9A 5JCXA 5T8KC 2HDHA 1CIVA 2V6FA 3PRJA 2CDAA 3PK0A 1BVUA 1NASA 4A0SA 1XA0A 5A05A 5JYEA 4EI2A 2Q45A 1KS9A 3HWRA 5ICSA 1E6EA 1TVEA 2IZ0A 3FR8A 3R6DA 4U0KA 1GTMA 4CUKA 1E5QA 4IUYA 4OHUA 4RZHA 3NX4A 3Q0EA 1JKIA 2FWMX 3JQ7B 2J3KA 1VJTA 2NVUA 1DO8A 1H2HA 1D3AA 1VC2A 4MVJH 3ZH2A 4ZN6A 3PJGA 4JXKA 5JW6A 3A1NA 4WGGA 4JX8A 1QMGA 1UAGA 4OQYA 4B79A 4NHEA 4PLFA 2J3IA 1HDOA 3B6ZA 2B35A 3E9NA 5JE8A 4LCJA 1EVIA 4HP8A 4I5DA 2BGMA 3VVBA 3CUKA 3WMWA 4DYVA 4LGVA 4DMMA 3OP4A 3RIHA 3CH6A 4H3VA 5JNLA 1NPYA 3FSRA 3NT4A 4U8GA 3IUPA 2VUUA 4ZHSA 1BDBA 5DDIP 3VAZA 4ALIA 1NFRA 1YQXA 3RU7A 2ZJ0A 2FRDA 4QO7A 4KTTE 1ZH8A 4O59O 3U9LA 2BKAA 1KC3A 2RCYA 5TT1A 1AHIA 5G4LA 1LDMA 3ABIA 5L4LA 4HNHA 3H65A 1Z73A 1T4DA 3ORFA 3GPIA 3F4BA 1NM5A 3K31A 3W1VA 4XQEA 4J1NA 1Y9EA 4NBVA 2P4QA 3F3SA 3ZWOA 5KOIA 1DC6A 1SAYA 2HMSA 1LNQA 4CMGA 1EVYA 1KVQA 1W8DA 2Y0EA 1KEVA 3KEOA 4YT5A 1RPNA 1LXCA 1HETA 2Y0CA 3L6OO 1JAYA 4FFPA 1Z7BA 4GVLA 3KTDA 3HDJA 5C7OO 4LMRA 4IXWA 1X13A 4M8SA 4N7RA 3AK4A 2C5EA 4B8ZA 4YTEA 5DOZA 2H6EA 5EERA 1N92A 2PKQP 1XKQA 4OJNA 1YDWA 2Q99A 1BXGB 1F8FA 2FZWA 4RF2A 1CF2O 1ZMTA 4AJOA 4U5QA 4XGKA 3BXXA 1CERA 4TRMA 3O8QB 3GZNA 4YVFA 3ZWPA 3RC7A 4GX1A 4PGFA 4YJFB 2JD1A 1EUZA 4YB8A 5FFFA 1ZVMA 2HSDA 2P9GA 3GVXA 3TFOA 1KOLA 1LA2A 4DQXA 1DSSG 2FOIA 4MIYA 4MVJM 4J1QA 2DBRA 3JQ7A 4IY1A 3AUUA 4NH4A 3PGXA 2Q1TA 2RH4A 2ZK7A 1FXSA 4HNGA 1U1IA 2NU6A 1M6HA 4ONEA 2AW5A 2PV7A 2WDZA 3EW7A 1SBYA 4XQCA 3KRTA 3RU9A 2FP4A 1ZK4A 4A10A 1JA9A 2AE1A 2C20A 4BUCA 2QRLA 3CZRA 3DZHA 3H8VA 3CSDA 3N58A 3OJFA 4CLOA 3MWDB 3F1KA 5CEFA 3ICCA 4HFRA 4J0EA 1ZJYA 3TN7A 4FB5A 3COSA 1YL6A 4DMLA 1X15A 1AN9A 2I3AA 4CMIB 3GGPA 2ZCVA 3RUAA 1GD1O 2VWPA 4IDBA 4TZKA 4E5NA 5L51A 3UKOA 4PG8A 4ESOA 1HEUA 4JJIA 2HMWA 2Q4BA 1HT0A 3MOGA 3RI3A 1GUYA 1HWYA 1UXKA 4J1TA 4BNJA 3K5PA 2YZ7A 1KETA 1EBFA 1YGYA 4R1UA 4A26A 1MG5A 3BMOA 4R41A 1XGKA 5CDYA 4OM8A 2VHWA 5IZCA 3WGTA 4J7UA 3WOHA 4YJHB 2DBZA 2BI8A 2VQ3A 4HUJA 3U4CA 4BO8A 1CYDA 4XGNA 3FTPA 1UP6A 3RBVA 1DAOA 4TZTA 4YPOA 3B1KA 4PLWA 2BGKA 4NMHA 2AEMA 2DT5A 2WWRA 3P7MA 2GZ1A 4UUOA 3OHSX 1K6IA 1I3MA 3VPSA 4AJPA 4XIJA 4R3NA 4RCVA 1P74A 3HFSA 4FOOA 1N9GA 3DHNA 1GYPA 3DAGA 4XX0A 5L7YA 4AJHA 5EJ2A 5C5IA 4O1MA 1CQIA 3UICA 4TWRA 2QYSA 4CJXA 3QWIA 3V1YA 1B2LA 2IRWA 1GCUA 3KSZO 3PDJA 2OP0A 4D3DA 4NZ9A 4KDEA 1J0XO 3GEDA 4LW8A 4YJFA 5AOVA 2H63A 5A9RA 4IS2A 1HDCA 3FBTA 4FDAA 2FMUA 5TX7A 1U2GA 3TPCA 2BH9A 3LSYA 5G0UA 3RD5A 1KEPA 2PLAA 1DB3A 1VL6A 2D4AA 3JYLA 1O8CA 3QVOA 2OXIA 3RFVA 4BV8A 4II2A 5IG2A 2X0RA 3GC6A 4HFMA 1HE2A 1Q1NA 5BR7A 1PZGA 2Y1FA 3D0OA 2XOXA 2ET6A 1VRWA 2PZJA 1T24A 2WD8A 2ZB8A 4PLPA 1C1XB 4G5HA 1XELA 3HFGA 2G0TA 4IDDA 5JDCA 2ZTUA 2B5WA 1YQGA 1BW9B 2A92A 1PJTA 3IUSA 3NJ4A 3DZKA 2O4CA 3LT2A 3WLFA 1E7SA 2NV6A 2EJWA 2YYYA 4XYBA 1T2CA 1O6ZA 1LU9A 3RC2A 1Y8RB 1Z6ZA 1NP3A 1X7HA 3WB9A 1KVRA 3IL2A 1A27A 2GD1O 5J23A 4RQTA 3ZU4A 5KJCA 4YWJA 4YAKA 2J8ZA 5G0WA 3EHEA 2Z1NA 4IBOA 4OL9A 1UUFA 4YT8A 3DOJA 3GVCA 3SC6A 5H82A 3DR3A 5DN9A 2VTDA 3M1LA 1PU2A 1KEUA 4MDHA 1N2SA 4EJ6A 1E5LA 1NVMB 1PTJA 3VDRA 3JV7A 4BNGA 3OQ6A 1I2BA 3GGOA 4J91A 3ZV3A 2WTBA 5C7IO 4RV9A 1WZIA 1I0ZA 2BHLA 4B4WA 4CQLA 3X2EA 4R68A 3Q1LA 3ZWWA 3AM3A 2FPIA 4UVEA 5BSEA 2DVMA 4NK5A 4NQZA 2GCGA 1TT5B 4W82A 3DBHB 3K30A 2W2LD 2BRUA 2CDCA 3AJRA 3TZHA 1N9GB 2WE7A 3UCEA 4B3HA 3GOHA 1PGPA 2JFHA 2OFPA 3JQBC 3PLRA 4BQRA 1BXKA 3WSVA 2PKRA 2UV8A 1YDEA 1CEQA 4MP3A 1ISGA 5GZ1A 5IZ4A 1XYGA 3PJFA 5COBA 1QYCA 4AJ4A 4YQYA 4EITA 3SJUA 1ENPA 4OXNA 1E1NA 1U7HA 1I2ZA 3KLMX 3IJPA 4XA8A 1F0YA 2EERA 1O95A 3PIDA 4YXFA 2CFCA 9LDTA 1EUCA 4RPKA 2EW8A 1UDCA 1G1AA 4N18A 3ITDA 2ZCUA 1DIRA 4CUZA 1IHYA 2VUTA 2WYWA 1A5ZA 1M76A 1PZEA 3DOOA 5A04A 3E5MA 3FNFA 4GVXA 1RYDA 3WSWA 1FDWA 3Q9UA 4CPDA 3U0BA 4KQXA 3RBXA 4QT0A 1EDOA 4IGEA 3QWFA 2A9FA 3NEPX 1P77A 