4YT8A

Semet-labelled hmdii from methanocaldococcus jannaschii
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
344
structure length
344
Chain Sequence
DNMKVSVYGAGNQNLYINKLNLPEKFGGEPPYGGSRMAIEFAEAGHDVVLAEPNKNIMSDDLWKKVEDAGVKVVSDDVEAAKHGEIHVLFTPFGKATFRIAKTIIEHVPENAVICNTCTVSPVVLYYSLEPILRTKRKDVGISSMHPAAVPGTPQHGHYVIGGKTTDGKELATEEQIKKAVELAKSAGKEAYVVPADVSSVVADMGSLVTAVALSGVLDYYTVGRKIINAPKKMIEQQVIMTLQTMASLVETSGIEGMVKALNPELLIRSASSMKLLDRQKDLDAALEILQNLDETLKAEVEKAEIKPTTLVAAQSLVKEIKTLIGGAAAEGAIKRSARKLFEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords H(2)-forming methylenetetrahydromethanopterin dehydrogenase-
publication title Towards a functional identification of catalytically inactive [Fe]-hydrogenase paralogs.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
total genus 114
structure length 344
sequence length 344
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03201 HMD H2-forming N5,N10-methylene-tetrahydromethanopterin dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1300 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4yt8A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4yt8A01
2HRZA 4CV3A 5JAQA 4EEZA 2GLXA 3JQAA 1UZNA 4R68A 3SJUA 3K92A 2VT3A 1ML3A 3BMQB 1ADBA 4HFRA 4DYVA 2WE7A 1UZLA 1DLIA 1N9GA 1ULUA 4OIMA 3PDUA 2QW8A 1TXGA 3WS7A 1XG5A 4LW8A 4IIUA 3WNVA 2Q1TA 4BUCA 4PG6A 4QXMA 3ZH2A 2Y68A 3EZLA 3LF2A 4R1NA 1EZ4A 2JCXA 4HFMA 4Q3NA 2PGDA 2O3SA 3GRKA 1KEVA 2QIOA 1YBMA 3MEQA 4CUKA 3DZHA 3VZSA 4UUNA 4IZHA 4HWKA 2VZ9A 4Y98A 3V2GA 4HV4A 3CPSA 2ZTMA 1E0DA 4JP2A 4AJ4A 4E5NA 5U1PA 5TX7A 4RZHA 5A04A 3SJ7A 4F3YA 5A3JA 1ENZA 4KUGA 2V6FA 3PJDA 1JKIA 2PKQO 2AEMA 3PHJA 2X58A 3AUUA 1GEGA 3GDOA 1M2WA 1YBAA 2YFQA 5IF3A 3L4BC 4XA8A 4YDRA 5A9TA 2J5RA 2P5YA 1P1FA 5BSHA 2Q4BA 3HDYA 3TZQA 2HMUA 2Z5LA 3VPHA 4J91A 4NBRA 4WNCA 3AY6A 3OJ0A 5C7IO 3AK4A 2GASA 5DT9A 5U9CA 1YL7A 3AUSA 3WGOA 4BNJA 3H4VA 4CM4B 2Q2WA 1DIGA 4A27A 2ZJ0A 1V8BA 4RPLA 1SMKA 1CJCA 5B4UA 1E7WA 4WLOA 2VYND 2ZQZA 2FR1A 2R00C 4GGOA 3FNGA 3IJPA 3RUDA 4A73A 2ZB3A 1IHYA 1WMAA 3QVWA 3NT5A 3S2GA 4GX2A 3WQRA 3W6ZA 4FFLA 3UGKA 4J4TA 1Y9AA 3DOOA 5HM8A 4X54A 2BGKA 2C2YA 2H1SA 2JD0A 1PJ3A 4Z6KA 1PJQA 4J0FA 4YPOA 1JN0A 3WMXA 2NU8A 3ROMA 3AY3A 3RASA 1EQ2A 3OA2A 3LSYA 4R1TA 2YYYA 3MTJA 4O59O 2OGUA 2NVUB 3QIVA 4DRYA 2Q1UA 4NG5A 4BNXA 4NNJA 1IY8A 4BO9A 1DRVA 1U3UA 4DC1A 4J7UA 4MP8A 4BO5A 4S3MA 2A94A 4MVJG 4ITUA 3RCBA 2IODA 5JCJD 4K9DA 3DZGA 3FSRA 3JYNA 3PIDA 1O95A 3NTOA 2AE2A 1QG6A 4Y6SA 4YAEA 3TL2A 2PTGA 2DPHA 1HT0A 4MVJD 1Y5RA 3VH3A 4GVLA 3GRPA 4TRNA 3STHA 3SBOA 4AJEA 1DIHA 4KP7A 1UDAA 3JQ9C 4BV8A 5JDCC 3U4CA 5JY1A 3PWKA 1PGOA 3OJEA 4ZU3A 2QYSA 4N18A 4WEOA 4IIVA 4CR7A 2FWMX 2XOXA 5CDYA 3PP8A 3ZV4A 4RVHA 1E5QA 3GEMA 1SB8A 1KOLA 4CLHA 1VSVA 3NT4A 2WD7B 2EP5A 3L4SO 2AEJA 2CZCA 1XKQA 4IJUA 4NK4A 2WEKA 4PCVA 4WOKA 1T2FA 2I5PO 3DO5A 2Y0CA 3QV1A 4R4JA 4AJJA 1IULA 5JMPA 4Q39A 4YEDA 5BR7A 3HQ4O 3O38A 3M6IA 3U4HA 1B3BA 4IDBA 2GSDA 3K2BA 3EW7A 3RC1A 4QO8A 3AUAA 1EVZA 2HKIA 5CG2A 3WDSA 4GKBA 2ZK7A 4FGSA 4K26A 4KTVE 1HDZA 3AFMA 2YHIA 1DC4A 1ZK3A 3S8MA 1CERA 3GVIA 2O7QA 5JC8A 4N5NA 3JQBA 2QZZA 1YBVA 3ZCXA 1B14A 1Y8RB 5IDXA 3KOUA 2O23A 4XRRA 5TT0A 1PQUA 4XQ9A 5AXBA 3RUAA 1T2AA 2DTXA 5T57A 4PLZA 4BNIA 4B8WA 4BNGA 4ZJUA 3H5AA 1KYQA 1B8UA 3NDIA 4H7PA 4UVHA 3BAZA 4GX1A 4DLBA 4HXYA 4RLHA 3ZWOA 1C3VA 3DBRB 1NR1A 4RQTA 3U62A 2ZCUA 2YJZA 2AA3A 1DAOA 3GEDA 3Q9NA 1GEEA 2YQ5A 4DPMA 4A7PA 4PZEA 1IB6A 2VNSA 2VUSA 1BXGA 2X0IA 4B8ZA 4NU5A 4O0LA 3LYLA 1UXGA 1OC4A 3R6DA 1R66A 1W73A 3GNQA 4CMGA 3H65A 2Y66A 3ROPA 5CPBA 3UCFA 3D4PA 4CM9A 2FY8A 4J1TA 3TZKA 1Y5MA 3DBLA 5JY6A 4OXNA 5L40A 5CG1A 1V35A 4PLPA 1KEPA 2Y1EA 1DFHA 2DBVO 4CMIB 1N1GA 4J7CA 2BELA 4M87A 2JL1A 4P38A 2Q50A 4XYEA 4R9SA 2EXXA 1LNQA 1T1RA 1EK5A 1E6UA 2VCYA 3RUEA 3ZWMA 1E77A 3QP9A 4L9RA 3WSVA 5GZ1A 5JXWA 3RIHA 1ZEMA 2X0JA 4IPTA 1E7QA 3E5MA 2AEFA 3OJOA 2D2IA 3QVSA 1KIFA 2AHRA 4D44A 1Y1PA 2CVZA 4HP8A 1HDXA 2SCUA 3ZWYA 3ZWXA 1ARZA 1LU9A 2P4HX 4R1UA 4BV9A 3OQBA 3L77A 1GADO 3ZW8A 3WGZA 5IDYA 3TSCA 1AE1A 4MKZA 1H0KA 1B15A 2OBNA 4RZIA 1K0UA 5BT9A 3B1FA 1CDOA 1N8KA 4IS2A 4FS3A 4L75A 1NX6A 1ZK1A 4UEKA 3P2OA 2O2YA 1E3LA 4B7UA 1I36A 2EJVA 1ZXBA 3G79A 4TROA 1NPTO 3ZGYA 4JCOA 4NH4A 2FSVA 3QSGA 4BO8A 4WASA 3C8MA 4CMEA 4DYDA 3GR6A 4IMPA 3Q3CA 3FHLA 1YJQA 1LDYA 4TRMA 2GZ1A 2YHIB 1A9ZA 1ZBQA 4HY3A 2FZWA 2WD8A 3N7UA 1ONNA 1IZ9A 1LLUA 1GPJA 3NTQA 3AUTA 3I52A 4IZIA 4QTZA 3Q6IA 2VZ0A 3ETDA 1GZ4A 3DQPA 3IJRA 1EEHA 4MVJP 2Y1FA 4ZRMA 3WGYA 3V1TC 4U0JA 2HMSA 2X0RA 4XQEA 3GZNA 3DONA 4TRJA 2C5AA 5GZ6A 5BNIA 1VKOA 4O5OA 2D5CA 3P19A 3UF0A 4D79A 3H2ZA 1RJWA 3ZNPA 5KJ6A 1BXKA 3KB6A 3QVTA 2PD6A 1QYCA 3D4NA 1JKFA 2P91A 4BGVA 4XGIA 4NR0A 3LZ6A 2Q99A 4OYRA 4E5YA 5F1OA 5I7VA 3EMKA 1DFIA 3DZBA 3H7AA 2FRDA 4YJHB 4CUZA 3ZNOA 1XU7A 3LQFA 1GZ6A 4KDFA 3S2FA 1NFRA 4NI5A 5IN5A 1QYXA 4GPD1 1LLDA 3VZRA 1ZVMA 3R3SA 5I9MA 1I5RA 3GVXA 3SXPA 3UH1A 4TVBA 3JQFC 1D4FA 5IZCC 1BTOA 2HSDA 3AJRA 1KBZA 2GUGA 3WNQA 1VRWA 4EI2A 4PG8A 2XF8A 1WLYA 5AYVA 4L0QA 1F14A 4RDIA 4Z9FA 4OO3A 3LT4A 3F4BA 2PNFA 3F1LA 3PGXA 4U6SA 2AE1A 2NUAA 4LK3A 5K6AA 3DB2A 3W6UA 4BO2A 1ORRA 