4YT8A

Semet-labelled hmdii from methanocaldococcus jannaschii
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
344
structure length
344
Chain Sequence
b'DNMKVSVYGAGNQNLYINKLNLPEKFGGEPPYGGSRMAIEFAEAGHDVVLAEPNKNIMSDDLWKKVEDAGVKVVSDDVEAAKHGEIHVLFTPFGKATFRIAKTIIEHVPENAVICNTCTVSPVVLYYSLEPILRTKRKDVGISSMHPAAVPGTPQHGHYVIGGKTTDGKELATEEQIKKAVELAKSAGKEAYVVPADVSSVVADMGSLVTAVALSGVLDYYTVGRKIINAPKKMIEQQVIMTLQTMASLVETSGIEGMVKALNPELLIRSASSMKLLDRQKDLDAALEILQNLDETLKAEVEKAEIKPTTLVAAQSLVKEIKTLIGGAAAEGAIKRSARKLFEH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H(2)-forming methylenetetrahydromethanopterin dehydrogenase-
publication title Towards a functional identification of catalytically inactive [Fe]-hydrogenase paralogs.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Metal binding protein
total genus 114
structure length 344
sequence length 344
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03201 HMD H2-forming N5,N10-methylene-tetrahydromethanopterin dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1300 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4yt8A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4yt8A01
4D45A 2YQ5A 3DOJA 1LDEA 3DAGA 1OBFO 1T2DA 2ZYAA 4Q9NA 1I01A 1XDWA 4Z6KA 5JYDA 1M6HA 4R3WA 1ZK1A 2O4UX 3ZI0A 4BO5A 3O9ZA 4IXWA 5EL0A 4UVEA 1JTVA 1E7YA 4AJ1A 1Q0LA 4KP7A 3AI2A 1MLDA 3GG2A 3ZU2A 4J3FA 1H6AA 4HBGA 1TT7A 1G0OA 3WGYA 3ZWPA 4I9NA 4TRNA 3FTPA 3PYMA 2VQ3A 5TIIA 1DHRA 1K2WA 4XRGA 3EHEA 4I5GA 1RM3A 1YQGA 4BNKA 4CM9A 2HRZA 2DVMA 1X0XA 4BMNA 4B3JA 4MO2A 4DGSA 4EJ6A 4TKMA 3VZQA 2DUWA 2X23A 4HY3A 2G5CA 1GEGA 1A5ZA 5BNIA 1KVQA 1U28A 3G49A 1QR6A 2B37A 3ANNA 3F1KA 3RFXA 4Q3DA 3HSKA 4PZCA 3TNLA 4Z3KA 2NTVA 4GX5A 2ZB7A 1DIAA 4RDIA 2OORA 4LN1A 2Y0DA 2Q2WA 3MOIA 2NU7A 4G2NA 1Q7BA 1D1TA 4ZA2A 2Y1CA 1NX6A 1HETA 1U5AA 4Y6SA 1PR9A 4WLUA 2NSDA 3H9QA 4KTVE 1E3SA 1G1AA 2DFVA 2AA3A 2PGJA 3BMNB 2VUSA 3GNQA 4O63O 4I9UA 3RUDA 3KHUA 3ZWOA 1LQUA 3TZQA 3DB2A 1X7GA 5K6AC 1YS4A 2FR0A 3VHRA 1V3TA 2YQ4A 2ZB8A 3DDNA 4HFNA 2CMDA 3MOGA 4GMFA 5BNFA 4O5OA 3VTFA 1AE1A 1JA9A 5KJFA 2EF1A 4TWRA 1FXSA 3JQ8A 3H9JA 3K6JA 1LU9A 1B15A 4J7CA 3RUIA 4BS9A 5TLSA 5IDWA 2O3SA 1WDKA 2VWQA 3ZNOA 4MP3A 3U3XA 4QTZA 1WMBA 3WICA 5JMPA 3BIOA 3AOGA 3GVPA 3BMQA 3RI3A 1BGVA 1YQDA 4MIOA 2IXAA 4JIGA 1ZW1A 3DONA 1YJ8A 4IDDA 4F3YA 2B0JA 2VNAA 3JSAA 4ONEA 3IC5A 4TZKA 5L3ZA 5CG2A 3AW9A 1HYGA 1VJ0A 3D5QA 1GQQA 3GF4A 1O6ZA 2WEKA 1R6DA 1N9GA 2C7GA 3FBTA 4NU6A 4CPDA 1ZK4A 1L1FA 2OP1A 4BQRA 1E6EA 1VI2A 1M66A 3FF4A 3IP1A 4R9RA 1P1JA 3R6DA 1QYDA 2PH5A 3JQ7A 1MC5A 5IF3A 1P1RA 1PJ2A 4E2XA 4BQPA 1XGKA 2O4CA 5TF4A 3N7UA 2YJZA 2ILTA 2Y68A 3DAFA 4IJUA 4A0SA 3LT1A 3QHAA 3DMTC 5BSGA 2RH8A 1K5HA 4O6VA 1DPGA 2DQ4A 3VAZA 1ZZEA 3FD8A 4XIYA 4YJHA 3D3WB 3FWNA 4CUJA 5CEFA 4IXTA 3G0OA 2Y66A 3INGA 3W4JA 2BH9A 1IHXA 2PNFA 4EW6A 2WE7A 4RPGA 3V5NA 3T4XA 5A06A 4BVAA 5KIAA 2IEBA 3INRA 4OH1A 1UH5A 4DLAA 2OMEA 4CM1A 1JN0A 4Z9FA 5AXBA 2I76A 4CLRA 3GQVA 4I9HA 1QYXA 4IQ0A 1ADFA 1IL0A 4TROA 4W7HA 3OIFA 3L0DA 2RHCA 3QVTA 4R68A 5JBIA 2VYND 1AXEA 1J0XO 1PJ4A 4JJFA 3PFWO 4UUMA 5CG1A 3MJSA 4HNGA 2FPPA 2AMFA 2ZK7A 4LMRA 1JWBB 3CXRA 2CDBA 1U2DA 2ZTUA 3C85A 1YWGO 5DP2A 5CPFA 4EEXA 4OM8A 4NK4A 2E49A 4KDEA 3UW3A 1JDJA 3U62A 3CMMA 2X58A 3WJAA 5K0ZA 1FF9A 3CPSA 2GGSA 2RBEA 2ZIZA 1LLQA 4WEQA 2JD1A 1XLTA 1ONPA 4FOOA 5JCXA 1H2HA 2Q1TA 4D46A 3OF2A 1MC4A 1K0UA 4EBFA 1Z7BA 2DTEA 3FNEA 1WNTA 1N7GA 3AFNA 2BFAA 4FJ1A 4AJHA 2EKLA 2PKRA 1ISIA 3OQ1A 4RV9A 2D1YA 1ADGA 3JQ8B 3GY0A 1GZ6A 3DBHB 2J5QA 1ZNQO 1F06A 2R2GA 3BAZA 1LRLA 2VRCD 2PV7A 3OIDA 5ENDA 2ZCUA 3E03A 4W9NA 3BMQB 2Y1EA 2R00C 2Z1NA 2V6FA 2A94A 2V6GA 2FZEA 3F4BA 4C7JA 1CQIA 4MVJH 3K73O 4XD2A 1PJLA 4AG3A 1XCBA 4OL9A 3VC7A 1N9GB 2C07A 3PQFA 3H8VA 4I5EA 1C0KA 1UAGA 3BMCA 3FNGA 1F12A 4YRDA 2B83A 4QECA 1ADCA 4GWGA 3OP4A 3BYZA 3MJVA 1T2EA 1XG5A 4IDAA 4NJOA 3IIEA 3Q1LA 4KUGA 1RYDA 4DBZA 3DC2A 1PSDA 1N8KA 2BGMA 4RCVA 4L74A 2O48X 1U4OA 3IL2A 1ZSNA 1PZEA 2ZATA 2D2IA 2JAPA 4F45A 4Q3NA 4ND1A 4CV0A 4J4BA 3A4VA 2ZTLA 3W1VA 3VVBA 1ZH8A 2A9FA 4TVBA 3DHEA 3OETA 3BZUA 4KOAA 3DQPA 3N74A 4GVXA 3RJ9A 3E6AA 4YVFA 2EKQA 4R16A 1LDBA 1I32A 2PZKA 1EVIA 1Q7GA 3FWZA 4R1SA 4CQMB 1AHIA 2JL1A 2X86A 4N18A 3F5SA 3TF5A 1NTOA 3ONDA 4Z9XA 5CDGA 1HLPA 4XA8A 1I24A 4NI5A 4ROSA 3RCBA 4CMEA 3S8MA 4WNCA 4AJEA 1DIGA 1I33A 1NXQA 1PWXA 4HFRA 1VM6A 4BNHA 1NM5A 4KWIA 3KEQA 2X5JO 3UKOA 3V2UA 1I2ZA 1EVJA 3EAGA 2Q4BA 3QVSA 2C82A 3GT0A 4ITUA 2JCXA 1K6JA 4M89A 4TVOA 3RIHA 4E5PA 3ZU3A 2PLAA 4WK6A 5T5QA 1EUCA 4W82A 1DXYA 3RBXA 4FR5A 4D44A 2CY0A 3HDJA 2VYNA 4B8ZA 1TVEA 1EK5A 1X14A 3FCOA 1GQYA 2WD7A 3R0IA 1T1RA 3W8DA 2B4RO 4HADA 3P2OA 4R5HA 4FFLA 2WMDA 3K92A 2HDHA 1NQTA 2CFCA 4Y8VA 2D0IA 3JQ6A 3JYPA 3V2HA 2EP5A 4RF2A 4UVDA 1QG6A 5G0UA 1NPTO 4YAJA 4CQLA 1YVEI 4KWHA 1GPDG 2C59A 3PWSA 1PL8A 3I9OA 3EZYA 1ZJZA 3BMOB 2FRDA 4LGVA 2IZ1A 2VT3A 3UHAA 3KLPX 1S7CA 4GKBA 4E6PA 5ICSA 3PDJA 4MKRA 1U8XX 2Q46A 3DL2A 5IDQA 1DO8A 2BFOA 4JCOA 5A5EA 3QE3A 4A5OA 4M1QA 3H3JA 1ENPA 3GOHA 2Y05A 3NDJA 2Z5LA 4B7XA 2WD8A 3WWZA 2CDAA 2C0CA 1YQXA 4BNGA 3KYBA 3F6YA 4BGUA 2ZYGA 4RVGA 1V9LA 3GNSA 4XYEA 1V3VA 2ZCVA 3I4CA 