4YT8A

Semet-labelled hmdii from methanocaldococcus jannaschii
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
344
structure length
344
Chain Sequence
DNMKVSVYGAGNQNLYINKLNLPEKFGGEPPYGGSRMAIEFAEAGHDVVLAEPNKNIMSDDLWKKVEDAGVKVVSDDVEAAKHGEIHVLFTPFGKATFRIAKTIIEHVPENAVICNTCTVSPVVLYYSLEPILRTKRKDVGISSMHPAAVPGTPQHGHYVIGGKTTDGKELATEEQIKKAVELAKSAGKEAYVVPADVSSVVADMGSLVTAVALSGVLDYYTVGRKIINAPKKMIEQQVIMTLQTMASLVETSGIEGMVKALNPELLIRSASSMKLLDRQKDLDAALEILQNLDETLKAEVEKAEIKPTTLVAAQSLVKEIKTLIGGAAAEGAIKRSARKLFEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Towards a functional identification of catalytically inactive [Fe]-hydrogenase paralogs.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Metal binding protein
molecule keywords H(2)-forming methylenetetrahydromethanopterin dehydrogenase-
total genus 114
structure length 344
sequence length 344
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03201 HMD H2-forming N5,N10-methylene-tetrahydromethanopterin dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1300 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4yt8A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4yt8A01
2A9FA 3TZHA 2BRUA 2Y1CA 3F4BA 5JW6A 1ISJA 4BHTA 2IXAA 2BI7A 3T4EA 4F46A 4OXYA 3ANLA 2UVDA 1VJTA 1GQQA 3GY0A 1N92A 5I7VA 4GX0A 4PG5A 2VYNA 4UEOA 3FNEA 4R16A 1X1EA 1LDEA 4XYEA 4CQMB 2DTEA 3ASUA 4CQMD 4YRBA 3G49A 4H3VA 1P1IA 1YJ8A 1M2WA 5C7LO 3E9QA 1I32A 3R3JA 3KO8A 1U7TA 4P38A 4B3JA 4CMIB 2YFQA 1UP7A 4J6FA 1UXIA 3PIIA 4Q9NA 3ICPA 1GADO 4NBVA 1BRMA 1X15A 4QXMA 5BNIA 2CDBA 3GAFA 2OOSA 2OBYA 2VUTA 3OQ6A 1PZEA 4JGBA 4RVDA 3W8FA 4O6VA 3NDRA 3N7UA 5DN9A 3HJAA 2B69A 4FR5A 4XIYA 4KWIA 1H9AA 2AQIA 4OQYA 4U5QA 5T67A 3GRKA 1E6UA 4BB5A 4WCDA 2IZ0A 5CEEA 1VKOA 1NHGA 3PHJA 1IZ0A 2HU2A 1C0KA 1E1MA 2OFPA 4HKTA 3TQHA 2FP4A 2Z95A 4FFNA 3QVSA 2HK9A 4GKVA 4LRTB 2CNBA 1N1GA 2VRCD 1DFGA 1BDBA 5ES3A 4YR9A 1GZ4A 2Y67A 2ZQZA 5JAQA 2XAAA 4CM8A 2OMEA 1U3VA 2WSBA 4PVCA 4DA9A 4JBGA 3L77A 5F5NA 3GVHA 3INRA 4IDGA 1A27A 3WJAA 4HBGA 3FI9A 4RF4A 2PTGA 5A9SA 4RL6A 3LF2A 4WLOA 3RAJA 3BYZA 1M67A 3ZH2A 1NWHA 2Z1NA 4RF3A 3UICA 4OGWA 2HSDA 1EE9A 3RSHA 3EZLA 2Y0CA 3LLVA 3INGA 4HWKA 3VTFA 4CMAA 1XSEA 1TT5A 4XX0A 3WS7A 4B8WA 3G1TA 3ZNPA 1LDYA 5JE8A 4I9HA 1P1RA 2X5OA 3GPDG 3LK7A 3QHAA 2O4CA 4OO3A 3TPCA 1Y5RA 2IEDA 2Y93A 3DBLB 3ZV3A 1VPDA 3KLMX 1Q7BA 4YA6A 1G1AA 3T7CA 1N9GA 4URFA 1BHSA 5L4LA 4AJEA 3E5MA 3P19A 5U4QA 1ZFNA 3BTOA 3HADA 3GR6A 1J49A 4YJFA 5ER6A 2AG8A 1ZSNA 2GPTA 4S3MA 1QR6A 5AQ1A 3O4RA 1ZJZA 1BXKA 1T2EA 1OZAA 3ZI0A 2I99A 1GUFA 1E7WA 4RPGA 5EN4A 3COSA 3FF4A 4NFSA 4CQLA 5ENVA 1W4ZA 3QWFA 4MVJM 2Q49A 3BHMA 2NVBA 2DM6A 4YT5A 1T1SA 1JA9A 2V6BA 3AK4A 3WMXA 1M76A 1DC5A 3ROQA 2BFOA 2YDYA 1WDLA 1E0DA 4EUHA 2FOIA 4IGFA 5TLSA 2TMGA 2X0NA 3GC6A 1LSSA 1T2DA 4ALNA 1PL8A 3HG7A 4OOFA 1H6DA 4E3ZA 4YT2A 1A71A 3HUDA 2PH3A 3DAFA 2P5YA 1ENZA 3DZJA 1EE2A 3U4DA 1DLJA 2GRAA 1T2CA 4X54A 5DNAA 3VPXA 3IUSA 5IN5A 2O2YA 3VKVA 4XYBA 5BSEA 3H5NA 5KWEA 4PCVA 2X9NA 3U49A 3UFXA 3DBHB 3I6QA 2BH9A 4YDRA 2OUIA 1R12A 1TEHA 1MFPA 2QRLA 5IDWA 1D4FA 1Z75A 1DSSG 3DB2A 1P9LA 1LLDA 4BNNA 4NG5A 5GZ3A 4NJMB 4I8XA 3HDQA 1A4UA 2PWZA 3NT2A 2X9GA 3D3WA 4ALIA 4E30A 3RCBA 5K6AC 1ZJYA 1EMDA 4FFRA 1EUZA 4UULA 4IINA 5DOZA 1HYGA 3H65A 3RJ5A 2GF2A 1GYPA 1ADCA 1I3NA 3LVFO 1TVEA 2VHYA 1ZNQO 3OIGA 2WDZA 3CPSA 1QYVA 3KUXA 1KOLA 1UDBA 4RJTA 1E3EA 4XQEA 5CG2A 1EFLA 2WD7A 4BNZA 1VL6A 4HFRA 5L3ZA 4EI2A 2XXJA 3RUFA 2WMDA 3I6IA 4WCFC 1I3LA 4R9SA 1YB1A 4ROSA 3RU9A 2CVOA 3E03A 3O03A 1ZO8A 4W9NC 3NGLA 2WD8A 3RFTA 1J0XO 3WYBA 3GNQA 5F21A 1XKQA 1YGYA 2QYTA 4CPDA 1KC1A 5FF9A 2FR8A 2VRCA 3KYCB 5L4NA 3JD1A 1BVRA 3VH1A 3C3XA 4YT4A 1G6KA 3AU8A 4J4TA 4YT8A 4OIMA 4RZIA 5CP8A 3JQGA 3QSGA 1JDJA 3WFJA 4E5PA 4XR4A 3AUUA 4BV8A 5KVSA 4E5KA 3NDIA 1FXSA 2OZPA 3ZDFA 1IB6A 5COBA 2EJWA 5CG1A 2C7GA 4FFOA 2VZ9A 1E3SA 1DPGA 1H6BA 3DOCA 4BGVA 3JV7A 2DFVA 4B4VA 3C1TA 3F1KA 1FDWA 3E48A 2RHCA 3EDMA 1U8XX 1PEDA 3VH2A 3UCXA 1W8DA 4N5LA 3W1VA 3Q0EA 1Y8RA 3W8DA 4TSKA 1L7DA 4KQWA 1BVUA 3HB5X 4JN6B 1B15A 2QW8A 3I3OA 1AGNA 1JTVA 5BT9A 1OC2A 4U7WA 1I2CA 3I83A 4ALJA 3ZWAA 4GPD1 4IZIA 1E92A 4J1NA 4D41A 1KEVA 4CL3A 3DHYA 3NT4A 3ONFA 3CKYA 4KTTE 1O8CA 4E12A 3OJEA 4BKOA 5A1TA 3FHLA 4WJZA 5B4UA 4R3NA 2FR1A 5GY7A 4TRRA 3RUEA 1UZMA 4R01A 3FNGA 2ZQYA 1P74A 2O3SA 2VNSA 5KJEA 1ML3A 3JTMA 1LLQA 3EGOA 5BNTA 2ILTA 1VRWA 5IDYA 3ITDA 4H15A 3DZHA 4N5MA 1PS0A 4CM9A 1YS4A 5JY1A 1DOHA 3HNPA 3AFMA 3EW7A 4RVGA 2JAHA 3DR3A 1PQUA 5JO9A 2HK7A 3B1JA 3DBHA 3SJUA 1YBMA 5A04A 4M55A 1YO6A 4JK3A 1YH3A 4XB2A 4YACA 3BMNB 1E1KA 1OC4A 3RUCA 3TZ6A 1JAYA 3L6DA 4R54A 4A10A 1C1XA 2PZJA 2JD2A 4QTZA 2FZEA 2QHXA 3TSCA 1PJ3A 3I52A 4B7CA 3WWYA 2XF8A 4P4NA 1T24A 2FPPA 4RPKA 1NYTA 3VHRA 1PR9A 2NADA 3LC1O 2ZTUA 3WOHA 3AM5A 3RFVA 4TWRA 1QKIA 3PGXA 4BKUA 4YAGA 4K26A 4WECA 3Q6IA 4B79A 3LT0A 4E33A 3VZRA 1RM4A 1DIHA 1MUUA 3WBFA 5TF4A 3QVOA 5B12A 5IFLA 3D7LA 4J16A 3AM4A 1KVTA 1V3UA 1NBOA 3ZV4A 5DBGA 4Y98A 4FIZA 1EVIA 4GH5A 2DBVO 4OYRA 3GG9A 3NV9A 1GZ6A 1H94A 2DT5A 1KVQA 1MP0A 3PJDA 4ILKA 2C5EA 4C7KA 4E32A 5JCXA 2JFFA 1MX3A 1NFFA 1CIVA 3AI3A 1MXFA 3FTNA 3JYLA 4KDEA 