4DREA 3GG9A 4II3A 4YA6A 4R5MA 1LEHA 2CNBA 3A28A 3ZNQA 4BB5A 3JD1A 3FI9A 4B4UA 4LVCA 3CIFA 4UUPA 4XCVA 3GY0A 1WP4A 2J3HA 1N7HA 2DUWA 4FB5A 1C0LA 3GF4A 2ZB7A 1E1NA 1GQ2A 1CYDA 1NFFA 1OBFO 1GFSA 1RKXA 2VYVD 3KHUA 1NBOA 5TJHA 5B4VA 3UHAA 5KVCA 4LISA 1I2BA 2C07A 3ITKA 2Z1MA 3HE3A 2R2GA 3WG9A 2WWRA 4FFMA 4PLFA 1MB4A 1GUYA 4OSPA 5TJ9A 3FN4A 4XQGA 1ZFNA 1V3UA 4FPXA 3EVTA 1ZSYA 5TNXA 3QA9A 2P9GA 3F6YA 3CKYA 3NJ8A 3JYLA 4CM6A 5B12A 2WYUA 1M66A 1ZZEA 2PGLA 2X1HA 3PXXA 4WLEA 3A9WA 2PZJA 1YQGA 2GCGA 2V6MA 1OAAA 3INTA 3LC1O 1MUUA 2ET6A 2W2KA 4EGFA 4TKLA 2EP7A 3PTZA 3OIDA 3DHNA 4KUHA 4IDCA 3INGA 2D1YA 1BVUA 3BTVA 3B70A 3G0OA 3U49A 2RAFA 1A71A 4XYGA 4E6PA 3IMFA 5A4DA 3JQGB 3I9MA 1IZ0A 1N2SA 1QV7A 3HFGA 3GZNB 4RDHA 3OJFA 5KNLA 3DZJA 4IMRA 1HF3A 3H3FA 4PG7A 5B37A 1B2LA 4M1QA 3R3JA 4G65A 4F6LA 2X6TA 1E92A 2V6BA 1UDBA 1LXCA 5THKA 3KYDA 1O8CA 4I1IA 3NEPX 3WGHA 5KJEA 4J90A 4UUMA 3FRJA 4CLOB 1MXFA 4CLDA 1YO6A 3O8QB 3WXBA 3ZWWA 1YQDA 2AQ8A 2X8LA 3QHAA 2EIHA 1I30A 4DXHA 2CDCA 4CLRA 3NUGA 4QFCA 3I9KA 4J7XA 2B69A 3LDHA 2FP4A 4XB1A 3GHYA 2A35A 1PGPA 4ONEA 3QVOA 4WCFB 5IG2A 1G6KA 1NM5A 4XR9A 3AI1A 3OH8A 4CUJA 4L74A 1ZK4A 2A9FA 1EVYA 3B1JA 4CMCA 4YJDA 4ZQEA 3GH3A 1VE9A 1P31A 2HK7A 3DHYA 3ONFA 3OM9A 4W4TA 5IN4A 1V9LA 4R5HA 1YB4A 3RQSA 1I2CA 4NJOA 2Q1WA 4EDFA 3GN2A 1PL6A 1UP4A 2JFGA 4MO2A 4UULA 3GC6A 1ZIDA 1H6BA 3KSZO 3NYWA 2BLLA 2G17A 2NU9A 1PZGA 2VWGA 2VWQA 4BO6A 4RQUA 2AMFA 4BQRA 1XDWA 2QRLA 4RVFA 4IDGA 3VTFA 3C1OA 3INRA 4GLOA 5ITVA 1EQUA 2FPPA 1MLDA 2HUNA 2YY7A 2WSBA 2ZCVA 2GD1O 5DULA 3O26A 1UUFA 2GDZA 2YUTA 3QWFA 4RJTA 1KVTA 2FPIA 6LDHA 3ZHBA 3BIOA 2YFHA 1Y8QB 2NV6A 2X7HA 3M1LA 1YDWA 1JAYA 4HBGA 3I3OA 2CF5A 4OM8A 1HRDA 2B5WA 1DXYA 2JAHA 3TOXA 4ID9A 4BNNA 1H2BA 4XDYA 1MA0A 5ADHA 4E2YA 1QKIA 3AFNA 4WCDA 4ALIA 5BSGA 4E32A 3H9GA 3E9NA 4D0SA 4C7KA 1ADCA 2BF7A 3EHEA 3CSDA 3Q2IA 1TI7A 5IJZA 3FR8A 3WLFA 4BGIA 3T4EA 3PHLA 2I76A 4IGFA 4N54A 4TRRA 4ZD6A 4CQMA 1HLDA 1PL7A 3F4LA 4D7AA 4UVGA 3KEQA 4GQAA 1XLTA 4WJZA 1ZKMA 2EERA 3KYDB 3I9JA 4J0EA 4BMSA 3LU1A 4JNKA 1SEVA 4PG4A 3DMTC 2C59A 1U8FO 3ITDA 1X1EA 5C37A 4BVAA 5BQFA 5JNLA 1B8PA 4PZDA 4DBVO 3WGGA 4JK3A 2ZB8A 1ZK2A 2OZPA 3CZMA 4CLRB 4D46A 1NASA 1SO8A 3FTPA 5CEEA 1FDSA 4R01A 4RVDA 2D8AA 2GERA 4BNFA 1XWFA 4D45A 2Q45A 4UEOA 1RM4A 1J6UA 3IDSA 2C2XA 2IYOA 1UDCA 3VPXA 1DB3A 1PEDA 4I8XA 1FDTA 4J3FA 1ENPA 4Y6PA 2VHVA 2JAPA 2IEBA 1IOLA 4UREA 5GMOA 1ZSNA 3D7LA 4YJFA 4JQCA 2BH9A 2DT5A 3WBFA 5T5QA 1YL5A 4M54A 1ZUD1 4KQXA 2D5AA 4DA9A 2PGJA 1PZFA 4CMAA 4LMRA 4CV1A 3IKTA 4QX6A 4HNGA 4YAKA 2DBZA 3TFOA 1OMOA 1NQTA 4BKOA 4YBZA 1GCOA 3PEFA 3RVDA 1SCUA 7MDHA 5A05A 3ZW9A 3A4VA 4M86A 2E4AA 3RBZA 4IJVA 3RUIA 1DLJA 1B0AA 1XQ6A 5H82A 1NVMB 4RF5A 4E21A 3PLNA 4AJPA 4CMJA 1P1JA 3E48A 3NGXA 2DU8A 3FNFA 4QECA 1WAMA 3VC7A 2XXBA 5FEUA 4XWYA 4GVXA 3JD2A 1DSSG 4D3FA 4XIYA 2Y93A 3E5RA 3GLQA 2YV3A 4FCCA 1XGKA 2X9NA 2VRCA 4A03A 1GQYA 2CDAA 2EHDA 3FF4A 3KZVA 4DIBA 3PYMA 3GA0A 4AJNA 4QFDA 3OJLA 4YB8A 3DBHA 2C20A 3OQ1A 1O89A 1DO8A 3JQ8A 1QSGA 5TRTA 1D7OA 2Q2QA 2YDXA 4WPGA 3TZHA 1HE3A 3GUYA 5JDIC 3V1UA 5AVOA 3BMNB 3HB4X 5G0TA 1HDRA 2DUUA 4IDAA 3MWEB 4JBIA 4NHEA 4PIVA 4CMHA 1PJLA 3V5NA 4RV9A 3TPCA 3JD3A 1R12A 4WE3A 1RM3A 2E48A 4FFOA 4W6ZA 3OECA 4J2HA 2PFGA 5ITWA 2VHXA 2FPGA 4BGEA 5KJ1A 3W8DA 1ZXLA 1YKFA 1DOHA 2B0JA 2CMDA 5FI3A 4ND4A 4W9NA 1LUAA 1GUZA 2WMDA 1E3WA 5JYEA 1VJ1A 2CF6A 2VNAA 1SPXA 3P7MA 4JIGA 4DIFA 1O5IA 4ZGWA 1O9BA 1Y6JA 2FHSA 1WNTA 3PJEA 1B16A 1E7SA 2DVMA 1NR7A 2I3GA 2O3QA 3GNTA 3HB5X 3I4CA 2JHFA 3QQPA 4YT8A 3B20A 5LCXA 1EDOA 5BNFA 4BKUA 1U2GA 5JS6A 2PD4A 4E2WA 2PV7A 4IQGA 1IE3A 4DPLA 3U9LA 2HAEA 4YTEA 3RBVA 2EEZA 1UXKA 1X0VA 2O50A 1TT5A 4MVJF 5FI5A 2QYTA 3HUDA 3PHIA 3JV7A 4BL5A 4A2CA 2BD0A 3PRJA 1SC6A 3UAGA 4LRTB 2ZQYA 1VSUA 3F47A 3BMOB 3KEOA 1QLJA 1KVUA 1I01A 1X14A 4BO7A 1X0XA 2B4TO 4AFNA 4MDHA 1P1IA 1R15A 4WEQA 4CQLA 3KYCA 4ROSA 1RM0A 2X86A 4IXTA 3L6EA 2HLPA 1M75A 3OFSA 3U09A 3ADOA 3BYZA 4YT2A 4IUYA 1LBEA 4BNYA 2JHGA 2RHCA 3EUWA 3WWYA 1U1IA 4JX8A 5T8KC 2F00A 3W4JA 2E6UX 3GQVA 4XYMA 4BNLA 2J6IA 3ABIA 2WJPA 3AI3A 1NYTA 1EVJA 4FJ0A 1WZIA 3JSAA 1UZMA 2QRJA 3HADA 4BNVA 3A06A 4J6FA 3NKLA 4GMFA 1LSUA 2OP0A 3ICPA 3JQAB 4OGWA 3RC9A 3ZU4A 5KTKA 2CVOA 3FWZA 3NJ4A 4NIMA 2ZTUA 4I5DA 4EITA 5ILOA 3Q1LA 4FC6A 1N9GB 2EKLA 4F6CA 3E18A 4BMVA 1EUZA 1PGQA 1Y81A 4JXKA 2P5UA 1P44A 4R9RA 2BMAA 3MWDB 1CEQA 4OKNA 3DBHB 2B36A 3H9EO 1MC4A 4U0KA 4B7XA 4XYLA 3JQ8B 4UVDA 5L9AA 1DC3A 3GEGA 3KLMX 2B35A 3DDNA 1I2ZA 4CM5A 2NU7A 3ETGA 4I5GA 4ND1A 4CJXA 4MVJI 1E3JA 5JAIA 2BI7A 2EWMA 1ISFA 2PK3A 1PZHA 3AWDA 9LDBA 3VKVA 4CLXA 4YRAA 1C1XA 3TFQA 3TOZA 2P68A 1JA9A 4CM8A 1RYDA 2GN4A 1HLPA 1KERA 5I8ZA 1H9BA 2ILTA 3K8ZA 4CM9D 3UXYA 4NJMA 5KVSA 2DC1A 2YZ7A 3UCEA 4Y9DA 3ZV3A 1YL6A 5B1YA 4D0RA 1LQUA 5C7OO 1P1KA 3KBOA 4CL3A 4R41A 3LK7A 3AU9A 5B4TA 4WKGA 4URFA 3H5RA 3F1KA 3PIIA 2GN6A 3KSUA 3WYBA 1LDNA 1ZW1A 3PQDA 1E7YA 3L4BA 4DLLA 3RUCA 3WBBA 3T7EA 5IDWA 1VL8A 2TMDA 1PGNA 4CODB 3F5QA 3EK2A 2D59A 4OKIA 1CETA 1V3VA 3IP3A 3O4RA 4YAJA 2G76A 4DMLA 1I3LA 4CR8A 2DM6A 1O0SA 2Z95A 3U0BA 1U7HA 1PWZA 2BKAA 1A4IA 3L6DA 5BSFA 2EJWA 5L7YA 4MVJH 1T25A 1EBUA 5KKCA 1NPDA 2R00A 