2PTGA 1NVGA 4GPD1 3AM4A 2ZYGA 1VE9A 1HXHA 1I01A 1GZ4A 2Y1GA 1PEDA 1Y5RA 3SXPA 3ULKA 2HMTA 4Q3NA 3RASA 1ISIA 2DM6A 2PD3A 1C0IA 4FFMA 4Q3CA 2DUUA 3GZNB 2J3HA 2YHIA 3MJVA 4DPMA 4DGSA 1R0KA 4OGWA 2QYTA 4OKNA 4EUHA 2J5RA 1ONNA 4ZQBA 4BMNA 1T26A 5ES3A 3WGGA 4E6PA 4PLTA 1ISFA 4RVGA 2JAHA 2BLLA 2AQIA 2VWHA 3HHPA 1VI2A 3PGJA 4E5YA 3DZJA 4XQ9A 3MWEB 5BT9A 3UH1A 3F47A 4L76A 3U4DA 3W8DA 5TLSA 1SB8A 1RM4A 1GR0A 4KUGA 4XR4A 1LX6A 1CQJA 3UUWA 1LDBA 2X58A 4QSMA 4WE3A 2X1HA 4YT2A 1Y81A 3JQBA 2YY7A 2VNSA 1X0XA 1PJQA 2HAEA 3G49A 3Q2IA 1FDUA 4BNIA 2TMGA 5T64A 1MLDA 4JGBA 1TT7A 1RYEA 4MVJG 1T2FA 5ITVA 5FF9A 3JQGB 3WGZA 2D2IA 2EP5A 4L75A 3A28A 4FCCA 3TSCA 3HDQA 4TROA 2FR8A 1JVBA 3L07A 2ZTVA 3CE6A 1U3VA 2RHRA 3JD0A 4BKQA 3DBLA 3KM0A 1WP4A 3PWKA 4CMAA 1U3WA 3O4RA 5G2OA 3EVNA 4ALLA 1BVRA 3OJEA 4XKJA 3GZ4A 3L6EA 3ZHXA 3K6JA 3GVHA 5KWEA 5I7VA 1U4OA 1DIHA 4Q3AA 1IE3A 3EZLA 1FMCA 1P45A 1LQTA 4QUKA 1JKFA 4J6FA 3JTMA 3BZUA 1RJWA 3QP9A 1DRVA 2PK3A 3BMNB 2V6GA 1R4MB 2YV3A 1D8AA 2P9EA 2Q4EA 2DTDA 5G0VA 1ZW1A 2JCXA 4GKBA 1O89A 4N5NA 3ZWAA 3ZHZA 5BNTA 4QTZA 5ER6A 2V7PA 1XU9A 1WZEA 4IDAA 4N5LA 3I6QA 3KLPX 3S2IA 5TNXA 3HG7A 3WGOA 3S1LA 3FNGA 4J2OA 2ZQZA 1E7QA 1J4AA 1KVSA 4DL9A 4WK6A 1NBOA 3B20A 1ISHA 2NQTA 4NFSA 4BGVA 1JU9A 2O3SA 4D45A 1PL7A 4ZICA 1ONOA 5I8ZA 2CNBA 4A73A 4IZHA 4AJEA 1ZSNA 3K96A 5K0ZA 3WQQA 4JJGA 5ICMA 5DF1A 4RPJA 1LI4A 1H5QA 3H9JA 3TNLA 1I24A 2AQKA 4RO0A 3S2GA 4NPCA 4R9RA 2NUAA 4OQZA 3I9KA 1ZEJA 4O63O 5ITWA 3V8BA 2VT2A 2WE8A 3HADA 2I76A 3UGKA 3LC7O 2PD4A 4PLCA 2Q50A 3GF4A 4ND1A 3VKVA 3ZU2A 3NDIA 5EN4A 1H94A 1HLPA 1H9AA 2R2GA 3OQ1A 5TIIA 3U62A 5DP1A 4J49A 3WBFA 1NQOA 4GMGA 2FSVA 1BGVA 4BO9A 5JS6A 2Z5LA 3RCBA 3ZU5A 3R1IA 3U5TA 4Z3KA 5T5QA 4Q3BA 2DU8A 1Q0HA 2LDBA 1K3TA 3OIFA 3GRKA 3R0IA 1FDTA 3KZVA 4P4NA 3EAGA 1UR5A 5JLAA 2HUNA 1NAHA 4BB6A 4FN4A 3LC2O 2ZB7A 5MGBA 5JC1A 5ILOA 5A02A 1XQ6A 2DQ4A 2HJSA 2V6MA 3WQRA 3E9QA 3BMCB 1ZK3A 2GERA 2HMVA 1MV8A 3PHLA 1U8XX 4IINA 1GPJA 3GFGA 4WUVA 3S55A 2WD7B 1LC3A 4PRKA 3FBGA 5A5EA 1SC6A 3OMLA 3HDHA 1XCBA 1WPQA 5F1PA 1LRKA 2QW8A 3GVPA 4J4BA 3QWHA 5A4DA 2XXJA 3ZNPA 5JY1A 2X0NA 1A4UA 4XRRA 3ZV6A 4DLBA 1OFGA 4R3WA 5KVVA 5L53A 2HK7A 1EVZA 2IE0A 3OBBA 3PI7A 1QORA 3GNSA 3MJ4A 4GSKA 3GQVA 4PZEA 4BO0A 2WSBA 4BMVA 1PJ2A 5IDYA 3E1KA 1W4ZA 4BKPA 3KETA 3NDRA 3I23A 3NKLA 1GADO 1JDJA 3GMDA 1LLUA 3DEYX 1AGNA 3DBHA 5EMHA 3SBOA 5JAZA 1G6KA 3AI2A 3ZV5A 4ZRNA 8ADHA 4I5FA 3DZBA 1VM6A 3HDYA 3AUAA 4IIUA 3I9LA 4CODB 1RKXA 1OBFO 4BNYA 1I30A 5L7TA 2ZKLA 5DP2A 2ZB4A 3JQGA 5FEUA 1OMOA 1PQPA 2X9NA 1VL8A 1Y8QA 2Y1OA 3NGLA 4RPHA 3VC7A 4URFA 4ZRMA 5I8WA 4E2XA 1CRWG 2QRJA 2AEJA 1U4SA 3O26A 1M6WA 3I1JA 2VNAA 2EV9A 4CM7A 1YOVA 1ZXLA 3O38A 3VPFA 5C37A 2X5OA 2ZQYA 4G81A 4GH5A 1EK5A 4ND2A 1SOWA 2OOSA 2YDXA 3NTRA 4RVDA 1OC4A 3JD2A 3AU8A 3ZN2A 4ND5A 5CP8A 5AQ1A 3IJRA 2PNFA 3ITKA 4U0JA 3UVEA 1F12A 4WLVA 4PRLA 4DLLA 2W4QA 3C85A 3K73O 4NJMA 2A94A 3LT4A 2C82A 4IPTA 2IEBA 3B1JA 1T2EA 1UH5A 1T1SA 1E3WA 3ADPA 4HY3A 3PVZA 4NK4A 3WFJA 3GR6A 2HRZA 1H6CA 4BNVA 3QWBA 1OAAA 3ZWYA 1XSEA 4ND4A 4R69A 1IULA 1YOVB 3BHJA 3CTMA 2NLOA 2A35A 3OEYA 3QE3A 2WEKA 3VTZA 1YONA 2WYVA 4OXKA 2I66A 4B7UA 2X5JO 1K89A 3F6YA 5L7WA 1E7YA 5DT9A 4W9NC 2VUSA 1UP7A 2CF5A 1NR1A 5DULA 4J43A 2V6BA 3P2OA 4XZ3A 1NWHA 2C7VA 3R3JA 3SC4A 3QQPA 3U49A 1C1XA 2GF2A 5T6BA 5HS6A 4TMFA 3TZQA 3CIFA 4R4JA 4E21A 5I7SA 3B70A 3PLNA 3WIDA 4J4TA 5F5LA 3TF5A 3JYOA 3AI3A 3H4VA 4BGIA 2DPHA 2I67A 1R6DA 1ADBA 3ZZNA 3D64A 4HWKA 1S7CA 2VZ0A 3BTVA 3AM5A 5BNFA 1P33A 4FJ0A 1YVEI 1HKUA 4CL8A 5EINA 3V5NA 2VYVD 4ALMA 3EYWA 2YJZA 2O23A 1R0SA 3RUIA 3L77A 3PYMA 3V2HA 1NVTA 3SLGA 3VPXA 1ZXBA 2J3JA 3LZ6A 3UXYA 2YV1A 3OIDA 3I83A 4OYRA 1BHSA 3H6KA 3DQPA 4RVSA 1G0NA 2HO5A 1F17A 1QLJA 4CV3A 4DREA 2HKIA 3H3FA 4AG3A 3L4SO 3RWBA 1JTVA 