3IMFA 1ADFA 2P4QA 5DP2A 5KVVA 4XJTA 2O23A 4JP3A 2PGJA 2Y0EA 5JMWA 1B8UA 1JKJA 3EVTA 4DWVA 5A3JA 3CE6A 2J5QA 5HTOA 3W8EA 1JWAB 4MKRA 5IXSA 4M86A 1XR3A 3ZU3A 1QLHA 2HCTA 3MZ0A 1Y9EA 4YJDA 1NHWA 4IMPA 1E1NA 1QG6A 2H5LA 3RKRA 3WQQA 2ZKLA 3AFNA 4EUFA 1OBFO 1PL6A 4DQXA 3ZNOA 2Q3EA 4I08A 3FTPA 4E5NA 3BZUA 4J43A 2Z5LA 1QP8A 4GSLA 2I3AA 4YWJA 2RCYA 1DIGA 3C8MA 1WNTA 2YDXA 4LGVA 3S2FA 2VOEA 3KYBA 5G0TA 3W6ZA 5BQFA 3NKLA 2J3HA 3NRCA 1C0PA 4CLHA 3LT2A 4D42A 1ADBA 1CERA 3O9ZA 4GWGA 3UGKA 4MP8A 1B7GO 1MG5A 3JQAD 2WJPA 3OA0A 3SLGA 4LW8A 2NQTA 1QMGA 3PQFA 1PJ4A 5IXYA 5IN4A 2Q1WA 1E7SA 4TVOA 1F06A 4CMEA 5KJ6A 3ABIA 1ZCJA 3JQAA 4BNIA 2GGSA 2VUUA 1IZ9A 3UH1A 1B2LA 2HMVA 2F1KA 2YQ5A 4J9VA 1UDCA 4Y9DA 5DCYA 1ORRA 4II2A 1E1LA 1R4NB 2GN4A 4NBWA 2HDHA 3OQ1A 4Z0TA 5IZCA 1O95A 3NTRA 3T7EA 2AG5A 4PLZA 3ZWOA 1YDEA 1U8FO 3ZWBA 5KVQA 2GASA 4BNXA 5EMHA 1B3RA 3T4XA 4PLHA 1KERA 1JQBA 3FPCA 2E37A 3BMQA 3NDJA 4R68A 4CLXA 2WWRA 4E2WA 5KOIA 2C7VA 3D0OA 1YONA 4D0RA 3KTDA 4HFNA 4PG4A 4PLGA 4U6QA 1DRUA 1LNQA 4NIMA 5JDCA 1DAPA 3MWDB 3DTYA 3VC7A 3BMCA 1SAYA 1PJ2A 1T2FA 3PLNA 1HLDA 2OBNA 4ZRNA 5TJ9A 3U9LA 1K5HA 2PFGA 5TRTA 5JS6A 5ITWA 1UXHA 4KOAA 4BNKA 3H4VA 4L0QA 2IZZA 1K3TA 3GG2A 3IJRA 4A73A 1VJ1A 3BTVA 4XQCA 3AI2A 3JD3A 2Y1GA 3PLRA 3GUYA 2FMUA 5AXDA 2Y1DA 4QO8A 3GF4A 4WPGA 4B7UA 2BGMA 5EINA 2CUKA 5JAMA 1F8FA 4MKZA 3V5NA 3FRJA 1EVJA 4ND5A 1CJCA 1I2ZA 4Y6RA 1A7KA 1Z6ZA 1AHIA 1DIRA 4L75A 2W2LA 5ILGA 3KSUA 1UP6A 2AW5A 2HRBA 1E3WB 3OIDA 3DOOA 2VOJA 3Q2KA 3H2ZA 2VRBA 1P0CA 2O48X 4WLNA 1WWKA 2XPCA 1Z82A 3LQFA 1ZMTA 3SC4A 3L07A 1Y9AA 3I9MA 1GCUA 3ZGYA 3MOGA 1F14A 2JFHA 3GGPA 4KQXA 4UAGA 4EJ6A 3WGYA 4A2CA 3BTUA 1KVUA 3RQSA 2X9VA 4L4SA 4W7HA 3A28A 5FFFA 2JFGA 4BNWA 3JQGB 1V0JA 1Q7GA 2IRWA 1T4DA 1UP4A 2AE2A 1ONNA 1ZW1A 2JD0A 5L7YA 5CPFA 1LI4A 4B4WA 4GVLA 5ICMA 3FSRA 1PWZA 1PWXA 2V6FA 3CXRA 3FBTA 3VH3A 5JAIA 1ZZEA 2Y66A 5BSGA 3G17A 2EEZA 1R15A 4RPHA 3D4OA 4CM6A 2BELA 4TRJA 1PGOA 4I5DA 2NUAA 1BW9A 5TGDA 1O0SA 4NBTA 3W4IA 5IJZA 1SEVA 1ZBQA 3BMOB 3DONA 3GZNB 3ENKA 3ETEA 3FWZA 3FPLA 2VZ0A 3F1LA 2FHSA 4IDBA 4XYMA 3PQEA 4BIIA 3KHUA 2VYVD 1Y5MA 1PSDA 4B3IA 5DDIP 4NJOA 3QY9A 4A0SA 3TWOA 4EEXA 3JQAB 4PN3A 2CVZA 3SBOA 4GMFA 1R0LA 2GSDA 5FI5A 2ZJ1A 3VPFA 3WMWA 5G0WA 4BOYA 4Q3NA 1DBVO 1PX0A 3I4CA 3JYQA 3PIDA 3PZBA 4W99A 4AJJA 1LDNA 3P2OA 2AXQA 2RIRA 3OJLA 2QIOA 3QA9A 1RPNA 4OKNA 3VAZA 1GV1A 5FYDA 1A4IA 1ZMOA 4RF5A 4ALKA 4N7RA 2GN6A 4BGIA 5A5FA 3B1FA 1BXZA 3RVDA 1FMCA 4GAEA 1JKIA 3C24A 3Q2IA 4GGOA 5A9SB 5C7OO 4IQ8A 4E5YA 5G4LA 4DIBA 1A9ZA 5CEJA 2PV7A 3DEYX 1YQXA 2NNLD 2PD3A 3I9JA 4II3A 3JQFC 4RCVA 1Z7BA 2VYND 2DBQA 1DLIA 5B4TA 3RUDA 2NSDA 5L95A 1GPDG 4BVAA 1GEEA 4CM4A 1PGJA 2B36A 3KYDA 3ONEA 3WGQA 4HFMA 3K2EA 4BB6A 4BNLA 3GHYA 3EYWA 4DL9A 1YBAA 3K2BA 3BMCB 5L53A 3WNVA 2X86A 1EBUA 2ZYAA 1GAEO 1LRKA 2DPHA 3AY3A 3PYMA 4XWYA 3OEYA 1N9GB 4WCFB 4MVJP 2I9PA 4M49A 5CPBA 4CLOB 4E13A 4MVJE 1BXGB 2IYOA 4RPLA 4PZCA 3GH3A 4MVJF 4KDFA 3JD2A 1E6WA 5KKCA 4ZVVA 1XQ6A 3MEQA 3HB4X 3GN1A 4RDHA 4CQLB 1XQ1A 3PGJA 3OETA 4UUMA 3UAGA 1BGVA 4DPMA 2PGLA 3I23A 1P1KA 4JXKA 4EUEA 4TZKA 2D59A 3KBOA 4QT0A 4ZICA 4CV2A 3IQDB 4QEDA 4AJIA 2A35A 2BI8A 3SJ7A 1X14A 3H9GA 5K9ZA 2XXBA 2IDZA 4QSMA 4MINA 1ENYA 1Z74A 4J4BA 4RZHA 4PZEA 3GLQA 4A5OA 1XLTA 5JAZA 3ZV6A 3ITKA 1EZ4A 1NQ5A 4NFYA 3R0IA 2YV1A 3SLKA 3VDRA 4E2ZA 2BFAA 2R6JA 3AUTA 4BGUA 4IIUA 1MC4A 4L4XA 1DHTA 3GGGA 3I1JA 3R1IA 4Z3KA 2HMWA 2R00A 3WGIA 2D4AA 2O7QA 1AXGA 1PTJA 2FR0A 3PDJA 3TDKA 3F46A 2C20A 3M6IA 4IS2A 4EW6A 4O63O 2FZWA 4DBZA 1JU9A 1LSOA 4DC1A 2NVUA 3P2YA 5F1PA 2JKVA 3WJ7A 4XB1A 3RBVA 4A03A 1VJ0A 2DBRA 4FGSA 5T64A 4NH4A 4XGKA 3VZSA 5TIIA 3LU1A 1IUKA 1DAOA 3VZQA 3ZNQA 4FBGA 3C7CB 2ZB4A 1RKXA 2R00C 3D5TA 5CDTA 4MP3A 3G1UA 4W82A 4FFMA 4EEZA 3U4CA 3RUHA 4TZTA 2X0IA 3BMOA 4MO2A 1U2DA 1C0LA 2O3RA 3GHHA 1L1FA 3PPIA 5ITVA 2HQ1A 3LSYA 1ZXLA 2WD7B 3L0DA 4Y67A 3HDHA 4U0KA 4GLLA 4R1SA 5EESA 1BMDA 1AXEA 3DDNA 3E9NA 4C7JA 3HE3A 2FPIA 2QRKA 3WYCA 3QP9A 1B8PA 1N7GA 5JO0A 1TT7A 3B20A 1EK6A 2NU9A 4TKMA 5G0UA 2YV3A 3LDHA 3ZHYA 4AICA 1R16A 1E3LA 1GPJA 1PZGA 4CM8B 3ZU5A 3GNSA 4YJGB 3GVXA 1HDXA 1MG0A 1QXSA 1SBYA 4UREA 4GI2A 4PLCA 1GV0A 4PG6A 5BSHA 3PFWO 5DBFA 1UZNA 5TNXA 3VH4A 3U4HA 1U3UA 3KOUA 4CM7A 3RD5A 3BMQB 1UDAA 2O3TA 2I3GA 1ZEMA 3PWZA 2YHUA 4YAJA 5CDYA 3DFZA 4YAKA 2CF6A 1LA2A 2EKPA 2VCYA 2PKRA 3D4NA 3VPSA 4IDCA 2P68A 5JPIA 1I10A 3S2GA 2C59A 1ZK3A 1IE3A 4MVJG 3PTZA 4IM7A 3ZV5A 5KCZA 1QYWA 5L7TA 1LLUA 2DQ4A 3K96A 4TQGA 4CLDA 4Q3EA 5F3RA 1E7MA 4ZA2A 1WVGA 2FN7A 3K30A 1LSUA 4G5HA 1PS9A 1DJNA 3RBZA 1S6YA 2CFCA 2EP5A 3D3WB 1PJSA 5CDUA 1RM5A 1GY8A 3HHPA 5EERA 2X6TA 4ZU3A 2AMFA 1GQYA 2GUGA 1HDOA 3GZNA 4QUKA 4J1SA 3PYLA 3V2GA 5JFOA 1MGOA 1KY5A 4AJKA 4WLUA 4CLOA 4Z9YA 2DUWA 4NQZA 3PDUA 2X22A 1JN0A 1FF9A 4KWHA 4IJVA 1NM5A 3MJTA 4Q3CA 4IPTA 3MTGA 4BO7A 1A72A 1NPTO 1SOWA 1DFIA 1CWUA 3ETDA 4DYDA 1P1JA 2VNAA 3TJRA 4PLWA 4NU5A 4LCJA 2AA3A 3A06A 4BNVA 3NYWA 4ZQBA 4K6FA 3VOSA 4DREA 4RVSA 5CDSA 3CMCO 4OKIA 3RROA 1ENPA 3UW3A 1ISMA 2EKLA 3GMSA 5KTKA 1XA0A 4PG8A 2Q4EA 5T8KC 1HKUA 1LBEA 4W7IA 1H0KA 4BKQA 3V1UA 4U8GA 5JBIA 5BR7A 4XGIA 4J91A 3PJGA 4YJHB 1Z45A 3H9EO 1IPFA 1ZK1A 