4YT8A

Semet-labelled hmdii from methanocaldococcus jannaschii
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
344
structure length
344
Chain Sequence
DNMKVSVYGAGNQNLYINKLNLPEKFGGEPPYGGSRMAIEFAEAGHDVVLAEPNKNIMSDDLWKKVEDAGVKVVSDDVEAAKHGEIHVLFTPFGKATFRIAKTIIEHVPENAVICNTCTVSPVVLYYSLEPILRTKRKDVGISSMHPAAVPGTPQHGHYVIGGKTTDGKELATEEQIKKAVELAKSAGKEAYVVPADVSSVVADMGSLVTAVALSGVLDYYTVGRKIINAPKKMIEQQVIMTLQTMASLVETSGIEGMVKALNPELLIRSASSMKLLDRQKDLDAALEILQNLDETLKAEVEKAEIKPTTLVAAQSLVKEIKTLIGGAAAEGAIKRSARKLFEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H(2)-forming methylenetetrahydromethanopterin dehydrogenase-
publication title Towards a functional identification of catalytically inactive [Fe]-hydrogenase paralogs.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Metal binding protein
total genus 114
structure length 344
sequence length 344
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03201 HMD H2-forming N5,N10-methylene-tetrahydromethanopterin dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1300 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4yt8A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4yt8A01
2VYND 3ZWOA 2ZQYA 1PTJA 3CUKA 3QJ5A 3DBLB 2PZLA 4RF4A 3VZSA 1JN0A 1QR6A 2NV6A 2FSVA 3W4IA 1P74A 4B3HA 1P44A 1O94A 2DTDA 4ZQBA 3HJAA 1P1FA 5JDCC 2X1HA 4AJLA 1ZCJA 4I5EA 3RVDA 1Q1NA 4ALJA 3OFSA 4EUHA 3E18A 1GYRA 2WYVA 3AM4A 5G4KA 1SAYA 1RPNA 3O9ZA 4MVJM 3TFQA 2RBEA 3PQEA 3ETEA 1N1EA 2JCYA 3DDNA 1DC3A 4RPJA 1UDBA 4AJJA 1O6ZA 4UEJA 1CRWG 2C5AA 2FR0A 2AMFA 4O6VA 3PHGA 1ONPA 4MVJP 1DEHA 1ISIA 1U8FO 2CD9A 2CMDA 1H9BA 3KZVA 3DZKA 4PZEA 4ALMA 3AUSA 3ZWPA 4B7XA 1JW9B 5K6AC 1DIGA 1NFQA 2XOXA 4UVIA 5CDSA 1YBMA 3AY6A 2GCGA 1X1TA 1ZUD1 2O3TA 1BG6A 4CM8B 3RJ5A 1X14A 3Q1LA 4LK3A 3V5NA 3FBGA 4MVJA 2J3HA 2FP4A 4CUKA 2NWQA 4XZ3A 1ENZA 1X7HA 3O38A 1R15A 3M1AA 4JBIA 1Z7EA 3A9WA 1CQIA 4K9DA 1A9ZA 5IJZA 4BNIA 3C1TA 5A5EA 1QLHA 1JQBA 3R3JA 2AA3A 4JK3A 1K5HA 1Z45A 4TVOA 1N9GA 2D8AA 5TNXA 3RU7A 5JNLA 1V35A 3GRKA 1BVRA 3STHA 2JHFA 3ZU4A 4TWRA 1LSJA 2X4GA 2YFHA 1BXGA 3DONA 2EP7A 4I5GA 2P9EA 5KJ6A 3DZFA 5I7EA 1AN9A 3RFVA 5IZ4A 4R5HA 4BV9A 2AHRA 3JQCA 2PR2A 3QWFA 1V3TA 3SJUA 3RU9A 1DIHA 2PY6A 3LQFA 3DMYA 2WD8A 4YQZA 3UHAA 2P9GA 2BGKA 5L45A 4ALNA 3JCZA 1JWAB 4CMAA 2B5VA 2VOEA 5B37A 3VVCA 4EZBA 3KSDO 3KXDA 2J5KA 4MVJG 4U0KA 3TQHA 3VHRA 3IS3A 1UUFA 4GMFA 4TRRA 5ADHA 5IFLA 3KSUA 4QEDA 1W4ZA 4PVCA 5TT1A 5JMWA 1HT0A 1R4MB 2EWMA 2VYNA 3HHPA 5IXSA 2HJSA 1DDOA 1O89A 1A4UA 3WBFA 1RKXA 2AEJA 2VZ0A 5CG1A 3ZN2A 1JAXA 1I3KA 5LDHA 1SB8A 5JO9A 3ZWMA 3I3OA 3ASVA 1ENPA 4ZN6A 1Y1PA 3GFBA 1K2WA 5TF4A 2YDXA 4E6PA 5IDYA 5I8WA 2OORA 4GPD1 3OA2A 3WSWA 3QQPA 1Y8RA 1G1AA 2VRCA 1XKQA 3JQBA 1C0LA 1T2DA 3HFSA 4UVDA 4JX8A 1EDZA 4LMPA 4FN4A 4QTZA 3OIDA 3JYPA 4E13A 2AG5A 4TMFA 5ICSA 4D43A 3DBVO 4CQLB 3FPCA 1MC4A 3OIFA 1B3BA 1B3RA 4WKGA 3TZHA 1MGOA 2Y1EA 1L1FA 1X0XA 2VYVA 1MX3A 3KYDA 4JBHA 2EW8A 4OQYA 5A1TA 4DIFA 2AEFA 2NADA 3OSUA 4WGGA 1H6DA 4E12A 4FCCA 1I3NA 4YJFA 3SX2A 5A04A 2CSUA 3SLGA 2VHYA 4N7RA 1H6CA 4IM7A 4ALIA 3NDRA 2I65A 4YRAA 1LSSA 1DO8A 3GEDA 2DBZA 1SC6A 1D1SA 1G0NA 1PZFA 3D3WA 2Z1MA 3UFXA 4BNHA 2X7HA 4XYLA 1NPYA 3F3SA 3F1KA 5DNAA 3OJ0A 1DAOA 4EGFA 2H6EA 4OYRA 4NR0A 2HU2A 4D7AA 5DT9A 2I67A 2CUKA 3GGPA 3DEYX 2ZKLA 4BKRA 4F45A 1NPTO 1QRRA 2BGMA 1LDGA 3H9GA 2C07A 4B8ZA 4BNZA 4XKJA 3I4CA 4JBGA 1ISFA 1PR3A 2HDHA 3ADOA 3PEFA 4OXYA 3PRJA 4CR6A 3INGA 1ZW1A 4MOWA 1OMOA 3IJPA 5JPIA 3SC6A 3H9EO 3FNEA 3KBOA 3D5TA 2DUWA 5B12A 3HUDA 1A27A 4BVAA 2X22A 4HY3A 4YJGB 1GEEA 4WUVA 4E30A 1P0CA 2NU9A 3RASA 1EQUA 3BHIA 4R9SA 3EGOA 5BR7A 5CDYA 4DWVA 4MP3A 5AXAA 1P9LA 1HDRA 3PIIA 3H65A 2LDXA 4ALKA 1ADBA 4Z0PA 3MJEA 4D41A 1WW8A 1YJ8A 1N7HA 4IQ8A 5T67A 4BNLA 5EQFA 1NQOA 3F6YA 5EINA 4LRTB 4NFYA 3HN7A 3S2FA 4IBOA 3WMWA 2BFMA 3I23A 3VDRA 1F8FA 5K0ZA 3M6IA 4AL4A 4E33A 1XQ1A 1V3VA 4YACA 3DBHB 1HYHA 3QVXA 5DZSA 2GN8A 2YV3A 3M1LA 4D3DA 1GZ3A 3I9NA 1EVYA 2W2LD 3GMDA 4YPOA 2IDZA 3GMSA 1PJ2A 1E3SA 4OL9A 1EK5A 1NQ5A 3C8MA 2P5YA 5TT0A 4RVDA 3GLQA 3DOOA 4LMRA 1NQTA 2YZ7A 2VUTA 3DHEA 4KUEA 4P38A 3R0IA 1NBOA 1DIAA 3ANMA 5K9ZA 3CIFA 1R66A 5H81A 2GSDA 2J5QA 3JQFA 4IGEA 2OGUA 4KTTE 2J6IA 3JQAB 5ER6A 1R0SA 2O48X 1EEHA 4JIGA 1C14A 3GRPA 4R3NA 4ALLA 2GN4A 4FSHA 5IDXA 3ZZNA 1PWXA 4HFMA 3ETGA 4BO8A 4CR8A 2I66A 4R1UA 1KVQA 1NVTA 1O95A 3BTVA 3FWZA 3ZWVA 4CQMA 4ILKA 5C7IO 1J0XO 3V1UA 5C37A 2YQ5A 5A06A 3G3EA 3JQ9A 2DFDA 2BI7A 1UP6A 3AW9A 3FNFA 4KOAA 2H9IA 3QVTA 4NMHA 1ONOA 1H2HA 1E3JA 4PLYA 3UXYA 1QMGA 2W8ZA 4L73A 2FY8A 2OUIA 5L7WA 1MG5A 2QZZA 3GK3A 3L07A 3K31A 1U3UA 4J0FA 4E5NA 3F46A 1LDBA 1U8XX 5J23A 2XPCA 4A73A 3E48A 4PLZA 1ULSA 4PCVA 5G0SA 1R0LA 4BKOA 1DFGA 4G2NA 2JCXA 1HXHA 1XLTA 1HDCA 3OQ1A 2WYUA 2HMWA 4FW8A 3TJRA 3LT0A 1HLDA 3MWDB 4XD2A 3PHLA 5BNIA 4AJHA 4RVHA 2ZB3A 1FXSA 2VNAA 3I5MA 1B16A 3FNGA 3GQVA 4K6CA 2NVWA 2Y0EA 3UOGA 4RGBA 1NR1A 2NM0A 3G17A 3JQAD 4XGNA 5GY7A 2BHLA 3OJFA 4BNYA 4E5MA 1B8UA 4NDNE 2QX7A 4FFRA 3TZKA 3LYLA 3OJOA 5T57A 1XQ6A 2ILTA 3MEQA 4E2XA 4AJPA 2O4UX 4WCFB 3G0OA 4R01A 3VKVA 1PS8A 2IEDA 3PK0A 3PIDA 4NU6A 5KVVA 1U3TA 3K96A 1V0JA 1IZ9A 3C24A 2X9GA 1Q7BA 