5EQDA 3GPDG 3HDHA 4E3ZA 2Q1WA 3WXBA 3GZ4A 4PRKA 2PA3A 2GRAA 3K9QO 3LLVA 5IZCC 3ZWMA 4K1LA 3ZV4A 5EIOA 1JWAB 1KIFA 2W2KB 2DBVO 4FW8A 1DRVA 2O2YA 4OAQA 4DIFA 3ZV3A 4EGFA 3E1KA 3PI7A 1AGNA 1ZFNA 5JNLA 4ZICA 2E6UX 4UREA 3RUEA 4IDGA 5FFFA 4BL5A 1GZ4A 3U0BA 4AJ2A 5H81A 1LJ8A 4TZTA 3S2GA 3ROPA 1IOLA 3A28A 1CEQA 2OFPA 1SC6A 3O26A 3SC4A 5KCZA 3OA2A 4Y6PA 4BB6A 2CDCA 3AOEA 4CMGA 1E77A 1PJQA 5TT0A 4WCFC 4NMHA 1LNQA 5L45A 3KTDA 3WNVA 3KETA 3VKVA 3ZHBA 4J1TA 4XRRA 2OBYA 4WOKA 3L9XA 4CM4A 2NTNA 3E5MA 4ZVVA 5BR7A 3MJTA 3EK2A 2PTGA 2OXIA 1V6AA 3ULKA 3C8MA 1W6UA 3CZMA 3IDSA 4RGBA 2JD2A 3ONFA 2OL4A 3RC2A 2VTDA 3FHLA 3RVDA 2YYYA 4OOFA 5A3JA 5C37A 5JXWA 1VC2A 1Z6ZA 3I52A 1ID1A 1PZGA 3HUDA 3AWDA 4ND3A 2AXQA 1NFFA 3GUYA 5DDIP 4OIMA 3L6EA 1XR3A 3VH4A 3LDHA 4MDHA 3WSVA 3S2EA 3C7DB 3KO8A 3EC7A 4EJMA 3H5RA 1OC4A 3WMWA 3D5TA 2Q45A 3JYLA 1BDMA 4XR9A 5DCUA 1YBVA 4INAA 3K31A 3HE3A 5T8KA 1GR0A 3JQDA 2G76A 2WM3A 4YT5A 4RVHA 3P7MA 3RUAA 3M2PA 5G0WA 5BSFA 3EY4A 2OZPA 2Y99A 2IRWA 1T4BA 4BO4A 1HSOA 2AQKA 1D3AA 4R4JA 2BD0A 3JQFA 4L8VA 4CV1A 4QO7A 4YCAA 1DLIA 2VHXA 3GZNB 1WW8A 1LX6A 4B4OA 2J6IA 4HFJA 5K9ZA 2FZWA 5I9MA 1DHTA 3OQBA 4P4NA 3RFVA 2AG5A 2GNAA 5CDYA 3EDMA 5T64A 4DC1A 4B8WA 1HE3A 1NPDA 1FDSA 1IULA 1IY8A 2B35A 1PL7A 1FMCA 4JNKA 5CHEA 3H5NA 4HNHA 4GLLA 4YEDA 4U7WA 1BWSA 3QWIA 5ILGA 1E3EA 2YV1A 4Y98A 1QXSA 4UVHA 2DM6A 1QP8A 3DFZA 4NBUA 5LCXA 3BTSA 1I30A 1KEPA 4BKOA 3MWDB 4FFRA 1Z45A 4OGWA 1SOWA 1WPQA 5I9LA 3DZFA 3RU7A 4N5NA 5GZ3A 2JHGA 3TN7A 1VKNA 4WEOA 3GNTA 1EMDA 3H6KA 2FY8A 4O1MA 2I65A 3UVEA 3WS7A 4GMGA 4ALMA 1VL0A 4N54A 4I5FA 1YOVA 1DBVO 1R4NB 1W0CA 4IS3A 1H2BA 3JQEA 4YQZA 3MEQA 3ROMA 1DC3A 1OFGA 4NR0A 1Y8RA 4ND4A 1VPDA 3TL2A 3JD4A 3DZBA 2RIRA 1PTJA 3BA1A 4EDFA 3QSGA 3BXXA 2G17A 1MUUA 2XXBA 3TFOA 3ITDA 1WWKA 4CMHA 1A9ZA 4A7PA 3UN1A 4M55A 2Q1UA 4XYBA 1PGNA 3PJGA 1YB5A 3DHYA 3ONEA 2AEJA 5KOIA 4OKNA 4R5MA 4CV2A 1VL6A 1UDAA 3OBBA 1BSVA 4OKIA 1UZMA 2VOEA 2GLXA 3RKUA 2YW9A 1JKIA 4XJTA 5TX7A 2P4HX 4JP2A 4K26A 1OMOA 2B36A 4Q39A 4W7IA 2GZ1A 4WPGA 1NBOA 1GUYA 1NVTA 2D5CA 2CVZA 4RZHA 2NNLD 4ZQGA 4AJOA 1ENYA 4WLNA 4ZD6A 3DZKA 2A4KA 5ES3A 2NVUB 5U4QA 1LQTA 3I9LA 1QLHA 4DRYA 5ITWA 1U5CA 2NU8A 4RQUA 3QIVA 4CMKA 4AJKA 2ZJ1A 2O7SA 3EVTA 1KERA 2QRJA 2HQ1A 4RPKA 4U0KA 1DRUA 4IGEA 4EZBA 4E13A 2Q3EA 9LDBA 5HTOA 1LDMA 3F5QA 4NBTA 5DBFA 5EINA 4PZDA 4J16A 1NFQA 1NP3A 2XF8A 4DXHA 1VJ1A 4B4VA 3OM9A 2I6TA 4BGEA 3D0OA 1P74A 5U1PA 2VUUA 4PLWA 1GDHA 1CERA 3LLSA 2HUNA 4P22A 1HTBA 5JC8A 4GVLA 3WWYA 2HCTA 2IE0A 4DWVA 3T7CA 1ULUA 4EJ0A 4MOWA 2O23A 1NASA 1ISMA 1LXCA 3RJ5A 5H83A 1ONOA 1M76A 1UP7A 3MCVA 4QX6A 3P19A 5DP1A 2VN8A 3U4DA 5AXAA 3RROA 2NV6A 3V8BA 3D1LA 1A4UA 3G1TA 3ZW9A 1B7GO 1NQOA 2OGUA 4PG7A 3VZSA 3SEFA 3JQCA 3P2YA 4OYRA 4PG4A 4R1TA 2O3UA 5IN5A 3C1TA 4YACA 4CL3A 3JQAD 4OXNA 1H93A 2C2YA 3D4PA 5AXDA 1QLJA 4YT2A 2VT2A 4GSLA 4LW8A 1BMDA 4OQYA 3RQSA 3EMKA 5L53A 3WQQA 4GL4A 1U3TA 4ZJUA 4D3SA 3WLEA 4XCVA 2IYPA 1Y8RB 4L0QA 4XYMA 3ZU4A 3BHIA 1LDNA 1HKUA 2V7PA 5CDTA 3I9MA 4PLTA 2FPGA 3HB4X 2JD0A 2AHRA 4YRBA 1VJTA 3GGGA 2WSBA 3GLQA 4O0LA 3U49A 4J49A 4ZGWA 4RLSA 3R3SA 1UXJA 1R4MA 1SB8A 1HZZA 1GD1O 1IPEA 3GVCA 2B69A 4FGSA 2VZ0A 1R37A 2YV3A 1IUKA 4G5HA 4FS3A 4LVCA 4FPXA 1GL3A 4BNUA 2VYVD 1Y6JA 5JO9A 2X1HA 3FSRA 2Q2QA 2QHXA 1C1XA 1U9JA 4XEHA 1SMKA 1A27A 3HN2A 1B0AA 4H7PA 1P45A 2CVOA 4D0RA 1H6DA 3AU9A 2J5KA 2GN9A 3ZHZA 1SPXA 4UEJA 1PGPA 1NAHA 1BW9B 1O89A 4BNTA 2VZ8A 3G1UA 3JYOA 2BGKA 5EQFA 4J4TA 1NPYA 2X5KO 2JJYA 4OSOA 4CLHA 2AEMA 1H9BA 2Y1DA 3NUGA 3OJ0A 4S1VA 4MIYA 5JDIC 2IEDA 4K9DA 1ZMOA 5L40A 4MVJM 1LTHR 3AM3A 4NDNE 4CUKA 4YR9A 5DZSA 4UEOA 1TEHA 4LCJA 2X0JA 5ADHA 1PGQA 4MPDA 4BO8A 1GU7A 4CM8B 5HA5A 4D3DA 3Q11A 4NNJA 3H7AA 3CH6A 3ENNA 3GH3A 4M8SA 1HYHA 4Z9YA 4LCEA 2WWRA 2NTJA 3RWBA 3TFQA 1YE3A 1F0YA 1PJ3A 3JYQA 1N1EA 1V35A 4GSKA 4J6FA 4CMIB 2GD1O 1A7AA 1E6WA 3RU9A 3GGOA 2B5VA 2JCYA 1E3LA 2HJRA 3PFFA 2H1SA 5JDCC 4WASA 3BTVA 4DVJA 4RL6A 3I23A 2VWPA 4IZIA 3LQFA 1HWYA 3CUKA 1RPNA 5ITVA 3PHHA 4YJFB 3S2FA 3NJ8A 3TWOA 3HG7A 3DBRA 1BG6A 1I3MA 2PZJA 3K2BA 1KS9A 2AE2A 3ICPA 2HO5A 4OMUA 4R41A 4E2YA 3PHLA 3PHJA 3Q0EA 3LSYA 3P5SA 3AUAA 1EDZA 4KDFA 4BV9A 5L7WA 1Z82A 1V3UA 1E5QA 1TT5A 1KVTA 4KQWA 3VH1A 4NBWA 3NV9A 1QSGA 2B5WA 1D4FA 5T57A 5C7OO 2H9IA 4C4OA 3NYWA 5L7TA 4IDFA 4BNYA 4Y6RA 4FBGA 4AJ4A 4JP3A 3HQ4O 4PLCA 4GX1A 1R0SA 3E82A 5C7LO 7ADHA 5IAAA 4G81A 4IIVA 3V1TC 3I3OA 2I9PA 4IUYA 4NFSA 3WGOA 3DEYX 1CJCA 4LK3A 3PRJA 3JQAA 1T2AA 1P9LA 1H94A 2NACA 3AFMA 1IYZA 2OBNA 1DB3A 3TZKA 1EZ4A 2EERA 4XJSA 3WR5A 4XWYA 3ZHXA 3PJDA 1C1XB 1MXHA 5KVSA 1EUDA 4DLBA 4KTTE 1M67A 3MTJA 2I3AA 4JLWA 5AYVA 4BKUA 5I7VA 1X1TA 2QYTA 3ABIA 3GHHA 2E37A 1GQ2A 2W98A 3JQ9C 1V0JA 4ZRMA 2GERA 4II2A 2BKAA 4A2CA 2G82A 1MG0A 2VYVA 3IS3A 5DN9A 4BNXA 1P1IA 1ULSA 1E6UA 5IFLA 2HLPA 1O9BA 2FP4A 2RHRA 1YBAA 2EV9A 5ER6A 4IJKA 2EGHA 2NVBA 2AQ8A 4I08A 3OJFA 3L4BC 3WLFA 2WJPA 1K89A 4DBVO 4CLXA 1O95A 3RC9A 4FC7A 1J49A 3GN2A 4FC6A 1RWBA 4GGPA 3DFUA 4YWJA 2SCUA 3QP9A 5TS3A 4UVIA 1EVYA 1WP4A 2OOSA 4CR6A 3H3FA 1E0DA 3K30A 2W90A 2JKVA 3ORFA 5FEUA 2QIOA 1HT0A 3AJRA 4U5QA 4XQCA 1XWFA 3RSHA 4BNZA 2XPCA 4YTEA 1KEWA 4AL4A 3H5AA 4D42A 