3HZZA 4CQLB 1YB5A 4NFSA 3OSUA 3PGJA 5DOVA 2NVWA 3ORFA 4LCEA 1NHGA 5G4KA 4ZQFA 5CDUA 1UH5A 5JAZA 4PLYA 3E1KA 4ZVVA 3TJRA 5CEJA 1DC5A 3FNEA 3K73O 3WGQA 4AJHA 3WQSB 4D43A 4XD2A 1HZZA 4H16A 2H5LA 1YJ8A 1VJTA 4J1QA 1Q7GA 2I99A 1R4NA 3EVNA 5EQDA 1XSEA 4WCFC 2Y67A 1JTVA 4KDEA 1IPEA 1MXHA 5LDGA 1EE2A 2VTEA 3D1LA 1PJ2A 3UOGA 3ZV5A 3SVTA 4D41A 3UW3A 3G49A 3WGTA 3WIDA 4A5OA 3S1LA 3E6AA 1QRRA 1PIWA 4OJNA 3WR5A 1ISHA 3NV9A 3RUFA 3X2EA 2OP1A 1YWGO 1SAYA 1U8XX 3E82A 1U2DA 4JJFA 4IDDA 3KTDA 1QYDA 1NWCA 3BTOA 3VVCA 3G1TA 1Q2XA 2VHYA 2B5VA 1LC3A 3JQ9A 1P9LA 1FK8A 4WLNA 4RF2A 2EKPA 4E13A 4GBJA 3GMSA 5JDCA 3TDKA 3VKUA 3BHIA 1C1XB 4CM8B 1M6HA 1GDHA 3AOEC 2Y1OA 1YXMA 1QORA 3OETA 4INAA 1ZK0A 5HS4A 4GX0A 4AJ2A 4JGBA 1VKNA 5FFFA 4NJMB 4LCJA 1E5LA 4ZQBA 4HFNA 3AW9A 1H6DA 5EQFA 3K2EA 2XPCA 1GYQA 4L76A 1D3AA 1T4DA 1C0IA 2DBQA 1LLCA 1TLTA 1WDLA 4FN4A 3WJ7A 4GSLA 1E7RA 1PTJA 2JCYA 3DTYA 1N5DA 5T67A 3CTMA 2HO5A 3OICA 2E49A 1YGYA 3NT2A 4MPDA 3K96A 2CD9A 2I3AA 4D3SA 2IYPA 4MINA 4EYEA 1VC2A 3D3WA 4CV0A 3AOGA 3FR7A 2HJSA 4L8VA 3WX0A 2HJRA 3G1UA 4IY1A 1BW9A 3BMCA 3E8XA 3D3EA 2Q3EA 5ILGA 1EFKA 3EGOA 2DFDA 2B4QA 4EUEA 5JSFA 1BXGB 5DF1A 3FPLA 5HS6A 3DOCA 3DOJA 1X7GA 4IGEA 2NWQA 1UR5A 3ZZNA 3IC5A 3IP1A 5AQ1A 1H5QA 5G4KB 5JO0A 3PWZA 3NRCA 3OEWA 1ZJYA 2Q1SA 5CEFA 3C7DB 3AU8A 1HDCA 2J3JA 3DBLB 4PVCA 1IPFA 1QYWA 3S2IA 3PI7A 3RC7A 1PJ4A 2UUOA 2NADA 5I9NA 4NMHA 4BO1A 2Q2VA 1UJMA 3H2SA 5LDHA 1H6CA 3DWFA 3D0OA 4RPHA 3GGOA 3WYCA 3WFIA 3SX2A 1PSDA 1BDBA 1HDGO 1F12A 1K6IA 2CVQA 2DQ4A 3MCVA 3ROKA 3GHHA 1Z7BA 3FBGA 2WTBA 4PG5A 4JJGA 1L7DA 5A5FA 4U7WA 3DFUA 2Z1NA 2J5KA 4IQ0A 4M49A 1KC3A 5JBIA 3VH1A 2VUUA 3X2FA 4OXKA 4OMUA 1E1KA 4DGSA 3JQEA 3KRTA 4IJKA 1W8DA 5J23A 4O6VA 3UKOA 2BGLA 4BNWA 4BOYA 3PJGA 1U5AA 2BI8A 4RVGA 1Y7TA 2EV9A 1GV0A 2PR2A 1AHHA 3F5SA 4DQVA 5L4LA 2FZEA 1E6EA 3HFSA 2BGMA 3TNLA 1HXHA 4Z9YA 2PZLA 5COAA 2VOEA 2J8ZA 1PS8A 3EZYA 1EVIA 2X23A 1TVEA 2H6EA 1C0KA 1FJHA 4L73A 3TZ6A 4YRBA 2I65A 2ZIZA 4I9UA 1EMDA 1HZJA 1GYPA 1U28A 4RF4A 1ENOA 3LLVA 3HDQA 4FDAA 2GYYA 3VVBA 3ASVA 3ZWCA 4Q3CA 1EBFA 4K6FA 1D8AA 2IE0A 2OOSA 1HETA 3GGPA 2PZMA 2VOJA 1HDYA 4TWRA 1E6WA 4RPKA 1RWBA 3QWBA 3RD5A 3S55A 1ISJA 4GSKA 4Z3DA 3BTUA 2RBEA 4J4HA 5DCUA 3BXXA 2NQ8A 4MVJM 5F1KA 3UCXA 1JKJA 3D3WB 1LLQA 1Q0QA 5JO9A 2OXIA 4WLFA 3L6OO 3ANLA 3BTSA 4J1NA 3CH6A 1WDKA 3BMCB 4JP3A 4H15A 1DIBA 4RLSA 3TZCA 3VOSA 3D5TA 1BWSA 1AXEA 1R16A 2X5JO 1EFLA 1KY5A 1F8GA 3A14A 3JD0A 4FJ1A 5A3VA 4NU6A 5GY7A 3PWSA 1FF9A 1Q0LA 3IUSA 3QWHA 4Q3AA 1LRJA 3RJ9A 3IAHA 1Z73A 1WW8A 3K30A 2C0CA 1ZCJA 3F9IA 2RCYA 2FOIA 1JQBA 2VQ3A 4UEJA 1KETA 4NDNE 1EUDA 1G1AA 1MG0A 1DJQA 2PH3A 1CQJA 4ND3A 3DHEA 3CEAA 1J0XO 4B3JA 2XXJA 4U8GA 3MJTA 2NACA 3ZHXA 2NSDA 1PGJA 3PYLA 1DHRA 5T6BA 3GT0A 1R4MA 2RIRA 5CDTA 2X9VA 3QRWA 4O1MA 4B3IA 2VHZA 4TZTA 3RFXA 4LRSB 3F46A 1T24A 3N74A 1LRKA 3JQFA 3VH4A 1E3EA 4Q3BA 4OL9A 5CDSA 5IZCA 1I24A 2BFMA 3NDJA 2NU6A 3DBVO 2EF1A 1F06A 5DN9A 4NPCA 5ENVA 2C54A 4Y6RA 4GX5A 4E2XA 4D42A 3DAGA 1ZEJA 3UICA 4J49A 5JLAA 1Q7CA 2R6JA 4DL9A 4CQMD 4EJ0A 3OHSX 4CMKA 4MIOA 1OI7A 3EAGA 4F46A 1AHIA 3DC2A 3H9JA 1ZO8A 5C7LO 3GNSA 4HNHA 1H6AA 3SLKA 4KOAA 2VN8A 4IDEA 4JBGA 4NBWA 3GZ4A 2OMEA 5FF9A 3WB9A 1VPDA 3DL2A 3C3XA 4PGFA 5THQA 1GQQA 5C5IA 1EK6A 5KCZA 1SEPA 5CHEA 5DCYA 9LDTA 2O4CA 3A1NA 3GOHA 2EW8A 2NTNA 2OO5A 1T26A 5F1PA 3TRIA 4WECA 1Q0HA 4XB2A 4WLUA 4BO0A 4YWJA 2W2KB 4AICA 3H9UA 1C1DA 3FWNA 5A9SA 2NM0A 5TGDA 5T64A 1D1TA 4MIEA 3HWRA 1AGNA 3OIGA 4U6QA 4PLHA 4A0SA 4ZN6A 3TF5A 3O9ZA 3L9WA 4E2ZA 1MC5A 4FFPA 4PLWA 1V0JA 2NVBA 3BMQA 5K0ZA 1AN9A 4KUEA 4CV2A 1A7AA 1ISIA 4FQ8A 2BFOA 3NTRA 1KC1A 3MJCA 3OEYA 4ILKA 2GN8A 1AXGA 2V6GA 4RO0A 1NQOA 4L4SA 3GAZA 1LJ8A 3AM4A 4WLVA 4BKRA 2CUKA 1WWKA 1GZ3A 2OORA 4LGVA 1V3TA 3IKVA 3E9MA 4RPJA 4NK5A 4BIIA 2VWPA 3CINA 3ENKA 3C85A 3QVXA 4TVOA 6ADHA 1LSSA 2YV1A 3PQFA 4FD3A 5ICMA 5IFLA 3PK0A 4ESOA 4R16A 1DJNA 5TLSA 1ZMTA 3JQAD 3S2EA 4HUJA 1GCUA 2J3KA 4E5MA 2NTVA 2EG9A 4TKMA 3ZV6A 2RH4A 1IHXA 3KVOA 1XEAA 5AXCA 4AVYA 4J1SA 5HBRA 3ZWNA 4G81A 1HDOA 2VRCD 4XR4A 1H94A 2PZKA 1LSOA 4FJ2A 8LDHA 1G0NA 1DPGA 4I9HA 1ONOA 3GFGA 5EESA 3I6IA 4NFHA 1K6JA 1FMCA 1HE4A 4FBGA 1EDZA 3TWOA 4FFRA 2AQIA 4CM4A 3JYPA 4PLCA 4DTIA 4E5PA 2O3RA 3JQ6A 4TMFA 1LRLA 2DTDA 3NDRA 5A06A 4XZ3A 3ON5A 5DDIP 4CM1A 5CDGA 1U5CA 2YQ4A 3VHRA 5JCXA 3ZHYA 1R37A 1YB1A 4B3HA 1LX6A 4YQZA 1ID1A 4KTTE 5EJ2A 1B8VA 4PRKA 4GMGA 3DMYA 5ENDA 2FMUA 1VI2A 4RVUA 3W1VA 2TMGA 1XIVA 3LC2O 1U7TA 3UUWA 3KXDA 2YW9A 2QG4A 3KV3O 3PPIA 3COSA 3V2UA 3I4FA 4FC7A 4O63O 4XGNA 1HE2A 2OUIA 3ENNA 3HSKA 4BNZA 2QQ5A 2GR9A 5L45A 3QWAA 3IS3A 3Q0EA 5I7SA 3V8BA 4EZBA 1T4BA 4MKRA 2J5QA 1GTMA 1R6DA 4RF3A 3GAFA 4TZKA 4DLAA 4E30A 4BNMA 1U3VA 5TQVA 4CPDA 1XQ1A 4MP3A 1JVSA 4OH1A 4EJ6A 2DTEA 2NVUA 3MJVA 2HDHA 4GL4A 2YDYA 4J9VA 5ER6A 1UAGA 3U4IA 2CDBA 3RWBA 4C4OA 3UN1A 1QR6A 2H9IA 4B7CA 3WWZA 4EUHA 2AXQA 2JD2A 1GYRA 3FCOA 4Q3DA 3G17A 3EC7A 3CXRA 1BGVA 4EJMA 1BHSA 1L1FA 2X5OA 1LDGA 3KUXA 5ER9A 1GY8A 5G0WA 1P1RA 4CQMB 3AI2A 1P0FA 1JWBB 5A02A 4ZQGA 1SOWA 4AJIA 3RU9A 2POQX 1E1MA 4CR6A 2P9CA 2HK8A 5FWNA 4Z3KA 2UAGA 4YRDA 3T7CA 1ONPA 4FOSA 4AJOA 1W4ZA 1QXSA 2H63A 3VH2A 5KIAA 