2VCYA 1R6DA 1LA2A 1JKFA 2FR1A 4U6SA 3VH4A 3WG9A 1EZ4A 1HETA 2DU8A 4MKZA 1AXEA 2IXAA 3ANNA 3U4CA 4N5LA 4W6ZA 4LGVA 3CMCO 4TROA 3RBVA 1FDVA 1OAAA 1WMBA 2GZ2A 3KUXA 2Q45A 1M75A 5U9CA 3AI2A 3U4HA 1FDTA 3VVBA 1JAYA 4GLLA 3ROPA 1DHRA 1BSVA 1F17A 1PJSA 4NJMA 5BSEA 1F06A 3I4FA 4Z9XA 1K89A 1J49A 2A4KA 1B0AA 5BQFA 1KEWA 2DTEA 1BMDA 3LVFO 1MFPA 3OQ6A 5ENDA 3T7CA 3GUCA 3MJCA 4TZTA 1HE5A 1NR7A 2D2IA 1E5LA 4MVJH 3SJ7A 5CDUA 4CM4B 3OHSX 2GUGA 4WEQA 5ITVA 4UUNA 3T4EA 4CMIB 2QHXA 1HTBA 1XYGA 4HP8A 2C59A 2VHVA 4R4JA 2J3KA 3VH3A 1ZK2A 3AUUA 3K2EA 1BW9A 4M8SA 3PFFA 1VC2A 4JP3A 4PVDA 4QSMA 1GY8A 1VJ0A 5AXDA 5A9SB 4PLTA 4IS2A 5L4NA 3OBBA 4NG5A 3MWEB 2E49A 4DC1A 2Y0DA 2JCVA 1ZK1A 3OM9A 2A9FA 3ZHZA 5JCJD 5BT9A 3AY7A 4A5OA 4NK4A 5CEJA 3T7EA 3KO8A 5EJ2A 5G4LA 2YDYA 2Y67A 4BMVA 4MVJE 4FR5A 3VZPA 2TMGA 1A9YA 2NLOA 2GR9A 1AHIA 1HF3A 1IY8A 2B4QA 3BZUA 3TRIA 2AXQA 4Q3CA 1ZFNA 3QWBA 4B7CA 3U09A 1QP8A 4PLWA 4URFA 3HFGA 2ZTVA 4J1SA 3ANLA 1J5PA 4HFJA 4YYZA 1ZKMA 3WR5A 4WLOA 3KYBA 4PIVA 3LF2A 3BMQB 3WFIA 2DBVO 1HLPA 3NRCA 3ONEA 4CODB 2AQ8A 3RUHA 4RZIA 1P1JA 2FPGA 4H15A 3PWSA 2PZJA 2HK8A 4FJ0A 1YJQA 3NTRA 3WQRA 2GLXA 3CINA 4CPDA 1SEVA 3HG7A 3H7AA 3GNTA 4O0LA 4J3FA 2OXIA 3RCBA 1PJBA 3PJDA 1SNYA 3ENNA 3QWIA 2UVDA 2H5LA 1PQPA 3GC6A 2GYYA 3P2OA 3PZRA 4LISA 4IY1A 3QWAA 1HWYA 4E3ZA 1RM5A 4XYBA 1LTHR 3TL2A 1PQWA 3MTJA 2B0JA 4CM7A 4FJ2A 5BSHA 2NUAA 2X0JA 5KTKA 5BSFA 3DMTA 4IXWA 4J4TA 3TZ6A 4CUZA 1PS9A 4BUCA 5G0VA 3L4BA 1GL3A 1Z73A 1HE4A 1N92A 4M49A 3MCVA 4XIYA 4KMSA 4FQ8A 4NBVA 1TEHA 4DVJA 3K9QO 2GD1O 4FFOA 4KUHA 5I7VA 1YDEA 3ICPA 1KERA 2BF7A 2WD7B 4UULA 2FSSA 4ZA2A 4DLBA 1IHYA 4DPKA 3TZQA 4XDYA 2Q4EA 1KVSA 3I9KA 3C7AA 3A1NA 1NQAO 2I99A 1SPXA 1E5QA 4FGSA 2HSDA 4BO0A 1ZSVA 2PH3A 2O3RA 3W1VA 1HZJA 2DPGA 4B79A 3DMTC 1TA4A 3NEPX 1PJQA 1JA9A 3T4XA 2VHWA 4YEDA 4R51A 5FI3A 5CPBA 4KDFA 3GPIA 4ND2A 1WDMA 4IQ0A 4LCJA 4BO5A 4DLAA 3D1LA 5C7LO 2P4HX 1NPDA 3LLSA 3PLRA 4KWHA 1UZLA 4CL8A 1MC5A 1E0DA 4ZD6A 5H82A 1ZBQA 2O7QA 3PDUA 1H6BA 3BXXA 1AXGA 2X23A 4B7UA 6LDHA 2C7VA 3QSGA 3ZW9A 3WGTA 3ZWNA 1HYGA 4B8WA 1C0KA 3H6KA 3JYLA 5FEUA 1GD1O 3ZWYA 1KEUA 1O0SA 3MZ0A 3OETA 1GZ4A 1LXCA 2FPPA 1I10A 4P4LA 1DBVO 3R6DA 4CR7A 1E77A 1BWSA 1ZMOA 1Y8QA 2NACA 2AEMA 3G79A 1ENOA 4PLGA 5A9RA 3C7DB 1LLUA 4CMIA 1X7DA 1DB3A 1T2CA 3KLMX 3LC1O 1YOVB 3LDHA 4NU5A 1I32A 3H5NA 2R00A 1H94A 3G1UA 3PI7A 2AE1A 2O2YA 2PGJA 1XWFA 5HWSA 4C7KA 1Y81A 1ZSNA 3NJ4A 2W2KB 3ZH2A 5GZ1A 2DPHA 1LDEA 1UJMA 3BA1A 4RLHA 3JQEA 1KVTA 4A03A 4CUJA 1R0KA 4NH4A 4Y6SA 3CPSA 4GH5A 3WYCA 3AI1A 3KTDA 1E6WA 4B4UA 2Q46A 4TSKA 4YJHA 3WIEA 2B83A 3WNVA 2I5PO 1HRDA 1P3DA 3P2YA 1V9LA 1AE1A 2E4AA 4P22A 3IOYA 1XDWA 3FBTA 4MP8A 4J9UE 3AU8A 2QRJA 3CZRA 3I9MA 4DBVO 5ER9A 2XXJA 5JW6A 1K3TA 3MJSA 5KKCA 3GNSA 3JYQA 1LLCA 1RYDA 3NKLA 1C1XB 4GQAA 3QIVA 4XR4A 3NTOA 3AK4A 3RC2A 1E7RA 1T1SA 2X5OA 1X0VA 3BTOA 2O3QA 3BMQA 2G0TA 2J5RA 2Y05A 1P45A 3AFMA 5T8KC 3FTNA 2EERA 5G0UA 3ST7A 1CETA 5G0TA 5IZCA 1ISHA 1NX6A 1ZXLA 4AJNA 1LDNA 5G0WA 3W4JA 4ZJUA 3MJTA 1ADCA 4ZRMA 1CEQA 4L76A 3AOEA 5L4SA 4DRYA 3OMLA 1VM6A 4I1IA 2CNBA 4DYVA 4U6QA 3VZRA 3NTQA 1F0YA 4G5HA 4GWGA 4YBZA 3EVTA 1RM0A 2V65A 3HDQA 2DLDA 3N74A 1U5AA 3V1YA 5JDIA 3DAGA 4BNMA 1UXGA 2DM6A 2WE7A 3R3SA 3GUYA 2YQ4A 3A4VA 3WIDA 5TIIA 1WDLA 4JJIA 4XB1A 1E1MA 3BTUA 1ISGA 2BLLA 1NWHA 1P1HA 5ITWA 4HFNA 1T24A 1UXIA 3QY9A 4J0EA 4UUOA 3ZU5A 4CM9A 1GQQA 1MA0A 4XQGA 3HDHA 1R4NB 1UR5A 3WBBA 2AQKA 3KETA 2CDCA 2VT2A 4TVBA 2X58A 1F14A 4JGBA 2RIRA 4DMLA 1P1KA 1UZNA 4WJZA 3TWOA 5A5FA 1KVUA 3KRTA 5LDGA 1U5CA 4HWKA 4BNFA 1JWBB 2Z95A 4H3VA 2DKNA 1NAHA 4YJDA 2D5CA 1LDYA 3X2FA 4FD3A 3B1FA 2Y0CA 4CLOA 1KBZA 5TS3A 4AVYA 4K26A 4BKPA 1EE9A 4J1TA 1GUFA 4QECA 3KV3O 4WNCA 1YL6A 3EAGA 4IZHA 3V8BA 3F47A 4B3JA 1Z6ZA 2P2SA 3WDSA 1ZK3A 5EERA 2D4AA 5ENVA 4W9NA 2IYPA 1DHTA 3LZ6A 3BTSA 4E5PA 5JC1A 3KEOA 4UAGA 1P31A 3H8VA 1W0CA 2PZMA 4YWJA 4OHUA 4RVUA 1ZZEA 5L3ZA 2EKQA 3O8QB 1YWGO 1H93A 3IMFA 3O03A 1N5DA 4UUPA 2VWQA 3PWKA 1A7AA 1N1GA 1NVGA 2C82A 3KVOA 4IINA 4CV3A 4EUEA 4CLRB 3AUAA 4KZPA 3QWHA 2NVUB 4CLEA 1XGKA 2V6FA 2EKPA 4K6FA 2O7SA 3RROA 4XRRA 3WTCA 4LCEA 3KLPX 4IIVA 3DBRB 2Y1CA 4EUFA 4I9HA 2P91A 3UCXA 2ZJ1A 4I08A 4OM8A 2Y1FA 4MIEA 4OKNA 5LC1A 5JYDA 5FF9A 3EK2A 3D7LA 2HRBA 2CVQA 4CM1A 3LSYA 4Q3BA 2G82A 4Q9NA 2YHIB 2ZATA 1I36A 1GUZA 3EUWA 3Q0EA 1GYPA 3W6UA 2HKIA 1UDCA 1PJTA 1VSUA 2OP0A 4J49A 5B4UA 3GN2A 4IMRA 5JSFA 2YJZA 1K6XA 3LF1A 3RC1A 4HFRA 2JAHA 3JD3A 3COSA 3KYCB 3L4SO 1ISJA 3RJ9A 1ZJYA 2PD4A 2I3AA 2QRKA 3QRWA 3ZV5A 4J4HA 4XX0A 1LRJA 2Q1TA 1QORA 3DR3A 3H9QA 5FYDA 1H5QA 2CFCA 2D59A 4IDDA 3M2PA 4IGFA 4A2CA 1ZK4A 3NV9A 3CMMA 4J1NA 1ZO8A 2OO5A 4J2OA 3QE3A 3FD8A 3V2GA 1YRLA 1EUCA 2A92A 3DBLA 3JD2A 3JQBC 4UUMA 2BRUA 4A7PA 3ORFA 3DWFA 3VH1A 2CVZA 4Z9YA 3RD5A 2RH4A 3OEYA 1FK8A 3H3JA 3E03A 1C1XA 1GPDG 4E2YA 3HB4X 1U4OA 1LRKA 1MG0A 1VL8A 4QQRA 3D4PA 1B2LA 4ID9A 5T6BA 3UH1A 4D46A 2LDBA 2EGHA 2V6MA 4FS3A 1XEAA 4WOJA 3PWZA 4LN1A 4DL9A 3KSZO 3D4OA 4TKLA 3I9OA 2WYWA 5KJEA 2GASA 2Y1OA 2X86A 4OGWA 4G65A 1KC3A 1TB4A 3GHHA 3OQBA 4OIMA 1HDOA 4BNJA 2FRDA 1DC4A 1IB6A 1I2BA 3EHEA 4N5NA 3RIHA 3G49A 2XXBA 2JD1A 3KM0A 1LJ8A 2HO5A 3JSAA 3K2BA 1SZJG 