5HWSA 4Z3DA 4U0JA 4AJIA 3PTZA 3SLKA 1R0LA 3DBRB 5A5FA 3PEFA 8ADHA 2AQHA 2VNSA 5F1OA 3VPXA 1TLTA 3GVIA 5KKCA 4ZHSA 4U6QA 1E1NA 4NJMA 4RF3A 4WECA 4P4GA 1NFRA 2JFHA 4LSMA 2HMVA 2W2LD 4P38A 3HNPA 3GRKA 4O59O 1WMAA 3WJ7A 3JQ7B 3ITKA 5IDXA 4ALJA 3OSUA 5GZ1A 1ZSYA 3ETEA 5LDGA 2HMTA 2VHZA 3V1UA 1JU9A 2TMDA 4RF5A 3L4SO 1B8UA 3WDSA 3W4KA 1FJHA 4FIZA 4W4TA 3ROQA 1VKOA 1PS9A 1YH3A 1HRDA 3DWFA 5KVQA 1J5PA 2BFMA 3D3EA 2Z1MA 2ZJ0A 4YJHB 5BSHA 2ZQZA 1SEPA 4DA9A 4R51A 4FD3A 3C7AA 3Q6IA 4DQVA 5DNAA 4BV8A 3VZRA 5TSDA 4ZU3A 2GN8A 1DC5A 4PLZA 3TOXA 4J4HA 2PY6A 4L4RA 4XQEA 1NYTA 3RUCA 1EVZA 2PK3A 3VDQA 2RH4A 3QY9A 4R1NA 1G0NA 1NR7A 3DBVO 4I8XA 3SVTA 1PEDA 3Q9NA 3MJCA 5COAA 1GFSA 4ILKA 1C1DA 3MJEA 1DAOA 3A06A 4QSMA 5G0SA 5LC1A 4CLRB 2DPHA 4XKJA 1A7KA 3ZGYA 1LLDA 1B26A 4FSHA 1BXZA 2HAEA 1UXKA 4KMSA 1T4DA 3ZWCA 3CMCO 4FB5A 1IPFA 1ZMTA 1WXDA 3SLGA 4TRJA 2OO5A 4RLHA 2EW2A 1UDCA 4URFA 1BHSA 1HDCA 3ZCXA 5EN4A 1PJSA 1TB4A 5FYDA 3JQGA 1E1LA 2X9GA 4R9SA 3FTNA 4U8GA 5I8WA 4MVJI 2UV8A 3PZBA 1RM4A 5I8ZA 1EUZA 3T7EA 4W99A 4BKRA 3AK4A 1XHLA 4GWKA 4PG6A 5CAEA 3RBVA 4YJGA 3RFTA 3RUHA 3L6DA 4M87A 1AUPA 4NZ9A 3G79A 3NEPX 4DMMA 1SCUA 2W8ZA 1DFGA 2C54A 3EW7A 4FJ2A 4D3FA 2GZ3A 1I3LA 4E32A 2Q1SA 1O8CA 1RYEA 4MP6A 3ON5A 4YXFA 3ICCA 4D43A 5KJCA 1N5DA 4N7RA 1YL6A 3IJPA 4L9RA 2WYUA 2BI7A 2PWZA 5TGDA 3NT2A 1I2CA 1IB6A 3JTMA 1KYQA 2HK9A 3EZLA 2PD3A 6ADHA 1GYQA 4JQCA 3JQBA 3ZNPA 3GAZA 3PZRA 3HDYA 3HFGA 3C1OA 5I9NA 3VTZA 1C0PA 5A4DA 3NRCA 4IPTA 1R16A 4FJ0A 3TZHA 1E3WA 3FPLA 1CQJA 2DAPA 1XA0A 3SJ7A 4YAEA 1H9AA 3UF0A 3VKUA 4AVYA 5B4UA 4BO1A 4BNMA 4OJNA 2RCYA 1I2BA 4IDEA 4NJMB 3O8QA 1ADBA 2Z95A 4BOYA 3WSWA 3FR7A 3K5PA 3NT4A 3DBLA 1KVSA 3BMCB 4MKZA 5EJ2A 3H4VA 2Y93A 2VRCA 1DJNA 4IIUA 4E5YA 4XYLA 1CYDA 1P1KA 1SB9A 2RAFA 1F17A 3Q3CA 3I9KA 2OUIA 1HDGO 3ZW8A 1YONA 3M2TA 3QA9A 1T2FA 4PLFA 5KVCA 5JS6A 2PR2A 4J1QA 4RVDA 2J5RA 1VRWA 2GF2A 1DIHA 4WUVA 4QQRA 1O0SA 1RM5A 3GMDA 4FOSA 2HSDA 3FN4A 4PVCA 4MINA 3WBBA 1QYCA 1CRWG 3R1IA 2JFGA 3ENKA 4NFHA 2EGGA 1HE5A 1FDVA 2JFFA 4NQZA 4Q3CA 2W2LA 4RVSA 4GX0A 2GDZA 3PDUA 4GKVA 2YDXA 1PJTA 1LC0A 3K8ZA 3VH2A 3STHA 2LDXA 3KYCA 4QFDA 3AY3A 5G0TA 3DOOA 4FFMA 3E9QA 1C1DB 4M86A 3WQRA 2X0NA 2YV2A 4IGFA 4LVUA 4OOEA 3U5TA 4CMBA 3RAJA 1Z7EA 3IP3A 3GDGA 1X7DA 4DMLA 3W6ZA 2CNBA 4YB8A 1L7DA 3UUWA 3WGTA 1XU9A 1P1HA 4LRTB 3F46A 2D8AA 3M1LA 3RASA 3TZ6A 3WX0A 4DTIA 1BXGA 1NAIA 2WE8A 4J90A 3CEAA 3JQGB 3CTMA 3KV3O 5KJ6A 1DC4A 2Y67A 1GCOA 2DBZA 1GAEO 1HLDA 3OJEA 2O3RA 2EWMA 3E8XA 3PQEA 1SAYA 4NU5A 4R54A 2V6MA 3MZ0A 4EUEA 3CE6A 5AQ1A 4J2HA 4MVJD 4BGIA 5TJ9A 2EJWA 1OAAA 3QWAA 3AI3A 4X54A 2WD7B 1RM0A 4ZQBA 2O50A 4P8RA 1SEVA 5ENVA 4Z0HO 3GAFA 1VSUA 1D1SA 3WYBA 3DR3A 4BO7A 2O3JA 3PJFA 3EUWA 1MXFA 2HMWA 2WTBA 2FMUA 1LA2A 3CSDA 4MVJE 1DFHA 2J3KA 4CQLB 2DTXA 2PZLA 4CLOA 1E7QA 4KUHA 3E18A 1LSOA 1HDXA 4IMRA 2E4AA 2VWGA 1E7MA 3Q9UA 2FWMX 3S2IA 5TC4A 1XYGA 1E3WB 4XZ3A 1C3VA 1EE2A 4XYGA 5A03A 1H5QA 3ZDFA 1I3NA 1KETA 4L73A 5EESA 5K6AA 3PP8A 1N2SA 3AUSA 4W9NC 4YAKA 4PRLA 4RF4A 3KBOA 4RQTA 3DBLB 2FOIA 3NDIA 4L75A 3ZWVA 1KY5A 1XEAA 1GV1A 5JAQA 1LI4A 3TRIA 2VTEA 1LC3A 4BNIA 5JC1A 1WAMA 1H6BA 1F8GA 1K3TA 4YRAA 3FR8A 3BHJA 1I5RA 2P5YA 3E5RA 4JBHA 1U3VA 4J0FA 1ZEMA 1TI7A 5HBRA 3DZHA 2EKPA 4IDCA 4XX0A 1P33A 3ADPA 1I3KA 1DAPA 3F47A 4ALNA 9LDTA 3TDKA 1M2WA 1R12A 4CODB 2BRUA 3GFGA 3I1JA 1H6CA 4IS2A 4AJLA 1LEHA 2D3TA 4YBZA 1ISHA 2EW8A 4R1UA 5A3VA 3WGIA 4K6CA 2AE1A 4FQ8A 3T4EA 4Y9DA 2P4QA 2O7QA 1EE9A 2PFGA 3E9MA 4BMSA 1ENOA 1KVUA 4L76A 4E4YA 3BTUA 1B14A 3LT2A 5I7SA 3LVFO 4CL8A 1DSSG 3DMTA 2UUOA 4PLPA 4ALLA 4CM4B 2FPIA 1I0ZA 1YB1A 1RJWA 2I99A 1UXHA 2AEFA 5A9SA 2GN6A 4HFMA 2I67A 4PGFA 2WYVA 4NHEA 5J23A 1JKFA 2QW8A 4ZQHA 4CMEC 4AJPA 2J3IA 1B3RA 1U3WA 2F00A 3GGPA 1BRMA 3SBOA 4A73A 1ZO8A 2POQX 4II3A 4B4UA 4E5NA 5JCJD 2QZ9A 3KSZO 4XR4A 2XOXA 5KVVA 1DEHA 1X15A 2NU9A 4Q3AA 3V1YA 4UEKA 2H63A 3PYXA 3TQHA 1FDTA 2AQIA 3O38A 1NQAO 2P9EA 1D8AA 3MWEB 4YAGA 4J9VA 2VHVA 3SC6A 4XDZA 3M1AA 3HN7A 3H9UA 1EQ2A 1ZEJA 4FN4A 5GZ6A 5A05A 3TL3A 1E5LA 2UAGA 3IQDB 1U4SA 1I8TA 3GC6A 3KRTA 4FCCA 1Z74A 3IOYA 4FDAA 4XDYA 3WYEA 1EDOA 2GSDA 1T24A 3AU8A 3D7LA 3KUXA 3O03A 1WDMA 4A27A 4MVJA 3D64A 1B8VA 3DTTA 1LUAA 4TQGA 2Y1FA 1JW9B 4Q3BA 3ZV5A 1X7HA 3UH1A 3I6QA 2PH3A 3PIIA 1E1KA 4A03A 5JYEA 3PLRA 1ZUD1 5DOZA 3AI1A 3FI9A 2LDBA 3PWZA 3GRPA 3W6UA 1PWZA 3U09A 5F21A 1ENZA 1HF3A 2ET6A 1ISGA 1DDOA 3SXPA 4I1IA 1CWUA 5GMOA 3GVHA 3JD0A 1PGOA 1UUFA 1Y5RA 2R00A 2YZ7A 2GN4A 2VCYA 4KUEA 1DIBA 1E7SA 1NHWA 4PN3A 4YAIA 3NAQA 4E33A 4CLEA 3G3EA 3ADOA 3GK3A 2IODA 2DBRA 3NDRA 3A9WA 4MP8A 1EFLA 4ZQEA 1YBMA 1Q0QA 4JJIA 2HRBA 1YJQA 1YOVB 5FWNA 2GUGA 2AW5A 1UAYA 4RDHA 4BNWA 4S3MA 4DREA 3NGLA 4RPHA 4EITA 1V8BA 4PLGA 1ZK0A 4XQ9A 3UFXA 5IN4A 5BQFA 3OFSA 3EVNA 3VDRA 3QW2A 4E31A 3DTYA 5COBA 3W8EA 2QRLA 3S55A 2C20A 1Q1NA 4I5DA 4B3HA 2PGDA 3JD3A 3LT4A 1LSUA 4DLLA 3AOEC 3HDQA 5AOVA 4MVJF 3I9JA 2YDYA 2ZB3A 3LC2O 1WZEA 4JGBA 1OI7A 4GH5A 2NLOA 2DT5A 4DUPA 1M6WA 1Y7TA 5DCYA 4EEZA 3TJRA 3JD2A 1SO8A 5F1PA 4CQMD 1HE2A 3A14A 2P9CA 5B12A 4DPMA 4L4XA 2ZTVA 1GUFA 2PD4A 1PX0A 2Q99A 4G65A 3D3WA 3ZNQA 2HK7A 3X2EA 5BT9A 5L4LA 3EYWA 1GUZA 3PHGA 4NH4A 