3C1AA 3I5MA 1J5PA 4OQYA 4RL6A 4UUOA 5JC1A 2WD7A 3MTGA 4FR5A 3D64A 5U4QA 2HU2A 5AOVA 3VPSA 3RC2A 4XX0A 5DBGA 3LF1A 3PVZA 3DMTA 1X13A 3V2HA 3W4IA 1VM6A 1UP6A 5H83A 4JN6B 4IINA 2I9PA 3JQBC 5IAAA 1PX0A 3ZHZA 1FDWA 2C82A 3ASUA 1T2CA 3K9QO 2W2LA 3HNPA 1I3KA 4IJWA 3RKUA 1K5HA 4YJGA 4YJFB 3ANMA 3JQ7A 5FYDA 2HMVA 3GGGA 1DBVO 1Y8RA 2GPTA 2ZTLA 3OQ6A 1KVSA 1ZSVA 3E9QA 4RPGA 4BNHA 3GK3A 5KVVA 4FOOA 1JAXA 4ALNA 5EMHA 2OHXA 1P45A 2IZ0A 3RFTA 4R51A 4OOEA 1PJTA 3DBRA 4XJSA 3FBTA 3RAJA 1OZAA 1PR3A 3IQDB 2G5CA 2HK9A 1R0KA 4Z0HO 3K5PA 4A10A 2WM3A 1ISMA 4YYZA 4ALKA 4C7JA 5IXYA 3I9OA 3WIEA 4YCAA 1UAYA 2P4QA 1MG5A 3CMMA 3I9LA 3ETEA 3C7CB 2AQHA 3AM5A 3PZRA 1GV1A 5IXSA 3DZFA 5JW6A 4FW8A 1R0LA 3H8VA 4ZA2A 1A9YA 5L7WA 4U5QA 1YS4A 1SOVA 5F5NA 1O94A 4MP6A 2IEDA 2ZYAA 3TQHA 3Q2KA 2I66A 3N58A 4TSKA 3PFFA 4L4XA 3F3SA 4QO7A 5F5LA 4E31A 2Y05A 3TN7A 4CMIA 4YT5A 3LC7O 4MKXA 1JW9B 1MP0A 1YRLA 3CZRA 1VLLA 5A5EA 1HSOA 1NWHA 2GNAA 1PL8A 1DRUA 2FSSA 2LDXA 4JLWA 4LVUA 4AJKA 4W99A 4N5MA 4DPKA 4E33A 4DMMA 2A92A 5KJFA 2FR8A 1FXSA 1PQPA 4NBUA 2VYNA 4IXWA 4ND2A 3HG7A 1N92A 2O3UA 4QSMA 4DWVA 5JDIA 4WUVA 3RFVA 1GR0A 1U3TA 1VL0A 3GVCA 4BQPA 1DDOA 3PYXA 1CF2O 3RI3A 4W7HA 3QW2A 3DXFA 1Y9EA 3WFJA 2AQKA 1LSJA 4K28A 1E3WB 3NGLA 1Z45A 3ZNNA 3I6QA 1LDEA 4CMEC 1Q1NA 2X9GA 3W4KA 1NQ5A 4I5FA 5HTOA 3C7AA 4R54A 1SNYA 2VZ8A 1NXQA 4AJLA 1LDBA 2GZ2A 1T1SA 2IDZA 4ZQHA 2O48X 4EBFA 3M2TA 4DC0A 3PFWO 3EDMA 1P0CA 3GPDG 3V1YA 2DKNA 2V7PA 3U4DA 5G2OA 5I7FA 2ZATA 1A4UA 4BB6A 1TT5B 1NTOA 4PN3A 1X7HA 3C24A 3PHGA 1P3DA 5JCJA 2PD3A 4YJGB 3JQ7B 2GF2A 5HWSA 2PLAA 3HN7A 2AG5A 2W98A 3CE6A 3DEYX 4Q9NA 1XR3A 4MVJA 2EGHA 2O7SA 3GDFA 1UXHA 4LSWA 1S6YA 4JROA 4HKTA 4ALMA 1G0OA 1HWYA 2WYVA 1P74A 1I33A 3HHPA 3DTTA 3KYCB 1B3RA 3LVFO 2O2SA 1KEWA 2VUTA 1I32A 3LT1A 3VZQA 3PDJA 1DRWA 3D4OA 3JCZA 4WOJA 4KMSA 4MJLA 5G0UA 2BRUA 2V65A 2X4GA 2F1KA 4BNTA 2O3JA 4RCVA 3H5NA 1M6WA 3IL2A 1PR9A 3O03A 4YJHA 2Q49A 4Z0TA 1YH3A 3L0DA 1VJ0A 3PZBA 1ENYA 1U9JA 5T8KA 5KJCA 4FGWA 3EYWA 2G0TA 4UAGA 5I8WA 5L51A 4B4WA 4RVSA 4BGUA 4DUPA 2A4KA 1H93A 1IL0A 3QJ5A 1P33A 4K6CA 5K6AC 5I7EA 1ADGA 1KS9A 3H9QA 1DHTA 4HADA 4N7RA 3HDJA 4GH5A 2UUPA 3ZWBA 3IIEA 2B4RO 3AM3A 1NVTA 3ZU5A 4YT4A 4RORA 4R3WA 3GDGA 3K31A 4BO3A 2CSUA 1N1EA 1QLHA 1BSVA 4P4LA 3AY7A 5AXAA 2HCTA 3DAPA 3KM0A 3KLPX 2HMTA 5BSEA 5AXDA 2O4UX 1YONA 2E82A 4LMPA 4I9NA 3PLRA 1XYGA 3FTNA 3HN2A 1GD1O 2GO1A 2W8ZA 3RSHA 3DZKA 1YVEI 1YQXA 3H6KA 4OAQA 3GG2A 5DP2A 2X5KO 1XHLA 3RJ5A 1W6UA 2EGGA 4GKVA 2QHXA 1X15A 4K1LA 1WVGA 3GUCA 1T2DA 2JFFA 4EEXA 1LA2A 1PS0A 4AG3A 2G1UA 1BRMA 4J43A 1ISGA 4ZICA 2DPGA 4BMNA 2GZ3A 1J4AA 3ZWVA 1UXIA 4NBTA 1KVRA 3TL3A 3EY4A 5BNTA 2DAPA 1H9AA 1TT7A 4DQUA 5EN4A 4IQ8A 3JQDA 3OIFA 4IDFA 4YR9A 2OBYA 1HYHA 1NVGA 2Q4EA 1LQTA 1UP7A 5L4NA 4NQZA 4XJTA 2GN9A 4E5KA 3FPCA 4II2A 4E0BA 5IZ4A 1RM5A 4XDZA 2IZ1A 3VAZA 1FDUA 4E3ZA 1TB4A 3Q11A 1DEHA 1SBYA 5L3ZA 3JQGA 4L4RA 5EPOA 2JKVA 1BVRA 2OL4A 1NNUA 1RPNA 2VWHA 2VRBA 2O3TA 4J9UE 1TEHA 2C5EA 2ZTVA 2XAAA 4GWGA 2GRAA 3MOGA 5F21A 1KY4A 3CMCO 4ND5A 2W4QA 3LT0A 3E03A 1K3TA 2ZB4A 2WYWA 4DBZA 1P1HA 4R1SA 5KOIA 5L53A 4AJ1A 2C29D 1R4NB 4HFJA 4S1VA 3WLEA 3ZU2A 4XIJA 1A72A 4CLOA 3KO8A 3OP4A 1WDMA 1Z6ZA 3O8QA 4WNIA 4Z0PA 3ANNA 3WSWA 2DFVA 4YAIA 1B26A 2RHRA 3GVPA 3WQQA 2FN7A 3ADPA 1Z82A 5DP1A 3W8FA 3VPFA 1NAHA 1JWAB 5MDHA 1JU9A 2DLDA 2Y1DA 1TA4A 4R69A 4WCFA 1X7DA 3RUHA 2W90A 4JJIA 1C14A 2PY6A 4LN1A 1F8FA 1HSZA 4UVEA 4A26A 4PFJA 5TC4A 1SB9A 3BA1A 3HJAA 1MV8A 4OHUA 4P4NA 5L95A 3R1IA 4QT0A 3U5TA 1QV6A 3OA0A 3NAQA 4RGBA 3WYEA 5KKAA 1EE9A 1MX3A 2UV8A 4XEHA 3D5QA 3JQCA 4GLLA 1YE3A 5COBA 3IOYA 5ES3A 5LC1A 2Y99A 1BG6A 3RU7A 4XYBA 2JD1A 1I3NA 3KSDO 2HQ1A 2Y0EA 4B4OA 3QWIA 3WTCA 1E1LA 4G2NA 5G0VA 5TF4A 3SLGA 1GU7A 4P4GA 1CQIA 4FFNA 2NTJA 4CMBA 3P5SA 2RH8A 1WPQA 3AOEA 4IS3A 1W0CA 1BMDA 3BZUA 1DAPA 2YV2A 4UVIA 1WXDA 3QE3A 1Z74A 1U4SA 4CLEA 3T4XA 3JYQA 1NHWA 4ALLA 3VPGA 1Y8QA 4PLVA 4H3VA 1P77A 4FSHA 4I5EA 4OQZA 1B7GO 2Q46A 1XCBA 3P2YA 4J16A 4W7IA 3I23A 1Z7EA 4DIOA 1A5ZA 3MJ4A 3I1JA 3RBXA 3LLSA 1BW9B 1E3IA 1ZH8A 1GPDG 1HL3A 4M89A 4R3NA 3W8EA 3WJAA 1I0ZA 1ADFA 3ZWPA 1CWUA 3L07A 1DFGA 4J2OA 1I8TA 1DIRA 5JYDA 3SC4A 4XGKA 3ST7A 1DC6A 4QUKA 3DAFA 5A03A 1MFPA 4J4BA 5DBIA 1PJBA 3B1KA 5G4LA 1YOVA 2J3IA 1UXJA 3OF2A 5JPIA 4CM3A 1I10A 2VYVA 3KYBA 2JJYA 3PJFA 2Y1CA 3SC6A 3VDRA 4NBVA 4DVJA 2VTDA 4KWHA 4OOFA 4PVDA 1MGOA 3JTMA 1R0SA 4ALJA 1L7EA 4Q3EA 3PHHA 3ZU3A 1PJCA 2PKRA 1A7KA 3CUKA 2D3TA 3OMLA 2P9EA 3MJSA 5DBFA 1BDMA 2IXBA 3ZWAA 3K6JA 3HDHA 3M1AA 3H3JA 5EIOA 4BNUA 4M8SA 1OOEA 4M55A 5K9ZA 2WDZA 3ZI0A 1F0YA 3BHJA 1JVBA 3RKRA 1VL6A 1LDMA 1AUPA 3LT2A 3NX4A 1BXZA 1QYVA 3VDQA 2CY0A 4Y67A 4BKPA 4IM7A 4KWIA 5DZSA 3OBBA 2E37A 1HYEA 4ZHSA 1PS9A 4D3DA 3ONDA 4YAGA 2QX7A 3ROQA 3MJEA 1QMGA 4GI2A 3I83A 4BHTA 4E4YA 4GWKA 3DZIA 3I9NA 2FR0A 4GGPA 3WICA 3KETA 1LTHR 3DR3A 4JBHA 2P2SA 5HA5A 4BO4A 1EUCA 3C1TA 4BS9A 1V6AA 4PLGA 4I08A 2D0IA 1Z75A 3R0IA 1T2EA 1ZNQO 5DNAA 4WGGA 4DQXA 5F3RA 4HX5A 4ZRNA 2HMWA 4B4VA 4KZPA 5L7TA 4MIYA 3UFXA 1PWXA 4YQYA 3WMWA 2PWZA 2WE8A 3ULKA 1CRWG 3MZ0A 4WK6A 1DIAA 2QZ9A 1FDVA 1WZEA 5IDQA 2IZZA 1JLLA 1WMBA 4XQCA 5JMWA 4GAEA 1HYGA 1LC0A 2JFHA 