3VPHA 1JLLA 2BI8A 2AQHA 3ZWXA 4EJ0A 4YAEA 1NTOA 1CJCA 3IUSA 3L9XA 3PPIA 2PA3A 1LBEA 4CM8A 2PH5A 3I83A 3PYLA 4W82A 5JY1A 4L4SA 4J1QA 1ZH8A 2EKLA 5B4VA 3VPXA 1UXKA 2BGLA 1EMDA 2Q2WA 2OOSA 3FPLA 4R16A 1I0ZA 3HWRA 4RDIA 3W4KA 1R4NA 3OECA 3R1IA 4L0QA 1W73A 1LQTA 3ZV4A 2FZEA 3FNHA 8ADHA 1VLLA 3LC7O 1YXMA 3FTPA 3S8MA 4AJOA 1FDUA 1YQDA 5JMPA 1DAPA 1UXJA 2EW2A 1W8DA 4J7CA 1V6AA 4GVLA 4M86A 5CAEA 4ND4A 3JD4A 1JVBA 2C5EA 4RDHA 4BIIA 3GEGA 5H83A 3UN1A 3DZIA 4J7XA 5IN5A 4DC0A 1QV6A 2WMDA 4GWKA 3F4LA 4E2WA 2EG9A 1UZMA 4KWIA 3G1TA 1PZEA 3ROMA 1IPFA 3BMNB 1L7DA 2FN7A 4O5OA 5L7TA 1CYDA 3NX4A 5CHEA 1XIVA 1M66A 1DIRA 4R3WA 1N8KA 4HUJA 4R1TA 4WK6A 1VSVA 3BMOB 4LW8A 1NM5A 4GGOA 3TFOA 3CE6A 4IDAA 1ZSYA 3CKYA 2OMEA 4P8RA 1QKIA 1TT5B 2EIHA 4NBUA 3A06A 3GVHA 3S2GA 4FGWA 5MGBA 1R4MA 3OJLA 4WLUA 5JAZA 2AG8A 1A71A 3FR7A 4XCVA 3ASUA 4XRGA 3IP3A 3WGOA 1IHXA 4MVJF 4YVFA 5EMHA 4NIMA 3DBRA 4X54A 4DTIA 3WQSB 1YBAA 3ONFA 3VKUA 3H9JA 1I5RA 3HSKA 4HNGA 4MIOA 1HSZA 5JYEA 2P4QA 3RBXA 3S55A 1X1EA 1MFZA 1V8BA 3JQFC 3FF4A 2I76A 3SC4A 2GZ3A 3ENKA 4ZQFA 1D1TA 5U4QA 2I9PA 3JQ6A 1DFHA 2RHRA 2YV2A 4TZKA 3WLEA 5IDWA 5COBA 1MV8A 4GVXA 3WXBA 2UUPA 3C1AA 2AE2A 3GVCA 3KYCA 2NU8A 4II2A 4HXYA 4Y8VA 2PKRA 3B70A 2W4QA 3GPDG 4Z0HO 3JQ9C 4CQLA 4CMJA 1VI2A 1BDBA 4W7IA 4WNIA 3WGIA 4EEXA 3IKTA 1BVUA 3CXRA 3LT2A 3WGHA 3ROQA 4FOSA 2PK3A 1XCBA 1SB9A 2G5CA 3SLKA 3N58A 1J4AA 3GFGA 4I9UA 3ROKA 1O5IA 4EITA 4IMPA 3GDGA 5BNTA 3JYNA 2H1SA 2TMDA 1Y9AA 2Y1GA 1KOLA 1ZEJA 4PG6A 3U3XA 2J3IA 3GDFA 5DP2A 3NDJA 4AICA 3HB5X 1U3VA 3TN7A 3PLNA 4YDRA 5I8ZA 1VL0A 5CDGA 4KQXA 2Q3EA 1I2ZA 3WYEA 1J6UA 1PGOA 3IL2A 1EBFA 1DC5A 2DC1A 2BD0A 3ZNNA 1X13A 5CFZA 5CEEA 7MDHA 3LC2O 1E7YA 2ET6A 4WCDA 3GGGA 5DBGA 4WLNA 5LCXA 5ILGA 3WLFA 1NHGA 3PQFA 3N7UA 4PRKA 5JLAA 2W2LA 4PLCA 1KVRA 3S2IA 1OOEA 4O59O 1JVSA 1LNQA 3GZ4A 1XA0A 3Q9UA 5KJ1A 1ORRA 1OBFO 4QFCA 1H9AA 4LSWA 1A72A 4FJ1A 2GF2A 3NUGA 3WMXA 3F1LA 5I9LA 4YJGA 2B36A 1LLDA 4FOOA 2Q99A 4D79A 5HTOA 3V2HA 3AJRA 4CMGA 4XB2A 1TI7A 2Y66A 4Y67A 1DLIA 1T26A 3H5RA 1YBVA 3H2ZA 4CM3A 1PQUA 2O2SA 4TRNA 3U4IA 5THKA 2O23A 4R68A 1YL5A 3HDJA 1ONNA 1VL6A 4XEHA 4BNUA 4UVHA 2EF1A 2OHXA 2JFHA 3U5TA 1OI7A 3JQ8B 3A14A 3DHYA 1LRLA 3LT1A 4Q39A 3TF5A 1MXHA 4R5MA 3RUFA 2RAFA 2ZYAA 3D64A 2PTGA 1LC0A 4E2ZA 2IZZA 3FR8A 4OJNA 1ID1A 1NYTA 4MVJI 2QYSA 4U5QA 5HS4A 2DVMA 3DBHA 4EI2A 4A26A 2E6UX 2EP5A 4IDCA 1D3AA 1E3IA 4EJMA 2C0CA 1GV0A 4QX6A 4GSKA 2C54A 2BFOA 2ZB8A 2FWMX 2Q2QA 3GAZA 1EVIA 2CDBA 4L74A 3NJ8A 2D1YA 4XGIA 7ADHA 2QG4A 5JAIA 4II3A 1NASA 5EIOA 3HE3A 3H3FA 1Z74A 5HA5A 4IUYA 4BO3A 5JY6A 3PTZA 1HDYA 2ZTUA 1VPDA 1YH3A 3BMOA 5CDTA 2VZ8A 1M6HA 3JQ7B 4IJUA 3WJAA 4UREA 1RM4A 3JQAA 3ADPA 4CV2A 3UVEA 3E6AA 4DQUA 5DBIA 3WICA 2HRZA 2IRWA 2Y93A 1Z7BA 5F5LA 2GERA 3QLJA 3H9UA 1FMCA 5DOZA 2WTBA 2HMUA 1BGVA 3VDQA 4L75A 1P1IA 2PFGA 1G6KA 1YB4A 2OFPA 3GZNB 4FC6A 3TDKA 3QP9A 3PYMA 4L4RA 4ONEA 1HDZA 2IE0A 2E48A 4HX5A 2NNLD 5A02A 4AJEA 4CLXA 1ENYA 2Y99A 1CQJA 5L9AA 1Q0LA 5COQA 3RFXA 2D3TA 1GFSA 4WLEA 3VPFA 4OQZA 3TL3A 4E5YA 3AM3A 2G1UA 5AYVA 3ON5A 2NTVA 3BIOA 4PFJA 3WNQA 2UV8A 4OSOA 1BRMA 3GH3A 2RHCA 1IYZA 1JU9A 5G4KB 1PJ4A 5THQA 1WZEA 2QW8A 2O3SA 1EFKA 2VUSA 4CV1A 4EJ6A 1A4IA 1X7GA 3ITKA 4Y6PA 1PZHA 3X2EA 2DT5A 1BTOA 4TKMA 3CH6A 5IG2A 2ZJ0A 1MUUA 1NWCA 3ZWWA 2OBNA 4FC7A 4KDEA 1WAMA 2PKQO 3F5SA 2JKVA 1FDSA 4O63O 2C20A 1QYXA 2WWRA 3ZU2A 3CTMA 3KEQA 3W8EA 4IJWA 5F3RA 3ETDA 1VKOA 3LK7A 4WCFA 5A4DA 3A28A 5B4TA 1MB4A 1UAYA 3PQDA 4YQYA 2DFVA 4DYDA 4EEZA 3B1JA 3VC7A 3AI3A 2AQIA 2NQTA 2QYTA 3DL2A 3EMKA 4ZQGA 6ADHA 1NFFA 4UVGA 3WSVA 3UCEA 1PL7A 4QXMA 1GTMA 4RORA 3L4BC 3RBZA 2PZKA 3SXPA 3GVIA 3D3EA 4Y6RA 1WWKA 1N9GB 1E1KA 1Q2XA 4YA6A 4N5MA 5ILOA 4WCFC 2J8ZA 1PR9A 4BNKA 1BXGB 2WE8A 3WGQA 4RPGA 4CMHA 1QYWA 4UEKA 5JCJA 2CF6A 3WX0A 1I8TA 3PFWO 1S7CA 1X15A 3EDMA 5KVQA 1PL6A 4AJ4A 3ZWAA 4PGFA 1YDWA 3BMCB 4LRSB 4OAQA 4FFNA 4NBTA 3PJFA 2W90A 3H2SA 4HADA 4DQVA 3E8XA 5KVCA 3RSHA 1U7TA 3PJGA 4Q3EA 5T5QA 4BOYA 3ABIA 1EQ2A 1ZIDA 4NI5A 4J16A 1LX6A 4JN6B 4NBRA 4D44A 4RPHA 2X9NA 3RUEA 4AJ1A 4BV8A 1Q7GA 2BELA 4CM4A 4DIOA 4Y9DA 3WWZA 4YAJA 5EPOA 2RH8A 1Y5MA 4MVJD 2BMAA 4CMKA 3ZDFA 1C0PA 4DQXA 4E0BA 1EUZA 3FCOA 1GQYA 1PGPA 3E1KA 5DCWA 1LI4A 3ZWCA 2PWZA 2DQ4A 5JAQA 1HKUA 3LT4A 2GRAA 1QYDA 3IIEA 4ZVVA 5A9SA 1OC2A 2HMTA 3Q9NA 4BNTA 2C2YA 1K0UA 2BFAA 4DPLA 4BHTA 1RYEA 5KWEA 1TT7A 1YS4A 4YRDA 5C3MA 2CY0A 1E1NA 3AFNA 4GI2A 3IQDB 1NXQA 3GT0A 2HQ1A 2ZYGA 3GG9A 4A27A 1IE3A 1Y7TA 4I9NA 1Y8RB 3BAZA 4MDHA 4WLVA 4CV0A 2ZTMA 4AFNA 3ZNOA 1HZZA 3DO5A 1KEVA 2DBQA 2GNAA 3RUAA 2VZ9A 2R00C 1ULUA 4TQGA 3U4DA 5G2OA 3GR6A 3C85A 1BXZA 4B4WA 3IC5A 3RUDA 4WPGA 5JDCA 1PJLA 1T4BA 1YO6A 1ADFA 1WDKA 4IIUA 1LQUA 1PGNA 3FI9A 4ZGWA 4GLOA 2V7PA 3F9IA 1KY5A 4K1LA 5DULA 3CZMA 3K73O 3K5PA 4BO7A 3KYDB 1SBYA 1TXGA 1M2WA 1S6YA 3FN4A 1NAIA 1XG5A 3GG2A 4GX1A 4UEOA 3K92A 3GN1A 2NU7A 5DF1A 3HN2A 4AG3A 1E7SA 4YJFB 4I5FA 1GADO 3PGJA 2ZIZA 4U0JA 4RV9A 4YAGA 4BGVA 4AJIA 2HCTA 3UAGA 1B15A 1TLTA 3UICA 3SVTA 3K6JA 1LDMA 4CJXA 3IJRA 4KUGA 1IULA 3D3WB 4E31A 5K6AA 5KJFA 3IKVA 2UDPA 4IJKA 1AUPA 3E82A 2B35A 1I2CA 4KTVE 4GMGA 1T25A 2UYYA 3ZU3A 4MKXA 4PRLA 1HDGO 5IZCC 2VRCD 