1CETA 1UR5A 4QT0A 2HU2A 4UUNA 1PU2A 1MFPA 1U2GA 3NT5A 4CUZA 4BMVA 3OECA 1PQUA 3HHPA 3NTRA 3SX2A 2R6JA 2P9GA 5TQVA 5ICMA 3WIEA 5EMHA 2E48A 1LSSA 2Q2VA 3TZCA 3RUFA 4HUJA 1BVUA 5G2OA 5JCJA 1DFIA 4J1NA 1I10A 3F4LA 4MJLA 1NNUA 4XIJA 5T8KC 2XAAA 3HZZA 1UZNA 4D7AA 1NHGA 2I66A 3QVWA 1NQ5A 3H9GA 5JMWA 5I7FA 1T2CA 4E0BA 2CF6A 2X8LA 1HYEA 3ZWXA 1ONNA 2FR8A 5JO0A 3IJRA 2X5OA 5F3RA 2P2SA 4OO3A 4GGOA 5F1KA 3JQFC 4OQZA 3UOGA 2GASA 1J6UA 1GYRA 2NU6A 2PD6A 1MB4A 5JSFA 4JN6B 4ZN6A 3IKVA 2NWQA 5BNTA 4N5LA 4UAGA 4J91A 4PLYA 1QMGA 2X22A 3GFBA 3OIGA 4R69A 1P0CA 3C24A 2DLDA 1YO6A 2NQ8A 2C5AA 3PK0A 1LBEA 4FFNA 4YA6A 3NKLA 4XGNA 4B4WA 4OXYA 4Y67A 3DBHA 3F3SA 1KEVA 3LU1A 3WBFA 5LDHA 1A9YA 4JBIA 1P3DA 1S6YA 5GY7A 5MDHA 3NX4A 3CZRA 2J3HA 1YB4A 3DHNA 3JD1A 4CM6A 2YFQA 5AXCA 5TRTA 1QYVA 1Y5MA 1J4AA 3OH8A 4QFCA 5F5NA 1ORRA 3PLNA 4KQXA 1C0IA 1PS8A 1JAYA 5L4SA 1ISFA 3B1FA 3KOUA 4BO9A 2D5AA 1KOLA 3I83A 4OSPA 5HS4A 1XQ6A 1W4ZA 3ZHYA 1P31A 1R4MB 2VHYA 3PJEA 5IZCA 3DZGA 1AHHA 2EHDA 2ZKLA 1GCUA 3VPFA 3E48A 2QQ5A 1R15A 4JK3A 1QKIA 1DIRA 3CINA 2FSSA 2VOJA 4CMCA 2CSUA 3RC7A 1IZ9A 4WNIA 5G4KA 2IDZA 1HZJA 2G0TA 1EQUA 1X13A 2W4QA 3AUUA 4JX8A 1BTOA 2PKQO 3MJ4A 3QVXA 1QV7A 3IUPA 3QVOA 2X0IA 1OOEA 3GMSA 3VPGA 2HMSA 4TRMA 1TXGA 3PIDA 4J7XA 4WCFA 4JJGA 4ALIA 1CIVA 4E5MA 4B3IA 2Y1GA 3UAGA 1CDOA 3LF1A 2DFDA 2PKQP 5ER9A 1DC6A 1YXMA 4BNJA 5L9AA 5CEEA 3OHSX 4PG5A 3SJUA 4CQMA 1ZSVA 5COQA 4WKGA 1E7WA 1B16A 2D59A 4J2OA 4E2WA 4JXKA 1B3BA 4YT4A 3TOZA 2Y1OA 1O94A 3WGGA 4DYVA 1PGJA 3WTBA 4DIBA 1EEHA 1DLJA 3I4FA 1PJBA 4CMAA 1GZ3A 2B4QA 1NVMB 4ID9A 4UUOA 1P0FA 4ALKA 4HP8A 3WOHA 8LDHA 1PR3A 3ST7A 5KTKA 5EPOA 2O3QA 2PGLA 3LF2A 4J43A 4AFNA 4CM7A 5CP8A 3VPHA 2VUTA 4RPJA 4IINA 5MGBA 1VL8A 1MV8A 3D4NA 4JROA 3QQPA 3WQSB 4XQGA 2VHWA 1ZIDA 5HM8A 1LRJA 2WYWA 2DBQA 3D4OA 2P91A 1OZAA 4DPKA 3MTGA 1GADO 3QWFA 4UULA 3B1KA 3UCFA 2FSVA 2F1KA 3AY6A 3E9NA 4GLOA 4EYEA 1DJQA 3GPIA 1XKQA 4CJXA 1PQPA 1TT5B 3BMOA 1B2LA 3U4CA 5JAMA 3HWRA 3ETDA 4CMJA 2VZ9A 4E21A 4LISA 1M75A 2ZYDA 4QEDA 2BHLA 3I6IA 1JKJA 3OEYA 5JY1A 2OP0A 4BIIA 2HJSA 4AJJA 4W6ZA 4L4SA 5G0VA 1WVGA 3ZN2A 3ZWYA 4WJZA 1F14A 4M54A 4BO0A 4AICA 5KJ1A 4HX5A 5DOVA 1KVRA 3JQAB 3PVZA 1R66A 2Y0CA 1MP0A 4J1SA 2E82A 4DPLA 1T25A 4NG5A 4BNVA 2DPGA 2Q49A 3WGHA 2EXXA 2GO1A 4Q3EA 3PGJA 5G4KB 1GTMA 4PZEA 3AUTA 1NWHA 5A9RA 3PYLA 1YRLA 3O4RA 2YY7A 4E2ZA 2W2KA 4N5MA 4DL9A 4U6SA 2D4AA 4BO3A 2P68A 1U8FO 4CR8A 3RKRA 1GY8A 1Y81A 3L77A 4WCDA 4PIVA 2PZMA 4WCFB 2O2SA 2P5UA 4IY1A 4YT8A 5KKAA 1UXIA 1Q0HA 4FFOA 3F9IA 2V6BA 3GEGA 3WIDA 1E3IA 1D7OA 4HWKA 1QRRA 2UYYA 1OC2A 4YYZA 3S1LA 2DC1A 2UUPA 3L6OO 4B7CA 1C0LA 3BTOA 2A92A 3LK7A 3ANLA 3COSA 2HKIA 4RVUA 1LRKA 4IBOA 2DKNA 1W8DA 1U7TA 2C5EA 1U7HA 2UVDA 3U4HA 5JE8A 4E30A 4DYDA 1N92A 2TMGA 3UXYA 5THKA 5THQA 4QXMA 3U9LA 2NQTA 2X4GA 1NR1A 4WLOA 4ZRNA 1JAXA 1JQBA 4IZHA 1SZJG 4C7KA 1GPJA 1XELA 2J8ZA 1H0KA 1YL7A 3NTQA 2GPTA 1HL3A 3FNHA 2BELA 1ZK3A 4D0SA 2GCGA 3WNQA 2NADA 2UDPA 3GN1A 1MX3A 3OICA 1XU7A 3FBGA 3UCXA 4DQXA 5B1YA 2YUTA 1LDGA 3B70A 1E1MA 1W73A 3KSDO 2IZ0A 2QYSA 3KSUA 4IM7A 4TSKA 4M49A 3FNFA 4NPCA 3HB5X 1ZCJA 2ZTMA 4F6LA 5CDSA 3OJOA 1QYWA 5KWEA 3OQ6A 3ZH2A 1Y9AA 1PS0A 2BMAA 3WGQA 1AXGA 4HKTA 1WZIA 4GI2A 5IXSA 4DIOA 3C3XA 1C14A 3RD5A 2H5LA 3L9WA 5DBIA 1ZKMA 3WFJA 3QLJA 3Q2IA 1NVGA 3KZVA 1IE3A 3LT0A 4WLEA 7MDHA 2A35A 1DRWA 1SOVA 2FN7A 3KM0A 2C2XA 4IQGA 3HFSA 2IZZA 5G4LA 1HEUA 4R01A 5C5IA 3GG9A 3GZNA 5AVOA 4J7UA 4BB5A 5A02A 1GEEA 3G17A 3OEWA 3QRWA 4RO0A 2B4TO 4WLVA 1HDRA 3DZIA 1YGYA 4OHUA 4YJDA 5T6BA 3ZU5A 1ARZA 3AM5A 5I7EA 2VRBA 1UP6A 3FRJA 5JPIA 1K6IA 4EUFA 4EUHA 3I9NA 5CPBA 2H6EA 2C7VA 3ETGA 5L95A 1UP4A 3M6IA 3WB9A 2EJVA 1R0KA 3LZ6A 4IQ8A 4YPOA 1E92A 5KJEA 2GR9A 5DT9A 3WMXA 1Z75A 4TKLA 3KLMX 2BFPA 1ZK2A 5IG2A 3GR6A 1F8FA 4GAEA 2CVQA 6LDHA 3B6ZA 3BHMA 3WG9A 5CEJA 5A04A 2WDZA 1XQ1A 4MKXA 3KVOA 4B79A 4EI2A 2V65A 5A1TA 1R4NA 1EBFA 5JFOA 4BNFA 1GYPA 5L51A 2C29D 3GA0A 4YJGB 4XB2A 1B8PA 4FGWA 3AM4A 4IJVA 2CD9A 4ND5A 5FF9A 4Z0PA 1EBUA 5CDUA 4LRSB 3DAPA 4MVJG 2I5PO 5KNLA 1Q7CA 1Q2XA 1JLLA 4AJNA 4RZIA 4F46A 1UDBA 4B7UA 4WOJA 3KYDA 3PXXA 2X9VA 1L7EA 3Q2KA 5IDYA 1SNYA 5FI3A 5TNXA 2X9NA 4PVDA 3ZNNA 3ZZNA 4ESOA 2Q50A 3C1AA 3KB6A 3WGZA 4TMFA 4IMPA 1LDYA 2NUAA 2CUKA 4NBVA 3PHIA 5JAZA 5JDIA 3DXFA 3NGXA 1HE4A 1PIWA 3ZWAA 4QO8A 1KEUA 2QRKA 1FDWA 1O5IA 1YL5A 2EG9A 4D79A 1MGOA 1UXGA 4YDRA 2YHIA 5C7IO 2BLLA 1ZXBA 3VOSA 2NVUA 5BSEA 1G6KA 2J3JA 1FK8A 1UZLA 2XXJA 3JV7A 4DQUA 1HXHA 3GUCA 3O8QB 3GDFA 5F5LA 3UCEA 3IAHA 3TSCA 3OJLA 1VE9A 4R3NA 2HK8A 1ZVMA 1ML3A 4K6FA 1QV6A 4RVFA 3FPCA 5L4NA 3VPSA 3ZWWA 1A72A 4XGKA 1KY4A 3N58A 1KC1A 2IYOA 2NM0A 4NBRA 1E3JA 3PQDA 1PZFA 1T1SA 4NIMA 1IHYA 5U9CA 2X6TA 3GVXA 2EEZA 1EK6A 3U4IA 4J9UE 5C3MA 2Q4EA 1Y1PA 5TT1A 3TPCA 5JDCA 1PJCA 2BI8A 1VSVA 1CF2O 1E7RA 5L7YA 1U3UA 1A71A 4TRRA 3V2GA 2YHUA 3JCZA 1FDUA 5JAIA 2DUUA 3KYCB 3OMLA 1YDEA 2QZZA 4PCVA 3NJ4A 2JHFA 3KXDA 4P4LA 1XIVA 4RPLA 3LYLA 2CZCA 3QWHA 4IJWA 3PPIA 4OXKA 1A4IA 5B37A 5DULA 4LMPA 1JVSA 4H15A 4PLHA 1BVRA 4RORA 3NTOA 2NVWA 1KC3A 3WTCA 3B20A 1ISJA 4D41A 5B4VA 4CR7A 1SBYA 2FHSA 3INTA 1HDYA 4UVGA 2X0RA 4CV3A 1BXGB 2HMUA 3QV1A 1QORA 4BKQA 4DC0A 