3GFBA 5KVQA 2I6TA 3GVHA 5I9LA 5JFOA 1HEUA 4Y8VA 2UVDA 3VTZA 1J49A 2ZKLA 2BFAA 2NNLD 1XU9A 2AW5A 2C7VA 1HKUA 3B6ZA 3QLJA 1SZJG 3RROA 4KQWA 2X0NA 4G5HA 4OXYA 2ZYGA 1YDEA 4EUFA 2G82A 2QRKA 4N5LA 3BHMA 1GAEO 3MOIA 4BNKA 1NQAO 1ZJZA 2CFCA 2GGSA 2HRBA 4BKQA 1A27A 1I3MA 7ADHA 3L9XA 4LSMA 4MOWA 4Z9XA 1X1TA 1ULSA 1KEUA 2Y1GA 4P22A 4PRLA 3IUPA 3FNHA 3SEFA 1D1SA 4YXFA 1M67A 1OC2A 3JYOA 5DOZA 5COQA 3BMNA 1U3WA 4F45A 1GL3A 1PJSA 1YOVB 2I67A 3ICCA 1N7GA 4W9NC 4XKJA 4MVJE 2BHLA 3JD4A 1F17A 2EKQA 1OFGA 1M76A 1NFQA 3DFZA 5G0SA 2BFPA 4NFYA 2DBRA 3G3EA 2B83A 4B79A 1NPYA 1PU2A 1MFZA 2VHWA 3Q9UA 1S7CA 3VZPA 1R4MB 1JDJA 1O6ZA 2NLOA 3ZN2A 1RYEA 5JE8A 1IYZA 4W82A 2JCVA 3FD8A 5CAEA 4EW6A 1K89A 2UDPA 3UVEA 2ZYDA 4AL4A 2AG8A 4IBOA 2UYYA 2C7GA 4XRGA 3GPIA 4YVFA 5MGBA 3GMDA 3ONEA 4QEDA 2PA3A 1NAIA 5ICSA 3WGIA 1PQWA 2EW2A 1Q7BA 2LDBA 1XELA 4FIZA 5GZ3A 1CIVA 5TSDA 1K6XA 5C3MA 1H2HA 5H81A 1IUKA 1K2WA 2OFPA 4QQRA 5EINA 5HRUA 2NQTA 5DCWA 1ZMOA 3QY9A 1QP8A 5TS3A 5TT1A 2Y0DA 5JAMA 3WOHA 1LI4A 2IRWA 3M2PA 1GUFA 3BMOA 1HTBA 3PQEA 5EERA 2VT2A 4NZ9A 5A9RA 1NP3A 4CL8A 2YHUA 5EL0A 5KWEA 5CPFA 2X22A 1E3SA 8ADHA 4PZCA 2PH5A 2D4AA 1E7MA 1PZEA 5A1TA 5TIIA 3GN1A 4PLTA 2B37A 1U4OA 1C0PA 1KVQA 1XA0A 3WTBA 3U3XA 5CFZA 1HE5A 1C1DB 2PKQP 2W2LD 4OSOA 5A9SB 4YACA 4CM7A 5CP8A 5L4SA 2IXAA 4P8RA 2ZJ1A 3ZDFA 4TQGA 4E12A
chains in the Genus database with same CATH superfamily
2VCEA 5DSTA 4TXHA 3NB0A 4KE7A 1X1RA 3DVAB 3LWDA 3KUDA 4HFMA 1I6MA 3DCNA 2DH6A 1KI7A 4MYDA 2GBLA 4UUNA 4HWKA 1JR8A 3AXSA 3A1FA 4RZHA 1M6VA 2ISSD 3HU3A 3K0FB 5LQUA 3N70A 2HM7A 2FEOA 2FFAA 1EXMA 4CBVA 4RPIA 4XA8A 4HYTA 3V33A 4HDRB 2Q4BA 1OFTA 3AK4A 3H16A 5DT9A 4EB3A 3PUWA 4RD4A 3T99A 1N2XA 2D5RB 1YT5A 2FR1A 3M81A 4TSFD 3FZGA 4FFLA 2I1VB 1MOSA 3PEEA 3KXKA 4LF7B 4EABA 4TYWA 3ROMA 3RASA 2YYYA 3KX2A 3MTJA 3PX2A 4NG5A 1XMVA 4RU1A 3BD9A 3EIXA 5H3LA 4L7QA 2WFLB 4E88A 2CNWA 1KO5A 4QI0A 1YAHA 4UM7A 2CXOA 2L2QA 4R2HA 1Y5RA 2JJ1A 3L7JA 5JDCC 4YWHA 3VF0A 4CR7A 5CB6A 4B31A 1DELA 4CLHA 2HQSA 4NE2A 3S3TA 3MBIA 2WF6A 3DO5A 3QV1A 4R4JA 3I1FA 4DE5A 2ZXEA 3MMSA 3UYKA 3M6IA 3C6BA 3AUAA 1DS6A 5CNKA 3ZVMA 3QU5A 4D92A 3PITA 2P40A 1B14A 1FXUA 4QYSA 3CEJA 2NZJA 3K15A 2XE4A 5AXBA 4ZVTA 1U3DA 3M70A 1FFAA 1PLJA 1T1GA 5DM0A 3PEUA 4KRXA 1DAOA 4TV9B 4HTFA 2VUSA 1SHLA 2HK6A 4LECA 4FINA 3SG0A 1YVPA 3VKHA 2CBZA 4HLCA 3OZEA 3LIPA 4OXNA 3FMPB 3UPTA 1QAOA 3O2SB 4PLPA 3TFWA 4DJJA 1UKCA 5D3KA 1BDJA 4KIUA 4L9RA 3WODF 1ZEMA 4CKWA 3UK0A 2FX3A 4M9CA 3TKAA 3T34A 1VQ1A 3VR4A 2Y39A 2DSNA 4LOLA 4AE4A 3ZWYA 1OWPA 1AE1A 3H11A 4RZIA 4N7BA 1CNMA 3NDPA 1KGDA 3WRXA 4GOND 5E7MA 1NLFA 3IX7A 4C4AA 5BN4A 3BSFA 4TROA 3ZGYA 3DMPA 2A7QA 1YJQA 2ECKA 2W4IA 1UODA 4R6WA 2FZWA 2FPUA 2Y76A 3I52A 2LCQA 3ICEA 1GQFA 3K9BA 1GZ4A 5EP1A 2PDAA 4TRJA 1Q84A 4AUNA 1VKOA 1KAEA 1UOQA 1P2TA 1WO8A 2ASRA 2P91A 4M8KA 1Y3FE 2QF7A 5EXEA 3NAGA 1V6CA 2X0CA 3CZ9A 3RVRA 2SECE 1ZVMA 5I9MA 1WQ1R 2R86A 2J8WA 3T7RA 4EG0A 4LOKA 3O55A 1D4FA 1QPUA 1KMIY 3W8RA 4PCLA 1JFFB 1A9XB 4GOOD 3PGXA 5REQB 4B43A 3SAJA 1MDFA 1VJ5A 3FI9A 4B4UA 4LVCA 1PP4A 2VPIA 1U9YA 1WP4A 4WFIA 2VP6A 4ABTA 1RCFA 3GF4A 2LCHA 1OX5A 2O7VA 5HFNA 3ITKA 1A04A 3SDBA 1JR3D 5TJ9A 5IHXA 4FPXA 1P3JA 3QA9A 3IIIA 2F3TA 3VKGA 3UM9A 1FBTA 2PZJA 4W9MC 4MVMA 4O2BA 2V55B 2FAXA 1RI5A 1VRCA 4PFQA 4DJTA 4K9OA 2D5IA 4OATA 3EX7C 2OORC 1OFUX 1G20E 1AUQA 4O4JF 2H3HA 2IBFA 3RVBA 4EKGA 3ZWWA 3QHAA 2Q1XA 5FPYA 1I30A 3C2QA 1W4RA 4JFRA 3BF7A 3T7KA 3DH0A 4OD5A 5IN4A 1IJFA 3L0CA 4YRCA 2DX7A 5AMXA 4YH1A 3MWYW 1WN0A 5HSGA 2QRLA 3C1OA 3AOUA 3O4GA 4S24A 3JWJA 3WB2A 1GXSA 3QWFA 3LCUA 2PBEA 2G1JA 1EFVB 2HA5A 2OUKA 1Y8QB 3N8KA 2NXWA 4C2AA 2RH9B 1H2BA 3HCDA 3IO5A 1QKIA 1JHYA 3DA8A 4V0QA 4WINA 4NXNB 3TW8B 3HRKA 3SQXA 3V5YA 4KXYA 5D5PA 3ESDA 2AOVA 3GP8A 4R01A 3PUKA 4D45A 1OZGA 1RM4A 4F5DA 2C2XA 3U39A 1J8FA 3GP5A 4NCQA 3LYAA 1XZPA 1QVAA 4EFNA 2BF4A 4CMAA 2TRSB 3PEFA 2FZGA 2EJBA 4CI0B 4BUJA 2CJWB 4G24A 4E21A 4R1OA 1ZR4A 4J32B 2VFAA 4IDQA 1XLUA 3UT5B 2M6LA 1BGWA 1M83A 1AK9A 2H65A 4MVOA 4V0OA 1RPAA 1V95A 3ZHRA 2DHCA 2VBFA 2XB4A 2CDAA 3C8DA 4EI9A 2PN1A 2PE5A 3NBMA 2A8YA 1RLIA 4DDTA 1NLXA 5FEMA 4JKOA 3U7QA 5CNMA 3KL2A 2VF4X 2WHEA 4LK2A 1AK1A 5FI3A 2YJNA 4PGGA 2FLWA 4FS8A 3CPJB 3M6WA 4JIGA 3NHMA 4H1HA 2A5GA 1Q11A 4GXTA 2FFRA 1V7ZA 4KQHA 1NIPA 1U2GA 5JS6A 1WETA 1E4EA 1KOGA 5AKKA 1NJFA 3RBVA 1QO0A 1SBTA 3AP2A 5KBYA 4Q9IA 3BREA 1G21A 2DWUA 2NQ2C 2WVGA 4F2DA 4W5HA 2XUDA 2O2ZA 1E63A 1XZCA 3IHLA 3U09A 2C8KA 2IHJA 1JQ3A 4ZZIA 3I58A 1R5OA 3NTVA 4MQBA 3COJA 2QVXX 1WZIA 4EAAA 1KO7A 3NJ4A 2GF9A 4RJ2A 2P1DA 5AJYA 5ILOA 4WSOA 1XROA 2P30A 4R8SA 5A2QA 2GT1A 1Q1QA 4EX6A 3EUAA 2GK4A 2F90A 1YR9A 1Z08A 3DDNA 1ESDA 4JJAA 1GTRA 4PHFA 1T8PA 5EYPB 2O5EA 3MTBA 1R8JA 4CM8A 1M6VB 4BX0A 3MQFA 3REOA 3AKZA 2ON6A 4B3CA 5DGIA 4FDLA 2L6GA 2WP8J 4F2PA 1GRNA 2JLZA 1VYHA 3A9CA 1QRSA 3WLNA 3L4BA 1QVRA 3W3AA 3LUPA 3NBAA 3OBIA 1I13A 2QU8A 4D80A 5EJ7A 3FNBA 2EJWA 4P3PA 2DB3A 2A58A 2EYUA 3PGJA 5AW5A 2Q0QA 5H3CA 3E1KA 1GDTA 2Q3FA 2C0PA 3UAOA 2B2NA 2HTEA 1GNPA 2I4MA 3VBCA 5E4FA 2I99A 2YL1A 4ZVKA 1Z2DA 4UQLA 1NMXA 1B42A 3BT7A 4EDHA 4M98A 2HSBA 1P0MA 3BK1A 4RHUA 1G6OA 4QBIA 3E82A 3L5KA 1FYEA 5KMGA 