1UDAA 1YKFA 4RVSA 3D4NA 4MPDA 3M2TA 4E32A 3GY0A 1B26A 3AOEC 2VWPA 4LVUA 1E7QA 3D0OA 3DZGA 2PD6A 4MJLA 1T2AA 1O9BA 1GAEO 3DB2A 1NHWA 1HDXA 4DIBA 3ZHYA 5IXYA 4IDFA 4NHEA 2WD7A 2B37A 4YXFA 3Q2KA 1U7HA 1N7GA 1JKIA 3PP8A 5KIAA 2VYVD 4PLPA 5F1PA 4K28A 3ZNPA 5JFOA 5JDIC 4BNXA 1W6UA 2DBRA 2PV7A 1E7WA 4YT8A 4YT4A 3B6ZA 2OZPA 2WSBA 1VRWA 2X6TA 4JP2A 1ZMTA 3MJVA 1YB5A 2Q1WA 4RF3A 1QV7A 1HE3A 4INAA 2YY7A 3JQDA 3RUIA 1CIVA 4ITUA 3C1OA 1HEUA 3EY4A 4KQWA 4XQ9A 4RVGA 2UAGA 1UP4A 3GGOA 1PJ3A 3RAJA 2YUTA 3NGLA 4RZHA 2XAAA 4ZHSA 4GAEA 4J91A 2Q49A 3BMCA 2W98A 1EE2A 3DQPA 5IAAA 1GUYA 3WFJA 3RQSA 9LDBA 1JDJA 4FFLA 4NJOA 1VE9A 2X8LA 1PZGA 4ZQHA 1XU7A 9LDTA 3W8DA 1L7EA 1U9JA 1Z82A 4FFPA 1D7OA 4W9NC 1GDHA 1ZEMA 4LVCA 3ZV6A 3ITDA 3E5MA 1AGNA 3PJEA 3RC7A 2VQ3A 1E6UA 3ZCXA 2VRBA 3NDIA 3GAFA 3IP1A 3VAZA 4R9RA 2V6GA 5MDHA 4N54A 4PLVA 4ZU3A 4CMBA 4JJFA 4BGIA 3WGGA 2EXXA 5ES3A 1XU9A 4BMNA 5AQ1A 2JJYA 2YFQA 4Y98A 2PLAA 3GDOA 1YOVA 4NK5A 1C1DB 1ISMA 3SEFA 3ZGYA 1KYQA 5JBIA 3TOXA 4CQMB 1E92A 4DXHA 1UH5A 2BH9A 2W2KA 5T64A 2FHSA 3OJEA 4Z6KA 2P68A 5A03A 4DBZA 3DFZA 3JD0A 4E21A 2C29D 4CL3A 4C7JA 3VOSA 1SO8A 1HE2A 2DTXA 4D0SA 1KETA 3DAPA 3PHJA 4FB5A 4HV4A 1P33A 4M87A 4XQCA 2QRLA 3P5SA 5EQDA 2IEBA 1I3LA 4YAIA 1E1LA 4JXKA 1VJTA 1YONA 4MO2A 1F12A 5HRUA 5JAMA 4JCOA 3W6ZA 4E5KA 5GZ6A 4GX5A 1KIFA 4R1NA 1C3VA 2NU6A 3UW3A 3IUPA 2EJVA 4BB5A 3WB9A 3DAFA 2V6BA 5I7FA 3EVNA 3MTGA 3UGKA 3EW7A 4BL5A 1SEPA 3C3XA 1N2SA 2E82A 3MOIA 1DLJA 4OOFA 3F5QA 1I33A 3WGZA 1D8AA 1P0FA 2ZB7A 2Q50A 4P4NA 5TGDA 2VWHA 1I3MA 2VT3A 3Q3CA 1ZK0A 2IZ0A 1YGYA 2ZCUA 3S2EA 2VHXA 4FDAA 5TJHA 2ZTLA 4BNNA 1A5ZA 2NQ8A 4J43A 2VHZA 3ZHXA 2EV9A 1PEDA 4AJ2A 4E4YA 5FFFA 1I24A 1WPQA 3WYBA 3PHHA 5JE8A 4OO3A 3RC9A 4XGKA 4CQMD 4A10A 1T1RA 1IOLA 4I5DA 4JLWA 1WZIA 3ICCA 3ULKA 4CLDA 3RWBA 4D3SA 5KCZA 1T4DA 4KP7A 3LLVA 4XYGA 4F46A 1H6AA 3JQGB 5DDIP 4YRBA 1DJQA 1EK6A 4RPKA 1YL7A 2IYOA 1HSOA 4EDFA 1WXDA 1EFLA 1EUDA 3ZI0A 2B4RO 3OICA 3FHLA 3FSRA 1Y5RA 2X5KO 2JFFA 4EBFA 2FPIA 5L53A 4YR9A 3ONDA 3U49A 3ZW8A 4QT0A 4I8XA 2C2XA 3JTMA 3PHIA 4R54A 1YQGA 4ZQEA 3BHMA 4NJMB 2CZCA 3HQ4O 5B1YA 3PZBA 3QVSA 4G81A 1DIBA 2JL1A 3QHAA 1XR3A 1UXHA 3WJ7A 3MJ4A 4HBGA 1NVMB 5DN9A 1GCUA 4RL6A 2Z1NA 4Z3DA 1P1RA 1WLYA 4EW6A 3HDYA 4DA9A 4BNVA 3UKOA 2WEKA 3GEMA 1ADGA 4PZCA 1U2GA 1QG6A 3E9NA 3FWNA 4DUPA 5COAA 4RVFA 5BNFA 3DFUA 3JYOA 4J2HA 3WS7A 4IDBA 3NT5A 2HUNA 3MOGA 3GOHA 1KEPA 4J9VA 1RWBA 3B1KA 4MIYA 4W99A 2GN9A 1BW9B 3O8QA 1MLDA 2X5JO 3AWDA 2SCUA 3DZHA 4MP6A 4F6CA 4M1QA 5EESA 1ML3A 4OXKA 4YT2A 3ZV3A 5F21A 5HM8A 1D4FA 1IL0A 1EVZA 3I52A 4CLRA 1M6WA 3AU9A 3EYWA 3I9LA 4RLSA 5AXCA 3O26A 1H0KA 5I9MA 4CMCA 2NVUA 4Z9FA 2WM3A 5TJ9A 4GX0A 3KHUA 3TZCA 4PG8A 1R12A 1F8GA 3DZBA 3QV1A 5FWNA 5IDQA 2EHDA 3BYZA 3LU1A 5GMOA 4BNWA 3AUTA 3NT2A 5HBRA 3L6EA 4GSLA 4ZICA 3GF4A 1E3WB 2JAPA 1T2FA 3HADA 4D45A 3QVWA 4YTEA 2YYYA 3GHYA 5JO0A 4M54A 1I30A 2YHIA 3VZQA 2FMUA 2NVBA 2F00A 1PU2A 1K6JA 1SOVA 2G76A 4PLFA 3P19A 4JROA 4CMEA 4C4OA 4RJTA 5CPFA 3AY3A 1XELA 2O3JA 1LEHA 1EVJA 2FR8A 1C1DA 4W4TA 4NFHA 3F4BA 4YAKA 5KVSA 3RI3A 3WQQA 4GBJA 4GL4A 2PD3A 1O8CA 1M67A 1GPJA 3EC7A 4B4OA 4BQRA 2X9VA 3P7MA 2WJPA 5AOVA 3NYWA 4BKUA 4ND3A 3UUWA 4ROSA 2Q1SA 5KNLA 3UF0A 4NQZA 4DLLA 4QO7A 1PL8A 2PGLA 2WDZA 4OMUA 2VOJA 5A3VA 2FOIA 4Q3DA 5DOVA 4CMEC 4IXTA 2DAPA 1E3LA 1WVGA 3GVPA 4R1SA 2OP1A 1IPEA 4BO6A 2VN8A 5TC4A 1UAGA 2RCYA 4CM6A 1OC4A 2GGSA 3L9WA 4XJTA 2EGGA 3DC2A 1AHHA 2ZCVA 3EZYA 1C0IA 2NTJA 3OEWA 8LDHA 4RF5A 2O50A 3GNQA 3TNLA 1E6EA 2GO1A 3U62A 1LUAA 2OBYA 4GKBA 4NZ9A 4NPCA 2GN6A 3ZNQA 3VH2A 1I01A 2IZ1A 1PIWA 2QZ9A 2D5AA 4R69A 3DOCA 5TSDA 1EBUA 3W8FA 1PSDA 1PWZA 4Z0TA 3L6OO 5HS6A 1GQ2A 2A35A 1CWUA 1FJHA 4BO9A 2O3UA 1T2EA 4HNHA 2X0RA 3EZLA 5I9NA 1E7MA 4XDZA 3Q11A 1U3WA 1PX0A 4YB8A 2EJWA 4PG4A 2I6TA 5A05A 3INTA 3JQGA 1QSGA 1WNTA 3V2UA 2YHUA 4H16A 4WOKA 4CM5A 1DRUA 5AXBA 2CF5A 4YT5A 4FPXA 2P9CA 4F6LA 4BGUA 5TLSA 5TQVA 1GU7A 3BHJA 4ZRNA 5L51A 2NTNA 3OIGA 2B5WA 3K8ZA 5TRTA 1LU9A 1A7KA 4J6FA 3RKUA 4S1VA 1TVEA 4RQTA 4MINA 3RFTA 4YCAA 3U0BA 2Y68A 5EL0A 1VJ1A 3PGXA 5AVOA 3TSCA 1B14A 1VKNA 1WP4A 3CEAA 3DHNA 2ZB4A 2YW9A 4XWYA 4LSMA 2FZWA 1GZ6A 5A3JA 5JS6A 1Q0HA 4HKTA 5TX7A 1EDOA 3D5QA 1Y8QB 1FDWA 3HNPA 2GPTA 3BMNA 1MP0A 3VTZA 4BO1A 3QVOA 4IS3A 4U8GA 4BQPA 4JJGA 1IUKA 2QIOA 4L9RA 1BHSA 1K6IA 1DJNA 5L7YA 5KJCA 3I6QA 2HJRA 3UCFA 5CP8A 2B69A 3L6DA 1B7GO 4PG7A 5DBFA 4DGSA 2A94A 1ZNQO 4F3YA 1TT5A 2B4TO 2OL4A 3CSDA 3GA0A 3NGXA 5C5IA 4DPMA 2PGDA 3WOHA 3JV7A 1QXSA 3DZJA 3S1LA 1Y6JA 4QUKA 4BNGA 3I1JA 3PDJA 4YJHB 4U7WA 4ND1A 3RUCA 5A9TA 5L95A 3VTFA 3TOZA 2GZ1A 4PG5A 2ZQZA 4J4BA 3PYXA 4TRMA 3JD1A 1QLJA 3Q6IA 4BO4A 5KOIA 3Q2IA 5JCXA 1E3WA 1P77A 5IN4A 1RJWA 2UUOA 1RM3A 1SCUA 4GX2A 4PZDA 1GV1A 2HK7A 1XSEA 2C7GA 3KB6A 2AW5A 3INRA 2O4CA 1YE3A 4O1MA 4RF2A 1XHLA 2Q1UA 3PXXA 1LSUA 1LLQA 2Q2VA 1M76A 1KY4A 3OA0A 3AOGA 4P4GA 4GGPA 3NT4A 4RCVA 1U28A 4M55A 1Y9EA 4WE3A 1Z75A 3QA9A 2NSDA 1PS0A 2VTEA 4L8VA 1LC3A 3ZHBA 2PNFA 3B20A 3V1TC 2YV1A 1JTVA 1Q0QA 1DXYA 4QFDA 4S3MA 5FI5A 4BMSA 1ZJZA 1QYVA 4OOEA 2VNSA 3ZWBA 3IAHA 1DSSG 1DC6A 4NBWA 1PGQA 1U1IA 4WLFA 5CEFA 2JD2A 2J3JA 2VTDA 2CVOA 3VPSA 1SMKA 2P5UA 2PKQP 