3WYCA 1Y8QA 3C7CB 4PFJA 1LLUA 1Y9EA 1YKFA 3VVCA 4CM9D 1UJMA 4MIEA 4GX2A 5FI5A 3ANMA 3L07A 4PG8A 3LC1O 5A9TA 3CIFA 1BXKA 1MG5A 4BHTA 4CLDA 1IZ0A 1VLLA 2ZB4A 3HJAA 4J0EA 4RJTA 4GPD1 3WFIA 1YDWA 4BNLA 1ZBQA 4A10A 1HDZA 2GYYA 4XGIA 3KYDB 1MA0A 1HSZA 4JBGA 2DU8A 4NK5A 4CM3A 2IXBA 4CM5A 3JQ9A 3QWBA 2QG4A 3DZJA 3H65A 5HRUA 4BGVA 4KZPA 5B4TA 4WE3A 3EGOA 5DF1A 2QX7A 4CLOB 4MVJP 2OHXA 1WLYA 1T26A 4YQYA 3RBZA 2GZ2A 3ZWNA 4GQAA 3H2SA 2G1UA 2YHIB 4Z0TA 1KBZA 2YFHA 4LSWA 3A1NA 1BW9A 4E5KA 2DTDA 2VWHA 1DOHA 2ZQYA 4IDBA 3UGKA 3L4BA 3W8FA 2BF7A 4GBJA 1RKXA 4F6CA 5CFZA 3JQBC 2EIHA 4H16A 1N1GA 1PZHA 2FR1A 3DO5A 3ASVA 5DBGA 1I36A 3PGXA 3I5MA 3GEMA 5IZ4A 4CM8A 2O3TA 3BMNA 2EP7A 3X2FA 3ZWBA 1PQWA 4WLFA 3IMFA 3IKTA 3W4IA 4ND2A 2Y0EA 1HDOA 3PWKA 5T67A 5IXYA 3HADA 1XSEA 2JCVA 3KEOA 3IUSA 3VH3A 1LSJA 3F1LA 3OA0A 4HV4A 2X7HA 4BNNA 3H2ZA 1TA4A 3CKYA 5DCWA 3UICA 1P1FA 3GHYA 3DMYA 4UUPA 4ZQFA 4CMIA 1ZXLA 3QJ5A 5JLAA 3GDOA 5H82A 5JW6A 1Z73A 2JAHA 3GEDA 1PL6A 1MFZA 4H3VA 4PLVA 3R3JA 4NFYA 1JVBA 3K2EA 4BO2A 4K28A 4XB1A 1P44A 3H9EO 2CF5A 5IJZA 1ZJYA 1X0VA 2I3GA 4YJFA 1LLCA 1WDLA 5ILOA 4FFPA 1AN9A 1X1EA 1BDBA 3DOCA 3RC1A 3LC7O 4BO6A 4BUCA 1K6XA 4QUKA 1U1IA 4A26A 3ZV6A 3ASUA 5EERA 3AY7A 2BGLA 3ROKA 1NWCA 3B1JA 3K96A 2AG8A 3JYNA 1GV0A 1N7HA 4E12A 4HXYA 1P77A 5A9SB 1Y8QB 5TJHA 3VZPA 5HS6A 4BKPA 5JY6A 4WGGA 1EFKA
chains in the Genus database with same CATH superfamily
1OBFO 3JAKA 2ZAGA 2HLNA 1UOEA 3ZI0A 5LQRA 4I50B 4EA8A 1N2HA 2VQ6A 3ZU2A 3IEUA 1IK6A 3K9FC 2YS7A 4L4UA 1KAEA 4B76A 4X8MA 2KPOA 3EHEA 1WXIA 2HR1A 2R62A 4YDHB 4ESEA 5C32A 1P2DA 2G5CA 3F1KA 5IVIA 3HBAA 1I7QB 4Z3KA 1GNRA 2QI9F 3KJHA 1SUEA 4ZA2A 1U5AA 3SF0A 5CIWA 4TTRA 2QAGB 1IC6A 2V7WA 2I91A 1JA9A 1D03A 3L7MA 3K6JA 1LU9A 4B6QA 3CLKA 3ZNOA 2ZRMA 4UFNA 3ZGLA 4FYMA 1B0ZA 1VPLA 3BRWA 1NATA 2Q4RA 4ZVMA 2C3MA 3ZHSA 2EC5A 3AHCA 5BOSB 4YRLA 3DOFA 4MVXA 3SHOA 4HBZA 4DT1B 1V7PC 5JTTA 1PK7A 5J5AA 2R4QA 3UT5A 2H11A 3WBJA 3FWYA 3T52A 2ZYWX 5L3RA 3U3RA 3WLPA 5L8VA 3GI1A 1UBCA 4E5DA 3GXOA 4R68A 3ODPA 3AETB 3CXRA 3ZJYA 3AR4A 3PBKA 4HUTA 4DV4B 3IEEA 3NHYA 4FESA 3JASA 5DYIA 2C42A 2BAGA 3UM9A 1YYJA 1YUBA 2PIDA 4KQ1A 4TPKA 2AD5A 4QYXA 3UAWA 2R2GA 3HKCA 4FIDA 1NY5A 3MT7A 2FUCA 1M8FA 2A94A 2CNKA 1V4AA 1CQIA 4MVJH 2XCSB 5JAHA 4QELA 1T6XA 1PJLA 5KYVA 4AG3A 3VC7A 3T94A 2Y1WA 5DQTA 4P0PB 3SZGA 4YRDA 4XQ0A 1VP3A 4JUCA 4LXQA 2C9ZA 2X2OA 5C8YA 4L74A 3WKCA 4US2R 1ID8A 3TEMA 4A0HA 2XUPA 2WSYB 3KZMA 2VC9A 5K2MA 1Z0KA 3RJ9A 3EDCA 4R1SA 4NI5A 4CMEA 3S8MA 2ZTHA 1OX5A 1DIGA 1NXQA 1N6IA 3QXXA 2CZGA 2Q4BA 1U0JA 2JK1A 5J2UF 3BOSA 2AHOA 2E21A 3U2MA 3RIMA 4O2AF 2PJZA 1YVDA 3B0UX 3NETA 1EHYA 2GB4A 4EB3A 3W2IA 1SA0B 4TMKA 2HDHA 2JHAA 1IZ8A 4N5HX 3UV7A 2WIAA 3HR4A 1JAIA 3KQWA 4G1FA 3UHAA 4XPIB 2QSUA 5BQIA 3AIKA 4M1QA 3GP3A 1ENPA 4B7XA 2FN4A 2IGBA 4E3ZA 1DBSA 1X70A 1SHZA 4AULA 3LLVA 2ZXWC 3AG1C 3ZVMA 4QGGA 2R8OA 1WSDA 1G5ZA 3E1KA 4KR0A 1WXEA 3RBAA 1SK9A 4AZWA 4RTNA 1NI3A 1HY5A 3AESA 1YU9A 3RYCA 4Y0AA 3ROPA 3WV5A 5KOYA 2CDCA 2WZFA 1GCAA 2FJUA 3GLGE 4J1TA 4G56A 3L9XA 4N3CA 4YMLA 2J59A 1WB4A 4ULWA 1E69A 4G5RA 1RYMA 3AEUB 2ZYUX 2JD2A 2IOYA 2FF7A 2O8CA 2ODAA 3VV2A 3G4XA 1PZGA 4ND3A 2LCQA 3KZKA 4OA5A 3GV0A 2WFLA 5TXGA 3P94A 5HDQA 3D5TA 1YBVA 2IEZA 4H2DA 3ZU6A 4X61A 2QRVA 3RRMA 2W9XA 1JMKC 4FMCB 3GZNB 5A6SA 1WW8A 3EG5A 1P2BA 4XSHA 1FDSA 2OHOA 4RQBA 4EMBA 3PC2A 2DM6A 2OUKA 3CZQA 1K88A 1QF6A 4OGWA 3UJBA 4UQOA 1T9GR 3DZFA 3V5XA 3TN7A 1MRZA 1QK3A 1H2BA 3TL2A 4NR0A 2JAOA 3NUQA 1P7CA 3A32A 1XTQA 1M7BA 4PYMA 3AC0A 5EJFA 3FNIA 4MR7A 3PF8A 1PGNA 1GPUA 3KB1A 4GZ6A 1A8IA 2G40A 3LUJA 3WQHA 1UZMA 4BFXA 4MTFA 4J7YA 1W4RA 2FE4A 2IZOA 2J0XA 2GZ1A 4JCHA 3H5OA 1IZMA 4F4HA 2JGNA 5KHAA 5EE5B 3W34A 2ZJ1A 4JCCA 2XOKA 5K8UA 1UFQA 3IERA 2HCJB 1AQYA 3X1MA 4PN7A 1UDRA 4GPIB 1I5OA 3W06A 1DL5A 4IHJA 4DWVA 3T7CA 5LZ5A 3OTIA 4I3GA 2MSNA 1QG4A 1U80A 3U4DA 4MW6A 4MYCA 4DR6B 4NX2A 2O3UA 4M2LA 1U5BA 4XTRA 2BTQB 4DJAA 4KAJA 3JRMO 2HV8A 4GL4A 3HKDA 5A0TA 1ULZA 1CE8B 4XCVA 4BVGA 1PEKE 3D6NB 2YIVX 1TO6A 3R3SA 4Q93A 1QTIA 2R48A 3LQ2A 2HSZA 3SSNA 4DF3A 2IC5A 2VYVD 3VBEA 3FSRA 3JARB 3KYJA 2P7VA 4UEJA 2Z9CA 5EHXA 2FW8A 1J0AA 1SIUA 1VPEA 2K87A 3TAXA 4KLZA 3V1NA 4JBNA 4PAOA 2ZBQA 2YV5A 1KAMA 3TJMA 3L1HA 4RMJA 1XRQA 4AZSA 1AIPA 1ZYRF 4B9EA 3H2UA 1WUTA 2ZJ6A 2HPAA 3QUAA 2XLOA 3U40A 4Q4AB 2W2QA 2D4UA 1R9MA 3ZWIA 3HA7A 4G1VA 5JP7A 4FYHA 1RRPA 3N5KA 4YONB 4NATA 5BVHB 2PA0A 4NE2A 3B3AA 2WVGA 1E64A 1MKYA 4IUYA 3A1CA 4UM7A 4ZVKA 1JHQA 3L1MA 4RDXA 5GGYA 1A9SA 2YNMD 3N24A 4WZBE 5I7VA 1NI4A 5LQDA 2XIJA 5JRJA 1FMLA 1P1IA 4BN5A 2COUA 2RHRA 4G23A 2EV9A 1XMJA 2NVBA 5CJ2A 2OZLB 4FNOA 5T3YA 2QTCA 3VKHA 2WKRA 4P7BA 3L0CA 4ZHQF 2MYPA 1L1EA 4DCPA 3H3FA 2GEJA 1C9NA 4HUQA 4QQ8A 4BFZA 1GKYA 3PDCA 4PYRA 5CB4B 2GAOA 4AY4A 2GNOA 2EZ4A 3TW8A 3BIFA 2ONJA 2AQHA 1UIRA 4B2YA 1XVIA 3UHOA 1ZRHA 3IYLW 3WP1B 5IDXA 3LUHA 3DAYA 3L4SO 1WM1A 3MTQA 4BECA 4R51A 3ZGNA 5KSZA 3CGGA 4J0IA 1P7WA 2A88A 2VAMA 3ZE9A 1Q11A 5KOHB 5FZTA 3DBVO 1UC4B 2V7QD 2EG5A 2R6DA 5HGXA 2GLTA 5LC1A 5DM4A 2DPHA 2VKTA 5EWMA 2YN4A 3RTGA 5AIAA 1T43A 5KHOC 1RC1A 2C4TA 2EARA 1DAKA 2ID8A 2NO9A 4B6FA 3AJ8A 4ARVA 4D26A 1B42A 3AUYA 3R0JA 2BFWA 5EUCA 