1RM3A 3ASVA 3K92A 4DLLA 2Q4BA 2AEJA 4IDDA 1QYXA 3FD8A 3WIDA 1I36A 5J23A 1LUAA 5IZ4A 5HS4A 3WBBA 3EMKA 3VVCA 2VWGA 3QLJA 4BO2A 2WTBA 2B5WA 2AE1A 2Y1OA 4ZRMA 3N74A 1N8KA 2C2YA 3H3FA 3ULKA 2ZB7A 1U5CA 3JCZA 3MJVA 3JYPA 5HWSA 4FJ0A 1U2GA 4J7CA 4KUEA 1GEGA 3OSUA 5TSDA 4DUPA 1I0ZA 3W4KA 1PQWA 4PIVA 5I7SA 3TFQA 3JQ7B 4R51A 1DRWA 5AXCA 3TOXA 2Y99A 4IMRA 1ARZA 5G0VA 3D4PA 3QWAA 4PRLA 3SX2A 3IOYA 1V3VA 4CMJA 1NVTA 2J6IA 3IP3A 3U3XA 8ADHA 2LDXA 4J90A 5A3VA 5JDIC 4P22A 3K6JA 3ZHXA 5B1YA 1HDGO 1KETA 4TMFA 5LDHA 1K6XA 1QRRA 4DVJA 4GX2A 4NU6A 3DHEA 1LC3A 3IUPA 5EPOA 1WXDA 1PGQA 2W98A 3ZWMA 4D79A 1B26A 2C5AA 2GZ2A 4Y6SA 2BHLA 1YDWA 2TMDA 1SOVA 4OXKA 5ICSA 3ON5A 3C1AA 2H9IA 4MIEA 3PHIA 1T1RA 2EV9A 5EJ2A 3VVBA 1CRWG 4BGEA 4NPCA 2VWQA 3WG9A 3R6DA 4IJWA 4JJIA 3VPHA 4D0SA 4NHEA 1UH5A 1X13A 1XU9A 2NM0A 3I4FA 5H81A 1E7QA 1EBFA 1MB4A 5DULA 2QG4A 2E82A 2X5KO 4LMPA 2AHRA 7MDHA 1R0SA 1SO8A 4XYGA 5JYEA 4MJLA 4YCAA 4PG7A 3C7DB 4WE3A 5A5EA 1C1XB 2E49A 3WXBA 2GZ3A 1DB3A 4E4YA 2ZTLA 4QX6A 2PZKA 3A14A 4RDIA 2P9EA 4OOEA 1KVSA 2I6TA 5G4KA 1Z73A 4JNKA 4OSPA 4KZPA 4XQ9A 2EJVA 1R6DA 3VZPA 1QORA 3AOEC 3AW9A 3N58A 1XDWA 4GKBA 1B14A 4ND4A 4MPDA 3RASA 5JCJA 4LISA 5JCJD 3OICA 3ZU4A 4JBHA 4ND2A 1ZXBA 6ADHA 4W4TA 1W6UA 1I01A 4ZD6A 4NK4A 2W2KA 1A9YA 4K6CA 1F0YA 4BMVA 2UUOA 4FOOA 1XCBA 1HSOA 4A7PA 3CZRA 2GD1O 2WEKA 3ZWYA 1FDVA 2ZYDA 2X23A 3Q3CA 4YPOA 3LT1A 5A03A 5I9MA 3IL2A 2PZLA 1YJQA 3JQEA 4CODB 2WYUA 5I8WA 3U0BA 2E48A 4QQRA 4L74A 3DHNA 4CR8A 1HETA 3JQDA 5JLAA 1OOEA 3EHEA 1VKNA 4NBUA 4G65A 1PJLA 4ONEA 4BO8A 1DRVA 3GA0A 4GQAA 1HTBA 4RGBA 1B16A 2EG9A 2Y1FA 3GVCA 1HL3A 4IBOA 1VSUA 3OA2A 3QW2A 1E77A 3FNHA 2G1UA 4EITA 2YZ7A 1K2WA 1J6UA 5CDGA 5DCUA 1CEQA 2G82A 2PA3A 2YUTA 1NNUA 4DIFA 1IOLA 3MJSA 3OFSA 1U4OA 2O3UA 4IS3A 3VKUA 4CLRB 2H1SA 3EK2A 4LSMA 4GLOA 3A1NA 3IKVA 4JBIA 4AJOA 4EGFA 3E9MA 1NXQA 2EXXA 1WZEA 5G0SA 3STHA 3FNFA 3GDOA 4PZDA 3QVTA 2OP1A 4DPLA 3QVXA 4Q3AA 4XYLA 3GDFA 2CMDA 4HUJA 2P9GA 3ENNA 4CM5A 3F6YA 3GGOA 3HDJA 5U9CA 5COQA 4CMHA 1T25A 2I67A 3IP1A 1YOVA 2DKNA 3DBVO 3JD4A 3KSZO 3V2HA 3WGTA 4AJHA 1B3BA 1GYRA 1PQPA 5A06A 1V3TA 3DTTA 3AU9A 3ZW9A 4EZBA 1KY4A 2X5JO 3PWKA 3DMTC 5TQVA 4L76A 1DXYA 3NTOA 3G0OA 3L9WA 4OL9A 1CQIA 2HJSA 3OM9A 2AEMA 1NX6A 3GEMA 2I66A 4U6SA 4BKRA 2X8LA 3TL2A 5CEFA 1XHLA 3D5QA 2PNFA 3RWBA 4Z6KA 3JQ6A 1CQJA 1IYZA 2ZB8A 3E82A 3MCVA 4OHUA 4AJLA 2OO5A 4OJNA 4JJGA 2NU8A 5JDIA 1JWBB 1ISFA 4DPKA 1NAHA 4YAIA 3QV1A 4E2YA 3PYXA 2YYYA 2P5UA 3UCFA 1HEUA 4JCOA 4JLWA 3UUWA 5BSFA 4IQGA 4CL8A 1EDZA 2G17A 2RBEA 3FR8A 3C1OA 1HF3A 1MA0A 2RAFA 4F6CA 2EERA 4NBRA 2YHIB 2CVQA 3DL2A 4UUOA 1MC5A 2ET6A 2Y05A 4CMKA 3DWFA 4CUZA 3DXFA 1YVEI 2JAPA 2NLOA 3NGXA 3ZWVA 3H5AA 3NTQA 2WYWA 3DBLA 2CZCA 3K5PA 4CJXA 5LDGA 2NQ8A 4MIYA 8LDHA 1IL0A 4S1VA 3RFXA 2NACA 3QJ5A 4ND3A 2XOXA 4AL4A 4UVHA 3CEAA 2UYYA 1Q7CA 5F1OA 5F1KA 4ID9A 5BNFA 3MOIA 5G4KB 4BO1A 2VT2A 2OHXA 2W2LD 2BGKA 4L73A 1P3DA 2X0RA 3U62A 4IGEA 3HZZA 4WKGA 3QWIA 1A5ZA 2GCGA 2PKQP 2OL4A 4MDHA 1WDMA 1GUZA 1HE2A 4YXFA 1GD1O 2NTJA 1ZK0A 1H6AA 2GDZA 2J3KA 5TX7A 3S2EA 1P44A 4ZQGA 1PGNA 3ZWWA 1SB9A 1YL6A 3DO5A 3PVZA 2DVMA 4BO3A 2J5RA 3ROKA 2ZK7A 4ND1A 4F45A 3GT0A 5IG2A 1G0NA 1NP3A 3GUCA 4BQPA 1OMOA 1RJWA 1TA4A 2BFPA 1LEHA 2WE8A 3BA1A 3JQBA 4FW8A 3WTBA 4CV3A 1X7DA 1H2BA 1LDMA 4YRDA 1RYEA 3AUSA 4EJMA 4DBVO 4FPXA 1SNYA 4RLHA 2VHWA 1R4MB 4Z0HO 3RUIA 1J5PA 3TF5A 4BO0A 3L6OO 5IF3A 3Q9UA 1O6ZA 3OJOA 5KJ1A 2H63A 2O4UX 5A9RA 3DZBA 4GX5A 1CF2O 3PWSA 4LSWA 4OSOA 3TNLA 1UR5A 1JLLA 4E31A 3ZNNA 2Q46A 3UHAA 1EEHA 2PK3A 1R37A 4DLAA 5MDHA 6LDHA 3WQRA 1F8GA 4IJUA 2EP7A 1LDBA 2DLDA 5A02A 1XWFA 2J3IA 2VYVA 4WEQA 5ILOA 3V2UA 4BNYA 3E6AA 2HMUA 1YRLA 1MLDA 3DBRB 4NMHA 3NEPX 2Q1SA 1FJHA 4HP8A 5THQA 4CM1A 3OJ0A 1PL7A 5JC1A 1Z7EA 3UXYA 1K0UA 3AWDA 4BNMA 4ZHSA 1OFGA 1E7RA 1PS8A 4QO7A 1UUFA 4IJKA 1XYGA 3WX0A 3S1LA 3DOJA 3ANMA 1PJBA 1KBZA 4KUHA 1WMAA 2HRZA 4A27A 1X7GA 4K9DA 5DP1A 4IDFA 1TB4A 3MJ4A 3KEOA 2PH5A 3L9XA 4Z0PA 2DAPA 1GZ3A 3HN7A 3KLPX 1HT0A 1QV7A 9LDBA 3RUAA 3OBBA 5IAAA 1JVSA 5JDCC 3KYDB 2O2SA 5K6AA 1E6EA 4WNIA 2BGLA 2NWQA 2NVUB 3A4VA 5I7EA 1IULA 1N1EA 3EVNA 1EQUA 1Y8QA 2B5VA 4WCFA 4FC7A 3MWEB 1Y6JA 2YHIA 1E3IA 2JL1A 3GOHA 1D1TA 1HE4A 1E3JA 2RH4A 2JCVA 3P5SA 4WK6A 3S8MA 2WM3A 1O89A 2HO5A 2ZIZA 3JQ9C 4D46A 4J1QA 3KSDO 5I8ZA 1C1DB 2C82A 2IXBA 1PJQA 1YOVB 4XIJA 1WP4A 1HE3A 2FWMX 3FCOA 3F3SA 3VDQA 4E5MA 1Y81A 2PR2A 3I9OA 4B3HA 4J9UE 1YKFA 2DBZA 4XQGA 4OH1A 4ESOA 2D8AA 1R66A 5L45A 3OIFA 1XG5A 2DTXA 1U9JA 1X0XA 2W4QA 1YQDA 1ZEJA 2FPGA 4ITUA 3S55A 3UF0A 4CM9D 3DZKA 1HZZA 3NAQA 4TRNA 5T5QA 2NV6A 4IXWA 4MOWA 3AJRA 2ZCUA 2YJZA 4YB8A 4DMMA 4FQ8A 1YXMA 4U0JA 5H82A 4ZGWA 5L7WA 3ANNA 5FI3A 5KJFA 4AJNA 3BMNA 3M1AA 1F17A 1EQ2A 4RQTA 2JCXA 1NQTA 4OQZA 2BKAA 4XJSA 3CH6A 2DFDA 1HRDA 4L9RA 2YY7A 3U09A 1NQAO 2GR9A 4LK3A 5FWNA 4MIOA 3D1LA 3RBXA 1B8VA 2JHGA 1HSZA 4KTVE 1V8BA 4NI5A 3ROPA 1NQOA 2PGDA 2WE7A 3WIEA 1QYDA 1WLYA 4I1IA 5GZ6A 3OECA 4IUYA 4AJ4A 2W8ZA 4YAEA 5I7FA 4CLRA 3LC7O 1NFRA 3JQ8A 2FRDA 4WLEA 3INTA 4RVFA 3K73O 1EVZA 1LDGA 1PR3A 2AQ8A 3IIEA 4IXTA 4BO6A 3KV3O 1KVRA 3H6KA 4DLBA 2AQKA 3DZFA 1HE5A 1LRJA 3TN7A 3I9KA 3PJEA 1L7EA 1DIAA 2V7PA 