3T7EA 4Q9NA 2HJRA 3H9GA 1SCUA 1PGNA 1TEHA 4HFJA 1HYHA 3GAZA 2EKPA 5IN4A 5MDHA 1E1KA 1R37A 1DOHA 3L6DA 2O3JA 3NDJA 3VKUA 1GEEA 1ORRA 1ZJZA 4M87A 2NU7A 4FGWA 1GZ3A 3KUXA 3D4NA 3I3OA 4D41A 1PIWA 5CDSA 3QA9A 3S2EA 3LVFO 5KIAA 3LYLA 4L4XA 4PFJA 3RFTA 4P4LA 4LN1A 1KVUA 5BSGA 4I9UA 5IZCC 5F5NA 4G2NA 5A9TA 1PSDA 3GRPA 3KYCB 3I6IA 3DZIA 1JQBA 4FIZA 3D3EA 4RLHA 2E4AA 1H6DA 3KVOA 1HDYA 1I3LA 3GDGA 3NT5A 1PZHA 4NU6A 5T67A 4I8XA 5AYVA 2B36A 1PJLA 1UXJA 1ENOA 4KMSA 4R01A 3EMKA 4A5OA 1P1KA 4PZCA 1Z45A 3T4XA 4W99A 4UEKA 3GMSA 3W6UA 4XGIA 1QSGA 4QFCA 1KYQA 4IJUA 5JYDA 1GQYA 1BW9A 4KDFA 3H9EO 4YJGB 1ID1A 4H7PA 2IXAA 1VL0A 4YACA 3S8MA 3IC5A 7ADHA 5HM8A 1R15A 4A2CA 3TDKA 1DRWA 1KY5A 2XPCA 4UULA 1YWGO 1XQ1A 4XYEA 4EEXA 4WCFA 1HF3A 4CLRA 1XG5A 1BWSA 3NUGA 2W8ZA 3KYDB 4UVIA 5EIOA 5GZ3A 3FWNA 4S3MA 4BNWA 2PZLA 3WQSB 4MKXA 4IDEA 5A5FA 3A06A 3HB4X 5FYDA 5F1OA 3QVXA 3VZQA 1LLDA 4BV9A 4XYLA 3TQHA 3ZWBA 2QHXA 4NBRA 4DBVO 1DHTA 2DC1A 2BGLA 3VTFA 1B16A 4JIGA 5TS3A 5F1KA 2OMEA 4E5PA 3IIEA 4LISA 1PS8A 4MVJI 4GX0A 4RVUA 3VZSA 4E5KA 4CMCA 5U9CA 2ZIZA 2VHZA 4CM9A 1EQUA 4YJGA 2R00C 5H83A 3INTA 4Z9YA 4D0RA 4L4SA 3AOEA 4KZPA 1K0UA 2JFGA 3QIVA 4E4YA 4AICA 4RPGA 2VCYA 3MEQA 2NU8A 4CMEC 1Q0LA 1YB1A 5I9LA 1TLTA 4XWYA 4BMSA 1PJ4A 3JQAA 4XJTA 4TKLA 5IDXA 1EEHA 3ON5A 4BNNA 1E1LA 3W4IA 1E3EA 1ZSYA 1LBEA 4FC6A 2CF6A 4W4TA 2P5YA 1E6WA 3RBZA 2QG4A 2IYOA 3I9JA 3DWFA 4ZVVA 1MXHA 3C1AA 3ETGA 4O6VA 3LF1A 3LT0A 1JVSA 4GWKA 3RC9A 2DTXA 2EKQA 3JYQA 1PR9A 3JQ6A 2QZ9A 3PZBA 4DWVA 1JW9B 2QZZA 4IDGA 5BSFA 1UP4A 4CLRB 3JYNA 3AI1A 1RM0A 3N7UA 1WDKA 3PWSA 4DXHA 3UCXA 4LMPA 5A3VA 5THQA 2RHCA 1PQUA 1WDLA 3P5SA 4XQGA 4D3SA 4OXYA 1B3RA 3MJEA 4DIFA 3ASUA 4Y6PA 1N7HA 3ANNA 1YE3A 4L0QA 2X22A 3K92A 2D8AA 1NXQA 5LCXA 5BSHA 4UAGA 4C4OA 1U9JA 4MP8A 4P4GA 2EIHA 3BHMA 1IOLA 3JD4A 4UVDA 3QHAA 4IDFA 3WTCA 4GKVA 3D1LA 3NV9A 2CVQA 1PZFA 3UF0A 3BYZA 2AG8A 4GX5A 2Z95A 2Q46A 1ADGA 1UXIA 1WLYA 3JQ8B 2GLXA 2HK9A 4R1TA 3ZNNA 2FR0A 1DPGA 3JQ9A 1N1GA 4OSOA 5A9SA 1DFHA 2CY0A 2J6IA 1MP0A 2UUOA 4J9VA 4PLHA 3FPLA 4BQPA 1GPDG 4K6CA 1H9BA 2ZB3A 4GGOA 4QECA 4XCVA 1JKJA 4HFNA 3MJCA 6LDHA 2Y1DA 2ILTA 2Q1SA 2FZEA 4UUMA 4ZQHA 3RUCA 2W2KA 4CLEA 3AUSA 2G5CA 1NR7A 1D1TA 4DBZA 3VDQA 2X5KO 1BRMA 3H5NA 1ZK1A 4PG7A 5COAA 3WLEA 1P0FA 1DFIA 3GFBA 4AJJA 3HZZA 4QO8A 5FWNA 2HQ1A 5JDIA 1ZO8A 1ISJA 1P1IA 2ZTLA 1AUPA 3IOYA 2Y93A 4HV4A 3FPCA 4YRAA 2WMDA 1NTOA 1VKOA 2GN9A 2W90A 3AOGA 4RGBA 2G76A 3E18A 3H5AA 5JBIA 3WNVA 4B3JA 1M67A 4WOKA 1VSVA 1V0JA 4BHTA 4DVJA 3IMFA 5IJZA 1QLHA 3PQEA 2CVOA 4CM8A 4QEDA 3U3XA 5L45A 4RJTA 2YDYA 5IAAA 2OBNA 2NWQA 3EVTA 1QKIA 1LSUA 3WJAA 5L95A 2BMAA 3L0DA 4BO3A 1HE3A 3ONEA 3W8EA 4EZBA 4EW6A 1EK6A 1YJQA 4ITUA 1E3IA 1QYWA 2H9IA 3RC1A 3LU1A 1JWAB 4N5MA 5IDWA 4YDRA 4XRGA 2OBYA 5AXDA 2DFDA 1LLQA 2DBVO 5A3JA 3KBOA 1P3DA 3Q6IA 5EL0A 1XR3A 5IFLA 4ZU3A 1SOVA 1ULUA 2NQ8A 1H93A 3K9QO 1EVJA 3LDHA 4FSHA 4NFYA 4Y6SA 3WX0A 1O0SA 4FC7A 4NNJA 1GL3A 2VYNA 3G17A 3PJEA 1LSJA 2EW2A 1FF9A 2GN8A 5CDGA 2ZJ1A 3JSAA 4GGPA 1E3JA 4XB2A 3D3WB 4RVHA 5JPIA 5JMWA 2NVBA 4BNKA 2VHXA 3WTBA 1B15A 1C0PA 3DTYA 3H9QA 4I9HA 1SZJG 5CPBA 3WR5A 2IZZA 1FDVA 4ALNA 5K6AC 4DTIA 1RM5A 3DZGA 4PLZA 5F3RA 2PGJA 4WLFA 5EESA 4NJMB 1N7GA 1SPXA 2VWGA 4L73A 1DC3A 2D0IA 2AMFA 3G1UA 3PQDA 4B7CA 1L7DA 4CM6A 1EE2A 3ZGYA 3JQAB 2BD0A 1JAXA 1B0AA 4DPLA 1E7WA 4GLLA 3EK2A 1IY8A 1NHGA 3GDFA 3WFIA 5DBIA 3WS7A 2DLDA 2UVDA 3R3SA 3GLQA 1SO8A 5I7EA 4FD3A 1X7DA
chains in the Genus database with same CATH superfamily