4Q9HA 2QORA 4NZ9A 2XA1A 3U60B 3T7JA 3ZBTA 3ZY4A 4UBLA 2Q1SA 1O8CA 2BBOA 4YXFA 3RHZA 1YL6A 3SZLA 3T06B 3WWEA 4FGUA 3A05A 1I2CA 1MGPA 1TWCA 3FOWA 3HFGA 1C0PA 5A4DA 3NRCA 4PFPA 1H9AA 4X24A 1I2BA 3X44A 4TWBA 3D0KA 4XYLA 2H2GA 5DHQA 4HS4A 4JP8A 4LI0A 1L3IA 4MEAA 1NV8A 1O0SA 3MJDA 2HSDA 1Z28A 4QQKA 3OJWA 5KQGA 4G8CA 1RFGE 1M0EA 2QVYX 2W2LA 2CNWA 3ZDXB 2YDXA 1YCDA 2WA2A 4EYGA 2EZUA 3E9QA 4DV2B 4M86A 1G98A 2B8EA 2YZ2A 3Q0IA 4UDOA 2CNBA 2IHZA 3AEYA 5IT4A 3UMKA 3WO0A 1RQXA 3D8SA 3WX0A 1K97A 1WDTA 1NAIA 3P9IA 3IJ5A 4N3NA 2JIZD 1O9HA 1SU8A 1MMDA 5CGZA 4MCIA 1NDHA 1FUKA 4BGIA 2EJWA 4LFBB 1GTG1 5EE0A 5UKDA 1VSUA 1D07A 2V1XA 2AGVA 4KUHA 2R9VA 2BL2A 2DETA 3HKKA 3OZVA 2QRMA 3S2IA 3W7BA 5AM3A 4HGOA 3U3ZA 3DE5X 4UM8B 1T2NA 1TPZA 4IDQA 3KBOA 5H8WA 3P4UA 3WMEA 2P7IA 1POXA 1GV1A 3VR1A 5A6AA 2QR3A 4G8BA 4YX9A 1OZHA 2BCJQ 1RAFA 3Q3HA 5K09A 4U7DA 2Q3FA 1UJ2A 4OHYA 2L9JA 1IBLB 4YECA 5IC5A 4FR2A 1C9EA 2IXMA 4GPTA 3U3FA 1YZ3A 4B6PA 3ZOKA 4L76A 4J0CA 2OKGA 3UMSA 4PLPA 4PFSA 3JR3A 4EQ6A 1UKEA 4RACA 3T15A 1X7ZA 1O3UA 1TQ4A 3U3DA 5FIUA 1RZVA 1YMVA 4Q3AA 3V9PA 2LTAA 1VXOA 1PFUA 3R7CA 1HI9A 2YKGA 2QTWB 3GLRA 4TMZA 1KEEB 3IOYA 4KYTA 1C3EA 1GRCA 1I1QB 2JVIA 3ESAA 3REGA 5IWAB 5KQLA 3DEKA 2DGJA 5L3SA 1E1KA 4UXJA 5JYEA 2P61A 1FXWF 3A6HA 4BYMA 4MDEA 2UVPB 3P32A 3FI9A 2G70A 3W6UA 1OW8A 2WHRA 4P3KA 1S4QA 3U56A 1AA6A 1GHTA 3HXLA 4X1IA 4HAVA 3RK1A 1SF8A 1FP7A 3PD7A 2X7XA 3PEEA 1YOVB 4DN6A 3TTTA 4EITA 1KJ8A 3UFXA 2H92A 3ZI7A 3S2UA 3QW2A 4QXAA 1JG4A 3S55A 1JBQA 2QLNA 3GLGB 3EGDB 5K01A 3QEJA 4UW9A 3Q7QA 4H1HA 5LQSA 4COOA 5A6JA 3KKKA 3SIRA 3T7RA 3ZNQA 2NUTA 2Q3HA 2F6RA 1KE1A 4CUZA 3UAYA 3QXSA 5BQHA 1Q5PA 3TIIA 3VR5A 1RXEA 4RTRA 3E70C 4J7TA 1S3SA 4IZOA 4UPVA 2Z8YA 3HZZA 4US1R 1HORA 3O8LA 1T2CA 4E0BA 2B98A 4KN5A 1E2FA 4M7RA 4GYWA 3B8EA 4MKIA 3BK1A 5BQOA 3L0YA 3IKVA 4UAGA 3OTOB 2QJRA 1YO6A 2NQ8A 4HQ0A 1YR2A 4MCJA 4BJ6A 1MX9A 3II6X 1ITZA 5LDHA 2H1HA 3PNKA 3CZRA 3G2IA 2VJAA 1UKBA 4IG9A 1GTL1 3HCWA 4UUBA 4Y2VA 2HA0A 3UHFA 2FWBA 4YREA 1ABFA 2OESA 3WMRA 1YZHA 1P31A 1R4MB 2J1LA 5IZCA 2O1EA 2C94A 2JW5A 3VPFA 2HLDA 1UBGA 1D7AA 1B8OA 3UMJA 3KWMA 1IZ9A 4ECEA 1HZJA 1MD9A 1FBTA 1JSZA 3GMSA 5KWIA 3A10A 4Q05A 1C2YA 2IY7A 4QJ5A 1RHUA 4PG5A 3S40A 5JAUA 3ER6A 2DT8A 2CXOA 3FFBA 2B1RA 3JRXA 4IJ6A 2G5GX 4IV0A 2WHPA 4JWTA 4IH9A 3L92A 1OKKD 1VB5A 1JEDA 3VMFA 2PGLA 2NU6B 4U2GA 2HZ8A 4FYJA 2B1IA 3RS7A 2QTLA 4Y18A 2WJ4A 4HRAA 3W0LB 1PLJA 4K0KB 3BERA 1DQZA 2QI9C 1KQGA 2DYKA 4E21A 2ZYDA 4J0JA 1EDEA 1FX0B 3LSTA 2PLFA 3CTPA 1ZHHA 2OE2A 1KKLA 3G50A 1R66A 2WUDA 4HVLA 2H2HA 2PG3A 4HAZA 3U7QA 5MGNA 3IVMA 4H0CA 1PYGA 2FWPA 5CIVA 4BQOA 2J8WA 5LNK1 2GF9A 3C3DA 3GEGA 4BWVA 4YYZA 3D81A 2D6FA 1IDOA 2FP4B 3RSFA 5AK3A 1TTQB 2B8TA 4AURA 4C01A 3U39A 2AK2A 5AR1A 3U9LA 4DXDA 1NR1A 3NHLA 2J8ZA 1CY0A 4O3FA 3MJFA 4ICIA 3FBGA 3SR3A 1K5GA 1UPTA 4INJA 4KREA 3Q6NA 2ZLBA 1O6BA 4XLZA 1QNFA 5KX5A 1NT4A 1Z4JA 1Q0MA 2QVXX 1C14A 3HVUA 2GFHA 5IJ9A 3ACDA 4WLEA 4KBGA 4M22A 3S1AB 2PRIA 3KM0A 2P6OA 3CUWA 3HFSA 2XQFA 4R01A 2LRHA 5BV8A 2KJQA 5A02A 1GEEA 2R7TA 1CC1S 3QRWA 2EFCB 2PXXA 2QQGA 5DGHA 4U9HS 4GPBA 4RV4A 3R5XA 2A84A 3MYIA 3BWDD 2EJVA 3CFYA 3ESZA 4K86A 2IUUA 1ESCA 3KPUA 2Z3ZA 4FEAA 4RD1A 3S29A 3N75A 4WZBB 4FWTA 4E5VA 3WL7A 2XLHA 4H17A 1Y3DE 1FTWA 2Q5OA 2FP3A 3IB6A 4Q3LA 2XUKA 1NQXA 4UNSA 2E4XA 5KNLA 3ZJTA 3EHDA 4G84A 2I4LA 2WVQA 3WODF 4NBVA 4KR6A 3P0HA 1F4PA 2QB5A 1MGOA 3EEIA 1EEXB 1WCYA 3TLKA 1HXHA 3NBAA 2PZGA 2HK8A 2WT4A 4XLTA 2ZJ5A 4TMVA 2JLUA 2IYOA 4MVYA 1NU9C 4M0LA 2WG1A 4DXAA 4HL6A 4OHVA 4AXBA 1EM8B 4OSEA 3LLMA 1N5OX 5HQ3A 1Q50A 4P4LA 3LYLA 4KFUA 2A59A 1A5AB 4MUMA 4CEJB 1VKHA 2J6BA 4RA9A 1VPTA 1USWA 2FHSA 3A1WA 1RD4A 1HDYA 4GBGA 3QV1A 1QORA 2F62A 3ZBPA 3BKXA 3BEDA 5T6MA 3VVCA 3KOOA 3I01M 1SQ5A 2ZBVA 5KTTA 2P5SA 2ZWMA 1VBFA 1L4EA 2XVYA 3SN6A 1A1SA 4OI1A 5FPTA 3OCWA 4BNLA 2ZULA 4CIAA 1E6LA 1CFZA 2CK3A 3OUTA 3G7SA 3QPWA 4NK5A 2IXBA 2UUIA 1YQQA 5HRUA 3H65A 5AW8A 1NRWA 4DG5A 1GZVA 2IH5A 1CUZA 1KSGA 4PV7A 1JDTA 3C8HA 4MUBA 2XLBA 3E3LA 3TPZA 2OCGA 4YLEA 1MTOA 2WLSA 1ABEA 3FPJA 4FQ7A 3IKTA 3CNLA 5B7GA 3KKLA 4EWLA 5FR2A 4BATA 1QH8A 3CISA 4ZT6A 3HCRA 5CFLA 1C3LA 4CDVA 4EY3A 3CAXA 3ZDYB 1A3CA 5JEDA 3G23A 3K2EA 4GNKA 1VMKA 3IA7A 1KYZA 2R68A 1EFPA 4ZAXA 5KVAA 1KDOA 1JQAA 1TYAE 5FPYA 2IX9A 8ABPA 4CTJA 1XEXB 2AOUB 3DOJA 4Q9NA 1N6KA 1AV6A 1XDWA 5TEVA 5K0FA 4OHZA 4Q3KA 4HYEA 4G0MA 5BN4A 4CG1A 4PCUA 2YW2A 3SXMA 1Z4OA 4Y2UA 4BNKA 1MQSA 3E9CA 2DUWA 3RGGA 2EPMX 3KQVA 2DHRA 2GBPA 4YI3A 4DEVA 4N76A 2JAXA 4PZCA 2X3FA 2D1SA 5FNVB 3FGNA 3ASYA 4JVLA 4Y30A 5C2JB 4CCSA 3UMVA 2HRCA 3PPYA 3TSYA 2C88A 1QZZA 5K6AC 1Z62A 3FJYA 3M6FA 4JE9A 2PZFA 3KUCA 1OW7A 1Z37A 5DWQA 4TWRA 3OT4A 3H9JA 3WSTA 1UPUA 4LLCA 3VO2A 1PBTA 4AX8A 1G8MA 1SY7A 4F3YA 1YDHA 3ZH9B 3IC5A 3HP4A 4ZZIA 1JP7A 4H3KB 4Z8XA 5JRAA 1N9GA 3FBTA 2YYZA 4R9RA 3UKDA 1ZI8A 1TAGA 4BQPA 3SXZA 3VZDA 3P4YA 4O33A 2ILTA 2Y68A 2A68F 2MINB 3ZJVA 3DMTC 1KORA 3FWNA 1HV8A 1UMCA 1K40A 3W4JA 4D3YA 4W5TA 5KIAA 1KK2A 3O4GA 2OMEA 4ER6A 4I9HA 2XCUA 1E1YA 2X76A 4ZTBA 1X8LA 2WSSD 2PUHA 3HO1A 1YWGO 3UNGC 2XGMA 2SKCA 4HH4A 5GP1A 1ST3A 4JSRA 1MC1A 4W6QA 4M6WB 1ZM9A 4ER7A 3OF2A 2BFAA 1FMJA 5FTJA 3N07A 