3M1LA 1P33A 4R9RA 4IZHA 3RKUA 3L4SO 4Y8VA 4KMSA 4IIVA 4N18A 2EF1A 2PLAA 3GFGA 3RU7A 3TZKA 4NNJA 5EQDA 3ROMA 3CIFA 1YL7A 4IY1A 4D45A 2AQHA 5L4SA 4WUVA 3H3JA 1ZSYA 3H2SA 3MTJA 4ZQEA 4Z9XA 1HDYA 3PQDA 1P1FA 3BIOA 3P7MA 4MVJH 4R5HA 2NU6A 4BNHA 5C7IO 4WGGA 2ZCVA 3GEGA 5C3MA 1KIFA 4YJHA 1PU2A 1SB8A 1NVGA 1MXHA 3HN2A 2J5KA 1ZIDA 1V35A 3OHSX 4CM3A 3PXXA 4PLYA 1NR1A 1LQTA 3HSKA 4RVUA 2FSVA 5HA5A 5L9AA 3I5MA 4RLSA 4EBFA 1E7YA 4B4UA 2UDPA 1G0OA 5A9TA 1DO8A 1I3KA 2HJRA 2O7SA 4XCVA 4D44A 4OXNA 3ZWXA 1H2HA 2IYPA 1HYEA 2P91A 3AUAA 3NUGA 2EHDA 4J4HA 3SVTA 4W9NA 4P4GA 3JQCA 1NPDA 1IPEA 3AM3A 5G2OA 4LVCA 3TZQA 2QZZA 5AVOA 4G81A 4DQVA 3WGHA 1MV8A 3DMYA 3V8BA 4J0EA 1NR7A 3LLSA 4K28A 4A26A 3Q11A 2D2IA 3H9UA 4EDFA 4J49A 3DAGA 1RYDA 4Q3DA 5LCXA 2X1HA 3RC2A 1ZK4A 2QQ5A 1T4BA 1ZVMA 4BNGA 4FB5A 3ZWPA 1GCOA 5C5IA 1H9BA 1IY8A 4XR9A 5F5LA 4PLVA 2CDCA 2ZTMA 3H8VA 3D64A 1YBVA 3F5SA 3KM0A 5H83A 3WGZA 4H7PA 3QWBA 4PLPA 2EGGA 1C1DA 2EWMA 4R3WA 3ZHBA 4YJGA 4AFNA 2QRJA 1I24A 1F12A 3LF1A 1Q1NA 3TL3A 4BNTA 5TT0A 2JJYA 5ADHA 1HLPA 3O38A 4HY3A 1RWBA 4QFDA 3V1YA 5KNLA 4CMGA 1QLJA 1V9LA 4R69A 3O8QA 1NAIA 1SEPA 4EYEA 4RO0A 3ORFA 1U4SA 4HXYA 4AJ2A 4D3FA 3QE3A 4YYZA 3L4BA 4LMRA 2G76A 1P77A 1U5AA 3GQVA 3E8XA 2A94A 3X2FA 4KUGA 1PZHA 1S7CA 3Q1LA 4UVGA 2UAGA 1TLTA 3M2TA 4DGSA 5JSFA 3L4BC 4OM8A 3IS3A 3KRTA 4FC6A 4ALLA 4CLEA 1UXJA 4BO5A 3B6ZA 4CR6A 1DFHA 3BHJA 2ZJ0A 3EY4A 1VSVA 2EW8A 4FGWA 3RC1A 1M75A 1K89A 3OJFA 1N7HA 3PRJA 2YFHA 1I2BA 1LSJA 1M6WA 1UXGA 2VHVA 3ZHZA 3A9WA 4JQCA 3FWNA 2NVWA 1ENOA 2V6MA 4Z9FA 2GNAA 4R1NA 2CY0A 4L8VA 4ALMA 4D3DA 4RVHA 3JQFA 2FY8A 3DC2A 4B7XA 4XA8A 4HV4A 1E3WA 4K1LA 2C29D 3LT4A 1LJ8A 3WGGA 2VTDA 4BO9A 3JQ9A 2HKIA 2JHFA 2SCUA 2GLXA 4N5NA 5THKA 5HBRA 2BF7A 3GVPA 1T2AA 1T26A 2W2KB 3F4LA 2B4QA 2E6UX 4PRKA 3OQBA 3ZW8A 3PEFA 4DMLA 5U1PA 4AJ1A 4LVUA 3B70A 2CDAA 4LCEA 2J8ZA 3HWRA 4AVYA 4O0LA 2DTDA 2D5AA 5KIAA 4JJFA 4XEHA 4FJ1A 1ADGA 3GRPA 1CYDA 1WMBA 4CMEC 2VZ8A 1JAXA 1LXCA 1SCUA 4WLVA 1VL0A 2GERA 3JSAA 2LDBA 3KB6A 1ULSA 2CD9A 4OAQA 3KYCA 2PD6A 4M89A 1EK5A 2OP0A 3DAPA 4QFCA 3B1KA 5ER9A 1ONOA 5T6BA 2NTVA 2HLPA 2EIHA 3EAGA 5MGBA 1KEPA 3CTMA 5HM8A 4R1TA 1ZH8A 2GZ1A 3KXDA 3QVWA 4I5FA 1FDSA 3C85A 3GZ4A 4GL4A 3UVEA 3HDYA 2ZB3A 1EFKA 1ISIA 1W0CA 3AOEA 3TRIA 1Y8QB 2J3JA 3JQ8B 1D8AA 2POQX 2JCYA 3GN2A 2PKQO 1I5RA 3GK3A 4WLFA 3WLEA 1H93A 1JW9B 3KVOA 2UUPA 3JYNA 5EIOA 3JYOA 4FSHA 3IJPA 4E21A 4YJFB 3H5RA 1TI7A 3BHIA 1LTHR 3RI3A 1FDUA 4BL5A 5IZCC 1Q0QA 2IZ1A 4CUKA 4CMBA 7ADHA 4B4OA 2X0JA 2D5CA 1I30A 1GR0A 1Q0LA 1VLLA 2QZ9A 4HNHA 3M2PA 1YQGA 1ZKMA 3O8QB 1V6AA 1E5LA 5TS3A 2NTNA 1A7AA 5KKAA 5CFZA 2PD4A 3IDSA 1HDRA 2G0TA 4B8ZA 1P45A 1NVMB 5ENDA 1NFQA 1IHYA 2DUUA 1ZSVA 4IQ0A 3TFOA 1X1TA 1NWCA 4P8RA 2PY6A 2YW9A 4CM4B 2VHZA 3WFIA 2B0JA 5C37A 1AHHA 3WR5A 2Q1UA 4CV1A 3W4JA 2B35A 1LLCA 1OAAA 4MVJA 5COAA 2Q45A 1I8TA 4HNGA 3EC7A 1AE1A 4HADA 1DJQA 1WPQA 5EL0A 3VPGA 4J0FA 4RQUA 1HDZA 2ZYGA 3GDGA 3UOGA 2GYYA 2UV8A 4DC0A 4BNFA 4YQYA 5IDQA 1BXGA 1C14A 1H5QA 4MVJD 4NR0A 4O1MA 5GMOA 3H9QA 3GAZA 4OMUA 5TT1A 1Y8RB 4FOSA 2VQ3A 4JIGA 4O59O 2O3QA 2Z1MA 3FR7A 4AG3A 1GU7A 4EJ0A 3OEWA 4I5EA 1DHRA 3GFBA 1Y7TA 4CUJA 4FDAA 1N2SA 5JC8A 1ULUA 1Q0HA 3ICCA 5TC4A 1LQUA 1NPYA 1XGKA 2PZMA 1O9BA 4UVDA 4L4RA 3ZWNA 3ADPA 3G79A 5T57A 2Q2WA 1DC3A 1BDMA 1ONPA 3DMTA 1YB4A 1EVYA 2P4HX 3CMMA 4YRAA 1ZK2A 4XRRA 3CINA 3C7AA 3DZGA 4CR7A 1LX6A 2VN8A 3OP4A 4HFJA 4IDAA 1HYHA 3LC2O 5A05A 3KETA 1E5QA 2DU8A 3HQ4O 2HMTA 3NJ8A 3RC9A 1AUPA 3DZIA 3ADOA 3RIHA 1UAGA 1C0IA 3UN1A 1AN9A 3UCEA 4I5GA 1P1HA 1GYQA 4J3FA 4Q3BA 2WYVA 2F00A 1JKFA 4UEJA 3K8ZA 3PP8A 1BWSA 1ISHA 3WLFA 2D1YA 4Z3DA 4GX1A 1W73A 3Q9NA 1BSVA 2GN9A 1U3WA 2EGHA 4M1QA 5HS6A 1QSGA 2ZTVA 3AY7A 3ONDA 3IAHA 1O5IA 4NDNE 4D7AA 4FJ2A 5HRUA 1YE3A 4IDEA 3DFUA 4WOJA 2Y68A 1EUCA 4GMGA 2ZATA 3GEDA 1ID1A 4XRGA 4BMSA 4DIOA 1KC3A 1ISGA 3PK0A 5I9LA 4DRYA 3G3EA 4BV9A 1RM0A 3IC5A 1C3VA 4PLTA 3QWHA 5JMPA 4NK5A 4UVEA 3PHGA 3PHLA 4MVJI 2DC1A 2X7HA 3MJEA 1SMKA 3PHHA 2QX7A 3K31A 3MJCA 1X7HA 1FDTA 4INAA 4F6LA 4NFHA 4Q39A 3ZZNA 4FFLA 4P4LA 4C4OA 4D43A 1HXHA 3WSVA 2E4AA 3HFSA 2B4RO 5DBIA 4DQUA 3E18A 5CAEA 5LC1A 3H7AA 4RPJA 4UUPA 3L6EA 4XKJA 5DF1A 3WSWA 1HZJA 4BS9A 4WEOA 3NJ4A 1YL5A 2Q99A 2GN8A 2I76A 1B0AA 3ETGA 3K9QO 5KJCA 4GSKA 2BFMA 1R4NA 3WDSA 4YQZA 4MP6A 5JY6A 4BUCA 1P0FA 4LN1A 5AYVA 1U28A 4E2XA 3E5RA 1KEUA 4R41A 4QECA 5CHEA 3GNTA 1VI2A 3JQBC 3GMDA 1DDOA 1UXKA 2NU7A 4H16A 4RV9A 1PJTA 4TRMA 4GVXA 5AXBA 3SEFA 2BLLA 2O3JA 2V6GA 2CSUA 4ZN6A 2W90A 5T8KA 4BNJA 3U4IA 4N54A 4TROA 4O5OA 3VTZA 4YBZA 3QIVA 2X4GA 1WZIA 3JD0A 2I65A 5K0ZA 1ZUD1 5DCWA 3I9LA 5AOVA 5IDXA 3OMLA 1WW8A 2HAEA 2V65A 3I9NA 4TVBA 5JYDA 2C0CA 3WYEA 4FCCA 1WAMA 2G5CA 4J1TA 1HWYA 3FN4A 3E1KA 5L51A 1I33A 2Q1TA 3ZN2A 1HDCA 4WASA 3F47A 3F9IA 4FD3A 1PIWA 4BKPA 5AXAA 1D7OA 5B37A 3ZWCA 4UVIA 1SZJG 5KVCA 1BTOA 1SC6A 1KEWA 4ZQFA 3GPIA 3S2IA 3ZU2A 3HFGA 2Q50A 1CDOA 5JNLA 2P9CA 4XD2A 4F3YA 1D3AA 1Y1PA 4GBJA 4J7UA 1DC4A 3U5TA 1LU9A 4FS3A 3TZCA 3WICA 4NZ9A 3R3SA 2VTEA 1EDOA 1GDHA 4JROA 3LYLA 4YTEA 1CETA 3D3EA 2B37A 1YB5A 1VE9A 1P31A 5DT9A 1X0VA 2AEFA 1H6CA 3NT5A 2VUSA 4D3SA 5B4VA 2P2SA 3PI7A 5EQFA 4XDYA 3X2EA 1GQ2A 