4BO4A 3ILHA 3SIPA 2KYHA 2NSLA 2V5AA 4ARVA 4YO7A 5AK4A 3NUQA 1AK9A 1KXZA 2AFIB 3RVZA 3D1JA 4HYQA 4P86A 3KIPA 1WMDA 4GQHA 2PY6A 4I81A 2EIJC 1J8VA 2C29D 1GQQA 4FWVA 3U9MA 1D2CA 2ATVA 4IX9A 1OAOC 5ECGC 3U3DA 3GLFB 1NN1A 16PKA 1QE5A 2CNWD 1JIIA 1K8XB 4ZEOA 2PKWA 1ZW2A 2WTAA 4Z9IA 2P1ZA 3LI2A 4OQXA 3F6SA 4IDNA 3IA7A 1KI8A 3V8VA 4AZSA 2VP0A 3M4YA 2AI2A 3AM1A 2HWWA 3BK7A 3TL2A 3GELA 2RH8A 1MNEA 3NOQA 2C8LA 5KINB 4YAGA 5B3IA 1NOKA 3DE9A 1XVUA 2UVQA 3NW9A 4YRFA 1BHQ1 3IUNA 2QTZA 3I5QA 2ZR9A 2IIQA 4WASA 5TT0A 1XMXA 1K4YA 2NU9A 5AJHA 1XHEA 4YMSA 3T5TA 3WIVA 5BMVA 3PDWA 1L4KA 4MUJA 3WIUA 6ADHA 1A9OA 1HDZA 4X45A 4B43A 2VOEA 4RD6A 2XE8A 1UC5B 2GILA 3R40A 4R2XA 2CV1A 3BXOA 1NT4A 4MHTA 1CR0A 3K6RA 4BMOB 1E1YA 2EATA 5MFPA 2PZMA 3IXLA 3T6BA 4QTTB 2GETA 2EFGA 4HDSA 4I1RA 4NEGA 4DT1A 2R00A 3N0RA 1ONSA 2VWQA 3ORYA 4S1OA 1KBZA 1KNXA 4A8PA 1TAQA 4OL0A 3FKQA 3I2JA 3AHDA 2YFQA 3L1IA 1P2BA 3KQOA 4M98A 4YUYA 4Z7NB 2Z08A 1V3UA 1R6VA 3ILSA 1BOFA 2EOAA 4YUVA 4DDUA 1XA4A 1YQTA 2BMDA 4D92A 1DELA 3F5DA 2PEZA 2XIJA 2GZ2A 3RVPA 4HFFB 5L0IA 1DP4A 4HB3A 2I8CA 3DFKA 4K6GA 4MVJA 3OQPA 3FOFC 4I1VA 3EXEB 4FHZA 3RLIA 5CJJA 4QXRA 4AJKA 1DX9A 1RRVA 1TX4B 3PGLA 4GMHA 4CVNA 1M1YB 5FWYA 3K1AA 2G71A 4G7ZF 3BIFA 5HTKA 3C7JA 4ZGWA 1VYTA 3V8EA 4K46A 5C32A 1E3DA 1N25A 1UXOA 3JWIA 1ZK0A 5B1DA 2NNWB 4N0MA 2EIXA 2OC4A 2R25A 4FLEA 4BY9E 3PFWO 4I6EA 5HF8A 4NABA 2QR2A 2PGIA 3SDSA 4FNAA 4Q4HB 2IPMA 3IJ5A 1Y89A 5CMLA 4P08A 4YP9A 1AX9A 3EE6A 5EJ8A 1OFIA 5CTAA 3ABLC 2Q00A 5AXBA 5IW8A 3LVBA 4PFOA 5G41A 4CTKA 1VG0B 4ZT7A 5BSVA 1BE8A 1OJ7A 2IDJA 4PG5A 3ZGOA 1KFKB 1KIFA 3FDIA 1JEJA 4J0JA 1H65A 2DB4A 4MS1B 4WOBA 4WZAA 5B4TA 2L6GA 4RTQA 3I5YA 4KNVA 1FP6A 3BWCA 3HCNA 4UHFA 4YNBA 3WK8A 5B6PA 2GPAA 2FSGA 4OMCA 1NT2A 4J2TA 1QXSA 1YHNA 3DCIA 2R47A 1JKJB 4P4SB 1QGED 2J3LA 2O2HA 1BN6A 2A1UA 4OJKA 1ZI8A 1CUUA 3TOXA 3U2QA 1TFUA 3VPGA 3IELA 3W0LB 1U2GC 2JX0A 3CUSA 3MTGA 3P9QA 5EZYB 3LBFA 4PG6A 2XMRA 1Q0SA 4RJ2A 2HUPA 3AF4A 3LGXA 3SMQA 1T9BA 2PJDA 3H6GA 2ZCJA 4LX0A 2DUWA 2R7XA 4IQ4A 3VTKA 1L1EA 1K6XA 4GI3A 3DH0A 4CF3A 3CRMA 1RBZA 3E8MA 1R0YA 4PXAA 4C3DA 3EAFA 5AKXA 3VR5H 1WOLA 1ZW3A 4OJTA 3TTWA 3JQQA 5SY4A 1LDNA 2BM8A 5BURA 1XRNA 1ACMA 4AKSA 2HF2A 4WLOA 4EL0A 2I4MA 3RS4A 3CKYA 2GK6A 5TRTA 3VR4H 4ZO9A 4A27A 2ZUBA 1DIBA 3ENKA 4XJSA 2VTVA 5TMEA 3HA3A 1W35A 2YMPA 3N76A 5CFLA 7MDHA 2HWKA 3T9EA 4N6HA 1M75A 1QRSA 1Z5UA 2H2WA 2QMQA 1J00A 1C4KA 1EGMB 1YR7A 2VYVA 2WHPA 1UPBA 3IUJA 4REQA 2FG7C 2NPFA 3TZKA 4BKUA 4CEIA 5J2TF 3FTNA 2IYYA 3LUDA 1IUKA 1QE0A 4PU0A 4WDRA 3S5UA 4C6TB 4AJNA 3WRWA 2HMUA 3DAFA 2R97A 3IVGA 2X51A 4CT5A 2OESA 2WAYA 1QYDA 2PSJA 2P9CA 2QTTA 4ID9A 1P1RA 3JYYA 3G7SA 2F7SA 5EJ9A 2Q2QA 4YRZA 3A6FA 3I76A 2NADA 1APBA 4PO1A 3JRMO 3INRA 3EZGA 4LGYA 3VU9A 1PS9A 1TKNA 5FBVB 2YIJA 2QYOA 3IP3A 5HKAA 4R54A 1HRKA 5NLLA 5C1OA 3HI6A 3QVVA 3SSAA 1N6LA 3C7CB 2VSFA 3L0IB 3TXAA 5IKPA 3FF4A 3AFIA 4ULWA 1K06A 2E89A 3ROQA 2H2HA 1BN7A 4ER9A 3BC1A 1JT2A 3KYJB 3N2LA 4FGLA 1J9ZA 2BF4A 3DB2A 1E66A 2X2EA 4Z3DA 1T4BA 4LK2A 1YXMA 1YULA 4H6XA 4ILKA 1MFZA 1KERA 2P41A 3L1HA 4TWAA 4X6UA 1MORA 3Q3GE 2GI4A 3CZCA 3FHCB 3HRHA 4V39A 2Q2VA 4F4CA 5JFOA 2H4ZA 3IPCA 3NANA 5AJUA 5ESWA 3TEMA 1PX0A 2PDAA 1VPDA 2BGWA 3DAHA 4C29A 4CCWA 3ABOB 5J5CA 2UUAB 4E1VA 1UWCA 4H59A 5TJ9A 4XIYA 2SNIE 5TSDA 1DEHA 2XDQA 2BMVA 1GY8A 3OZIA 1EWKA 3SHVA 5B57C 1RE1A 2JNWA 4I3GA 4RENA 3ZDFA 3S2UA 3D5QA 5THKA 1H3NA 4DC0A 4RBNA 1EXVA 2F43B 1YA7O 2R8YA 1U7OA 1T9ZA 4CM3A 4TRRA 2VJNA 1MC4A 3KKOA 2AJCA 3T94A 1UDWA 3OCUA 4JBIA 5CAEA 3VDMA 1BH2A 5CXQA 4EG5A 1NG9A 4J76A 4NCAA 4OH1A 4UNQA 3CJQA 2NVUB 5HILA 4CFZA 2V26A 2BJVA 2C1ZA 2QNBA 4MRSA 2QROA 1NBMA 3P0IA 1C9NA 4HXYA 2H08A 2FF7A 2JGDB 1O96B 1X1TA 3BIWA 4M4SA 4YCAA 3RRJA 3AW9A 5TF0A 4V3BA 4NBTA 5AJTA 1MJGA 1I1NA 2I6GA 3QPDA 4IIFA 3TG8A 1RHKA 1OCOC 1N1EA 4HNAB 1WUIS 4OIRF 1HSZA 2CSUA 1GJRA 2ETXA 2DT8A 2FRXA 2QY6A 3C8HA 4V0OA 1OXMA 1ISPA 4AZ3B 3B1VA 4J3FA 1RWXA 1UK9A 3EQ8A 5KNBH 1J1ZA 5GONA 1HDGO 5LDGA 1ORVA 3L8ZA 4EPWA 1OCEA 1B26A 4XSGA 5CLGA 2CHFA 5K4GA 4K9LA 3DR5A 4U3JB 1YCHA 