5KKAA 1ZXBA 4NFSA 1QYCA 1E3EA 2R6JA 5DP1A 2BKAA 4W7HA 4J7UA 1DOHA 3PVZA 4D42A 1HYEA 1GYQA 2F1KA 4OKIA 3DOJA 2IXBA 2HLPA 2X0IA 3WTBA 5L40A 4UVEA 5BSGA 1R16A 4B4VA 4BS9A 1LSOA 3KOUA 1FF9A 2D0IA 1NNUA 1B8PA 5EN4A 1DRVA 2I3GA 1SOWA 1G0OA 1GR0A 3QW2A 2GDZA 4B3IA 3OP4A 2VUUA 1BXKA 2R2GA 2XF8A 4TRJA 3OH8A 4IZIA 1NP3A 4XYEA 1CDOA 4IDEA 4CLOB 5F1KA 4Q3AA 1NFRA 4BO2A 4L4XA 4ND5A 1Q7CA 4RPLA 3E5RA 2ZK7A 4XR9A 4RO0A 4XJSA 4PLHA 4WEOA 1WMAA 1U4SA 4PN3A 4XQEA 3U9LA 4DREA 5CG2A 4DMMA 1HL3A 1V3UA 2Z5LA 1OFGA 4FFMA 3I9JA 2HK9A 2HAEA 3HZZA 4BKQA 3NAQA 5DCUA 1YVEI 1KC1A 2HMSA 4NNJA 1B8VA 2Q4BA 3GVXA 3JQ8A 3L0DA 2JHGA 4WASA 4IJVA 2G17A 3I6IA 3L77A 2CDAA 3H4VA 4D0RA 4JQCA 4R41A 1ZVMA 2DUUA 4XA8A 3TPCA 4AJKA 5F1OA 2EEZA 4BB6A 5IF3A 2E37A 1GCOA 4JNKA 4CM9D 1UP7A 4OXNA 2IODA 1DFIA 2H63A 3E9QA 4ESOA 4BGEA 4MKRA 1YB1A 4Q3NA 2ZYDA 3C7CB 1BDMA 4XIJA 1ARZA 4D3FA 3WGYA 1R37A 5JC8A 2Y1DA 3AM5A 1CERA 4H7PA 5DCYA 3VPGA 4FIZA 3H5AA 4IPTA 4A0SA 4EYEA 5C7OO 1H2BA 2JFGA 3OF2A 2X0NA 4IQGA 4M89A 4WECA 4XYMA 3RKRA 1U2DA 5U1PA 1IZ0A 1YQXA 2VWGA 3JQ7A 2JD0A 3DTYA 5JXWA 1DRWA 3K30A 1PGJA 1DPGA 1CF2O 1OZAA 3O4RA 1PJCA 4N18A 4QO8A 2BFPA 4RQUA 1JKJA 3FRJA 3DTTA 4OH1A 3E9MA 5I7SA 4CLHA 5F5NA 5ICMA 1KS9A 4IDGA 1GEGA 3DXFA 1MXFA 4J90A 5T8KA 4Z3KA 2POQX 4GKVA 3GZNA 5GZ3A 4FBGA 3WWYA 3SBOA 3IDSA 4OSPA 2QQ5A 2HMVA 5L4LA
chains in the Genus database with same CATH superfamily
2FSVA 2P79A 4IFTA 1H8HD 1OW8A 2A0YA 2A0UA 1GYRA 2P67A 2WYVA 3G9XA 1N4DA 1DC3A 3IDZA 4WBSA 2I91A 3DLCA 2HA6A 1U8FO 4ZEWA 2XTZA 1MMDA 3CUWA 3R3XA 4UVIA 1X94A 1V47A 1RJFA 4P93A 5CT8A 3QM1A 2FP4A 5BN3A 4C0HA 3NI2A 4K9DA 1FYVA 1VGRA 1SU8A 3NV7A 4CG2A 2DSTA 1L5RA 1YR2A 4PR3A 4D4LA 2BE9A 4EPYA 4H6XA 3HYTA 4C0XA 1T6BY 2WD8A 4NESA 5EUBA 1BYUA 5F76A 3ZXSA 3VI4B 1BXRA 3SMQA 4BV3A 1ZD8A 1K9SA 3K0CC 2VYNA 1PX2A 2HJSA 5DS4A 4D0NA 5CG1A 3LKZA 5JO9A 1ZD3A 5ALJA 1UFRA 1KP2A 1RWVA 4DR1B 2ZJ4A 4IKOA 2WM2A 2Q6KA 2BJHA 1HMPA 1XVAA 4MVCA 1S8AA 2HSGA 2JGEA 1USKA 1JR3E 2W9XA 4YP6A 3AR5A 2GEBA 4DDKA 3FPCA 1OGYA 1QTNA 1B3RA 1L7NA 4ZRDA 1KOJA 4J0JA 3SLGA 2VHYA 1H66A 5GJBA 3NDRA 4LF4B 4U1RA 1DO8A 4D4GA 2F8LA 621PA 1DBQA 4M0FA 3VHXB 2FI1A 4AB1A 1K97A 4M1TA 1NBME 2ZQ5A 2C07A 4C9BA 3PRJA 5K3DA 3NC1C 2XKKA 3SC6A 4TTRA 2QLNA 1GGHA 3W5CA 1N36B 2C8JA 1IVNA 4ALKA 2FW7A 3USCS 5KYVA 3WISA 3ETHA 3D2AA 4G5OA 4Z9JA 3GI1A 3WMWA 3RS3A 2A5FA 4AL4A 5C1PA 1B1CA 4MTLA 2ATEA 4INOA 1WW3A 2Q3JA 4QUJA 2DFLA 4Q7JB 1J06A 2W2LD 2P27A 2FPMA 3GO4A 3JAKB 5C8YB 3LQYA 1J8DA 4R6XA 1VLQA 2VUTA 1Q0PA 4P3YA 1KZYC 1FNTc 1NBOA 4ZYLA 2YNMC 2VTBA 3JQAB 3HVIA 2LFDA 4KK3A 4R3NA 2HBYA 4GVPA 3RSOA 5IDXA 2LR0A 1J0XO 3GA7A 1RHKA 3GJTA 3LJKA 4HDAA 2ZLBA 1QFXA 3FMIA 5AOAA 2OO7A 1EE1A 2JLVA 2VH3A 2EF0A 2JCXA 4I6EA 2QN2A 2O0LA 4CS9A 4K6CA 5BO5A 5AUOB 5T57A 3A0UA 2IEDA 4TYPA 1Z6QA 4BZPA 5K0CA 1NBBA 4QDTA 3ZEIA 4O08A 1VYIA 2XM4A 2CC2A 3OMWA 2QE7D 1U8AA 4LC9A 5E7IA 4RJJA 3WZMA 4DG9A 1RRVA 5AKKA 4NICA 3ZHVA 2DTEA 3EODA 2DWOA 1SRQA 4F04A 4JI0B 2IDJA 2BFEB 2W83A 5CDUA 2JLCA 1WETA 5EXEA 4CMIB 5HZGA 2WJIA 1OI4A 4QUHA 1L7QA 4CF7A 2LXNA 1KXJA 4G7OF 3RTEA 1H2RS 1K8YB 1OYWA 2B1RA 3VM6A 3SC2B 3IPRA 3SJAA 1IY8A 1JKMA 3A6EA 2FF7A 1D0VA 1MC1A 4L8GA 4F7WA 3K16A 3E3NA 2P0AA 2NSGA 2Q3HA 1BMFA 2AQ8A 1P1JA 4H15A 2OB2A 3QU4A 5HUJA 1O97D 2HIAA 2PX5A 1QH8A 3UQYS 4CF3A 1E89A 3EQ7A 5SY6A 2ORVA 3KAPA 3PCRB 4YUVA 4L51A 5CLFA 2KE5A 2EILC 3OZDA 2QENA 1DZIA 3A1WA 1YDEA 3LECA 1JHZA 2TMKA 1UAAA 5CJJA 2QQFA 1E5QA 2VDQB 5IJWA 2ERYA 3EWNA 4YRKA 4F4IA 2LBPA 1JRAA 9ABPA 1VBKA 1RC8A 2K7FA 3TMYA 2XODA 5JS5A 4IIBA 2J9VA 1QDEA 5KNCH 1XRNA 1GD1O 3QU7A 2VP9A 2R85A 1LXCA 2HR1A 3LOQA 1ZMOA 2ZS7A 1KJQA 2HREA 3L34A 3EEQA 4Q02A 2WWIA 5I7AA 1KI6B 5EEGA 3NVKI 1T2CA 1YOVB 3H5NA 5EPUA 3WAQA 1YR3A 4PEVA 1ZSNA 2W2KB 1XL0A 4QJ3A 4BPMA 4XX0B 5ES4B 3QVGB 4HDMB 3P2YA 1A2KC 2XNDA 3IOYA 1A5BB 3CZRA 5H3HA 4W5RA 2DFPA 2GWRA 3JYQA 2RGYA 2BTQA 3BTOA 1E64A 1QIKA 3DLAA 1ISHA 1KI8A 1KY3A 3CO0S 4PZUA 2C5FA 1B6RA 5E9AA 2IY8A 3P26A 3N74A 3L18A 2WE7A 3IO3A 4KLZA 2Y4NA 4JJIA 4U7HA 4PAOA 3DDUA 2BLLA 1CRLA 1P9WA 1QQ7A 1Q83A 4O6YA 5A5FA 1KVUA 1JWBB 1NAHA 1FSGA 5TY0A 3ROZA 2C8LA 3N5CA 4FT2A 1W581 3KWJA 1SBIA 1BJRE 1Z5WA 1TF5A 4O5AA 1U0JA 2R8BA 3CRMA 2LVBA 4GQBA 1QS0A 5FD8A 1YA4A 3AHFA 4JJ7A 3O47A 1TQ2A 3IHUA 3KPVA 3KXLA 1R74A 3NAZA 4K6FA 3I62A 1L5HB 1GGFA 1H8HA 5JYDA 1ECJA 4FM9A 3EPKA 1KJNA 3RTAA 4V3CA 2CVQA 2G82A 5KQGA 5SZHB 5C32A 4RA9A 3FPHA 3COSA 3NWBA 2WMOB 2Y8EA 1NKSA 3DCYA 2ZXOA 4PX9A 2XBMA 5H70A 1TKNA 2HDOA 1P81A 2EEPA 4MVQA 3A6JA 1ZK4A 2Z8XA 1ZO8A 4OB8A 2CFSA 4LF9B 4UUMA 1FU7A 3RD5A 1YOBA 3ENZA 1W44A 2XTNA 4ZKEA 4YYEA 2ZULA 3KT6A 2PYDA 4DV4B 5KJEA 3OQBA 1NXSA 4WDRA 3AJMA 1IB6A 1OW7A 3RVLA 3IE0A 5A6SB 3KM0A 1LJ8A 2P9JA 3DQQA 2BSXA 2VDMB 3OZ7A 2VJLA 1RAAA 3WKEA 3FJOA 4M9XA 4Q7MB 2PA3A 4F92B 4OHFA 3TVDA 4YFYA 4E03A 1BR1A 3O7WA 3P4YA 2EFGA 4EFNA 2FPSA 4DA4A 2ZRJA 2XZPA 4UD2A 4C6HA 3ROMA 1IPFA 4KQ1A 3T4RA 4ZLDA 4XPXA 4KI2A 3C63A 5C4GB 2CB9A 1L5QA 2OKGA 4NBUA 1DDIA 3LVQE 5MGBA 4OK5A 1R4MA 4QL3A 4WLUA 2VF2A 2A84A 2AUMA 4KPUA 4KYUA 5AKYA 3V42A 3DZAA 1JR4A 1MFZA 3L93A 1LK7A 1GCIA 4O2AB 2I76A 5TGZA 2GZ3A 1E79D 3EDCA 1SH7A 3SS8A 