4NCNA 1VP9A 2WAAA 3QYAA 4N0EA 4KRYA 2J5QA 2FPKA 2R1TA 4MVQA 2XYGA 4PZYA 3PNMA 1RI3A 4JZYA 1BC5A 3OIDA 1KR5A 4CS9C 3TVTA 2VJPA 3DHWC 2V4MA 3S90A 3B82A 3HLZA 5KYXA 4RA6B 3B0PA 3UA3A 2JA1A 1K7FB 3QBTA 3ZKAA 1JAHA 4IDAA 3GGJA 2EBHX 1P9WA 3GT7A 2H7BA 3FCCA 2AT1A 3NHRA 2O48X 1CIJA 3LPAA 2FTKE 2XGJA 4BEWA 2W22A 1RADA 4URXR 2R97A 4LWZA 3ZWDA 3UPUA 3VVBA 3OETA 3PR1A 4PWZA 5JXGA 1EWRA 4NBSA 4JC8A 4UDVA 5LQAA 2V98A 1XD2B 2AIRA 5AVVA 2YHSA 4BVEA 3BH6A 2VRNA 1KHTA 1XP5A 3M1CB 5HMLA 1VPVA 1QHSA 4LC9A 1EH5A 4ITUA 4E5PA 2R66A 1H0RA 3E61A 1C9KA 2ZWIA 3BWCA 4ZT4A 2VSXA 1X14A 2XEDA 1H5NA 3NBFA 3BGWA 1DG1G 3UYLA 4RETA 3V2HA 2XNJA 2CEAA 1ECBA 4U2KA 4OAOA 3GCXA 3DYVA 5JS1A 2QUKA 2Q46A 2XY4A 5K0BA 2SKEA 4FMBB 3FI0A 2I6FA 1R8JA 3FRHA 4BNGA 3U0CA 4JT2A 3QZCA 1W5FA 3K9QO 1A77A 3ZV4A 3TZLA 4UU8A 5JNLA 4I99A 4WA7A 3RYHB 4P32A 2EKBA 3KYIB 3SC4A 3BIWA 4BB6A 3EDQA 4UASA 5TT0A 2XTNA 1XDBA 3SDSA 4CI0B 3HXQA 3DL4A 3RG2A 3K1ZA 4JYCA 4XRRA 1RFLA 3UV3A 4TWIA 3EIXA 4EVQA 2OC9A 2OL4A 4KYVA 3FHLA 5C37A 5JXWA 2ZSIA 2I4TA 3HUDA 4JDUA 4ID3A 2XB2A 1ZQ1A 4WW0A 7REQB 2GXSA 4GOXA 3JYLA 3K31A 3BQMB 2HHCA 3QJGA 3P7MA 1XX6A 2VAVA 2Y99A 3CNBA 3TEJA 2AQKA 4LHVA 2BYTA 2VHXA 3MS7A 4INPA 5CDFA 4EVSA 1MT3A 4YP0A 2NT4A 1KXZA 1DHTA 5HW0A 4Q1VA 2OC4A 1NPDA 2GPJA 1EVLA 1BWSA 4V0SA 4UZFA 1HEYA 2HOQA 2YV1A 4Y98A 4C3ZA 3NBKA 2G71A 2VNIA 3BTSA 3OMXA 2E9SA 2WF8A 3T35A 2P8JA 3QBVA 1Q92A 4D5EA 4FHCA 5DLDA 2FCRA 5CYPA 2A14A 2ALJA 4ATNA 1E9AA 4YQZA 2VSYA 3QEMB 2A6PA 3D02A 3ZIBA 5E9AA 1EKXA 1EVKA 1EJBA 3HCNA 3CB2A 1WWKA 2R86A 4M55A 1XF1A 4QDUA 2CNOA 1CRZA 2H48A 5E6RA 3OKAA 1ES9A 3OFKA 1OB2A 2WUWE 5TX7A 1K86A 1XDGA 1ENYA 3AXSA 3ZKWA 2W6IA 4HH3C 1L8OA 2NVUB 1VK5A 4R9NA 1U5CA 3QIVA 1CY1A 1IHOA 2O7SA 5FFNA 3TNDA 3GCDA 1NUPA 1JE1A 3DE9A 1K7SN 1NFQA 1BCRA 4LQLA 3KKNA 3DPIA 3K8OE 4QIHA 1ZOIA 1I51A 4NCJA 2P1RA 4GVLA 4Y9UA 2NXNA 1DKUA 4HEQA 4I7EA 1B7GO 1NQOA 2CHEA 4PG4A 2GO7A 3U4GA 4X20B 2A9VA 4OXNA 6AT1A 4GUAA 2M1XA 4O25A 1PNRA 3BICA 3RNOA 4MIKA 2FN9A 4ZALA 5ESRA 4ZAYA 1FSZA 2PRYA 2Y0PA 3GQBB 3G9XA 4TZ6A 1R37A 1K7XB 1INLA 2QDXA 4JGGA 1NIPA 3G5LA 1B0AA 4RLFA 4D0RA 3AGQA 2BDEA 3GT3A 1BW9B 2DE0X 1DKRA 3LO5A 2AEMA 2Y1DA 4S1VA 3ZLTA 2IEDA 1OWOA 4N3GA 3W79A 4LCJA 4Y1RA 4E7PA 3PNVA 4TTTS 5LB2A 4M8SA 4L08A 1JU3A 1EFTA 1RCUA 3TFQA 2WSIA 2JCYA 5A7FA 3FZYA 1FL9A 5K8VA 5EHNA 3QEAZ 3GT4A 4NCKA 5ALPA 4D2IA 2PFDA 1EVEA 1CUAA 3ELBA 4YY3B 1D0ZA 2Z6VA 3I09A 1LY1A 5FBHA 3AL2A 3LUAA 5AJZA 2P2NA 4C4YA 1OH6A 1Z0SA 1TF7A 3T9OA 5ADVA 1H94A 3QGMA 3QE0A 1IYZA 4KFCA 1J2TA 4RJKA 3MWFA 1CUGA 4YJ2B 3L0IA 4CS8C 1XZCA 3PENA 4YXWD 3AHGA 2QRUA 4HQLA 3O0DA 3CCCA 1NU7D 1U2QA 4L22A 2WKSA 1GUAA 2EFGA 3WLFA 1L4HA 4B48A 5JECA 1Z7GA 4JVSA 2JLBA 3RB8A 3WL4A 3K30A 4U6NA 1XZQA 4RADA 1XWFA 2VQSA 4LYGA 4Y2SA 1NYRA 4FZJA 1DUVG 1AK2A 4YRTA 3SM9A 5K5EA 1R0LA 8ADHA 3THSA 3VPXA 2RGUA 1U9IC 2HMVA 4ISCA 4DDMA 2O7VA 4GKAA 3S27A 4OQMA 1HGXA 4ZI7B 2Q27A 1NBIA 1S2GA 3VR2D 4DQVA 1E4OA 4PLZA 2AB0A 1OILA 1KFJB 1VHTA 1VMAA 1O5OA 4TSRA 3E7WA 4WA8A 1M2EA 4QU5A 5EHQA 1CBUA 1UDCA 2X9GA 5CX4A 4MMXB 5FNZA 4PSKA 3VHLB 4FJ2A 1I3LA 3BXFA 3T9FA 1OXBA 4O29A 1N5DA 4TS1A 3A9UA 1WETA 2WIFA 1KYQA 1XLUA 3HDYA 5I9NA 1L7NA 1RHJA 3G7UA 3BMCB 4E7SA 4MKZA 4CTNA 2EX1A 2VRCA 4BVLA 2IWHA 4YFVA 2WILA 3Q3CA 2BCGY 4CZ2A 1F6DA 3FN4A 2H7OA 2D00A 3C48A 3R1IA 2JFGA 3MBOA 3ZLUA 1CRPA 3FSGD 1HE5A 1T8UA 2GARA 2XUIA 3QKUA 4K05A 3RS5A 3KQUA 2PHZA 4H1TA 2QN9A 1T0IA 1XA4A 5H4GA 4I14A 2DQKA 1ECGA 3ZE2B 1QS0B 5ICCA 4OFBA 4DTIA 2ERYA 3LESA 2Q1YA 1GP2A 4ERNA 3ICOA 1ODIA 4ME6A 5J2TB 1SAYA 2BEKA 2HO4A 1EUCB 1FQOA 3GJ3A 4MVJD 3TQSA 2J9FB 2PS9A 3JZFA 4KO4S 1JR2A 5ENVA 4WACA 2KK1A 3IIKA 4F8JA 1E8DA 2WTBA 4MVJE 2Q9UA 4A8JC 4S0XA 5JATA 2DTXA 4HGZA 2WZBA 3TLXA 5DN6A 3P2KA 2AW3A 3PUHA 3U8PA 5LOVB 4Y9SA 1BQ4A 4L73A 4WKPA 3LE8A 4RGQA 3A1SA 2ZJAA 2IYZA 3DBLB 2XMGA 4O8ZA 4FEGA 3LI2A 3SU8A 3R6TA 3JWEA 4IQ4A 3A0RB 3DS8A 1QKKA 3TDKA 4C43A 3N2YA 7MHTA 3C15C 2R96A 5A3VA 4RANA 3WQBA 1L4UA 5ECGC 4WKCA 1EE9A 3L34A 2JLAA 5I7SA 2YL0A 1NJ5A 1I3CA 1Z2PX 2I99A 2GXAA 4KAAA 1NC3A 2QP3A 4P5DA 3LUKA 3LVBA 5EYPB 3HR7A 5KVVA 4LF6B 1FDTA 4YI5A 5DHUA 4EY6A 4V0LA 3BILA 1UJBA 4G25A 3LS0A 1W93A 3FYSA 3I58A 5L0JA 1A5BB 1NQVA 4QDJA 1ZOPA 4QTXA 1AQJA 1O5HA 2PUTA 1DDOA 1CWUA 1UBSB 4UD2A 1UT8A 2OBMA 4KRGA 3DULA 2FPWA 2GN0A 2JNWA 1AHPA 1Q84A 4MUNA 5WRFA 4LYHA 4DREA 4I0WB 5CFOA 1G18A 3BAFA 1XTIA 4WI1A 3G5MA 3L40A 4ZV4A 5C4MA 2Y3HA 1GJRA 1ESMA 3LEVA 2R9RB 2PUEA 1K7YA 1Y1KE 3TXXA 4YCLA 3JWPA 4K0RA 3M8KA 1DO0A 5J4KA 3WLTA 2FMTA 1R4ZA 4B3MB 5FLYA 3ONNA 2FVYA 3Q8XB 3OECA 2JIOA 3ZE8A 1CGOA 5JH7A 2P9GA 2Y9PB 5B3IA 5REQA 2KBEA 3TZCA 4ZEMA 3W6PA 4O1HA 1KS2A 3R8CA 1KMNA 1OCOC 4RL4A 3VSCA 1JJAA 3U4QA 3LXUX 2FR8A 4MS3B 1FP4B 3GRUA 4WWHA 3EIOA 2V3VA 2GTPA 4N5LA 3V7FA 4J91A 2H07A 3UJNA 2GEVA 5DFAA 4JIMA 5IT5A 3CSUA 3WY9A 4BQSA 3NKLA 3N8IA 5HOEA 4GMHA 1S6YA 3NX4A 1B1AA 2C98A 2H3HA 5HILA 2LP4A 1EDDA 1PG0A 3GDHA 3TCXB 1BRTA 4R8MA 3LP8A 1QFJA 1ZGHA 3OF3A 3K0FA 4BX8A 4MI9A 2HCFA 3PB3A 2OLJA 3WAQA 3NZEA 2JLRA 5ALDA 4FCTA 1B2RA 4ARZA 4R8RA 4CQMA 3Q5GA 4F2GA 1E7WA 1YS7A 4QBHA 4E2WA 4LS3A 3P9CA 4ZEVA 2P4SA 2R5FA 4QOGA 4UUOA 1V96A 5KYWB 4C7XA 