2ADOA 2C4UA 1MO5A 2EZUA 5IHPA 5DM1A 3DWIA 1SOMA 1B3BA 3OPXA 3UUGA 2QN6A 3KUKA 4LXQA 2ZIFA 2ZATA 4JBHA 2WD7A 3A31A 1SC1A 3B12A 4Q4HA 1ZHYA 4BJ5A 1KZGB 3VH3A 4GPZA 2A0WA 3WLRA 4AN0A 1QYRA 3MUEA 4GI7A 4CNQA 4IAQA 4GPIB 1HLGA 5F28E 4MIEA 3N9IA 1W88B 3QFFA 1GAWA 2FSIA 2XYRA 4BLPA 2O5CA 3T3EA 1CPYA 2NO6A 1D2GA 2LWIA 4GM4A 5EC8A 4CQMB 2NYRA 4CSAC 1A9SA 1DKNA 3GK3A 3PV0A 5K6TA 3C1TA 4EJ0A 1IPEA 2BBTA 1P91A 4TV8B 5FWDA 4IIJA 4BAZA 4X7MA 4D0LB 1KU0A 2ZIWB 4YK7A 5KPDA 3JQDA 4XB1A 2D5AA 3NP7A 1G3UA 3U16A 1HG0A 2ZJAA 3D7NA 1N57A 4JUFA 2WHYA 4CM5A 3D5TA 4OMDA 3NHWA 2RCNA 2X76A 4GLOA 4YQZA 3GYBA 3RC3A 1TEVA 4RDHA 5EOVA 1U9IA 1QSPA 2QUHA 3CW9A 2OQIA 3KKLA 4NESA 5DBFA 4IHJB 1IJBA 4WJKB 4LRSB 2FGYA 5KNDD 2PA0A 4PFKA 5LMCA 4M1QA 1TA9A 4NFHA 1D7OA 1P75A 1Z15A 2FMKA 5E95A 1SCDA 1DUVG 2IY8A 3DNMA 3M6UA 3VXKA 2IH4A 3K6BA 1GSOA 1WHSB 1JHOA 3L7NA 1OR3A 1OFUX 4OIMA 4S1NA 1GVNB 1GQ2A 1K66A 1VKNA 2P6OA 4X1IA 5CHEA 3A2KA 5F7JA 5B6JA 2HXYA 4TTSA 2O1EA 5EHGA 3QW0A 4C0QC 1CV2A 2PH3A 2VTEA 4L0CA 5GPBA 4ZCPA 3EPRA 2E37A 5AW7A 1S8AA 3I04M 4O4IB 3ZE8A 4DABA 2G17A 1V7PC 3LF2A 3OTHA 1WM1A 1ZD9A 4YWHA 4WCDA 3PUHA 3ZH9B 4PNZA 1YJBA 1NF2A 1GRQA 5C8YB 5CXUA 2DULA 2E18A 4FXPA 3ZKWA 1IOVA 4PSCA 4AP6A 3RV3A 3C74A 3KB8A 5TQ0A 3GUVA 4ZT2A 1ZN7A 2OB1A 2Q41A 3CMCO 5CX1B 3AY3A 1VMKA 2B99A 4WUTA 1KAQA 3PNKA 2EDCA 1PJBA 3L8FA 1SA0B 1ZBQA 3LA8A 3PDIB 1M1ZA 1Y9ZA 2G82A 4HWOA 4AJ9A 5AVRA 1P1FA 3COWA 1HSOA 2EF1A 4IJWA 4YCBA 4CMIA 3U09A 1J5PA 2XB2A 3RS8A 1SEVA 1LKXA 1OY1A 2DHCA 3K9NA 3ZUPA 3V1NA 4BQEA 3F9RA 1EVLA 3T1YB 4G0XA 5IJ0A 3FCEA 2EG9A 2AWYA 5ARDA 2UUHA 3HACA 1RLJA 3OFJA 2Y1EA 1GA1A 5B5SA 4AS1A 5HOEA 2E87A 2AEFA 5HMLA 1DAEA 4C22A 3I0NA 3C3XA 5KHAA 3UC9A 1WPXA 1IC6A 1KI6B 1W9HA 2C4HA 3DFFA 1LV8A 3OZSA 1H66A 2AG5A 3GPCA 2RK4A 5AWFC 3OOWA 5JO9A 4YMVA 1HQDA 1SG0A 2P4HX 3ND5A 2ANCA 2J07A 3GL9A 2PMCA 3AP1A 2AIRA 4Q3DA 1NXWA 2C3OA 1JEYA 4D4HA 4EZIA 1R5OA 2M9MA 1P4RA 2VXOA 3W4KA 1IG3A 1RIFA 3M34A 5KVSA 2QTCA 1K0FA 3DKPA 3L8YA 1GYRA 3JZFA 3LDAA 3O3CA 2HJHA 4QWMA 4FOLA 2ZS8A 3KB6A 1JHZA 2QRQA 3Q41A 1YCDA 4Z0PA 3AVXA 1WS6A 1C17M 3I58A 1L5VA 4C30A 2JF0A 1W0CA 2H57A 4JI7B 3WL3A 3A3NA 2RHOA 2L6FA 3R23A 3TBHA 5I3ZA 1ZINA 3PUWA 4I4LA 1C7EA 5KI6A 1OXKB 4W7IA 3L93A 3TIIA 4C4TA 1LV7A 3QX8A 3E9YA 4RQUA 5E1BA 3HI4A 1JA1A 2XLOA 1T0PA 2V96A 4AL4A 1ZZGA 1OT3A 3V7FA 3ZQJA 4DDTA 4Y9TA 3IBCA 3KJHA 4P7FA 2HFKA 1XIVA 3ED5A 2AP3A 1SVNA 4IJ6A 3R41A 2FN7A 4HKTA 4OJMX 1V4VA 1NW9B 4ZVLA 1CR4A 3A14A 2E82A 2QM8A 4YMGA 2JLSA 2K6GA 4KMMA 3UHFA 3MJSA 3ZDQA 4Q1BA 4BJ3A 7REQB 3HNPA 4RD1A 3JALB 2ZI3A 4MNTA 2ZUDA 4FSDA 1MB9A 5IYZA 5ALNA 3B6JA 3CC8A 2VQ6A 3DOCA 2IEAA 1P9RA 1RC1A 3BE6A 2PJUA 1GQOA 4JNCA 2OG1A 4HX9A 1SCIA 1LSSA 5AVQA 2A6PA 2OUIA 4W5QA 3DT9A 5F4ZA 1A7KA 1NYQA 1YT5A 4R2MA 1OH8A 4RY0A 2E4ZA 3AHFA 2GEJA 4BNFA 1K08A 3FHLA 5B7QA 4UHCA 3W9UA 4PTYA 1UK7A 4CT4B 5ES4B 4GXRA 4IDHA 5KQGA 4ALKA 4TXNA 4U5XA 1T0UA 4I08A 5BUSA 2OCLA 1BOOA 2JFWA 3NBKA 3TL3A 1X92A 3QOFA 3VQTA 2CYDA 3S81A 1VLJA 2C00A 4NOJA 3I1IA 4G5SA 1CUYA 3B53X 3HNJA 3NHKA 1WN0A 1EPUA 3K15A 1QKRA 4KQCA 3ZV6A 4EI9A 2CEKA 1AO3A 1GV0A 1Y3IA 3IKTA 1YMVA 4LY3A 5IXSA 2NT4A 5CB4F 1P72A 2DZDA 1MGOA 4TQUS 4OU4A 1AF7A 2Y3HA 1FQWA 5HS4A 1W49A 1SVOA 1XP5A 3SQXA 3WL4A 3AEKA 4MRNA 3UA4A 1G2PA 4WLNA 4W1PA 2CZQA 4EO9A 4YYZA 1QQBA 1ZCZA 4JNKA 1XVIA 3KZ1E 4X60A 1J0EA 3T4RA 2WB4A 5CIWA 5H0IA 2H5LA 3FN4A 4L57A 1GV1A 2AUNA 3NTXA 2YWCA 1Z12A 4GZLA 3TUIC 1HNWB 4UE3S 1J97A 2AVDA 3W77A 2BF7A 3B9PA 2ODBA 4OXRA 4QUAA 1VXRA 4G5RA 1VBMA 3HCCA 4D9GA 5DBEX 2TS1A 1IM8A 3VNAA 2VAMA 1NLUA 3MYFA 1NAIA 4IIEA 5JJBA 3L2OB 1JWBB 3TW4A 1TFOB 3DJNB 2JGMA 3MOSA 5AHOA 3HCOA 2RAFA 1JU3A 2YLGA 1KZYC 1SRRA 3PNVA 5ALKA 2HS5A 4D0SA 2M6SA 1KI9A 4WA8A 3UN1A 4R1NA 4DTCA 2P6MA 4LXGA 2GYUA 4XUEA 5C1IA 4DV1B 