1Z4JA 5ITZB 1AA6A 4KFRA 4B34A 1CP2A 3OEED 5LQDA 1W88A 3FHDA 2PA0A 1AKQA 3OZXA 1U7OA 3SLKA 5BNZA 4REOA 3RS4A 2G1KA 1JEQA 4KGDA 3NKFA 1IRIA 3WYEA 4X45A 1J6UA 4ACBA 2BD0A 4MWBA 2Q4OA 3E9RA 5SZIA 2L69A 2GARA 2W2LA 5DXFA 4BQEA 1XA0A 3Q9UA 1OJLA 1U8EA 3NEYA 3IVGA 5HTOA 1U7WA 1TI7A 3VDMA 1YVPA 3L8ZA 4QBIA 4Z9BA 7YASA 1YBVA 3H2ZA 1Z5ZA 1T43A 4J29A 2ZSFA 1N2HA 3CUEF 5HJ7A 4J7YA 1SXIA 4Q39A 2VF7A 3KPWA 4PO8A 3FR8A 5BT8A 4MVJI 1M5TA 4UNQA 4IDCA 1PK8A 5LQUA 1XB2A 4EJMA 4ZZ3A 1P18A 3O8DA 2R7WA 3G8CA 3FPEA 1L0BA 5BWBA 5AICA 5EZQA 2H8AA 3BMOA 1O77A 4R1OA 5FJIA 4UPDA 2XT6A 2JD3A 3D3KA 1E2XA 1FMCA 2WTBA 4MXDA 1PZMA 3EXFB 4PTZA 3BIWA 1P1IA 3DFKA 4KW7A 3AGUA 2HSEA 4X94A 5A02A 2CLSA 5JSUA 1Q0LA 1HQYE 4MWZA 2QE7A 2BMVA 3ESRA 1SULA 3PR1A 4IGGA 1C9MA 1AK2A 4ZDKA 4Q9DA 3HPQA 1A4IA 2QM8A 1JQJC 4XGRA 3A2LA 3U3FA 2JKVA 2P7IA 1PFQA 2J9ZB 2V97A 1HE1C 1RWWA 1UAYA 3U2LA 1UANA 2Q5CA 3RBZA 2GZSA 4G26A 3UG6A 2G3YA 3GJRA 3GLTA 4DMHA 4N5MA 5BRAA 3ILVA 1EJ2A 2NZ8A 3P9PA 4N7JA 1GAJA 2EIJC 1ZH2A 4DB2A 2W90A 4PS0A 1NJFA 2P77A 4KN8A 1WSWA 4DXAA 4JR0A 4DIOA 4GQHA 3VYVA 4JR1A 3V4ZA 5IAGA 2AOVA 3M6LA 2Y3IA 4F2PA 3WI7A 1VZ2A 1LKZA 5HRCA 4QUIA 2VDRB 2DMRA 1TT7A 1NW8A 3R9XB 4QVGA 3H4MA 5ARDA 3B9PA 5DBOA 5ILQA 1LQ2A 4MDHA 2GNAA 1G5PA 2ORIA 4TQGA 4UUAA 4WPGA 3DCNA 2J3DA 3EN0A 2DZDA 1WDKA 1W5TA 3E4DA 1Y7IA 5FKJA 3AG2C 3GJXC 5TV2A 1M2WA 4V1CA 2IUTA 2QE6A 2HH9A 3COYA 1ZR4A 5KNDH 3SVTA 3CONA 4KUGA 4DY6A 4K9QA 4D92A 3CSSA 2H65A 3I45A 3EEFA 4ND6A 3GODA 1WB6A 1YDHA 4CXMA 3GWZA 3MS4A 4NHEA 2WD7A 4GYWA 4I50B 3HY4A 1H3EA 2A5LA 2P61A 4H6PA 1J1IA 3AEQA 4HVCA 3RUIA 2H7XA 1N5MA 4XFKA 4UM5A 3ONVA 3RAJA 3HXTA 3S7TA 1JP7A 3SWWA 1KSFX 4QJ4A 2VTKA 3F7TA 3OZBA 3UANA 4D8VA 3OT5A 2ALJA 3WHKA 4CI0B 2PSHA 2FVYA 3RC7A 3DO8A 2J31A 1JLSA 1GT91 3ESZA 4UARA 2YFQA 2IX9A 4L4YA 4CQMB 1W46A 5AP9A 5DI9A 2FHSA 2WIFA 1ILEA 2NSFA 1R0XA 1Z2EA 4FR0A 5K1ZA 2H2AA 3RM3A 3P5SA 5K2MA 1F12A 3AVOA 4FMPA 1Z6YA 1ZJ6A 1Y33E 3LUJA 3H0EA 2WUFA 1QH1B 3WB9A 3DAFA 1I7DA 1NJ8A 2J3LA 3WYAA 3LY9A 1WZNA 4I8IA 4UM9B 1CY8A 2MDTA 3NVMB 3T15A 1PEDA 4JSTA 4MW2A 3O6VA 2Q7OE 5CFMA 1HT1E 1DJMA 5KCZA 1L5ZA 3WGJA 2WT9A 3C45A 1E84A 1ZC4A 1ONSA 4YJKA 2J9UA 4YMVA 1WXDA 4P9FA 4LTMA 1KH2A 3UB3A 4F96A 4ZQEA 3FOCA 3PZBA 1SCDA 3P9YA 4IW3B 2R4UA 2QN1A 5EJ9A 2WJ6A 1Z0ZA 1OX5A 1I6WA 4FZRA 1RWBA 4TKUB 3DZHA 2X5JO 2SCUA 4H0NA 1YGPA 4Q4LA 4ZC8A 4ETIA 4K3VA 2I34A 1W4AA 3I52A 1U3GA 2WMNB 5AXCA 5CURA 1V1MA 3X1WA 4DIKA 5IDQA 1TD1A 2IEIA 3UAZA 1JHVA 2I2XB 1CVRA 4ZCPA 1CPRA 1N5IA 2XGGA 4ZCIA 2AX3A 1TQ4A 4CMEA 4PLFA 3GGJA 2WJWA 1EVJA 2R8XA 2VPPA 2FX3A 3E9DA 1J9GA 1SK8A 1SHKA 4JUIA 3L79A 4OX9B 1F2UB 3UF0A 1UWKA 2VATA 4PZPA 3NVDA 1XLWA 5K3FB 2PS1A 2GS9A 2ATXA 3PNLA 4TM8A 1HV8A 2W5UA 3RW0A 3LIPA 3OEWA 2I6SA 2Q00A 3KPHA 4O4JA 3TUIC 4CF4A 1T6ZA 3SYTA 5G1NA 1YFLA 3ZGOA 1FJHA 1J8FA 4HNHA 3EZLA 3E61A 4MJXA 2GK4A 5AVJA 2PO7A 3UMSA 2I6TA 5JV5A 1MO6A 3C8GD 3DDOA 5KEIA 2YHUA 3AEUA 2ID9A 1T91A 3RVJA 4YCCA 3ZLVA 1EXDA 1QCCA 3FLBA 2BFDA 2VPIA 3EFBA 3PFHA 4HGQA 3S68A 1R8XA 3CEAA 4OFXA 2M1XA 4OM7A 2I7VA 1YHZA 1E79A 4L0DA 2WZBA 3QVOA 3P9KA 4JJGA 1HTWA 2PMEA 2XVZA 3OEEA 1GM5A 2MYPA 2W2PA 3UCFA 1SYQA 3U2QA 1IG0A 3HU2A 4P32A 3M6XA 4DM7A 2V3CC 3TLGB 4X6XA 3CW9A 3AVYA 1FDRA 3Q6IA 4BO4A 4XOUA 1M2KA 1SCUA 2GBGA 1IJEA 1YMUA 1AKRA 2R60A 4ACAA 5ECWA 4RF2A 1XHLA 1VLVA 3ANTA 3CSUA 3OA0A 3U48A 3VVMA 4P6VF 4LJ4A 4BC0A 2QTWB 1K7XB 1WMSA 3GXBA 2VTDA 2VSXA 4N5IX 2HY7A 3NONA 1RYFA 2WTAA 3L6CA 1DOHA 1SBZA 2HCFA 2O05A 2PUWA 2WF6A 3TKAA 4Q7KA 2GXUA 5KS2A 4L5BA 1VJGA 3L04A 1PJRA 4DAOA 3LRPA 4MB2A 5M7EA 2HM7A 4RMGA 1MAUA 1E2NA 2Q3DA 1OI2A 5D00A 5GGXA 3ADKA 3ND7A 2I87A 2C9CA 2VR1A 3N59A 2A69F 5AGFA 4MS4A 3MJHA 2I7DA 2J9FB 1EFVA 5EKXA 2R7LA 1KAGA 3I6IA 3H4VA 4O4HA 1G2PA 2QXYA 2BHRA 3W2WA 4PHCA 4C7OA 3ZTYA 2RHBA 4U7DA 3RREA 4C6RA 4IPTA 2JFGA 3RKRA 5U1PA 5AW2A 1VDMA 2CJXA 2CCKA 4WHMA 2G77B 2Z6UA 1Y3DE 2D7CA 3B1VA 2VIIA 4Z3KA 3AVVA 3Q3GE 2XWPA 1JAIA 2GAAA 2JEZA 2ZQYA 3CUKA 1OXBA 4RD4A 1LTKA 3DAOA 4IOMA 2X7XA 1RYZA 4A0QA 2WTNA 5JDCC 2YN2A 1XL1A 5K4HA 3E18A 3AM4A 3FTQA 5J4YA 5M29A 3II6X 2Q0QA 5GV7A 4UEJA 4WI1A 1ONPA 3HA2A 3FHTA 4JZYA 3AUSA 4KDRA 2NV2B 2GM5A 2Q0XA 3QU2A 3TR5A 2XUZA 3TLKA 3S44A 1X14A 1YVIA 2J3HA 5SY9A 4KKVA 4EFLA 4CUKA 4XZ3A 1X7HA 4JBIA 1Z7EA 1A9ZA 4BNIA 1RWNA 3H2YA 5GTDA 7REQB 3Q7LA 4KVFA 5EHNA 3QVJA 5JISA 1NUAA 4YP1A 1H9TA 4NARA 4MVJG 3VHRA 2C7QA 3G2KA 3OIYA 4RM2A 2A9VA 5EE0A 2W11A 1W4ZA 3A6DA 1VYUA 4A4DA 4EIYA 4L08A 2ICWG 5JSZB 1KK3A 1RKXA 3ZQVA 1H22A 4H4CA 4MQUA 1OH6A 4ZN6A 2R1VA 2V5UA 1YCGA 2O9XA 4UMFA 1G1AA 5JTUA 4QTZA 3OIDA 2CXTA 3UXHA 5SZKB 5ICSA 3RGWS 1RKUA 2A1UA 1L1FA 1F20A 1QH0A 3OSUA 1EVLA 1NR5A 1TA9A 4TUYF 1J09A 4ALIA 1YRAA 5AVZA 1AGRA 4LDPA 3ZDEA 4MYHA 4UMDA 3OJ0A 1TGVA 4YX9A 2H6EA 4OYRA 1AS2A 4RANA 3OZAA 4YCJA 3EPPA 2Z9DA 2COKA 3RS8A 3GCDA 3DLTA 4JKIA 4EELA 5PGMA 2F8TA 3X1ZA 2XCRB 3AUJB 3BK1A 1LVGA 4DWVA 2ZI3A 2LDXA 1PDWA 1JU4A 1SVUA 4LMAA 1J1ZA 4ZVPA 4NFYA 4ZZ1A 1A77A 1R27A 4UQOA 1SA0B 4KGZA 3EARA 3G9QA 5KU1A 1YFKA 4CIHA 1U2GC 4ISBA 3MYIA 4I55B 2GSDA 1VPVA 3C6KA 5JSQA 3TLCA 2FDRA 3GRPA 4GXQA 4PYRA 2O52A 3ZE2B 4M3NA 1T6IA 3HBFA 5A06A 2DFDA 1UP6A 4FILA 