2JD1A 4M54A 5I9NA 5JXWA 1XEAA 1R4MA 4CMIA 4G2NA 2D0IA 3LZ6A 4Y6PA 1VL8A 3PZRA 2BD0A 3CUKA 2H6EA 1XU7A 4XGNA 4BNUA 1GTMA 2RHRA 4CQMA 4I9NA 3O26A 4NJMA 5FEUA 2VHXA 3V1TC 1BG6A 2EKQA 1D1SA 3CSDA 1VM6A 2EW2A 3PJFA 2IODA 2HUNA 4UUNA 2Q2VA 1PGPA 1PJCA 4LRSB 2C54A 9LDTA 1TXGA 4XZ3A 4RF2A 3ST7A 3QRWA 4MKXA 1SPXA 3JQ7A 4I9UA 4WNCA 4J2HA 1UZLA 1KS9A 3RJ9A 3AOGA 4PFJA 2A92A 1YWGO 1M6HA 2OORA 5L40A 5DZSA 1NASA 3BTSA 1DIBA 4ZQHA 4KP7A 4GWKA 3DBRA 3KEQA 2YV2A 2C07A 1WDKA 2CF5A 1N5DA 2IE0A 1LRLA 2IEBA 2Y1EA 1Q2XA 1JVBA 3H9JA 2BMAA 3UKOA 1XELA 2X58A 3SC6A 3WWZA 4JP2A 3AY6A 2FSSA 1IHXA 1U1IA 2DPGA 4FN4A 4J2OA 2O50A 1M66A 3GVIA 1QYCA 1MFZA 3OF2A 3PFFA 2RH8A 1OI7A 2B4TO 3WNQA 3AI1A 3IKTA 3ZCXA 4M87A 1UAYA 3EUWA 3F5QA 1PZFA 4E0BA 1FK8A 2OGUA 1TT5B 3CZMA 2HMSA 1KYQA 4PVDA 4XDZA 2GO1A 3NX4A 1XIVA 3WB9A 4J7XA 2OXIA 1I3MA 4WOKA 4CV0A 1U3TA 1J4AA 4PLFA 1UJMA 3FBGA 4DTIA 2HK8A 3BAZA 4GGPA 2QYSA 4BO4A 3KZVA 1EUDA 1K6IA 1K6JA 1LC0A 1GUYA 3TOZA 4M8SA 4CMCA 1BW9B 4DYVA 4YEDA 3RC7A 4R1UA 1GL3A 3OH8A 4YVFA 4JX8A 3W6UA 4R5MA 4BMNA 2Q2QA 4RORA 4W6ZA 4E6PA 2I5PO 2VT3A 1U7HA 2C2XA 4TKLA 2VWHA 3WTCA 3EZYA 4R4JA 1VC2A 3QQPA 4BQRA 2VWPA 4AJPA 1DEHA 4HX5A 3DQPA 1GFSA 2D3TA 3WQSB 1QV6A 4DXHA 2R2GA 2Y0DA 5A4DA 1R0KA 4PGFA 1O94A 3WGOA 4FFPA 2YQ4A 1NTOA 5DOVA 2B83A 3SXPA 5GZ1A 3BXXA 4UEKA 4ZJUA 5TJHA 2A4KA 1DC6A
chains in the Genus database with same CATH superfamily
2A9FA 4CGYA 3QUSA 5LQCA 3BJMA 3WNZA 1M8PA 1Y7LA 3F4BA 4IGIA 5JWOA 3IQIX 2DMRA 1EX7A 3LY8A 2JEOA 3VAYA 1NGSA 4MMZB 5EJGA 4XFKA 1GQQA 1RP1A 2BHTA 3ICWA 4LJLA 1X6VA 4PJMA 4CS7A 2RBKA 3QEKA 1A98A 5JS2A 1OZHA 1LDEA 4XYEA 5KNCD 1L9XA 4Y1RA 2XWJI 5KOJA 1EINA 2FWIA 3ASUA 2XIQA 1G21B 4UHFA 4X8MA 3G49A 5BT8A 3TOLA 2H5JA 3BVPA 2ZIAA 3I2HA 1HNWB 5EKUA 1N5IA 3HEAA 2CCYA 2VK2A 1NBAA 4CT4B 2GTPA 5G53C 2BFDA 2LNDA 3E7WA 4X61A 3UB2A 2YCLA 3HJHA 2VDUE 1NP6A 5EHHA 4YP9A 3U9TA 2PL9A 1LF5A 3U4AA 3AR9A 1RPTA 1L5NA 1FOEB 3CAXA 1G9XA 5IT0A 2GESA 3ICPA 4FIDA 4NBVA 2QSUA 1SCKA 1OIXA 5EXXA 1BYIA 4JY7A 2CDBA 4PAGA 4Y6QA 2XRMA 2G9NA 5BNIA 1IZ7A 1NLXA 5A0TA 1E4EA 2G1KA 2YZKA 2BGWA 1CNFA 1KGDA 2YIMA 2VAMA 3OWTA 4KO3S 4MUBA 4LY6A 4JGBA 1UBKS 4KYVA 3Q87B 5DN9A 4DM3A 4DEXA 3HJAA 4FR5A 4KWIA 1JIJA 1UFVA 5I8PA 1ZW6A 4KVZA 5K8IA 3GRKA 2ZBVA 3UHPA 2IZ0A 2J48A 5BRAA 1VKOA 1R6UA 3HM2A 2G3KA 3V8VA 3H04A 5CBPB 5H4GA 1Z07A 4M1YA 3RLFA 1R9GA 3UWKA 5HXAA 2VYQA 4PWZA 2XUHA 2G63A 1QBGA 2Z95A 4U2GA 4UHEA 5KUTA 2O5EA 3EIWA 1T1EA 4GKVA 1SD1A 5EYPB 1QDUA 5F98A 1N1GA 2VRCD 3OTGA 3M4BA 3DQQA 4OK3A 1GZ4A 1QUEA 2X8BA 1MNAA 3CSSA 2XS1A 5JAQA 2YVKA 1DO2A 1V9CA 1ZD5A 1T9CA 2OMEA 1XAHA 1F51E 3EGEA 3LL4A 3LQ2A 3B2QA 4LRQA 5JI3E 2FXVA 5F5NA 4FDLA 4DSAA 5HF5A 2OHGA 4AMBA 4RF4A 1WEKA 4AUMA 5F2OA 3ZYCA 4XGRA 1U6JA 2JI9A 2I91A 1PRYA 2O8EB 2FDXA 4BJ5A 2RIPA 5HCIA 3ZH2A 3E53A 3HJGA 4E08A 4DSZA 3LP6A 4HYEA 3R74A 4EZEA 3EZLA 4G41A 2V3CC 3INGA 4NCHA 5K3FB 5FCLA 4DV0B 4B8WA 3G1TA 2HU7A 3S29A 1MMFB 4LXYA 3T94A 3TLZA 4G8JA 4QNNA 1MR3F 3ZNPA 4QM7A 4HXGA 1DEOA 2X5OA 4OO3A 3LK7A 1A97A 4WKBA 2IEDA 2DXIA 2PMDA 3DBLB 3NOVA 2IZ6A 1X7ZA 3T3GA 1QTIA 3ZV3A 5IM5A 2R5FA 4US2R 3QU9A 3N2KB 3P0EA 4TM7A 1N9GA 1P91A 3GLFB 5L4LA 3N24A 1PTKA 2V59A 3HDTA 3GM3A 3IBTA 5EE9A 4BAUA 2QD5A 1GNPA 3E5MA 3V5XA 3IQTA 2JDID 4IO1A 4CIHA 2XTMA 5L3VA 3BTOA 5GAJA 3GR6A 1P39A 3OKAA 3AOUA 1KYIA 2GPTA 2I2WA 3O5AA 3KSRA 1QR6A 1S89A 3BOSA 3KEGA 1I14A 1BXKA 5NLLA 2FQQA 1GUFA 3CWZA 4I36A 4RPGA 5HFAA 3FF4A 3HZRA 1NBWB 1RWKA 2FW8A 1VBMA 1X2BA 3MT7A 1YACA 1V5WA 3OQMA 3X2QC 2Q49A 2HF8A 2NVBA 4RH1A 5JJKA 1XRJA 4KIWA 4BNDB 2WQ7A 1GN8A 1KO1A 4D6YA 1E1CB 1DC5A 3T7KA 3EXFA 3IHKA 2BFOA 4DHWA 3DGEC 1ULZA 3T6BA 1BVYF 1NBMA 3O3OB 2ORIA 1DS6A 2YXPX 3ZQ4A 2QMYA 3DEHA 1LSSA 1SD2A 4URWR 4ALNA 2Q9AA 1I1HA 3UFBA 2QRVB 2RB4A 2XMRA 2C5SA 3HG7A 1H6DA 2OV4A 3KDAA 3L1IA 3HSSA 3GZTB 1S9DA 3K09A 4RKQA 5IAEA 3WIBA 4DLKA 4O2RA 1GGMA 3OKCA 1KBOA 3DZJA 4II7A 5LP6B 1FBNA 3MBIA 2XDAA 2Q8QA 2ZJ7A 3M9WA 3KX2A 4YJ3F 3EXIA 4Y2YA 3B9PA 4MYCA 2V3WA 2AF3C 3WYFA 1FEZA 2O2YA 4FNOA 1C3OA 4K03A 3T95A 2XLEA 4GL2A 4YWHA 2P6PA 1Y1RA 1I7NA 2WWTA 2X9NA 1LBHA 3E3MA 4DCMA 3DBHB 5F2EA 4YDRA 2NZ8A 3BCRA 5M04A 1UMDA 2ICAA 4GI5A 1IRXA 3QXHA 2V6IA 1DSSG 2F8MA 1P9LA 3DB2A 3OHMA 3PFBA 4AX4A 2J67A 1Z0AA 2JBHA 3E3LA 3SHWA 4TWAA 4ZEXA 1CU1A 4EPTA 1WNFA 2FE1A 4G5SA 2VHEA 3D3WA 1KY3A 4P7KA 1PSWA 2BFDB 2Q5QA 3MRTA 5SZKB 4HG2A 3RIEA 3SSOA 1XMVA 4XSGA 4CKCA 3THXA 2OHJA 3E4DA 4X1KB 5DOZA 1HYGA 3H65A 1ZC3A 2WKSA 4LZAA 3C3KA 1XFAA 3MTDA 1USKA 4BMXA 1IN8A 1HX7A 1GYPA 1ADCA 1I3NA 1PG2A 1UPFA 3OIGA 2ORVA 3DE7X 2QTZA 2RD2A 4XEUA 4UFPA 1M0EA 1I4DD 4BQQA 2JRCA 5I7UA 2MCFA 1DWPA 1UDBA 3KT0A 1WL8A 4RJTA 4IWBA 5DYYA 4HVTA 3SN6A 1JMYA 4XQEA 3TQCA 3FOPA 2R8ZA 4IUDS 4G0YA 4EHDA 1GGJA 4GYJA 2DZDA 4GSYA 3EGVA 4HO1X 5L3ZA 3G1WA 2XXJA 3W8HA 5U4XA 3O4FA 5BQXA 1UAAA 4WCFC 1I3LA 3K9LA 4F8EA 2A0KA 2XYRA 4ROSA 1KEEA 3JWEA 4IDNA 2R6CA 4WN3A 2JLYA 4Y6OA 3V1MA 2H1WA 4Q24A 1KARA 2Z0MA 2ZYWX 4W9NC 1VK5A 2WD8A 1VJGA 3RFTA 3CQZA 3KQPA 1XKQA 1YGYA 4PZLA 3GWLA 3BSYA 5F21A 4EGJA 2O8FB 1YKGA 3WLPA 4B17A 4U7DA 1WKBA 1JA1A 1YDGA 2PBEA 3VTAA 3ESRA 3MC1A 1V7PC 5BN4B 4LACB 4YT4A 3AU8A 3HVIA 