2WP0A 2P5SA 4JUIA 4YQFA 3OD5A 1OA1A 1RVDA 1WXWA 5EPOA 1Y1LA 6PFKA 3JQCA 3OZRA 3AQCA 1ECGA 1T2UA 3WLIA 2RHLA 2C8KA 1DIGA 4S1TA 1R1DA 5DWVA 2W48A 4AN1A 4L74A 1D0VA 1QU3A 5F35A 1YHYA 4YRKA 5F98A 2Q9AA 1U2SA 1Q7RA 4MLDA 3OT4A 2IKSA 4BLVA 4J0HA 2GJSA 4KOEC 2IGTA 2FW7A 3RIPA 3VF0A 1WKBA 4EYEA 2IXTA 2YYSA 4RL6A 4ENVA 2GDZA 1LNZA 3FH0A 1YZLA 3OFSA 3P94A 4BB0A 1YBHA 1KC1A 3EGDA 4A7PA 3A11A 1GZUA 1QVWA 3AF2A 2EHDA 3HKDB 1FMWA 1GDHA 2F1KA 2BWJA 5LZ5A 3WSTA 2B82A 5JMPA 4HO1X 4M36A 1YIDA 1PCXA 1DLJA 1CZKA 2I3GA 5ALVA 3TECE 2Q5CA 3KDAA 3DUWA 2VRCA 1P4AA 1Q11A 1DCTA 3LAWA 5K2MA 5AVWA 3WWEA 3PUJA 4D8WA 2XOEA 3ETNA 1Z0SA 2I5PO 3OQHA 4HQ0A 4G9BA 2GAQA 1CJSA 1WU8A 1SBCA 1L4HA 2OU6A 2CCKA 5AVUA 1EYZA 3ZU3A 1OU0A 3L0CA 3FKSD 1BSVA 3MCUA 4XH9B 4DF3A 3VNSA 4ENSA 1ZGHA 5LQKA 1IZ7A 3EDOA 5DNCA 3TJ5A 1WULS 3B3JA 5K3AA 4CWAA 4D8YA 4LF5B 1TPYA 2VT3A 4Z6KA 4LRQA 3NEJA 3OY7A 2X4GA 5M04A 4BJ5C 5E9QA 1Y9AA 4QOFA 3RS5A 4DCPA 5CJ2A 5F5XA 1MA0A 4PVCA 4RIFA 1UZUA 2XNDA 4P82A 5AI0A 1VTKA 3NFRA 4PRZA 2WMYA 5CCXA 3DV0A 1B8PA 2EL7A 1KFJB 4FAPB 1JRAA 1FMLA 2P0EA 3BQMB 2O2SA 1YJ8A 3EYAA 2NO1A 2H07A 3Q1KA 4BO1A 1ZHFA 5LZ8A 1VDZA 4EGQA 1JEQA 2AF4C 3ZNOA 4ZTBA 1VCHA 5IM5A 3AQ4A 4WJLA 5LU8A 1BS2A 2NSGA 1H2BA 1U2TA 3PXXA 3GFTA 2GM3A 5JAIA 3ZJTA 2ZAYA 2HOQA 3WHKA 4B3IA 1C30B 1Z6TA 2HV9A 1G9SA 4FVTA 4BO6A 1OW6A 2R7KA 1YACA 2GFIA 3DAPA 1W93A 1UC8A 3M6IA 3OA2A 2IT1A 4K2HA 2BZ1A 4P3YA 3H16A 2OVBA 3INNA 2DWQA 3OH8A 2WZFA 2J9BA 3S99A 1ZKMA 1NBBA 4JBLA 3MUFA 3MPOA 1L7MA 1DFGA 5DNDA 4CDGA 2Z15A 1D04A 3AVPA 1E2IA 3KTFA 4TS4A 4U2FA 4EG4A 5JZSA 1Q1ZA 4RGVA 2D5CA 3EF3A 4B32A 4Y9DA 5B2FA 5JD4A 4RKYA 3NU1A 1JFLA 3ADOA 4UU8A 5JR3A 3BL8A 3VGPA 3KP1A 5IHXA 3OE1A 4HYYA 3HDVA 3NYWA 5CH5A 3THYB 2JCSA 4O4JB 1DAGA 1U5CA 1MDFA 1NMEA 1A82A 3PQ8A 4O4LF 2QENA 5EZ6B 4E31A 1P0PA 1QHSA 1FY2A 1WEKA 4QUHA 2IDZA 4AIIA 2OCGA 4B1FA 1DARA 2PR7A 3K0FB 1Q1BA 5A6AA 4DEYA 3D0RA 2QE6A 5ICEA 5F33A 2JPDA 3PX2A 3ZDLA 1WOMA 4FDUA 1HDXA 1E6LA 1GA4A 1UZMA 5B3JC 3H4TA 4BVAA 3I1FA 2BCGY 2PCLA 2EYQA 1ML3A 3R7LA 1I33A 4LJRA 3UENA 5JAOA 4QVKA 3E9VA 2V3CC 2FYTA 1UIMA 1O5IA 1FK8A 1USIA 1DQSA 4RQAA 2TMDA 1AUVA 1NUPA 2X4LA 4L08A 4LKOA 1DJMA 2GM9A 3PUKA 4RE5A 1KS2A 5DTJA 4XVQA 3BWYA 4BE7B 4JBGA 1NP7A 2PWBA 2R65A 3QF7A 3ZWQA 1SHJA 4ZOEA 3GLSA 5BNZA 4KR6A 4X95A 1TJPB 2COKA 4B7ZA 1UPFA 5E4TA 1JECA 1G5QA 3KAKA 3H8SA 3C5CA 3N0XA 3JASB 4CUJA 1XFDA 5KX5F 3PDIA 3NTOA 4D0NA 1MNAA 1OE0A 2V5UA 4BVLA 1DE0A 2FQXA 2IXDA 4X3CA 4P9FA 4DRXA 1W76A 5KWVA 1RXWA 3AH8A 1DAKA 4BOYA 4W5OA 3QY9A 1JIXA 1NF8A 3NJRA 3HN2A 3H5WA 5REQB 3GNQA 1KQNA 2UUPA 1PR2A 1N36B 2CFIA 1ZH4A 3PD1A 3UHJA 1PW7A 3H5LA 2XNSA 5H16A 1WXEA 1V16B 2J5QA 3TI9A 2QGNA 1QAMA 2VRCD 5DTEA 5C5CA 5ISMA 4LJYA 3GEPA 1LPPA 1NI3A 2DTEA 2GJ4A 2RFLA 2Q8PA 3HCWA 3ZHUA 3SKXA 1XNQB 1JFFA 2JFNA 4K6KA 4KI7A 4YRTA 1W581 1YKFA 5D86A 3TZCA 4UEOA 3T1QA 4JS0A 3N8DA 4MQUA 2PXCA 1E3LA 2J9RA 4JSYA 2KQ9A 1MU0A 2J09A 5L4NA 2Y1CA 4H3SA 2YASA 3GJZA 5CPFA 4BWYA 3R9XB 4KWHA 3H2KA 1ZU4A 3PP8A 4NC3A 4WECA 1D2MA 1NFQA 2PBEA 1G8XA 3EZ2A 5DQTA 1UZLA 5IF3A 2DR0A 3TFQA 1KQGA 3BGWA 3HVUA 5KZMB 4EG7A 4ZOLF 4ND8B 2OHXA 3EWAA 4CKWA 1IK4A 3GLTA 4KPGA 1RMQA 4XIFA 1FBTA 4OLAA 1AQYA 1CUZA 1PDVA 2KWIA 3VFDA 4RE6A 3OWTA 2PO7A 3UAXA 4UQLA 5REQA 4JI3B 3E84A 1GPAA 3COYA 3L8CA 3NI2A 4PQFA 1OXXK 3GMTA 4MUYA 1UCFA 2O7QA 1K8RA 2GF9A 3O3MB 1IB6A 1KOJA 1GPKA 5E6RA 5EIEA 1JE0A 4ZC8A 5JCPA 1NU9C 2C5LA 3SQMA 3QHQA 2YFHA 1NWCA 3U7RA 2E49A 1M0WA 1J2JA 1P39A 4YFYA 4E2ZA 1A0OA 5IN5A 4UOZA 5CG2A 3ZQ6A 5F9FA 2R87A 1XQ9A 2ORYA 4MVJP 5HF9A 1XCLA 3F3KA 2OBXA 3W3AD 3ETHA 4CQMA 3I4FA 2VRWA 4XX0B 1IQ0A 4N5IX 1MAHA 4UHKA 5A06A 2XQFA 2PLNA 4LWQA 1EWVA 2QVXX 3SN6A 3V1MA 1U6HA 4OSPA 2QAGB 2AQHA 3MGBA 4LNUB 4JW1A 1JP7A 1HGXA 1VCOA 1D6SA 1BR2A 1Z5NA 1YL7A 