1V4BA 1SKYB 5EE9A 2C9DA 1JDTA 1QHIA 4LWOA 2QOEA 3HXQA 1E5LA 1OHHD 1H1LA 5AIAA 1SVMA 1XOIA 1H6DA 4R2MA 1XXHE 5A7FA 1L4HA 2OFOA 1GFWA 3O0TA 4QNRA 4X97A 4DLVA 2R6AA 3JRNA 2IYPA 1NDUA 4JOCA 4JQOA 4IJJA 4C0HA 3VRCA 3E8XA 3DD7A 4HTFB 1QF7A 1ZRHA 3ZCRA 2PZEA 2FG5A 4M1KA 2OECA 1KJNA 3KH2A 4HHEA 1TKBA 1ZJYA 2ZRHA 4PVCA 2IEAA 2KX7A 2LXNA 4D8TA 1UJMA 2ZJYA 1PFWA 3QITA 7ABPA 4YASA 5HX7A 1NC1A 3S6JA 5A5FA 3DFUA 2Z1NA 2DWPA 1KC3A 2C7QA 2PSDA 2RGWA 4YDHB 2IXOA 1U0OC 3ZDEA 2YZKA 3KT6A 4I3FA 4CF5A 3H11B 2EV9A 4EVIA 2FZEA 5H02A 2JI7A 4TTTS 2M1XA 5HE8A 1U28A 4C4XA 3R5SA 2GYYA 4LXTA 3I34X 4H60A 5J2UA 1DRJA 3GGPA 1HETA 2F55A 3GLGB 2NZ8A 2W6QA 1E6WA 1WTAA 3CUWA 3L0PA 1ISJA 1W2GA 2QK4A 3LOQA 3PUHA 2NQ8A 3N7AA 2FUNB 1ECLA 1LLQA 2IEGA 1H0HA 4LF5B 2P9TA 2QKYA 3SJBA 1F2TA 1F8GA 3ZS9A 2ZUBA 3UENA 3RJ9A 1WW8A 3DE4X 1VHWA 5E2IA 1EPUA 3F9IA 1JQBA 4MWBA 4ND3A 2O7RA 1OXKA 2JJ2A 4BJ3A 5KINB 2J6HA 4ER6A 2X9VA 1VE5A 3KOXA 1E3EA 5CDSA 2NU6A 4OQNA 4WOBA 1Q7CA 4NEHB 3C6QA 1IUOA 3QX9A 4HYQA 4URHA 3DC2A 1O58A 4IDEA 4MUAA 1HH4A 3OAAA 4JVNA 3GWNA 5D85A 5F1PA 1A9SA 1XMQB 1O3YA 3LFUA 1QE5A 1U8CB 4DKXA 4O2BB 2RGUA 4FCTA 4YRLA 5A9SA 1DBWA 5FPPA 4G8CA 5EAIA 4PAGA 4FFPA 3A4YA 1V0JA 3SYNA 4CV2A 3NTRA 2VP0A 2BDTA 3SS7X 2CUKA 1D2HA 3BSWA 2P1ZA 3JXEA 1N2JA 1UCFA 3KDSE 5COGA 1T0HB 3OFJA 2IXTA 2AUMA 5IFLA 4ESOA 5J4YA 4X6LA 3GJ8A 1PYGA 5TLSA 3DF9A 2GS9A 2OGWA 4R7GA 2KK1A 1RCPA 3PC8C 4G81A 2EYQA 1GSHA 2EZTA 1SQFA 3SIRA 3EH1A 3TAUA 2IVFA 2F8TA 2XVZA 3GT3A 3IOCA 4FBGA 4C0BA 1N1DA 2XUIA 4S12A 1MJ5A 1M1YA 4ARUA 3KXDA 4Q7MB 5FOXA 2JCBA 1KI3A 3VHLB 1SD1A 1U7ZA 2CVPA 5DU2A 1QCCA 1PQYA 4MKRA 2WHXA 3ZIUA 3D6AA 3DKPA 2LWIA 2NVUA 2Z83A 3UAVA 2G71A 1EXWA 1CV2A 2H9IA 2A2ZA 4LQCA 3EC7A 2YW2A 4V3BA 1D9ZA 1PDOA 2C2MA 1ZN9A 3JARA 1JWBB 3RU9A 1U89A 3ATPA 1G5QA 4DY4A 3PQ5A 4DA7A 2OQ2A 2P9CA 4LRQA 4QOHA 1W36D 2PCLA 3VR6A 4Z3KA 4NZMA 1GAXA 1JQKA 2P0AA 3GUUA 5IKPA 2OKCA 2JIPA 3T6GB 1M0WA 3RF3A 2XCLA 7AT1A 3QIAA 4RPGA 4DIEA 1SUCA 4NMXB 4G7HF 3QEOA 3T5DA 5I9IA 3UKJA 1RKEA 1G98A 4IVQA 4Z8XA 1Y6DA 1ISPA 3EWNA 1IUPA 1NE7A 2AVKA 5TR9A 4RL4A 4GO1A 2AQHA 1GV1A 2UUBB 1BHJA 3LFTA 2G7MC 1TD1A 3I2GA 3ZK8A 2CUTA 3TTTA 2IL1A 3IB3A 5CX4A 4L4XA 3ZVKA 3Q5GA 4Y18A 2YUIA 4JLWA 2LDXA 3CRZA 5DGHA 5BN1A 1ZOIA 1UC5B 3U7QB 1GKYA 4YN3A 2CLCX 1U3TA 2GBGA 3B2NA 1DDOA 4RWEA 1CF2O 2NO7A 2P4UA 2OXFA 3CEPB 1JA1A 3PQCA 1Q22A 1BXRA 4NV3A 3VC3A 4TLDA 1P0CA 5FBZA 2V7PA 2F1OA 4C3VA 3EFHA 3ADCA 2FMHA 4XVHA 3OP1A 1DV2A 3DEYX 1TR2A 4NPAA 3HLKA 2KJGA 3DS8A 3HA5A 3NVAA 1ZUNB 1E96A 1LKXA 2CD7A 4KMSA 5G0UA 3U26A 2X4GA 3B48A 1M6WA 3VSCA 1KJZA 2PUFA 3WYFA 3F71A 3DE9A 1N2OA 4CG2A 4IH9A 3I8OA 2WA2A 4ZYTA 3WP1B 1OWOA 2WVNA 3GYGA 3KKMA 1PDWA 4N7RA 3EZ7A 3KG2A 4DGQA 2FEXA 4F56A 4HGQA 3HU5A 4E14A 4GC5A 3CM0A 4P4LA 1BX1A 3B2QA 3GORA 2FMTA 3FTNA 2FPMA 3HN2A 3I9V6 2GO1A 4U3JB 3RSHA 1QV9A 2X2FA 1WU8A 4CIWA 2OHJA 4I55B 1GGQA 1UL1X 1IU9A 1H4TA 4ZYVA 3WI7A 2ORVA 4Q05A 4MR9A 1LA2A 2ZP1A 1HOXA 4BMNA 4ICIA 2G9QA 5C1OA 4WDQA 2PKYX 3MGAA 5HQJA 1VLSA 3TJMA 1YDMA 4II2A 5K03A 5IZ4A 1JTFA 1RM5A 3ETHA 3TEFA 1L3BA 1IH8A 2GD2A 5A3SA 1J7KA 1Q12A 4AJ1A 4S1VA 2WM8A 3PG5A 1C8KA 1PV3A 5TPWA 4DR2B 1AQ6A 1NN0A 1RWWA 4R69A 3C3WA 1N2IA 5TQ0B 3TGLA 4F12A 3IELA 1CPQA 4MLDA 1MX3A 1Q1BA 2P35A 3KSDO 1LK0A 3LXRA 2YWEA 2QEQA 7REQA 5JXGA 3NU1A 4JDPA 1S2GA 2OJQA 2WZQA 1JE0A 2VJKA 2YXBA 4Z7NB 2ZOSA 4IYJA 1KO1A 3RW9A 4DDHA 1U1FA 4AYTA 1XCBA 4Q1VA 3PIRA 2YHSA 4TM8A 4ER9A 3O93A 3TQQA 4BB9A 3RNLA 5I7UA 5LA6F 5K0GA 1QG0A 1SA0A 2PMWB 1U8UA 3ZSUA 4AY6A 1CPRA 1DJMA 1XF9A 4OAOA 4RV5A 2H2WA 1A7KA 5A4KA 5DBFA 3HDHA 3HR8A 3ZYZA 2Q9BA 2V6IA 3GH1A 1EP3B 2EDCA 2VAMA 2VNJA 3TMAA 1F9AA 1L7AA 2XUHA 3GLRA 3G2PA 2YOFA 1TO2E 1VZ2A 2IM8A 5JFTA 3S0JA 3HR4A 3F73A 3VSAA 4HX5A 3WK9A 4X65B 1DIAA 4PACA 5KSZA 2ADOA 1KKMA 4I4TA 4L6CA 1M2OA 2I6TA 5FKJA 3B85A 4GYWA 4IRMA 3M83A 3JPWA 3C3AA 4ZEVA 4JELA 2X0NA 3RHFA 4ZGGA 1B00A 4R2KA 4N5LA 5GADl 4DBQA 3UXEA 4UNNA 1H65A 3MOIA 2BTOA 4UQPA 3ZOZA 1XDDA 3F6EX 1F2TB 1X1TA 2Y1GA 2BEVA 2WJYA 3EQLF 2H51A 2R02A 4J0JA 2GEJA 2I67A 4IRUA 4DNQA 1VIYA 4F96A 5E3IA 1OXKB 4AZ3A 2FQYA 3NS7A 2LUOA 1E58A 4AMVA 1RCTE 2YQZA 3ONEA 4QEDA 5E7IA 3ZE7A 1LLFA 1QTRA 1J70A 1CY1A 1TA0A 2WOOA 4LXYA 3UHJA 3JCUQ 2WC1A 4H0CA 5JJBA 5EERA 3OIYA 2CNOA 3T3GA 4TWZA 2JRLA 4NTFA 3PDCA 1ST6A 8ADHA 1X38A 3GN1A 5CFZA 1RRKA 3D4BA 4QPCA 5A9SB 5HQTA 1ZHOA 4BOYA 4TQGA 3R5HA 3QE4A 4NMWA 4C7BA 1WABA 1B6TA 3ROFA 1D0ZA 1QGUA 1S3FA 5AKGA 1LBTA 4LW8A 1WB5A 2Q1TA 3ZH2A 3LF2A 4MH0R 4C22A 2AMVA 3UOAB 5F1YA 2NO0A 3KSMA 1UFVA 5JNRA 4LX8A 5TX7A 4KO1S 3WWDA 3M4XA 3PJDA 4OIOF 1IDN1 3DLHA 5DRYA 2HMUA 2HRDA 3R5FA 3CVJA 5E2QA 4OJYA 3SXKA 2Q2WA 3FPJA 3TG8A 1CJCA 1AUOA 5B4UA 5AW4A 4ASUA 1XQXA 1KR5A 4Z1MA 4X54A 1IFXA 4HX2A 1PJ3A 4EY5A 1GZVA 4J94A 3AY3A 3OTOB 2ZRPA 3K1ZA 4R1TA 1US8B 2OGUA 5K8UA 2NVUB 3WLTA 1FP4A 4NNJA 4LC9A 2XLMA 2PAFA 5JCJD 1XZQA 2AE2A 4YAEA 1K27A 3JARB 3CZQA 4KP7A 4HO1X 1UDAA 5DTIA 1KBQA 1LTQA 3GODA 3QMVA 1E0AA 5CDYA 1CFJA 3CEXA 5JCZA 1T2FA 1J06A 2WT8A 4DEXA 2RDMA 4L0CA 3O8RA 1RJFA 3WDSA 4GKBA 5JSQA 5C5CA 2G6TA 5FH9A 1K8YB 4XRRA 3WV4A 5EJMA 4MS1A 3PJRA 1YIOA 2YL2A 4YP1A 5DX1A 3TLEA 2Q6OA 3BE8A 4HXYA 