4WXYB 1J5XA 3JQGA 4C08A 1MMAA 1SN7A 3H4IA 4Q82A 5D2CA 2UVPB 3L7BA 4DA4A 4YCSA 3WLQA 2FKNA 4U6NA 3U8VA 1LPEA 4YUWA 1C7JA 4DV1B 4OF4A 3AIOA 5FTMA 5A7FA 1KDOA 2EJWA 2C7GA 2WIFA 3CUTA 3CZQA 5BY2A 3BZBA 5CG1A 2VZ9A 3K70B 3H0KA 3H19A 1H6BA 2AN5A 2PO5A 2OAQ1 4DILA 4GXQA 3JV7A 2DFVA 2ATEA 3F1KA 5I4CA 1FDWA 5HGJA 1LNSA 3E48A 4QELA 4B09A 3FMOB 2RHCA 4LV6A 1R5ID 2WJWA 3IOBA 4A36A 3AR2A 3CVUA 2OM6A 1PEDA 3UCXA 1W8DA 2EYUA 2Q3LA 3BE4A 3QI2A 4RMGA 2PHZA 5IKPA 3BXOA 1NW8A 4EEKA 3HMQA 1LE4A 2EINC 2HIAA 4FYHA 1A4RA 1QHEA 1T8SA 4KQWA 2WF5A 4FWTA 4ADSG 4FR2A 4LFAB 2PTHA 4GLJA 4JB8A 4RTQA 3W5CA 4U2BA 1JTVA 4GZLA 1OC2A 1P3JA 2ZRBA 2B94A 2PVSA 2QI9C 1G60A 2O2CA 3LDGA 4MPTA 5CURA 2QM0A 4X41A 4RTJA 5E2IA 2H31A 2PRKA 1TM4E 2HPVA 3LWBA 5FBZA 3T41A 2CC2A 3QHQA 4CL3A 4CIAA 1E9CA 3ONFA 3LOUA 1XOIA 3DWGA 1O8CA 4QRHA 5EIFA 1MAVA 1X2EA 3OJEA 3FHDA 3NTVA 4E12A 4YR7A 2KB0A 3IXQA 5A1TA 2VC2B 2QWXA 3I01A 5GY7A 5TE9A 1EIZA 3LDFA 3DKVA 1HQCA 3OT5A 1UZMA 3G0GA 4R01A 2Z2XA 4KV7A 4ZREA 1L8AA 2IEGA 1C7FA 4U5CE 2O3SA 2YICA 1L5LA 1OH6A 4JEHA 2H11A 2XGMA 2VTBA 4RNCA 4JURI 3K9FC 2P9YA 2QAIA 4DR5B 4YUZA 2AJDA 3HCDA 2A6HF 3NM6B 3PXEA 2Q6KA 4Y2PA 4PC1A 5KCMA 4DFDA 1IY2A 1J7JA 1HNZB 2IDKA 2Y1XA 2GJ9A 3DZHA 2VDLB 4CM9A 3SVLA 2BY4A 2NAFA 4KFTA 1GKUB 1UMBA 4JBXA 1JDPA 2BCEA 4IG4A 2MSLA 2WZQA 2I7XA 4ZOLA 3DBHA 4TTVA 3SJUA 4B6JA 5IH3A 4H08A 1U4NA 1YCHA 2ZEJA 5HIIA 4DWWA 2FUG1 2RAVA 1KKUA 1AQYA 1V43A 2WHEA 4K9MA 4NPAA 4XB2A 4YACA 2V5VA 1OY1A 2O7VA 4FMCF 4LHZA 3RDPA 3RG8A 4LGCA 2AWOA 3KR1A 4RSHA 3GAMA 4TSRA 1FVXA 5EJ4A 2YNMA 5IK2D 1HM5A 1K5PA 3FRHA 3CN9A 1UOEA 2GK6A 1H8HD 2PZJA 3LOQA 5CIQA 3UKDA 2JD2A 5DB4A 1PL0A 3HNKA 1WB6A 2B92A 4QTZA 5JAOA 1VRCA 4QXOA 2IM8A 1O6BA 5H3HA 3WWYA 2ZXEA 2AT1A 1M2JA 1T0IA 1MT3A 1WUIS 2AFHE 5FZTA 4CF3A 4RPKA 2VF2A 3W5UA 4BLSA 2P62A 4O2AA 3VNVA 1PR9A 3K1TA 2NADA 3KUCA 4TQ9A 2ZTUA 4F60A 1P60A 4EMUA 3K71B 4MV7A 2BJHA 3QNUA 3SHTA 1BCRB 1H42A 1QKIA 4OB7A 5KX5A 4EIWA 1CSEE 1ZISA 4GR4A 4EP1A 2IEAA 3ISVA 4MTGA 3EPPA 4E33A 3H5IA 3JXEA 1TKCA 1VZ2A 1DX6A 5ED4A 5IMSA 4UAVA 1NQXA 4QKQA 4Z8XA 1A2BA 3JPYA 1JMWA 4LHVA 4MJ7A 5DLJA 2AS0A 5K6RA 2BONA 2CGEA 3CLSD 3AM4A 4J16A 2ZI7A 2RK3A 4IKEA 3ZLJA 1FUKA 1NBOA 5EIEA 1D5CA 2OO5C 4FIZA 4WCVA 4ZAVA 1EVIA 3VR5D 5I7RA 5DKFA 2IOYA 1T4CB 3EIOA 4F5DA 1H94A 1WB5A 3DEAA 4MLPA 4Y0NA 1G5HA 1Z13A 3R09A 2C5EA 2JJ2A 3PDIB 2W8BA 5DYNA 2UKDA 4C7KA 4E32A 3V9PA 1NFFA 1CIVA 1IIBA 1MXFA 1GPWB 1NZFA 2ACVA 2JFVA 3JYLA 3QLUC 5FYQA 3K0FB 1YZAA 3AETB 5DP2A 4M8KA 4JP3A 2P7HA 5DBHX 4BFWA 1KJQA 3OP1A 2O14A 1B8UA 2Q9BA 3A4IA 5I7EA 1O94C 2W0MA 3GFTA 2FYTA 3I5QA 2XV1A 3AVWA 2I2CA 3AHJA 5HTOA 2NYVA 3W8EA 1AV6A 1JWAB 1BJTA 2LRHA 5J2UB 3ZR4B 2R11A 5TQJA 4TKVA 3D5EA 1EZ1A 1XR3A 1QLHA 2HCTA 3V5ZA 4L9AA 4KYTA 1E1NA 1QG6A 2E21A 3WQQA 5DNEA 4BZPA 5ITSA 3EWIA 4G3XA 3UHOA 2NZWA 5ALJA 5KYKA 2HR1A 1PL6A 3UATA 4WACA 1Q3TA 2UUCB 3CURA 4OIFA 4BB0A 4QARA 1GILA 1W75A 4TTPA 4JTDB 3FTPA 1PO7A 3O94A 1ADYA 1SUAA 2Z5LA 4KNYA 2P1DA 5SYMA 4BCDA 2FQWA 2DCMA 3WBFA 3S2FA 1PR1A 1XNGA 4JV5B 5HJ5A 3NKLA 4HAUA 2QX9A 3NRCA 4FP9A 2V45A 2B2NA 5HK9A 1LTKA 1OQCA 1ADBA 4JLOA 4IWXA 5JNRA 2ZBEA 3KOZA 4GWGA 4Q05A 1CULC 4KG7A 4EHNA 1DJOA 3JQAD 1GJRA 3OCWA 2WJPA 1NNSA 4RFSB 3EZGA 2NQTA 3HKEA 2W42A 2OHHA 3ZY2A 1XDDA 3IRVA 3P9CA 1PJ4A 3C15C 3MT9A 3TJMA 5IN4A 4C4AA 3TM4A 1MHPA 1OPRA 2WZFA 4MI3A 3ZWNA 1XRRA 1TJ3A 1P80A 1A9QA 2QN7A 5K2MA 3TCXB 1QH8A 3ZY4A 1UCFA 1RKVA 3QKWA 2KC3A 1Q0RA 2AX4A 1B2LA 4G1CA 2YQ5A 2HS5A 3CLRD 3MERA 3X3HA 4D9MA 3RS3A 2O8BB 1V8DA 1XCOA 4WXMA 4TKUB 1X70A 5CT6A 2P4SA 4BP9A 1U8FO 4PZZA 3ZWBA 3U3ZA 4QOHA 1OX5A 4EHBA 4GIBA 5LZ2A 1SR8A 5ITZA 1B3RA 1TIBA 2SKEA 2ZAYA 1KERA 3FPCA 1KJYA 4YV7A 4BXOA 5EP1A 3NDJA 4WINA 4OBBA 4IVNA 1CJKC 1CZNA 1E9FA 2UZ3A 3OTIA 3T7AA 2X9LA 1CUGA 3C41J 4HFNA 2HMQA 1F2UA 2YYSA 1FFBA 1GKIA 1J09A 2B6HA 1VYKA 4LXGA 4X5OA 4MRAA 3VC7A 2H16A 1RRKA 5THXA 3BMCA 4EVQA 3GLIE 4GXRA 1K5HA 4YO8A 3PC2A 1IXZA 2QUBA 4QYMA 3S44A 1CX9B 1AU9A 3BERA 4IF6A 1UXHA 4AJ9A 2IPXA 3W6PA 4EG5A 3A7DA 4IVQA 1JAFA 1WMDA 1KHTA 2XCUA 4LYAA 4JH0A 3L8EA 1GG9A 5KQLA 3LCCA 2VJCA 3LA8A 4XQCA 4NS1A 1YJXA 3AI2A 3R41A 1JZSA 3DL4A 4WBSA 3R0JA 3ABLC 3B2EA 1WKCA 1ZICA 3GUYA 3NKVA 5AXDA 2D13A 4WMLA 4QO8A 5I47A 1VI5A 4MKZA 3GFQA 1EVJA 3STWA 3WI7A 4ND5A 2WT9A 4ZI7B 2D06A 4GMHA 4Y6RA 2FMHA 3PQ3A 5KMGA 2XMPA 1X1DA 3WLOA 3H1GA 1MJNA 1AHIA 1F4LA 2QTTA 3HACA 1ULHA 3QLEA 3HNJA 5ILGA 1UP6A 5AVXA 4HH4A 1JZTA 3I42A 2PUVA 2YHAA 2BPOA 1VLVA 4P53A 5ARCA 2ZSFA 2VOJA 3ZHOA 1RCPA 4FEEA 3A2MA 3M4ZA 4L27A 5ALNA 4D9JA 4DQ0A 3PIRA 1PCXA 4FEAA 2ESRA 4RWEA 1X1CA 3JWHA 3SICE 3V7NA 1LZLA 3K7DA 2J08A 1CDZA 3DAHA 1T91A 1G8SA 3L07A 1Y9AA 2EEPA 4A15A 3VSDA 3RARA 4X66B 1WF3A 5IP5A 4QQFA 4EJ6A 3AKEA 1DQNA 3WV4A 3WGYA 4A2CA 2YWHA 4AW9A 4QU9A 1FCJA 3SXYA 1VMDA 2ZTHA 3BJEA 3OG9A 2X9VA 2FEWB 3RQSA 2IGBA 4W7HA 4U5GA 1B76A 3TINA 4NZMA 5HRAA 3JQGB 1V0JA 3KSMA 1TC1A 4FESA 1E66A 1O3YA 4I1SA 3EJWA 1FVHA 2AE2A 4K9RA 2JD0A 1ONNA 3DC7A 2VXBA 1WLSA 4GECA 4NU0A 4B3GA 3I5YA 5DHUA 1DG9A 4U9DA 1X39A 3LKBA 4GVLA 1PWZA 2V6FA 3VH3A 4OD0A 2E4YA 2LIPA 3UO8B 2QUHA 1FDRA 5JAIA 4C2BA 1MRZA 1XVAA 2Y66A 1O4VA 3NQ41 1M2HA 2E55A 1TJYA 