2OFWA 4G84A 2UUBB 2DKOA 5ALQA 4UW9A 2D59A 1Z74A 2ZS9A 3GZTB 2C0CA 1X8XA 2EJVA 2I99A 3EGIA 4PC3A 5T41A 4EARA 3TGLA 2ZT6A 1N32B 1JR4A 3I4CA 1IW7F 1MC5A 3L5KA 4HH4A 4BO2A 3FYUB 2JLRA 2FWAA 5A5GA 4I1OA 2J0UB 5U4XA 1UBEA 4E2YA 4WCFB 1YBVA 2FF5A 2HA6A 3WK5A 1WHTA 1NJ6A 2XUGA 4JJEA 2ZSUA 1TA4A 1PL8A 3SBDA 3KHUA 3F5MA 1HOXA 1U3DA 4FR2A 4YUZA 5B7NA 5F2NA 4HZIA 1J70A 1E20A 3TIVA 1S8FA 5CEEA 2I6UA 2GDCA 3C1OA 5IBRA 2HPAA 3TKAA 2HA4A 1D9XA 1ZUIA 4RKWA 2NGRA 3M89A 1AMUA 2Y0BA 2B7LA 3PHIA 1Z28A 1U0HC 1UAAA 3FNEA 3RJ9A 4PYIA 3WP1B 2PL3A 1TMGE 5KAPA 2BKEA 2F3SA 3OPNA 5H3LA 1N2OA 3UYKA 2V1XA 1KJYA 3KZMA 5F3WB 4NBWA 3QLVA 5JAQA 3GYGA 4UOQA 1JXMA 3A27A 4B84A 2WHEA 5HG0A 4AWBA 3KUUA 1XLWA 1MOSA 2BEJA 2M2IA 1ENYA 2QDKA 3DFZA 3GN2A 3AFNA 2CXHA 3QI2A 4F8EA 2KYRA 1XF1A 1AD2A 3MRTA 4I4TA 3RQSA 3RUDA 5DHUA 4MXDA 4QD3A 5CCDA 4BLWA 3F67A 3KYCA 2DQYA 1FNSA 3MK31 4WESB 5BR8B 4GR5A 1G8MA 1CX9B 1ZIDA 1A50B 1QO7A 3NEAA 1ZKDA 3R9KA 3RIGA 4YAUA 2QPLA 3A1UA 3NNDA 4YAEA 3CQZA 3G79A 5LWQA 3O8QA 3ESRA 3S84A 3B29A 2A9JA 4HQKA 4NR0A 3P2YA 1XN4A 4RWEA 2IU6A 3K0CA 3ZY3A 1KH3A 2PMBA 1PSZA 5JAHA 4LJLA 1E99A 2QTGA 2B1QA 3E03A 4IVNA 4KQWA 2NYVA 3S0JA 4E15A 2IHZA 4N0PA 3VNQA 2JL1A 1NVVR 3GFQA 4RZIA 1PGQA 4Q9HA 1RKQA 3NH6A 2GBIA 4FFBA 4NAVA 4E5MA 1M7HA 4FYWA 4K0KB 4S2EA 2GWHA 1JJ7A 3PEFA 2DI3A 2H9AA 3A37A 1QRDA 4YLGA 4IV8A 5CRIA 1AOXA 2XOKD 3GLHE 2EKBA 3PVSA 3G0IA 5LA6F 3TQCA 4CM8B 1C9KA 4LJSA 4UM9B 1SK8A 3JWJA 1B2RA 5DKFA 5JO0A 4G26A 2V6IA 4JZAA 1PNQA 5FTKA 3RADC 3ZW7A 4BS9A 2EGUA 4M6WA 3HSYA 3HE3A 4FJ2A 1G6OA 2GZDA 4E5VA 4OIPF 3U3FA 2MSWA 1E7RA 4UAVA 4CR6A 3Q9LA 1JH9A 3O2JA 3UMFA 1J22A 1MTZA 3VRCA 3FLEA 2CNNA 2HSJA 2Y0DA 3H4MA 4NBLA 4ERXA 2P2DA 3FVQA 2H2AA 3HUTA 2ZR7A 3KEFA 3RJMA 1USUA 2B4QA 3LHFA 4L51A 1NKTA 4AJ2A 5K0SA 2PQMA 1G8FA 1V35A 2GQ0A 1J8YF 2P68A 3AW8A 1PBTA 3RABA 3SBXA 4E09A 5H4GA 3BHNA 4POOA 2IS4A 4BL5A 4MVUA 1U7ZA 1E1DA 2ZRQA 4OBWA 2YZMA 1PP4A 1ZW6A 1WWKA 4M9XA 5DSXA 2I33A 2VR1A 5IJ9B 1PL0A 2JJ1A 3IBTA 4O29A 1T36A 5E33A 1HYBA 1NPDA 2PS1A 1SB9A 3GRYA 521PA 2YJ4A 4D42A 1KU6A 4ZYVA 5FAXA 2D6FA 2QM0A 3CRVA 3LCCA 1D03A 5A6BA 2OV3A 1N6OA 3GG2A 3PQ7A 3QBTA 2CB0A 4M89A 2GK4A 3N70A 3UK1A 4AECA 3GEIA 3M6XA 4TYNA 4K0DA 2VHUA 3BULA 3HR8A 3EXHA 2HKVA 2B4YA 4WVLA 3KPYA 2I6FA 2R7NA 5KOJB 1WDWB 2ZBUA 1JAHA 4QHSA 3X1DA 1U2RA 4LJ8A 4OPMA 1UODA 1X1AA 2FFQA 1PR6A 1V9LA 2PRYA 3H97A 3HKCA 4H16A 3DFIA 4G5XA 3TQFA 2FWRA 4RESA 3A6DA 2F17A 4G1VA 2TYSB 2P6NA 3ACBA 2OP1A 3K1IA 3D8TA 3FM9A 4M49A 2PVPA 3B6EA 2ADMA 2OCYC 4L0DA 5E6UB 1ENZA 1WF3A 3U5SA 2HIMA 1X8JA 3MSCA 4NMLA 5GMOA 3TIXB 3K0BA 5AOAA 5AQEA 3DE0X 4G4SO 2I2FA 2I8BA 2WJVA 3O94A 3QKRB 3C6QA 4FEYA 1D2AA 3EQ9A 4B6FA 4YJDA 3HB1A 4TLEA 2ZRKA 2A1DD 4E12A 1HH4A 1V26A 2ACWA 3HXLA 5AVKA 1QRUA 4HDMA 1XZGA 3TTTA 4BGUA 1WX1A 2GCOB 4DSZA 4TKUB 2V45A 3INGA 4PR9A 4Q9JA 1AQUA 4I1PA 4M9CA 1X7XA 1FUKA 1NVEA 3VR0A 3D2BA 3FVVA 5BMVB 3IAEA 2I54A 4EJSB 3TJZA 3BH6A 2GBFA 3Q7PA 1TJ4A 4NCJA 3QZUA 5ERXA 1VZ3A 2O3RA 2R7AA 2R4UA 4HE8D 3TLKA 3UMRA 5FWXB 2O48X 2Y1XA 1PR1A 3MRXA 1YZHA 1WUKS 2C4VA 4P58A 4TXLA 4JEMA 4M55A 2CVHA 4KK4A 3IQIX 2O54A 4F9TA 4N3NA 3C43A 3SU8A 2YQ4A 3PCVA 1XTTA 1E92A 3QOWA 1JBQA 2G4VA 1V8OA 2FW9A 4N5HX 3V97A 4YCSA 1MX3A 3R0ZA 4CMHA 4GKKB 5KKNB 1PZNA 2SCUA 3PX3A 2RB4A 2Q8NA 3GLIB 3BWBA 5CI9A 1DDOA 1Y8AA 4I3MA 8GPBA 3OLWA 4CMEA 1EFRA 4O4LA 5J2UB 4J4HA 3VH1A 4DN6A 4BJTA 3ACDA 1SZPA 2VQEB 1TAGA 5BWCA 4MK4A 2RGBA 4WNYA 1ZBDA 2F9MA 3KCQA 1NLXA 3RF3A 2CDAA 3MCWA 1NNI1 1NQWA 3VYTB 1XA0A 2VA8A 3GH1A 5A05A 4QPNA 4DJFC 5E2AA 4LOIA 5JYEA 1TK9A 1RFGE 2ZXPA 1UBKS 2Q45A 3H11A 5BQIA 3HWRA 4EI2A 3LZCA 4F1JA 1GILA 5EZYF 4ZMRA 5K6AA 3BT7A 4EY6A 3EF1A 3QTTA 4CR7A 4XEFA 4H4KC 1M7GA 1E8MA 1XCPA 2I4RA 3OZCA 3Q0EA 4JBNA 4OHUA 4RZHA 5FRDA 3HV0A 3UWSA 1Y4SA 