3T61A 1E3JA 4PLYA 1CQJB 4ZTZB 1R6XA 4MUKA 4WKOA 4PCVA 2QN7A 5JQWA 2ZAIA 1TAUA 1HORA 5KWIA 4FHDA 4QOIA 5FOSA 4FCWA 1M0WA 2ZGVA 2ILTA 1TKBA 4JLVA 3TQTA 1R0CA 1YIOA 1JE1A 3E1GA 4YIHA 3C43A 3Q40A 4F5DA 3WLOA 3KYIA 3ESXA 3LA6A 1ELOA 5JSHA 2OZVA 3H2IA 3PHF2 4RWEA 3EGVA 3GLFE 5BUCA 2MCFA 5IM5A 3VVBA 4OYLA 3JR3A 3IVRA 2NMVA 3CX7A 1YA7O 4TZTA 3AVWA 3FYHA 2QXTA 2I22A 4OHOA 1MABA 4UUNA 3K8OE 3R8CA 3Q87B 1WQ3A 1JBQA 1GRVA 1D6SA 1T0JB 5JOQA 1ORHA 4PVDA 3FYDA 4IILA 4Y1RB 5A6BD 1M5UA 2CLHB 1PR1A 3HY6A 5ALIA 1I3OA 1IY2A 5GGYA 1O08A 1WV0A 1O54A 1PNVA 1HF3A 4CI9A 3LQ2A 3HBNA 1NJ5A 1WPRA 4QQNA 2A57A 1TC1A 5IAEA 5CIYA 2X1VA 2PZJA 4HVLA 2KM1A 2QN6A 3WQRA 4A91A 3EZ7A 3C8GA 2G63A 3RQFA 3PZRA 2OBLA 2FMKA 2NUBA 3N7TA 1HWYA 3TRFA 2RK6A 2HN9A 2B0JA 3UAXA 4B3FX 4CKWB 4X7RA 1S9DA 4M49A 2SECE 4G78A 2I33A 1U5BB 2ZIXA 3OQPA 4HSGA 4FGSA 3S1SA 5AM3A 1RW4A 1ZM2A 2X8AA 1U2ZA 1RQ7A 1A8SA 4BE9A 3LPDA 2P4HX 4LF5B 2W71A 1W6RA 5H82A 1H6BA 3FA2A 4TS3A 1N25A 4HNAB 1KYVA 3ET4A 3WGUA 4U6NA 3RVNA 3EDRA 5LMUB 3PD7A 1FRQA 3N76A 1UK7A 1J8QA 1SC4A 4JLKA 2IYEA 1VE5A 3OEHA 1COWD 5JVDF 1FP4B 2CYAA 2XMDA 3E35A 2B83A 1HRDA 3BPSA 3I01A 5ER9A 4PPYA 3LQKA 1II0A 3RDPA 1HLGA 1W5AA 1Z83A 3QIVA 1RWKA 5CFQA 3NTOA 3UNXA 3EXHA 5T4FA 1P5RA 2EAUA 2Y05A 3AFMA 2AWCA 4DARA 3STYA 1BA3A 2AJCA 4X7MA 3I6BA 5J47A 3HI4A 5HV9A 1OLOA 3HDQA 3R3SA 2P0NA 4G09A 5C52B 1GRNA 4W8HA 2FPIB 4OHBA 2OILA 4U8HA 5BUQA 4B46A 2Z95A 1T1IA 5KPDA 4BAGA 4OHWA 3IXMA 1UFQA 3EC2A 2C2BA 3B29A 4ER7A 1VE6A 1U99A 2UZ1B 5DO9A 1WS6A 1SR8A 1SHUX 5KYWB 3IMFA 3FCYA 4UUPA 1N1GA 4BFXA 3RJTA 3IVMA 2GAOA 2C3YA 2BR3A 3KLPX 1N0WA 4I9HA 4ZHQA 2W2MA 2QX6A 1XZDA 5ERGB 2QTAA 3EH1A 3MCUA 2BKUA 4XB6B 1E8MA 4HRYA 1RXCA 5COMA 4HAOA 2DUNA 2PD4A 4IQ4A 4LJ6A 1H5QA 4AKHA 4A2CA 4GNKA 1WUJS 3DBLA 1NUUA 3GJ5A 3JQBC 3KVVA 4ZP1A 2K2QB 3DP7A 3SKVA 1P0IA 1U4OA 3GJ0A 4KO1S 1JIVA 1FA9A 1Y6RA 2L7AA 4RKYA 4XIIA 5DW3A 2GYUA 2FEPA 4N0EA 3I9OA 1POXA 1T9GS 2EJUA 1HDOA 4CHGA 1A8PA 2MSKA 4BNJA 5JAPA 3G49A 3L7LA 1JFLA 4OI1A 4IRMA 5B6IA 1JLLA 2Z4SA 3T5AA 2AF4C 1CJCA 4ZDJA 4H1VA 5JY1A 1UMDA 3JW8A 1YVDA 1RIIA 4PO1A 5CK5A 3TLJA 1EMDA 3B0VC 2EJTA 3HGMA 1FDUA 2J41A 5JNUA 1FL9A 2EW2A 4RDHA 3VFDA 4OCZA 4J7XA 1W5FA 4X1IA 2EQ5A 1KJ8A 3BMNB 4O5OA 2AN5A 1X8JA 3OHPA 4WK6A 5A4IS 3V48A 3IQZA 3R2PA 4RUKA 1G3MA 3VYRB 2XIQA 3DT9A 2YIMA 3WQSB 3MXTA 1HSZA 2PLWA 4JVNA 5IJXA 4B6IA 2YFKA 2B8TA 2XMRA 2Q5QA 3HKBA 2PL3A 1OH8A 3EIXA 4YIKA 5C80A 4D6XA 1IBSA 4X1KA 5IUNC 3FWPA 2E6KA 4HXYA 4ZOQI 3CEXA 1QX3A 3SS9X 1OBHA 2OQIA 4CMJA 5T3TA 2W6PA 3A1DA 3IKTA 1S3IA 3UHPA 5C51B 3O1JC 3NDPA 3QSYA 3IOMA 4BBZA 2XDWA 4F9EA 3QYJA 3GRVA 1U3VA 3SN6A 3IAM1 3KR0A 1UKYA 2Q3EA 3PKJA 1QANA 4KWEA 2VKQA 4N49A 1EBFA 3FLAA 3A6ZA 4EG5A 3OY2A 1SVSA 4LYYA 3H83A 3N7UA 3L7NA 2IFTA 1XN1A 4HK4A 2EDCA 4DHWA 5IANA 4AZ3B 4XB2A 1DBRA 2FN4A 3TJZA 2VAPA 3VX4A 1L7OA 1QK4A 2KW5A 5CH8A 4C4ZA 2F8SA 2EPOA 1GUDA 3JRMO 3DWIA 5JJKA 3A14A 2CFOA 3V9PA 1X80B 2IZZA 2QG9A 4XWWA 1NYTA 4U5QA 3D6HA 1ZL0A 2R7AA 3B0UX 4YXWD 4ZU1X 5EIOA 4XX1A 1GL9B 1R6AA 3UVEA 3VOBA 4GZ5A 2H16A 2Q6OA 1ZRMA 3P2JA 3GLFB 2GERA 256BA 1DI0A 1D5CA 4N8DA 5AVXA 2VJAA 2OMKA 4GRAA 2MSCB 5CYOA 1O57A 5JMOA 4BATA 3H1TA 4GT1A 2YC2C 2GPSA 5IYZB 2UV8A 2GFIA 5K03A 1FP6A 2X6RA 3G2MA 2ZAMA 2DT5A 3L8MA 2ZJ0A 2OBNA 4J94A 1UBNA 3JRWA 3VPBA 4R40A 4D4XA 2AMJA 3WVNA 4DV1B 5ARCA 1AC5A 3PQDA 4WY2A 4I4TA 3EVGA 1DINA 2AQIA 2QYTA 4I3GA 4YPFA 4EW3A 4BPBA 3JWPA 1GTMA 3SPXA 1TK9A 2FYTA 1M1YB 1VP3A 5A6BA 2PXCA 2O8EA 2ZJ7A 1X1QA 4OJYA 3WGQA 1L5LA 4PYQA 1Q3HA 1HM5A 3VNQA 5E0OA 3H8WA 3FUCA 2X4DA 2OYCA 3IXLA 1IHDA 3ZHRA 4MK4A 3B71A 4AIRA 2ZXEA 4U2DA 5JXGA 2Y2VA 4MW8A 3N2GA 1FSSA 1ABEA 2WFZA 5A9SA 3QU5A 3THXA 1K0UA 3LO8A 1JMYA 4EL0A 3I5UA 4QWWA 1GGKA 2VEDA 3LS0A 1SZDA 3GQBA 2PT5A 3VU0A 3CZCA 4P4SA 1R5BA 5JU6A 3C85A 3HPRA 5E1OA 1T4BA 3FI9A 2JFBA 4B84A 1MH1A 2Q3BA 3ZW7A 4R2MA 1V8ZA 1JR2A 1HURA 5F78A 3VO9A 5DLEA 3O8LA 4RV9A 3G7NA 3C3YA 4LFAB 1M2HA 1FR0A 3BGOS 3D3WB 5KJFA 2WSSD 1YZTA 3I2KA 3E82A 5G3YA 1JPJA 5ECDA 2AYZA 1JHPA 4Y2XA 3M2TA 1MRSA 4ZZIA 5JYBA 2YOFA 1T2AA 2PZAA 4HN4B 1K66A 3UWSA 1FSZA 3ZNPA 4R2LA 4W1PA 4KXQA 3S7ZA 5BN5A 3JY6A 1IQRA 1J0EA 1IC6A 4R8KA 4UCFA 1Y1KE 2GJSA 4NCHA 1OXTA 4E6EA 1QV7A 3JQDA 1CIVA 1COWA 4L7VA 2WWWA 4KQWA 4XQ9A 1W52X 5C2JB 3W05A 2FG5A 1I6KA 1QE5A 3K1IC 3U7GA 4I14A 4BJ3A 1JDJA 3VRHA 2Z2YA 4DUGD 1K40A 2PFDA 4PGMA 4XVCA 2FUG1 4ZU3A 4CMBA 3BSYA 4IUCS 1KIAA 5L0JA 4IEIA 3T52A 1KYQA 5JBIA 2AP3A 1GAXA 2P68A 1TYBE 1OLUB 5CX1B 5FBVB 3VOSA 5DLPA 4B3RB 2XB8A 4YJ2B 1E20A 4OF4A 2QZSA 1KE1A 5CVDA 4JV5B 1UK9A 4Q4ZF 4G9EA 3TM5A 4NV1A 3IGFA 1ECBA 3ET5A 5ALXA 2XCQA 4R2XA 4IV8A 2PYIA 4WXPA 5TJHA 4BNNA 1RYYA 2ZT8A 2EV9A 5HHTA 4QT4A 4CEHB 4BLTA 1T1RA 3ICCA 5EIXA 1N2BA 3R7DA 4KVZA 2HJ3A 3RHTA 4YREA 3B5IA 3ZI0A 2X5KO 5H4HA 3LP6A 1N77A 3S3TA 3RV3A 3ZE0B 4TMVA 3LLUA 3JTMA 3BL6A 4XSVA 1GA6A 1Q5PA 2AJ8A 3FOFC 2XT9A 4QICA 2QNBA 1P1RA 3LRXA 3OQOA 3MF4A 3ITNA 3ZBTA 2G70A 4YP7A 3E70C 5CM2Z 3O92A 5HCUA 5CVUA 3V8NA 1KEPA 2PQ2A 2P1AA 4KFUA 3O9VA 4RJKA 1VE3A 2FSPA 1P0QA 1H3FA 5FTWA 1HE9A 1DAMA 3GB9A 1XBTA 1YCFA 2V96A 4BNWA 3L6EA 4GSLA 2JAPA 1J42A 3HADA 2PFSA 1VIMA 4FBMA 3GHYA 3T7DA 4BP8A 