3F8TA 4QPJC 5E3HA 1C9DB 2MWQA 4KPYA 1RKEB 1E1YA 4JMPA 2FHPA 4A7PA 3FHCB 4PZEA 1PI3A 5BQPA 5CLFA 4JS0A 2QUJA 3UGTA 5HR5A 4Q7KA 2NU8B 1XJCA 2H54A 2F2TA 2YL0A 4JLDA 2ZRDA 3AV3A 1OXBA 1IBCA 1NQXA 2VCYA 1E77A 5HUJA 1R50A 3TEMA 3OIUA 1QZ3A 3Q6NA 6CHYA 1G8KA 1ARZA 2P4HX 4IDOA 4Q19A 2Y1LA 3K35A 3L77A 1O97D 2OBNA 4EAQA 4FS3A 1ZK1A 2OXTA 2CL7X 3NVKI 1E3LA 3E4DA 2PO5A 1NU6A 1BS2A 3C8MA 3QEMA 1LDYA 5AJVB 1A9ZA 2H1RA 2W6ID 2WUGA 4OREX 1NUSA 4JENA 2XUJA 4Y6QA 5B64A 4GNRA 3QYAA 4QOIA 4DCSA 3WGYA 1V9CA 2AXPA 5B3IA 4MS4A 1YULA 3TOLA 4DYHA 3QVTA 1XP5A 3OU7A 1K97A 4ER7A 3E9RA 1V5IA 3E5NA 3T1VA 4LOAA 3RV3A 2XKAA 1CU1A 4L4YA 2WJJA 4EP1A 2ISQA 3R3SA 2E21A 4GZ3A 3W2WA 4MS2A 1N6NA 3WL8A 1II8B 1ISRA 4JUFA 3NYIA 4EO7A 5HV9A 4MJ3A 1MORA 2ZIXB 2M6RA 3F1LA 1ZGBA 1JIXA 1RXQA 2FEKA 4YA6A 4GZMA 1E1CA 3JD1A 2L69A 2ADMA 3I6ZA 2ZB7A 5IUNC 5B4VA 3ILYA 3QEBZ 3U40A 3HZHA 2G9NA 1T13A 2WJHA 3DDSA 3KKLA 1K8XB 1NYLA 2P9GA 3CKYA 4CM6A 1M66A 2X1HA 3PXXA 3JVEA 2W22A 2GCGA 2OO3A 4LDZA 3HA3A 4JU9A 2W2KA 4FE3A 1YUBA 3E9CA 3B70A 1UBLS 1T9BA 2Z98A 4WRRA 1A71A 3OQVA 5JR3A 1QV7A 5EZQA 1A76A 3VYVA 5AVXA 1GO2A 4UHKA 3KYDA 3NEPX 3NHFA 3LXXA 3FDFA 3X43A 4MI3A 1Z83A 3RYTC 2VNIA 5TPWB 1X80A 2B69A 3LDHA 3NRHA 1BFUA 3FMSA 4EARA 1QFYA 2HNBA 3RIMA 1JL3A 5CJPA 5LVAA 5A4MS 3S1AA 2NUTB 2GTPA 4R5HA 4C0AC 1KTIA 5G1NA 1SXIA 1B43A 3U3BA 3VNUA 4O6MA 4MWGA 2WU8A 1A0BA 5DQTA 3PD0A 3C3EA 4RQUA 3NNNA 4ZO6A 4GLOA 4FMPA 4F5WA 1UUFA 2P9ZA 3G2IA 4QDOA 4JW1A 2QMHA 2IYZA 1YDWA 3GD5A 1SKYE 4TQUS 1HRDA 1YZVA 3AFNA 3WXMA 4ZAGA 3CSDA 3L0BA 1SA0B 2JZCA 2PEZA 3OCJA 1UC8A 4GQAA 3I39X 2EERA 3NJRA 4RZUA 4NCAA 1X1EA 4D3YA 1B4DA 3PD1A 3HA2A 4N3NA 4D02A 1TNDA 1USKA 2QTWB 5JVEA 2ZB8A 1Z6AA 3DBIA 1TIPA 3FTPA 2H7CA 3H9CA 3CX3A 4UEOA 1UDCA 2RKBA 3CG0A 3IMGA 3QVVA 1PUIA 4XW2A 1Q0ZA 2BH9A 2JIMA 4HAUA 2OLEA 2JC3A 3RB8A 2NU9B 4YAKA 1YGPA 4I4TB 4DCTA 3ASOC 1Q57A 3BFKA 1B0AA 2VYFA 2KS6A 3KR9A 3MINA 2F8LA 2WR8A 4KEAA 3MUFA 4AIIA 4D9EA 1P6UA 4XQ1A 4JC4A 2FW0A 2QGNA 5K7SA 1KQPA 3MWDA 2YVAA 1C3LA 3I5UA 2HGZA 2X2OA 4HSGA 1D7OA 3PNYA 3DEZA 2R4QA 2I1LA 3ONNA 4A8PA 3V1UA 3IDOA 4OGFA 3IULA 4ACBA 4CMHA 3GLGE 2K2QB 3ZHSA 1GSAA 1LNZA 4EF5A 3VJKA 1LUAA 1C29B 1E3WA 5BWNA 4NZOA 4XEFA 2EBFX 1WNTA 3PJEA 1B16A 3GNTA 2JHFA 3LKDA 2PV7A 2HH9A 5CLGA 4C20A 5BP7A 5ARBA 3L79A 1VIAA 3JV7A 1EWYA 3GT4A 4WT7A 4RKFA 3GJ6A 1KYVA 1LS1A 4KC0A 1QO7A 1X14A 4W1QA 5AM3A 2B4TO 2JAXA 3HP1A 3INNA 3IUQA 4JUIA 1QR2A 4EY6A 4CCWA 4H6XA 4E7SA 5E8RA 4UM9B 4M0LA 2BHSA 4YFYA 4KQEA 1NN3A 3T9CA 4CCYB 5B55A 3Q7RA 1NL3A 2O0LA 5CM2Z 4ZYYA 5AW1A 3W6NA 3VSBA 2X14A 3K8YA 5ALXA 3CSUA 2R8OA 4B7XA 4C0QC 4Q47A 4COOA 2B35A 4MV9A 2P68A 5CCBA 4XD7A 1CJMA 4GYYA 4U5FE 4UATA 4W1SA 2L81A 5ESWA 3SF0A 5B1YA 2VVTA 4KDRA 2JF0A 1XVIA 2ZRGA 3F1KA 2GN6A 5IVHA 2YHAA 2ORED 1WV1A 4OHFA 4B3FX 3RUCA 3T7EA 4H3SA 1ZMRA 3KSBC 3EK2A 3IP3A 3HCOA 1I3LA 4CR8A 4WERA 2BKAA 3L6DA 5BSFA 4QYXA 3ZCQA 5HF5A 3R5JA 1NPDA 1Y5NA 1MJGA 5ALPA 4BFSA 3IT2A 4F8YA 3C87A 1K75A 1AGPA 1U7OA 4KXFB 3AV0B 3FNEA 5I5GA 4CIAA 4IARA 1SUEA 4WCFC 3TLXA 2J0EA 2VTEA 1PJ2A 1A50B 4P7BA 4A36A 1WMDA 3ND6A 5T3UA 3OZ7A 4BX9A 1U2DA 3G1TA 1VG1A 2DFLA 4YJ2A 2LBPA 1FSFA 3TLKA 3CKLA 2EDAA 5DM4A 3ZE9A 3ZKAA 1J2EA 1KA9H 3EFOA 4XJXA 3X1OA 1LF0A 4IWNA 1WLSA 1QP4A 1EFPA 3VJLA 1A7JA 3AUFA 4EPYA 1ZIYA 1CUXA 1N9KA 1ZPDA 1OFIA 1X2BA 4ZAVA 4F4BA 5AKLA 4H0NA 2B1GA 1QHHA 5J1TB 4C76A 1G8XA 4YCSA 1TADA 1MH1A 4BMCA 1IPFA 1COZA 5BSRA 3FSGA 4JL6A 4XGQA 4DNOA 1O8BA 4UUAA 4N8SA 3MOSA 1OXBB 1F12A 1Z7BA 3AC0A 1U3GA 3KYIB 1RKBA 4OXKA 3NO4A 1KYYA 1QHFA 4WA8A 4MV5A 5GM1A 2BHTA 2VIIA 2R3SA 3F5SA 1T5OA 4MTFA 1G8HA 2PZLA 3G9ZA 4B47A 4KO2S 5JECA 3EVDA 2IYNA 4H1TA 3KXPA 4J7AA 3SDSA 4I9UA 2XI4A 2QR2A 3ZWCA 2JHCA 3MUEA 2IE0A 4RD0A 1G4AE 2CVFA 1YRBA 4L57A 5DWDA 1V3QE 4JBLA 1E2MA 3E9EA 1NVXQ 3AUXA 1VG9B 4R31A 2X40A 3AKCA 3OTWA 3TD7A 3V4FA 4O6NA 1J2TA 4NYJQ 5K3SA 1PW7A 1NF9A 1AH2A 2C1ZA 1LRJA 3OZTA 2B7CA 1G21E 3JVUA 3NWPA 3ZBUA 2J32A 4QRIA 3ELWA 3MJTA 4RQBA 5HIAA 2WU4A 2QU7A 4GMDA 3RFXA 4LRSB 2OM6A 1SD5A 1RBZA 3NDJA 3PQ4A 4ZQIA 1F06A 5I7AA 1YK0A 2O1WA 3TD6A 3L1UA 4EJ0A 1JT9A 1MB0A 3UY4A 5H7XA 3LRPA 1AHIA 3SJAA 2XX3A 1ESZA 4QJ3A 4XWWA 1PQ4A 4GI1A 1VPDA 3EPJA 3IEPA 1TMKA 2W2KB 4FYXA 4FT4A 1CR2A 2FYTA 3A27A 3U4GA 2FPRA 4WXPA 3KPJA 2G36A 3RIXA 5LQRA 2QV7A 5BQ5A 3HI6A 2ZE6A 2BE5F 4FQ8A 1W4BA 1VKZA 1KC1A 2V6GA 4F4DA 3AXTA 1NSFA 1SUBA 3KNZA 4RY8A 3KVYA 1X80B 1ODIA 3NUQA 1EUDB 2I4NA 3S2EA 3WL7A 4QRDA 5AXCA 3IP7A 1ACLA 1CY8A 3S1AB 1H94A 2PXAA 4AB1A 4PYOA 1H8EA 5JHGB 1FLVA 4L50A 3HYLA 3CUVA 3FH0A 3WKCA 1VOMA 1HE4A 1M1NB 4FFDA 1CY4A 4TMFA 3ON5A 4BKMA 1GM5A 1OB2A 4GMGA 2H2GA 5ENDA 2XH8A 2TMGA 2I15A 5D3MA 2YW9A 2P9JA 1FMVA 3DMRA 2DJ5A 4PSCA 4KBLA 1PUJA 3ENNA 1E79A 1ZITA 4CDYA 4WFKA 2DHRA 4LF9B 3CISA 3E2IA 1WTYA 1U3VA 3SIWA 2RB4A 1K7CA 1S4QA 1K4YA 4D57A 2PHZA 4UTRA 3RWBA 1KXZA 5L0FA 3IUJA 3G17A 1XZGA 5HF8A 1BWQA 2H7YA 1GHTA 2WIKA 3R74A 1XAGA 4NVRA 4YRDA 3ZPXA 1QG4A 3ZQUA 2H5IA 5E9AA 2B4KA 3CH5A 3WRVA 3LF1A 1BMQA 1P17A 3V8MA 2W2LA 5FHRA 1BU5A 4PO8A 3LBYA 5KSPA 2Z58A 3AYXB 4XWAA 1U9IA 4I14A 1Q7EA 3R76A 3PPXA 1Q95A 3QEAZ 3I6YA 3RFTA 4V03A 1SK9A 4HEA6 4QSHA 3IQDB 3BK7A 