3WLNA 3ST7A 1YAHA 4AKIA 4BP8A 5JD6A 2WJWA 2WMOB 5TMBA 3ADBA 3T61A 2HQBA 1LRJA 1WB9A 1HRKA 4EFDA 1RMTA 1LV7A 4O4JB 4RE5A 3OX2A 1DKNA 2ZOSA 4QPCA 4FLMA 3SM3A 2VZ9A 1JKJA 3OEYA 1AZTA 1FNNA 3VX3A 4GYKA 2AOWA 1EXMA 2BFEB 3MRTA 1K3UB 3RU2A 4JI1B 2E82A 4NG5A 2X8JB 3AG3C 1O54A 4UARA 1QCDA 2PKYX 4XVCA 2CSXA 2P30A 3DJYA 2DG2A 4YT8A 1QRAA 1W29A 4FFOA 2QYOA 1QAOA 2JBAB 3DWGA 3OWOA 1JMYA 1NLUA 2DKFA 2ZUCA 4TV9B 5EMLA 5BV0A 256BA 1F2TA 3IP8A 1E1QD 4JQSA 1PD0A 1SXGA 5ALGA 3WNQA 3IQCA 2VRWA 3OICA 2OMKA 5I4IA 2WFMA 1JHZA 3RQEA 3DGFC 5E0OA 1QP7A 3U2QA 5KWEA 3WRYA 5LL6P 4NC9A 3HCPA 4K7BA 3WFJA 2YYAA 3G2NA 4TMTA 5BUSA 1ZN9A 1TA9A 2V3CC 2QSZA 3A11A 2J6CA 4K9OA 2VRBA 2RGNA 1JKMA 2OXEA 3ETGA 4V1CI 4TUYF 4DWJA 2V7BA 4IFIA 1R0KA 1E92A 5AO9A 1MMAA 4TKLA 1ZK2A 4G0YA 3K05A 4ZOLB 2RCNA 2IX3A 4KMMA 2FKNA 3AB3A 2LCFA 1LE4A 2F1IA 5BYBA 4EI2A 5JQGF 4JGIA 5JROA 2O54A 4A5SA 4GEKA 3DDWA 4BBPA 2BMDA 1TFOB 3VOBA 3SJCA 4Z0PA 4OFXA 2ODEA 5LSAA 1WY7A 1DG9A 3UG6A 4MR9B 1L7EA 4ETNA 5IDYA 1SNYA 4TGLA 2CB9A 4RWEA 1O95C 1CB0A 3TZEA 2PWBA 3FZGA 3SFVA 3S8YA 1XMXA 1HFKA 1ZVMA 1ML3A 3IKMB 4KH0A 4LBYA 3IHLA 2AYZA 3WWDA 1PZFA 1QFXA 1G41A 1E2BA 4WHMA 5GAJA 4IEEA 3Q7IA 3KYCB 4NOJA 4PCVA 3RGWS 1XIVA 2ODPA 2X41A 2B9VA 3C6MA 5C1IA 4EI8A 1M73E 1F2UB 4YRSA 3LHIA 2HMUA 5TQ2B 1TJ3A 3DJFA 4MIEA 4P84A 3N3AC 3MA0A 5FI5A 4FILA 2FW7A 4GEGA 3HJAA 3CUSA 3Q87B 3IXMA 4IIJF 2KJGA 1MA0A 2Q28A 3BD8A 3UBMA 4G0QA 4HNTA 2G1UA 4PPYA 1EQAA 3UGKA 4GD3Q 1ECCA 4WESA 4KO3S 3JQBC 3BF7A 1S2LA 2NTEA 4CM8A 2EP7A 2E1PA 3X2FA 5DJ5A 4WLFA 3L3BA 2Y0EA 2Y1KA 3D6HA 2RHJA 1D2HA 2PAFA 1VJGA 3TB6A 4XX0B 3CKYA 4RWZA 3B3FA 1SGWA 1FSSA 4I4TB 4FAPB 3NEYA 4ZJZA 3VRHA 5D51S 3D7MA 2CF5A 4QJ3A 1X0VA 1L7CA 1LLCA 4D02A 3RC1A 1WP9A 5FBZA 1EFRD 4JLOA 5EERA 1R8YA 1W75A 4G85A 5ERXA 4KK3A 3GLIA 1O0CA 4WBXC 2ROQA 2VZLA 1FB5A 3HR8A 4DIMA 1UMBB 3UC9A 2AWNA 4BO5A 5EL0A 3QITA 4CT5A 4HBGA 1GZHB 2D2VA 4TRNA 3FTPA 2GWRA 5K4GA 1S2NA 2J3QA 1KMHA 1X0XA 4TKMA 1MMNA 3WHKA 1IG0A 4C0XA 1Z5ZA 2FAPB 1QGYA 3MG9A 4GLBA 3DA8A 1J70A 3AZPA 4LN1A 2H4HA 1ZD3A 3AHHA 3GIWA 1NX6A 4HPJB 4WLUA 4I9UA 4LHSA 3IVRA 2W71A 3HXOA 2CMDA 5IANA 3M1IA 2A1TS 1JJ7A 5AW6A 4KXLA 4CHGA 2AOTA 4JIGA 4C7BA 1NSGB 1YJ8A 1A88A 3NRJA 2EFYA 1VB3A 1I7PA 3K1HA 1VJ0A 3OHPA 1RXIA 1M2OA 3UANA 5GPBA 2FFRA 1VI2A 1Z2EA 2W58A 4G63A 2ECPA 3CA8A 1C5KA 3TRJA 5GVSA 1K5HA 3CRNA 2OZVA 4D0GA 3G0OA 3CF0A 5A06A 1KYVA 3FDZA 2X7JA 2WOJA 3TLZA 1UH5A 1WD7A 2Q5HA 4G1UC 4AG6A 4IQ0A 1XTBA 1NZEA 1Y5LA 4WFQA 2F3PA 2DUMA 1J0XO 3VR4D 2G8LA 4NDAA 5K0IA 4LNUB 2XUDA 4URUR 3OTQA 1LV8A 1JWBB 4MUEA 1I1OA 3CMMA 1D2CA 3LPDA 1OGYA 1FF9A 3G0BA 3ISTA 5F9HA 1AM4D 1S7ZA 4ZXFA 2ORED 4LJ4A 3N6RA 1XV5A 4PX5A 1RWOA 2XNHA 1JHXA 2Y71A 1IXYA 4YO7A 4WVLA 3N2EA 3BD9A 4EG8A 2R00C 2V6FA 1C3XA 4RH0A 4JA0A 2Z98A 3ZUPA 2VF7A 1WNFA 1TZKA 3PQFA 4V02A 2P1AA 1ZC4A 5TDHA 2R8XA 2ZPAA 3SIPA 3ROGA 5KMGA 5LQNA 1B0PA 3QYPA 1JYFA 3AHIA 1YV9A 2HFIA 4JLMA 1U4OA 4ON9A 4RKFA 1QGED 5ECWA 3N74A 4GYTA 4O3MA 2DR2A 1R7RA 4ZQCB 3JZAA 3FWZA 2X86A 4N18A 1P2TA 4XA8A 3X1OA 5K1ZA 4ROSA 2Y1XA 3RCBA 2YR0A 3SS8A 4AJEA 1K27A 4BNHA 1RQ7A 1YOBA 5JR3A 5I48A 3EAGA 4XWJA 1DTEA 3FAJA 3OOJA 2NT3A 5BNWA 4FR5A 1S9DA 3HDJA 1I14A 3QXHA 3KT8A 3DE8A 2DWUA 5E8RA 4X0RA 3HB1A 3DCIA 1LD3A 3GP5A 1MNDA 4CQLA 1C4OA 4E1AA 2ERCA 1UBNA 5ICSA 1S7CA 4MKRA 4DCOA 3U7IA 4CQNA 3JALA 4NNPA 1RI4A 3DYIA 3Q88A 4HB2A 1PBNA 3T1QA 4ZYTA 2OLKA 3I2HA 1B6RA 2E5WA 2W2KB 2DBVO 1E9RA 4E46A 3ZV3A 1U0NA 5IM4F 1GDDA 4IFBA 1GZ4A 4AJ2A 1E4YA 2IXEA 1JHPA 3S2GA 1AA9A 4RJJA 3Q7PA 4Z2YA 1W2GA 3FROA 1YRYE 4WINA 1N6RA 4BCBA 5BN3B 2A6HF 4NMHA 1IY0A 3ZGZA 4GOJA 2XD9A 1YACA 4DDKA 2OFOA 4X71A 1DOWA 4QATA 4V2IA 4IAQA 1C4XA 3EXIA 2VTDA 1U7WA 2D2XA 3GH1A 5BSRA 1CY2A 4AUNA 1MEJA 1SKBA 2IQIA 4PBTA 3MWEA 2BDUA 1XYYA 4RVHA 6NULA 5CH8A 2W6JA 4F4JA 3D3JA 1E2JA 5INTA 3NWEA 3MGCA 2EZTA 1H85A 2GHRA 5DNWA 3M5CA 4Z1MD 4LOJA 1QOQB 2BEWB 5DNYB 1LZKA 1FZQA 5CCBA 4TKVA 1XVUA 2A9KA 4NCIA 4ETWA 4EZEA 1NLXA 4IIYA 3RU7A 4ZK6A 4KX3A 4C7OA 5BRJA 4LHYA 3Q0TA 3MEQA 3EHNA 3UK6A 2I6UA 4ND4A 2BFDA 3R7AA 4IRXA 4RHCA 1VL2A 4OHPA 2G17A 2XXBA 1XMSA 4Q9DA 3ITNA 4XPWA 1WZNA 3UN1A 1YB5A 4RVCA 1R6UA 4YGXB 5AC4A 4DA4A 4G9GA 3STYA 3MVEA 2VOEA 2EPOA 3L43A 5JISA 3OESA 1I1NA 1E4EB 2IBTA 5G3ZA 2B78A 3UW1A 4B7ZA 4QDLA 1KERA 1TIKA 3C3AA 2ISQA 3AR2A 3ZHQA 3FX2A 5CK5A 2RHTA 2CL7X 3RVBA 2H8GA 1YZNA 4Z8YA 3LMKA 1Z4IA 1Y3CE 4M60A 3ZXYA 4OU5A 1LBTA 2RFLA 3FWHA 4EJ0A 3GGDA 4MOWA 4R9VA 3RJ5A 5HIAA 4H1WA 3RROA 2JIDA 3VR4H 3O4JA 1CK4A 2H16A 3P2YA 3PA8A 1YHNA 5AXDA 1B74A 4EUKB 3DMGA 3DMFA 2RGWA 2HYDA 2O0KA 4FFBB 1MBZA 3C6YA 4PLTA 2JD0A 3NG1A 1UXJA 5BN5A 3PXEA 1Z36A 4DIKA 2IZ7A 2AJCA 5E3AA 5KPJA 1P45A 4OQQA 1SPXA 2QV0A 1NAHA 2BKVA 1BX0A 5KYGA 3JYOA 2X5KO 1QDLB 1H9BA 4OIPF 1YUNA 2J67A 4MIYA 1TCAA 3V8VA 4EF5A 4YRMA 4BLTA 5IH7A 4UEOA 4OJYA 1XN1A 3GH3A 3SZMA 5DLEA 1CJMA 2A5FA 5CJJA 1V35A 1MO3A 4PAWA 2GD1O 1A7AA 2XKBA 3SBDA 3TRDA 2RE8A 3L0BA 3TG8A 5ERYA 1SKYB 4N8DA 3J7TA 4YHHB 4UOZA 3U26A 2QE7A 4YJFB 4PZUA 4LJSA 1BG6A 5A6VA 1KS9A 2ZPTX 1I7LA 2IP1A 4X64B 1KVTA 1NMQA 4NBWA 3NYWA 1Q14A 3TTUA 3LHFA 5FXMA 1T0HB 1MDBA 4JEHA 3E15A 1C1XB 5A5VA 5KO2A 1BE8A 1I13A 5HIJA