4XUGB 5IT4A 5I7FA 1SUDA 1SVWA 4LYYA 3NHYA 2XL8A 4NV3A 3CLTD 3HEMA 4NENA 4DA6A 3UMSA 5EFZA 2M32A 1Q6YA 1M0EA 1DO8A 1EE1A 1H2HA 1JJFA 2Q9UA 4K1XA 2D54A 4IOMA 2SCUB 3A1NA 1UAGA 1NUSA 4B79A 4GMDA 3ZCTA 3I2FA 1NE7A 4F06A 4URYR 3QPBA 4N0QA 3B0PA 2AC2A 2B35A 3B6ZA 1GPMA 4LCJA 3OTWA 4DSOA 4XLNF 2CLSA 4KYVA 2R6R1 3QEAZ 4BQSA 2J87A 3TXYA 3VC1A 4QI2A 1HI9A 2JJ2A 5LQSA 2OK7A 4LTNA 1RI4A 3IBYA 4LGVA 5FV7A 2FH5B 1KFBB 4DMMA 4DVGA 4UTRA 3EXHB 3OP4A 2W2QA 3SC3A 4H3VA 2RHHA 1NPYA 4IEEA 5D5PA 4EUNA 2M1ZA 3L49A 2A5FA 3TTYA 4B6RA 3O73A 5DDIP 4ALIA 5JATA 4C3EA 1NFRA 1QB7A 5M5BA 1BGXT 1ULTA 2FDXA 1BA2A 2ZJ0A 1E62A 3H8JA 1ZGBA 1BEZA 4Z51A 1MD9A 1JBEA 2JIDA 5ALPA 4CU2A 821PA 5J4HA 4KR2A 2BKAA 2XT0A 3CH5A 5JBQA 5AW4A 5I8PA 3N2KA 1U5BA 3UTDA 4A9AA 3ZHTA 1XCGB 1QVXA 3B2NA 3IB3A 1EX6A 1Z73A 1T4DA 2JBHA 2ZEJA 2MU1A 3UK2A 1SCUB 3GPIA 3K31A 3W1VA 3FI0A 3QNWA 4XQEA 4XWGA 1E9RA 3AHJA 1Y7PA 1U6KA 5KOIA 1RYFA 3NR2A 2XCLA 1UM9B 1LNQA 4IDOA 2WVJA 1OB5A 4QU0A 3KEOA 1MW8X 2NQ2C 3AEUA 3QLUA 1W36C 5TEWA 1YK1A 1RPNA 3QPWA 2VDJA 4Q05A 1HETA 2Y0CA 1U9CA 1JAYA 2VAPA 2VI5A 3PC7A 4PYKA 3FRHA 2VASA 1JB9A 2WM9B 2JLUA 4FI3C 2CLOB 2PPLA 1X13A 2AGVA 2GZAA 4M8SA 4N7RA 1AK1A 1N3IA 5EIHA 3QKSB 4OQMA 1TIBA 4YTEA 2OHIA 1U8ZA 5FA8A 5HRCA 2PUGA 2KJGA 5EERA 1Z5GA 1N92A 2PKQP 2X2PA 3EEOA 2DXIA 5JNRA 1SK9A 3BZBA 2PMKA 2Z6VA 2FZWA 4MITA 1CF2O 2UYCA 4S05A 5E2QA 3LCMA 3OQOA 4KNYA 1COZA 4U5QA 4PXYA 4XGKA 1UKAA 2WQ6A 1RXEA 1KI4A 4YVFA 4RS3A 1E0KA 1XRRA 4MKIA 4PGFA 2CXPA 1YI0A 1Z88A 4HPXB 4UU1A 3OJXA 2GAIA 2V4ZA 4DLTA 4AD8A 1ZVMA 3DL7A 4FTWA 1TGYA 3CRZA 1WGWA 1Q7EA 3DZDA 1P7YA 3YASA 1ZITA 3TFOA 4DQXA 4MRVA 4MIYA 4JV5B 4A82A 5LNK6 4NARA 3V5ZA 4RFVA 1CQPA 1Z4JA 3V5YA 4US1R 2ZBFA 2O8NA 2WJ3A 2ZK7A 4OQPA 3TR0A 4B4DA 4G0YA 4HPJB 4J0KA 4ZVKA 4XQCA 3GT4A 2CSXA 2W6ZA 1EP3B 2P2ZA 4OUDA 2VBCA 1JA9A 3DP7A 2CUNA 1GXSA 2J0VA 2QRLA 3PE6A 3DZHA 4BUCA 3HYLA 3F6EX 3TVTA 4TTRA 4CLOA 3MWDB 4CF4A 4C03A 3UUEA 1BA3A 3CLHA 3FIJA 3NHFA 1Z2AA 3N1UA 1UEJA 4J0EA 1CRLA 2QQ0A 2ONCA 3VPCA 1QGUA 1ZJYA 4Z1MA 1YL6A 4F86A 4PTLA 4NU0A 3UMCA 2XQGA 3RUAA 1CY4A 2R8OA 4L5YA 4IDBA 4TZKA 4BKMA 2VC9A 2QLMA 1S0UA 2ZBQA 3K1IC 4ZVTA 4PG8A 5C18A 4FFBB 3EDYA 3SHFA 5KO2A 2HMWA 4KVZA 4PGMA 2Q4BA 2R4TA 5SZHB 4GC9A 1GUYA 1TZBA 3UJ6A 1UXKA 3WFIA 4AMUA 3F71A 3DYVA 3Q5GA 3G5TA 1GM5A 1L5KA 1KDPA 1RKUA 5ETJA 1PN3A 1DTWB 3PUZA 1Q0UA 3G7UA 4K6HA 4YXWD 5CDYA 1XZAA 3IESA 5DN6D 5FAKA 5I7WA 5IZCA 5K0JA 4ETNA 3RU2A 2DBZA 2EHJA 4JODA 1CIPA 1ZOSA 4QOGA 2ZI5A 4EAAA 1U3CA 2Y3BA 1CUAA 2JAUA 2MWMA 1T1JA 2XEXA 2QUAA 3KBBA 3WKCA 4BO8A 1KJJA 1HA3A 3ANTA 3FTPA 2GTIA 3P0RA 4QTYA 5CIVA 2XCSB 5AKLA 4YPOA 1P73A 5C1BA 4YH1A 5BYAA 4NMHA 3VMMA 2DT5A 5KTYA 3PKJA 1B23P 2J9XB 1Q12A 4NWIA 4KWCA 4P4TA 3FF1A 3W5SA 1K6IA 2F3RA 2A5GA 3EHDA 3UWPA 2CLMB 3OF3A 4QJ3A 2NP7A 3WMGA 4F04A 1I7PA 2J9GA 3VPSA 5HXAA 3AHHA 3VSEA 4R3NA 1KIMA 1H1TA 3JR3A 1ZHHA 3NXKA 4RCVA 3WDMA 4B47A 3LPMA 3IMEA 4RIIA 1W85A 1VIYA 3MLEA 4EABA 1ZYUA 1B00A 2P6PA 2WMNB 3T5PA 1Y3DE 2Y27A 3AKYA 1GYPA 3MFYA 4XX0A 2A1TR 2ZU0C 1F0PA 4AJHA 3LP6A 3F6PA 5C5IA 2ZU6A 4C4AA 4ZGBA 3KH2A 1ZVVA 3OF5A 2WTMA 3MXOA 4HQRA 4TWRA 2CN1A 4WXRA 4PV7A 4HDKB 3NO4A 3CFYA 2QYSA 3GJ4A 2IQ5A 4CJXA 1RWOA 4OLJA 4A92A 4HZUA 5DGTA 5I4BA 4EMTA 2ERYA 4G09A 3GEDA 4YJFA 3T7AA 5D3MA 2XUIA 3DUFA 1J0BA 2FEAA 3AJ8A 2B1JA 2F1IA 4IS2A 2DB3A 5FWAA 5JBNA 3ICWA 3DXZA 4O1IA 5CNMA 3LSYA 2PH1A 3C70A 3COJA 4PHHA 2V3VA 2EJTA 1H1LB 3FZYA 3KJIA 2ZULA 3G2QA 2VKTA 2PLAA 1DB3A 4JA2A 3H2VA 1U2ZA 1VL6A 4PY2A 1O8CA 2RHMA 3HGMA 3VU0A 4EHFA 3GC6A 4YGXB 3ZLUA 3V34A 3NUZA 2BE7A 2FSHA 1E4EA 2IHBA 4HEAJ 3C8DA 4L07A 1C8BA 1ZJ6A 2DY1A 2IHYA 2OEVA 3AG6A 3NWOA 4X20A 4XJXA 5GOZA 2PZJA 1HZZC 2ZB8A 4JI2B 1T5LA 4HQ6A 3RTCA 4F3RA 3LY9A 4G5HA 4UTNA 1XELA 1NRXA 2GXUA 3HFGA 3TX6A 2XWSA