2RHLA 3G17A 8LDHA 1M1XB 2VF7A 2PN1A 3D4OA 4CM6A 1RBQA 2BELA 4AQYB 1NI5A 1T3HA 1G8XA 1WTAA 1VLZA 4RPCA 4YMSA 1CEXA 4YI5A 4A2QA 4JR2A 5B7QA 3V80A 3L0OA 1BW9A 3FPGA 1UMCB 2ATCA 3IKLA 4DRIB 1W35A 1Z12A 3MD9A 5TGDA 3SJZA 4DQLA 5AW8A 5CB4A 3B3AA 3L1HA 3W4IA 4NBTA 3JAMA 2V7WA 1Q1QA 4RVOA 3KJZA 3GZNB 5F51A 1JDNA 3A4NA 1KDVA 1XCGB 4XYMA 4FKBA 3PQEA 3RYFA 2HDNB 3P0FA 2VYVD 3KT3A 4P08A 1PSDA 1TJPB 5HF9A 1YF3A 1EHIA 5F28E 2P90A 3Q3JB 1F3LA 1CE8A 1NXTA 5DX1A 3SBOA 2ZROA 2ZJ1A 4GS5A 3IBFA 2FUKA 1VGRA 2BKXA 2I2DA 1F38A 5BUOA 3BDAA 4RFSA 5GONF 1RYBA 3LJKA 5AJXA 2A5YB 4ZT4A 4X64B 1XN4A 3I4CA 2GZMA 1YIDA 5FL7A 4QGGA 4RA6B 3W3ZB 5JAUA 2LCFA 2GVNA 3L84A 3PZBA 3QXGA 4W99A 5JJCA 1GAJA 4R9VA 3P2OA 3WKAA 5BN3A 2AXQA 5F1YA 4QICA 1LWNA 5DRYA 2WU4A 5GM2A 2QIOA 3QA9A 3URKA 4OKNA 3VAZA 3PX7A 3R3UA 2QQ0A 4K9PA 2VKQA 4RXTA 3OF5A 3L82B 5I4IA 4HAZA 3VSCA 4Q18A 2G67A 3E7FA 3FYUA 4Q9DA 3ADBA 1G3UA 4IV5A 1FMCA 1I3OA 3KJFA 3KWJA 3Q2IA 4LE0A 4X1OA 5FPHA 4GGOA 1E2GA 4MUAA 4NNOA 5A9SB 3A3NA 3NYIA 2G25A 1A9ZA 1MQAA 2CDNA 3KPVA 3DEYX 3LPLA 2HH9A 4II3A 3BB1A 1OYOA 1US8B 3IMGA 4NP6A 3AXTA 3HXOA 3W06A 1SM4A 1Z7BA 2REOA 4IYJA 3UGOA 2C8JA 2VYND 2DBQA 2VF8A 1O0BA 3QMVA 3H5VA 2N47A 2MSEB 1TTQB 3CYFA 3FHJA 3Q8XB 4D4GA 3LUCA 1XZPA 1UINA 3CX3A 4CI0B 5CXUA 4JI3B 3K2EA 4O25A 2ZM6B 3RNLA 3EYWA 5F2NA 3U0VA 3BMCB 4PINA 4RTNA 3FPKA 5PGMA 2X86A 3WHKA 4EG3A 2FWRA 3PYMA 4XWYA 1N33B 1IHDA 4IGKA 4DOMA 2YQZA 3SX4A 3A25A 1M1YA 1U9ZA 1SXQA 3AI7A 4MVJE 1BXGB 3S84A 4JNCA 4PZCA 4MVJF 1P8AA 3A1WA 3HU1A 5JZMA 1EA7A 3G5UA 4B71A 4ZVVA 4PFKA 4DR2B 1Q5PA 3O2QB 3MEQA 3SQNA 3L0CA 1YJAA 2JAQA 2JD3A 3GN1A 3HB4X 3IMEA 4MWDA 1YA8A 2I34A 2JAXA 4RDHA 3RREA 5FH9A 3OETA 4C2UA 4UUMA 2OZLB 4OYLA 2EKDA 1PV2A 4B7AA 1N2IA 2ZT6A 3DVAA 1MVNA 1KFEB 1N2OA 1XVUA 4RS3A 3TOSA 1RXWA 5A4MS 3UK7A 4ZI2A 2ZUUA 4DYHA 1P1KA 2X2OA 1QF9A 3IT0A 4JHLA 4YWQA 3K05A 4NQRA 4ZQIA 4TZKA 4C6SA 3DM9B 3BQ9A 3SHQA 1W36B 2D59A 5HRCA 2E4UA 2XYVA 4PZAA 1M1NA 3IQDB 4QEDA 4TYPA 2OCIA 4LOKA 4ZVUA 3H9GA 3GMIA 4RZUA 1GVHA 1RKCA 2FSFA 2IDZA 2MYTA 1E2NA 4GPIB 2J9UA 2I7TA 1WPRA 1Z74A 2QN8A 4E0HA 1R6AA 4DMUB 2YWRA 4M3NA 1Y4AE 5AHOA 4HRVA 3OEHA 2YV1A 1QANA 3R0IA 5DGIA 3SLKA 3VDRA 2BFCA 2GK3A 2QM7A 1H3FA 4H4DA 1KAEA 4PGAA 1B0PA 1I1OA 2ZRLA 3AUTA 5CH8A 1U2DC 4BJ5C 3L6BA 2XKKA 1DHTA 2ECQA 5JP7A 2XRFA 1RXEA 3PKIA 3FA2A 2RGAA 1Y9JA 2R6R1 3PC8C 2P41A 1AXGA 1E2KA 3NHFA 2P0AA 4NZPA 3PDJA 3T5CA 3TDKA 5HX7A 2LXNA 1II8A 2XVXA 3TVYA 1IOZA 4EW6A 2XVAA 4XTRA 3S99A 5M34A 3R4VA 1VTMP 3AJMA 3NHYA 3P2YA 3JVEA 1ONSA 1Z9BA 2RKWA 3H2GA 3PQ7A 2JKVA 1I4WA 3WJ7A 3OQPA 3MGBA 1LLFA 1XDZA 2C2MA 2H2WA 3AY0A 1VJ0A 3B52X 3RBVA 3UMFA 4A03A 1YYXA 2CV1A 1TAUA 2N42A 5HOQA 1GS9A 1K98A 4WKNA 1F0KA 4QUGA 3RUPA 3ICVA 1IUKA 4IRMA 2X42A 4FBGA 4V0NA 4F2GA 4MITA 3C7CB 2BMWA 2ZB4A 4LQLA 5CDTA 1XQWA 4FFMA 5FT9A 2X0IA 1A88A 3BMOA 2GKOA 4LOIA 1S4MA 1L1FA 3KUDA 4XARA 5AUNB 4WK0B 5DU2A 5T7BA 2ZWPA 2WD7B 3TD7A 2IA5A 2NN3C 2REXB 2VDWB 4B81A 3R7NA 4PPGA 4G89A 4LF5B 1BMDA 2R8YA 4ESHA 1Q21A 1DP4A 2FSUA 3M6XA 4C7JA 3OUZA 3WYCA 1B8PA 1EK2A 2IU4A 3D7SA 2Y39A 3C74A 4X24A 2B0HA 3AWIA 4RJKA 5KI6A 2NU9A 4AICA 2YV3A 1ITZA 4FHGA 5DV9A 2VJAA 5TXGA 1E3LA 4CDNA 4CM8B 3NFYA 2R1TA 2ZXOA 2QENA 3GNSA 3HRIA 3MN1A 1WUJS 5FL3A 1P2TA 4JW1A 4KQ2A 1OFVA 1NDUA 4FKZA 4RK6A 3WWOA 1S3SA 4JTCB 4PLCA 4TKUA 2Y9PB 3BULA 1RIFA 3G7UA 4N65A 1GV0A 5CAEB 1V11B 5BSHA 4KQFA 5JTUA 1IVNA 1AQIA 1N5KA 5JI2E 5KREA 1XWIA 4WK4B 1F0PA 1S3IA 1U3UA 3AUFA 1W9HA 3DWEX 3RD5A 3EY9A 4XSVA 4BU1A 4INJA 4BX8A 4D0GA 2PQMA 5BOSA 4ND6A 5C7YA 5J43A 1A2KC 3NMIA 2FQ1A 3G7NA 3PWZA 4GGMX 3I8XA 4N03A 4YAJA 3I62A 4Y9TA 3SXKA 5CK5A 4TYWA 1J8YF 1KU0A 1RKQA 2ACEA 2CF6A 2EKPA 2PKRA 2VCYA 2VSQA 1F2UB 2ZQ5A 1DL5A 3DGFC 4MYTA 2P68A 2X0DA 4P81A 3ND5A 1ZK3A 3L1MA 3IMCA 4UHBA 4AX8A 1QYWA 2VNIA 3E8SA 4Z86A 2DQ4A 1K27A 1L5SA 3HBAA 4AWXA 3G9UA 3K9BA 3EMDA 5DISB 4A8JB 2QTHA 1XYYA 1Q1AA 3GT7A 5JXHA 1WIWA 1LSUA 3CH7A 4H27A 4XD7A 1DJNA 3CPEA 2GBFA 4L6AA 4QOFA 4UM9D 2CFCA 2OMKA 4BP1A 4F4IA 5MN4A 3ZQVA 1M5UA 4B32A 3PUYA 3I1FA 1ECCA 2R85A 4W1RA 5HW0A 4KLNA 5HIMA 1S2LA 5F4ZA 4LZWA 4PQGA 2AMFA 3WLHA 2GUGA 3OO0A 1HDOA 1SXGA 3UW1A 1C8KA 1NU6A 5F5HA 1YZLA 4IHKA 3K8OE 1FUIA 4J1SA 4JENA 4M9UA 4NCXA 3EXHC 4ULWA 1X1AA 4FN5A 2P11A 4BJ1A 4WLUA 3C3CA 5DEOA 3HVUA 2GBGA 1EGMB 1NRJB 4BC1A 2X22A 3NANA 4QGBA 1I7SB 1FF9A 2VFAA 1Q1BA 2X7XA 3Q98A 4NCIA 1KZHA 3BRWD 5LLDA 3MTGA 3QF4A 4C9BA 1U8YA 1A72A 1SOWA 2FZKA 3IUMA 3N87A 2YZ2A 3BGIA 3IDAA 3IVGA 3C39A 4HZUA 3HCFA 4JDUA 5DBEX 1PWEA 2CB9A 3T1VA 1R2QA 1U0TA 4Q16A 4ZQBA 4Q4AA 4LTDA 1EXVA 3AUXA 4JXJA 1DC8A 5AT1A 3CRVA 3HLTA 3PFHA 1P7PA 5IBCA 2BVNA 3OCCA 1MCZA 1ISMA 1VHDA 1T34A 4ULVA 2RD9A 1XA0A 4PG8A 2XYPA 1NJGA 3L0ZA 5H59A 3L0BA 4DSTA 1HKUA 1QP7A 2B20A 1MX9A 1G4US 3ZVRA 4X20B 4BZQA 5JBIA 5BR7A 1B0UA 1NNLA 4W5NA 4FFWA 1CZLA 1XJWA 1Z45A 3H9EO 1ZK1A 2CVHA 3KMIA 1L5FA 2Y4NA 3K92A 1ZQ1A 3JQRA 1X7YB 3FPAA 3JU3A 4Y1FA 3LP8A 2AEJA 5K45A 3ZGNA 4JUCA 4KMRA 5DGHA 3TEJA 3UFXB 3WIDA 2A69F 2JATA 3D4BA 4TN1A 1SKAA 3ZKAA 3TG2A 5HS4A 2ZP1A 3WBBA 4KQEA 5E38A 2NPOA 5F2KA 3VVCA 1T6IA 2Q1XA 2IV7A 2PIAA 1SUIA 3H1FA 3M9LA 4OU4A 5LUAA 2B5WA 3PDHA 1OB2A 2Y1OA 