3MINB 2Z15A 3EZNA 1S2MA 1UAYA 4EB8A 2AOXA 3UZUA 3ANSA 4AMZA 2LGJA 4U5QA 1UT5A 2WF5A 5FI0B 5I7OA 4QO7A 4KMMA 4D96A 1Q3TA 4MUNA 4IW3B 4YT5A 3AR5A 2X8AA 1VLLA 1KGSA 3ESBA 2R8XA 2A92A 1RKVA 1SIBE 2BGGA 4OM7A 4ND2A 3HG7A 1XFAA 2H3EA 4MUKA 3WFJA 1ZOLA 1E3WB 1W4CA 5HTOA 4AJLA 1EUQA 5IP5A 2ZETA 3T3DA 1USVA 3EDMA 2QSZA 1CJSA 3TG2A 4H6WA 4FP9A 1HT3A 3ZLUA 1XCLA 2D0PB 5BVGB 2B82A 2PT9A 3L7NA 3GB9A 1ULBA 2F1KA 4BJ5C 1Z4KA 3TLGB 3U3ZA 2H5EA 2OD7A 5JNTA 1FRQA 2UUPA 2YFKA 3SS9X 4NOKA 4P9TA 1OLXB 4P7GA 5JIBA 1PK7A 4W8GA 3WWEA 2HMTA 1RWXA 1S1CA 4LA4A 3MGKA 5ALTA 4H4DA 5I47A 3RJ5A 1HG0A 1YU9A 3U19A 2XB6A 5DGDA 2GZ3A 3VHXB 4KQCA 1Z4IA 1IWBB 1ZRNA 5JAHA 3KJFA 1L7XA 2Q4FA 1WS6A 4V2IA 3O4HA 1I2MA 1S96A 1TJNA 1BR4A 2EU8A 1A4RA 1UOPA 3TLZA 4QGBA 2ZWPA 3DW1X 3TVTA 4FYMA 1O6FA 3DT9A 4NZPA 4MW5A 5KOIA 5L53A 4BQOA 3WLEA 1A72A 2E9SA 4WNIA 1M1YE 2WRZA 2FN7A 2MSCB 1K63A 1VRVA 4A26A 3O7WA 5L95A 2WVQA 3EZFA 5DM2A 1P6QA 2C5LA 3L0IA 2ZR0A 2IX9A 3SE7A 2ZUTA 5JH7F 2G77B 2CHGA 5JBNA 1GU7A 4AZ0A 1I5EA 2RH8A 1KK3A 3KB1A 1W49A 3PRHA 3JYQA 6GPBA 4RA6A 1EFPB 4CS9C 1H3FA 4I5EA 3LDUA 2XZOA 1A5ZA 2XSZD 3SWWA 1EIWA 2HDNB 5DIFA 4MPJA 2F4NA 2VKQA 2Z9BA 4ER5A 3ST7A 5AESA 4QTUB 4CM3A 1RC8A 2WKPA 2JJYA 1SG6A 1RMTA 4Q3EA 1QRUA 2NMVA 1DOVA 3IUYA 1V37A 2ID8A 1VL6A 1N2ZA 2NO1A 4KWIA 2E37A 5DPMA 5BWMA 2OWEA 3ONDA 2JGMA 1AKRA 3DZIA 3DR3A 3H84A 3O4FA 3NCHA 4WTOA 4TL8A 4A16A 3PGLA 5IJ0A 2ERYA 3C3BA 4LE1A 1HQKA 4MAFA 5J3JA 3GFBA 5JADA 5KVQA 3IA2A 1L2TA 2QL6A 2J07A 1SZJG 3G2KA 4EKEA 4JXXA 1EVEA 4S05A 1GAEO 1I4ZA 3EYAA 1BE8A 3EISA 4W5WA 1CBUA 3F90A 3QZUA 1NOJA 3N39C 1VMDA 1ULSA 4YXFA 3VR3A 2VSFA 5COQA 4GT1A 3RW0A 2F4VB 1F17A 4B6RA 2MYSA 5IAGA 2ZDQA 3GJQA 1JDJA 2IXEA 3NYMA 3CH4B 5DM70 3ZQVA 5CDFA 3FOFC 4PYMA 2C7GA 5ICSA 4OQMA 1RTTA 1Q7BA 1XELA 5GZ3A 5KNBA 3K1IC 3RH0A 1FUUA 2WU0A 3T1YB 3QY9A 1GAWA 2AFVA 1AF4A 1YCHA 4HEHA 4EM6A 3DFMA 3QH4A 3Q3VA 1RAGA 2IUYA 2UUAB 4QFMA 2Z30A 3ZQ4A 1FX0A 3HYNA 1L4LA 3BXHA 1Q6ZA 1XT6A 1KXJA 2NSFA 5BRNA 2ES4A 3ECSA 4CM7A 3ZWDA 1L3CA 3QFFA 4CV3A 4JV5B 1UZNA 4JR0A 2PU5A 2VT3A 3FGOA 4D4LA 1UZLA 4OIMA 1JEOA 3VU0A 2Y68A 4R1NA 4NECA 1YLMA 3T7TA 2C95A 1D6JA 1YBMA 4BVHA 1X86B 1E84A 4MWDA 1XEXA 4JP2A 3TR5A 4BLWA 3IEEA 3RIGA 5JBQA 2AFIA 1QZZA 3PRYA 3FMGA 3UEOA 1UFBA 2D7CA 3G8BA 1E2IA 4IMIB 5AW6A 3Q7IA 5L3RA 3SEOA 4JT2A 4IGIA 2YVKA 1YDGA 2HMZA 2YINC 3HR7A 4JOSA 4IXNA 4IGGA 1E7WA 4B3GA 3CJQA 2XR1A 5A6JA 4Y9RA 1A88A 5B53A 1WMAA 4M9ZA 5D3MB 3G0IA 3DOOA 2WFAA 1G3QA 5BW5A 1YA6A 5CLJA 2BCEA 2X42A 3MAAC 2BHNA 3BWBA 3DZGA 4NONA 3ASZA 4TRNA 5LP6C 5HF9A 1Y63A 1QRTA 3U4CA 4J8PA 3O8LA 3IHKA 1MPXA 2XOXA 2YFYA 3LNRA 1KOLA 4LZNA 4RZ3A 2JEZA 4XOIA 3V3KA 5D6NA 4WOKA 4H7HA 2WLSA 3SVLA 3DUWA 1Q0TA 3G5AA 2YJ4A 3RC1A 1TEVA 2XSEA 2AR0A 5BNZA 1WEKA 3A2NA 2G3KA 4XQ9A 1PR1A 2GBIA 3SSMA 2MJLA 4ONSA 3PUXA 4INJA 4YO8A 3L8FA 1NR1A 1JBQA 4F2GA 4ZDIA 1S89A 2ZM5A 3WE7A 2Y66A 3S27A 1W35A 3DT6A 3TXXA 3UCFA 1FVHA 1JIQA 3P96A 5BYBA 3U44A 2DQKA 1DFHA 4MRMA 1S8FA 4GM0A 4MPRA 3RUEA 1T8UA 4MDFA 1IG3A 3ZW8A 4FXPA 4MKZA 2AWOA 5JCOC 1VFNA 3RTAA 1U1DA 3LPNA 3EXG2 3R0VA 3HO6A 2BJHA 4NYIQ 4X5OA 2FTKE 5L0CA 2XBLA 2ZDGA 3PT5A 3N7UA 3IQWA 4BNDA 5LZ5A 3SHFA 2PSFA 4B32A 2FWPA 3LQYA 3DQPA 3WQBA 3CW2A 4MVJP 3LECA 2JLCA 3JZFA 5GZ6A 1I94B 2FVXA 2IPLA 5D00A 5KHAA 3DZBA 1E9BA 4CUZA 3LQFA 4LDRA 1LLDA 4D8XA 1G8YA 4TVBA 5AI6A 4AG5A 5IZCC 1BTOA 1KBZA 2YKZA 1J20A 3VR2D 2XF8A 3U8PA 5ITSA 2XMGA 4QJ5A 4AZSA 1BDJB 1ORRA 3GG9A 4NP6A 4CKWB 4R0VA 1KJIA 4GDFA 2XB2A 1EX9A 3EXIA 2VYCA 3LPDA 3ZQ6A 1UPTA 3F98A 2CFTA 5MFZA 4AE4B 4LF6B 2J09A 1NBOA 5KVCA 5FD8A 3NORA 3UTDA 5C8DA 2F67A 4N3AA 5MGNA 5FTJA 2VJNA 4QDKA 5BN4B 2CLFB 2R7RA 3QUQA 2PT5A 3IQEA 2XNDD 2O8VA 3CUEF 5B1BC 3T9OA 3HS3A 4EELA 3INGA 3RHTA 2BM1A 2RGNC 1H22A 5K3CA 4MGIR 1B2LA 1LBHA 3C4JA 1Z0UA 3WGHA 2QE9A 2A9VA 2A9PA 4UUMA 4KIJA 2Y3HA 1CP2A 3M82A 4Y2XA 2G62A 3WXBA 3CNLA 2L7AA 3DD5A 1S2IA 4EVRA 2FP4A 2HLDA 1G8JA 1UK7A 2IHYA 1O2DA 2GJ8A 4HWPA 3L0IB 1YB4A 4FOTA 4A4DA 5JSZA 3F2VA 3KEMA 1N78A 1WXFA 4I3HA 2XJ4A 1VCMA 3LHIA 4AZ0B 3UJCA 3R3ZA 3CURA 2C4NA 1RAHA 2GD1O 4G7OF 1YDHA 1X1BA 4BFYA 4K05A 3MVEA 3TR6A 1KVTA 1Z2AA 4OUKX 4RA6B 2WLTA 4TLBA 5ADVA 1ORSC 1MKYA 1H1TA 2XVYA 1Q17A 3I37X 4G0WA 1R27A 5BT8A 1BE6A 1D2AA 5JS7A 1TI7A 3K8OE 1AKQA 4MA4A 3MWEA 2I76A 2GNPA 1PL7A 1SXQA 2YJ6A 4PHHA 5AKJA 2IEYA 4B82A 4DZTA 5CCEA 1S3IA 4ZCLA 1CS0A 4BVAA 1HYQA 5EMNA 1E66A 3WIBA 1ZK2A 4LRYA 4YHBA 1U7UA 4AUEA 3V5ZA 3RTEA 3F2IA 3OCUA 4UREA 2ZSDA 4YJFA 4F97A 5T5QA 3VU8A 4I46A 2PGJA 1P6XA 5T1DB 1YIDA 4QXRA 5G40A 1LE2A 2Q2OA 5K2OA 3AF6A 3ZW9A 3P2EA 3P2IA 4P3XA 2X4IA 1GXSB 1XQ6A 2WJGA 5BY2A 4PNHA 4FN5A 1O94C 2XXBA 5JRJA 1A7DA 5DS6A 1JLHA 1DSSG 2PRYA 4XVUA 4AP5A 4NZZA 1GQYA 5D84A 3EZ6A 4DIBA 3GA0A 4DSOA 2YWRA 4RENA 3OJLA 1H05A 1QIDA 3AZOA 3JQ8A 3B9RA 3CBGA 5GGXA 3GUYA 4UZEA 1GPYA 4IDAA 5EK0A 3OQPA 1I9CA 3L8JA 4WE3A 5D5QA 1YKSA 2FFJA 1KI6A 4CDMA 1GUZA 4X9XA 3WK5A 4GP9A 3E5HA 1E8MA 2Q8PA 5AUPB 1O95D 5IVIA 2MTBA 4BP8A 1G4HA 4QT4A 1EGMB 3UAGA 1BU8A 4OX9Y 2I2DA 2GPWA 1Y82A 4MDHA 4YXWD 4ROSA 3W04A 4K9QA 1BFKA 2B4AA 4G1MB 4IUYA 3F0TA 4BNYA 3SJCA 1DX9A 2HNKA 3ZE0B 3JASA 4OHKA 4YREA 1X9GA 5FPSA 5IKEA