1YZUA 3EJ6A 1ZVJA 3OM0A 3AY3A 4U3JB 1XDBA 3DMGA 2DP4E 3FROA 3DLPX 2Q1SA 4WMLA 4J0CA 3NYLA 3M0EA 5A3VA 2OCPA 4BO6A 3TEMA 3DCIA 1U98A 2X7JA 5EXDA 1VYVA 1SBQA 5JT1A 1N7IA 2FEKA 4B81A 3N2LA 1E2GA 4R1LA 3X2SA 2D5AA 1QIIA 2QVZX 1ZOIA 4LRQA 5TSDA 1EBUA 4KREA 3FGPA 4L72A 2Z4TA 2D4UA 2B30A 4BO9A 3IB6A 1US8B 4Q4HA 4B0PA 2X2FA 1WA5A 3QPVA 1NFNA 3I6ZA 2ZRMA 4IHJB 4JKOA 1RAHA 2VYCA 1V7QA 3RFTA 4HDNA 1ZNWA 1ZINA 4DMFA 4F4BA 4X20A 3WLJA 1MVLA 3OIUA 2IPAB 1NOIA 2VP6A 3MINB 5A3JA 4NZZA 1ODJA 4JUCA 4CSAC 1TQ8A 5L7YA 2R2AA 3PF8A 3T3DA 1GCAA 4K6GA 3Q6NA 2GA8A 4FYJA 2GT1A 4LJAA 4LXYA 5JJIA 1EFPA 3BH6A 1V41E 4DEVA 3Q0TA 3GFPA 4PHTA 4BZWA 1E66A 2XQFA 3AETB 2C4MA 2C7GA 2XNHA 4ONSA 1ZM3A 2QKYA 1GJRA 2G9ZA 3I0MA 1D6NA 4LBYA 1D1CA 1A1SA 3D02A 2AKYA 5E8JA 3LHIA 5HKLA 4G8JA 1U1IA 2H7CA 1ZD4A 2HI0A 3M1YA 5E9JA 4YAWA 1MB2A 1ZZPA 3WNZA 2IXBA 1W93A 5F28E 4WACA 2AGVA 2V58A 5GAJA 1YKSA 3ACDA 1VOTA 4YXWA 2E7ZA 1NFRA 1NNLA 1DMSA 3E5RA 4UZEA 1OXXK 1WBBA 3WP0A 3U9LA 5ALRA 2Q7XA 1PR6A 1PNQA 2WYHA 3BRCA 1Y8ZA 5IBQA 4LDJA 1V74B 1YVEI 2BDEA 4WK2B 4JC0A 4UMEA 1ZU5A 1B8VA 2W6QA 3WGVA 2R751 4JLOA 2BKLA 2P65A 4WZZA 3SEOA 4H35A 1FPMA 3DYIA 4H7PA 4J6EA 3VPGA 4XYMA 1UC4B 2X0NA 3U3OA 4JVLA 2CW5A 4JU9A 5FHQA 2JD0A 4FZJA 4LI0A 4JQSA 3DTTA 1U0RA 1QAOA 2QW1A 3SHQA 4C3ZA 3W04A 4TPKA 2G9QA 2POQX 1QLWA 4QDJA 1UPUA 1WD5A 1NMZA 5FL7D 1XHEA 4C21A 1P74A 1NXVA 2B20A 2GD0A 1V37A 1XALA 2X1HA 4ALJA 3UFXB 1W2WA 4LOKA 2PWAA 2YCBA 1B8OA 3CZ6A 4MW9A 3W6OA 2RAVA 3LUBA 2C5AA 4HGOA 1OROA 1FFYA 1P7YA 3PDMP 1K5GA 1Y80A 4Y2UA 1NNI1 2X4IA 1FLAA 2WLTA 2C1EA 4DXDA 2XNCA 4W1SA 2IEAA 4YUWA 4Q3KA 2ZAYA 3QXJA 1H05A 4NP6A 3DONA 3SJBA 3DZFA 5J58A 4X62B 5IZ4A 2J46A 2AHRA 3CLSD 1V3TA 2R66A 2FCAA 4JT4A 5CLHA 3S84A 3VVCA 4BQIA 4PSVA 2J5KA 5E7MA 2G8LA 2REQB 5IFLA 1NW6A 4YN0B 4WERA 1F2DA 3HHPA 3EIUA 2AEJA 3ZN2A 4KFSA 4DY4A 3ZWMA 1AH2A 2WSSA 2NXEA 2F1JA 2YDXA 1ZR2A 4EGSA 3L0IA 1WE2A 2ZUWA 3L1UA 1C0LA 4V2IA 4RK4A 3AJ8A 1JG6A 4EWLA 2GPJA 1EI7A 1QHFA 3BIFA 3K9BA 5E6SB 2C9BA 5ANRB 3IH5A 5AJTA 1O1YA 1F8YA 4WGGA 1NU9C 4FLMA 4PNZA 2CSUA 3RSZA 3K5IA 3RHFA 1E2MA 2A30A 3FTCA 2BL2A 1AQ6A 2CUKA 5J2TF 1GUBA 3IDQA 3GRCA 3IJPA 4DUGA 1WKVA 4RSRA 5CH3A 2DUWA 5FWYA 1X3SA 1DBSA 3V4OA 3UUFA 5GOZA 4YRFA 2WG1A 1LWOA 4EHHA 4FHGA 5AXAA 3N2KA 3PIIA 4TLEA 5F35A 2HJVA 3GFSA 1YJ8A 4JP5A 3F6YA 4QU5A 3EDYA 1RXSA 4Q3LA 4B80A 4R2WA 4R8VA 2VJQA 1HYHA 2Z98A 1E2KA 4ZREA 4GC5A 2IDZA 1J39A 4EAQA 5D3ZA 3UK7A 5CH5A 2WA1A 3MNFA 1YJCA 3D6FA 1SKMA 4KTTE 3IIKA 4QQKA 3T9FA 5G40A 2C1XA 3NHRA 1MR3F 4UHHA 4IXNA 4YCBA 4PXYA 4BO8A 2QMHA 4AU1A 1G3UA 4RD2A 4LJRA 2Y69C 4UCXA 3EHNA 2W8ZA 1Z23A 2DETA 3L0SA 3KX2A 2A68F 4G2NA 5LL6P 5J2UA 3DULA 2QRVB 3RWOA 3GRAA 2BHLA 2IU6A 4XDGA 2R7UA 3O2QB 1C3XA 4WCFB 4ZEOA 2WFLB 1LA2A 4DCSA 2FR1A 4QI0A 2IF2A 3IVXA 4YCSA 3LS1A 3EPRA 3PKIA 5HILA 3VA7A 3SZRA 3CMCO 1ODTC 2Q45A 1XMOB 5C5DA 1JFFB 1G4HA 2H1LA 1SCIA 3K5WA 1NG1A 1JIJA 1NW5A 1B0AA 1W5BA 4BJ6C 3C6BA 4MW5A 1EU1A 1L5VA 3L4JA 4LUCA 1ABBA 3VHLB 2IK8A 4JI2B 4HP8A 4HC4A 1KRWA 4GHWA 4R4JA 4Y2SA 1ECFA 1G5FA 4M8LA 1JYSA 1Y82A 4PHFA 3MK31 4HB4A 5DTJA 4PLTA 4ZPJA 1MMFB 3GGCA 4BCCA 4LXQA 3EX7C 4HZUA 1RACA 1A9YA 1TYDE 1UMBA 3BZUA 1D9XA 5LQMA 1U2QA 5EZYA 1Y3CE 4RX1A 4WLOA 4DABA 3LF2A 2G4VA 5JD4A 4KYVA 3RUHA 1GA4A 1BR2A 2PRYA 4RTPA 4QM7A 4Q5SF 2FFBA 3BFJA 1DAEA 3FZNA 2JLWA 4B2YA 1M8GA 1H9CA 4FJ2A 1GG5A 1QFZA 5C3UA 1PS9A 3T9CA 4F38A 2P90A 1SCJA 4FQ8A 3H99A 4QASA 1PT8A 1IHYA 1KVSA 2Q5IA 3C7AA 1NQAO 2ZCJA 3GFTA 1A69A 3UMRA 3LNRA 4CKYA 1CHNA 1D8TA 2O2HA 3TXYA 2VCHA 1HZJA 2DPGA 3DMTC 1VPTA 2I80A 5CPBA 1XVUA 4RD0A 1FBTA 4J0IA 1DKOA 3BGIA 3CVYA 3IO5A 6LDHA 3WGTA 3T1HB 5IPFA 1C0KA 3JYLA 4UHDA 4QOGA 4OD5A 1BH6A 3JARB 4EKNB 4YRRA 3HVHA 3N8GA 3EGIA 4P4LA 4FE7A 2HPVA 3FNIA 4RDCA 4G36A 4BG0A 1ODSA 4O4JF 2AEMA 4CIAA 2WHYA 2XUQA 3C7DB 1QZZA 1KZHA 2D06A 1LDEA 3QBTA 5JALA 5EYPA 1GXSB 1WXWA 2BE5F 1N0VC 1XRMA 4RKWA 2R8RA 4QHSA 1GPLA 4UHKA 1PEAA 3VYUB 1EUCB 1PFKA 2PZFA 4QYXA 5JW6A 4B6QA 4HDKA 1QQBA 2PRKA 4AMVA 3PD1A 4G5GA 1LDNA 5G0WA 3SXZA 1CEQA 1PTJC 3L3BA 4RTJA 3TQCA 2GBIA 2YN0A 2ODAA 1X77A 3DV0B 3UAWA 1U3CA 3BREA 1T6YA 1VRCA 2NSLA 4IUBS 2V3WA 2BDUA 5EGYA 2YQ4A 3V8QA 4M1EA 1WDLA 4DE5A 4QDOA 2ZBGA 3I28A 1OTHA 3ZU5A 2OZKA 1RLIA 2AQKA 3CEJA 2BR4A 5DX8A 1MQ8B 1BCRA 2Y0CA 4YMUA 4H18A 4JJZA 2OC9A 3SDSA 1S2NA 3QEMB 3Q5GA 4QGAA 4G0ZA 1XAIA 5JC1A 3H8VA 4RVUA 2NP7A 2G67A 2EKQA 3MCZA 3O03A 1DUVG 2YMLA 4X92A 3ELYA 1YD7A 2OHIA 1EP3B 4CLRB 4X7PA 3OZFA 5FL7A 3RROA 5K3SA 1MNEA 4NYMR 2WWYA 3MBKA 1D4ZA 5IJ9A 4MIEA 1WMDA 1QQ6A 1I4EB 2W4MA 2YWRA 1Q0TA 3P97A 1DTWB 2DCMA 1Z9BA 2X40A 1XTIA 4D25A 1NVBA 3HUTA 4JCZA 3ZV5A 2JK0A 4I81A 2BEUA 5I3CA 1HNWB 2X42A 3I5AA 5ALFA 3EXIB 4A7PA 3ORFA 1M2OA 3DWFA 2RH4A 4O4HF 1P17A 2JH9A 1C1XA 2II6A 3Q3VA 4UNNA 2X9LA 1Q15A 3KSZO 2MSWA 4ZVKA 2WYWA 3MMNA 2ZE7A 3QNWA 1TB4A 4U5BE 3FCEA 1SQ0A 2OCDA 3EHEA 5FA6A 1LS4A 4MW0A 1JXMA 2GD2A 1SZJG 1GZ7A 1ZDMA 3IUSA 3UMMA 2AVDA 3GZTB 3ORRA 1ZH8A 2G09A 4RCYA 4RE6A 2X1LA 4R6WA 2C9ZA 5ELMA 4ZAXA 4RZ2A 3RSLA 2VLIA 4OI4A 3UN1A 1NP7A 2EG9A 4KWIA 5CHEA 2Y9PB 4AQYB 1MAVA 4OHVA 2XBUA 1LFDB 4IDAA 3NTXA 3D81A 3ZGVA 1JMKC 1ZGGA 2HMQA 4NU8X 3S2GA 1G6Q1