1SOUA 2J6BA 4KC0A 4Z9BA 4ZRMA 5K51A 1N8KA 3DLHA 1NM5C 1OXKB 4E17A 1YS1X 2D3WA 1J25A 3VR6H 4OB6A 1RLOA 5AJZA 4RHYA 2HA0A 5HWSA 3X1YA 4DUPA 3OSUA 5TSDA 2RSLA 5I7SA 3ZX5A 3F8WA 1WUHS 5IWCA 4R51A 1JXOA 1JEEA 2G3YA 3TOXA 4C29A 2BEVA 2R68A 2Y99A 1MIOA 5FHQA 2QJRA 1ARZA 2F3TA 3SX2A 2M64A 2BP7A 4ZMRA 2WWYA 2JA2A 3DXZA 3HCCA 3MQFA 5HDQA 1AUEA 3QMWA 2HJHA 1T9HA 1E2IA 2M2IA 2R6GA 2J6IA 4EPRA 5BQ5A 1W94A 4G1UC 4HWPA 2FW6A 4UQLA 4EHIA 1EWKA 1TUBA 3E5HA 3AHIA 5J9FA 3OTOB 5JDIC 1N77A 2Z6UA 1WW2A 4X8HA 3RIXA 5B1YA 2A9VA 1T10A 6ABPA 2ZJ5A 4B7ZA 4GX2A 4NU6A 4J29A 3P9IA 3U4QA 1DDIA 4JUAA 4O8ZA 2BHNA 5IHXA 4X91A 2I4MA 1B26A 2ZKIA 4M36A 3U37A 1YDWA 2QF7A 1QQBA 4RD2A 3D6HA 3IEEA 3PPWA 4FMDB 4OXKA 5ICSA 1E0KA 3AHDA 3NHRA 1LTQA 3IE0A 1BU5A 1RCFA 4DVYP 4XM1A 5FPPA 4CE6A 2NMVA 2FMXA 1DT5A 5BMOA 2B2XA 3SHOA 1MVLA 2PWBA 2YASA 3ZE1B 1JFVA 1J70A 3WG9A 1WE2A 3NLLA 4IJWA 1XRQA 3HR7A 2JI8A 3M5DA 3SWWA 4NHEA 3RH3A 2QRHA 2P5TB 1UH5A 2IE8A 2ZIVB 5FOXA 1FNSA 2P6MA 2LK4A 4NENB 3T61A 5AICA 4CF6A 3QTBA 1E7QA 4GZ5A 3O9MA 3RANA 4MS3A 3SYTA 2KJGA 3MT0A 2RK6A 3T3IA 1QYRA 2AHRA 2WDPA 4DRHB 1GNLA 3EZ2A 4GMDA 1DAFA 4K6OA 4YRFA 5JYEA 3KALA 4MJLA 1E9EA 2B34A 2JVIA 1KDTA 4PG7A 4QVKA 5A5EA 2WWVD 1C1XB 1N6NA 4MS4A 1RCTE 4LDNA 3WXBA 4E4YA 3MT8A 4V0MA 4LYEA 3DNFA 1CUVA 4KH1A 5EUBA 2PZKA 2DQSA 3WP0A 3THYA 3IAUA 1INLA 1C9DB 1OX4A 4OOEA 4ZT7A 1KVSA 5CVTA 1P6XA 2DWOA 2PAFA 2GFQA 4JNKA 4OSPA 4CU2A 4XQ9A 1R6DA 2J33A 1GPH1 1Y7HA 4O2BA 2IUSA 5ALVA 2PGIA 1QORA 2C2OA 4F5WA 3AOEC 3O8OA 5JRDS 1FLDA 4GKBA 2QNIA 1T5LA 4LISA 1XROA 4DUZB 3HU3A 4D4NA 2HDOA 3ZU4A 1VLSA 4Q4JB 3UWMA 1TF2A 3DAYA 1PR0A 4JBHA 1U31A 2AU5A 3VZDA 4B2IA 5AW3A 1TTTA 2AOXA 1I01A 3NC1C 1E18A 2PYDA 2P3OA 3QPVA 4K6CA 2CK3A 2ZSKA 4BMVA 3IPLA 4FI3F 3TW8A 1XCBA 1Z33A 2IOHA 1GLGA 2D0PB 3KAPA 4PHHA 4IJMA 1YFKA 2X23A 2X2FA 3OU6A 4Y2VA 2J3MA 4WAUA 4BP8A 2Q7XA 5IKXA 4J7YA 4ZKDA 3SEQA 4LE2A 1REQA 3IAEA 3VRHA 3IL2A 1QE0A 3OOEA 5C32A 1UM9A 1A8PA 4MMYB 5I8WA 3U0BA 2RH9B 3DKAA 3SM3A 4PSKA 2PSHA 3PQ5A 1ZUWA 3ANXA 3UBMA 4DAOA 3U3RA 1OXMA 5D01A 3S81A 1RHJA 3TR6A 3OURA 5DH9A 5EMLA 3G2HA 5AVSA 1PJLA 4ONEA 1XTQA 1A2OA 1DRVA 1JGTA 2XGSA 3PNPA 4GQAA 2FEOA 4E3WA 2XSZD 4KK3A 4RGBA 1B16A 3VSAA 2Y1FA 1NF9A 1Y1QA 2NSHA 1J39A 1HL3A 1EK0A 1II8B 3CJQA 4B74A 1E77A 3FPSA 4C3BA 3FNHA 4X8LA 3RFUA 2XB8A 5CYPA 3Q8WA 4Q0MA 3TNYA 3UMJA 4DIMA 4AKGA 2ZLBA 2QD4A 2G82A 1UDWA 2YUTA 2A7XA 1NNUA 2WYOA 1IOLA 3G85A 3OFSA 4DIFA 2Z4TA 4ANFA 4CLRB 2H1SA 3EK2A 4LSMA 4AJOA 4EGFA 3E9MA 1YR9A 5LOVA 4CS8A 1DARA 5L0DA 2Z2IA 4RELA 2XECA 3FNFA 2J9VA 2DBYA 2P2ZA 4PZDA 7MHTA 3QVTA 4DPLA 3EZ9A 3PNBA 2AFHA 3KJXA 3H97A 4M0EA 5TVKA 4XYLA 1TVMA 2XAUA 2CMDA 4C0XA 4HUJA 1IIRA 2G7ZA 1MAAA 4D4KA 4ZMSA 5FOUA 2C97A 4IZ6A 2BL2A 1T25A 4CMHA 3JD4A 2DKNA 2YWFA 4ZOEA 2CZQA 3O47A 3WGTA 4CSAC 1DI0A 1GYRA 1PQPA 4MR8B 2CDRA 4C0BA 5A06A 1W0KA 5HIAA 3ZW9A 2QN9A 5C5EA 1AKYA 1KY4A 2X5JO 4MUNA 3H5TA 3HABA 5LQNA 2I8BA 1MC1A 5TQVA 1DXYA 3PC4A 1VDZA 3DUFA 3ECAA 2O07A 3ORYA 4LG1A 5FQOA 4LNUB 2XLDA 3RTBA 4PPQA 2I66A 1OWMA 4U6SA 4XLZA 3CUYA 4ER7A 4OLHA 3EVAA 5D6NA 1WW3A 3D5QA 3Q7QA 1EA8A 3TL2A 5CEFA 2CT8A 1BAPA 1W25A 4C4ZA 2ZZMA 2ZB8A 3E82A 1XQ9A 4AJLA 2NO1A 4P3NA 2RH5A 2YOHA 4JJGA 3CSKA 2K4MA 2Z9CA 2NU8A 1QKRA 1CF9A 1ISFA 1EGHA 3KU4A 1DWUA 3B5JA 1FFXA 3QV1A 3PYXA 3ES9A 1W59A 2P35A 4TWJA 3BXZA 4H4KC 1NOJA 4RGVA 2P5UA 1HEUA 4JCOA 1ZM4A 1MO3A 4UEQA 1PFVA 1G8AA 2HQRA 2QAGB 3BD7A 3F96A 5DIFA 1IBLB 2YXDA 4IQGA 2QE7D 3WK5A 4Y7DA 4AF7A 1USVA 4PNPA 3LI2A 3SQDA 3FR8A 5D86A 1TF5A 2HA7A 5ELXA 1PVDA 1S05A 2VZEA 1Y4ZA 3O31A 1S2MA 2L7AA 4V0ME 1P62B 3A3OA 4PYRA 3DL2A 5BWNA 1MC5A 1C80A 4M1TA 1Q20A 4O29A 5JYCA 7GPBA 1VOMA 4RK0A 3IEIA 2R87A 4F9GA 1YOBA 3VPCA 3TE6A 1H4SA 1J1UA 3WVNA 1MHTA 2C1XA 5LLTA 3ZWVA 3PNKA 2A88A 4BJTA 4HB2A 3NTQA 4KGXA 2WYWA 3DBLA 2CZCA 2B1RA 4KAXA 3ZIDA 4CJXA 1Z16A 2B4AA 3OOHA 4HDKA 2C2GA 3QJ5A 2E5FA 4G09A 4INPA 3IAS6 4ND3A 3L0IB 4XQ1A 3WYAA 3SE0A 5F1OA 2IXGA 1ORJA 4ID9A 1GFIA 2W4BA 3NNDA 4RY2A 1AUXA 3AEZA 1G5FA 2VT2A 4XIGS 1W5AA 3W2TA 1TCVA 2ES4A 3EF1A 4CG1A 1P3DA 3U62A 2VCEA 3LRPA 1JFSA 4M0MA 3HI4A 1JAHA 4WKGA 2NUTA 4MQFB 2G88A 1A5ZA 3WRXC 1Y34E 1JU3A 2XODA 4OHPA 4LRXA 2C92A 5GTDA 3KD3A 2ZOSA 1IN4A 4ENTA 3SEOA 2AV6A 4BFZA 2B0CA 1NVDA 4F6RB 1GGEA 2Q5CA 3KXLA 2GDZA 3D6VA 4GPZA 2J3KA 4N06A 2H1CA 2R7WA 4UXJA 2JIDA 3P9ZA 1GLVA 1P44A 1KK2A 1CR4A 2A58A 4LJ9A 1SB9A 2EQBA 3DO5A 1FFYA 2JGNA 2WKQA 1CBUA 3CS3A 4ZAFA 5T3TA 3DH0A 4BMZA 3EOZA 1XEFA 2OY0A 3C1UA 5F9MA 2R2AA 5TMBA 4ZGGA 5KOIA 1M2FA 3PNLA 4P5DA 3GT0A 3FVTA 1SXJC 1DINA 1M56C 1B00A 1NP3A 1R00A 1D1BA 3IDFA 1IBRA 5B3KA 2H8GA 2PZAA 2HSBA 2WSSA 3BHNA 4OFXA 2F59A 2C9ZA 4LJSA 4WBXC 3WKEA 3A1VA 5JNSA 5LKRA 3JQBA 1HNXB 5C8YF 3HC7A 4OLFA 4TTJA 4UAUA 5MFPA 2UUAB 1ESCA 4LPSA 1LDMA 1T2UA 1WHTB 3GWNA 2D2VA 3RSQA 3UXEA 1UJ6A 2E4WA 2Q2OA 2FETA 4GP6A 1EI7A 3N07A 1A8UA 4OQPA 1S8OA 3MGCA 3TNJA 2PQ0A 1RPJA 3FFBA 3R7WA 3BXGA 4XPYA 1YFZA 1G5PA 2VHWA 1HMDA 3RUIA 1QHNA 3I64A 1GRQA 3DOUA 3AKCA 4HWSA 4DQKA 4ZJPA 5JD5A 3TF5A 4IXNA 5K0BA 2XUOA 4Q00A 1XTRA 4ECAA 4J7AA 1UQTA 3C4VA 4DA0A 3CF4G 2PR7A 5F3WB 3HJNA 1FNTc 4FQ5A 4GOLD 4QXRA 3ZX4A 2WJYA 1O97C 4DJAA 4OL0A