4DVZA

Crystal structure of the helicobacter pylori caga oncoprotein
Total Genus 173
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
173
sequence length
522
structure length
459
Chain Sequence
b'LMGSHNGKVSLLYAGDKHDWNATVGYKDNVATLINVHMKNGSGLVIAGGEKGINNPSFYLYKEDQLTGSQRALSQEEIRNKVDFMEFLAQNNTKLDNLSEKEKEKFQNEIEDFQKDSKAYLDALGNDRIAFVSKKDTKHSALITEFNNGDLSYTLKDYEKNVTLQGSLKHDGVMFVDYSFNKVAVFNLPDLNNLAITSFVRRNLENKLTAKGLSLQEANKLIKDFLSSNKELAGKALNFNKAVAEAKSTGNYDEVKKAQKDLEKSLRKREHLEKEVEKKLESKSGNKKAQANSQKDEIFALINKEANRDARAIAYTQNLKGIKRELSDKLEKISKDLKDFSKSFDEFKNFSKAEETLKALKGSVKDLGINPEWISKVENLNAALNEFKNGDFSKVTQAKSDLENSVKDVIINQKVTDKVDNLNQAVSVAKAMGDFSRVEQVLADLKNFSKEQLAQQAQK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytotoxicity-associated immunodominant antigen
molecule tags Oncoprotein
source organism Helicobacter pylori
publication title Tertiary structure-function analysis reveals the pathogenic signaling potentiation mechanism of Helicobacter pylori oncogenic effector CagA
pubmed doi rcsb
total genus 173
structure length 459
sequence length 522
ec nomenclature
pdb deposition date 2012-02-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1270 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4dvzA02
4DVZA 4DVYP 4G0HA
chains in the Genus database with same CATH superfamily
3JSEO 4WABA 2H7OA 4H4KC 3EHNA 3HNLA 4W8PA 3U2LA 5AC5A 3C8GB 1YJGA 4G7ZF 3FAJA 4I1OB 1R4TA 1UFBA 1V4AA 3JYHA 4CBEA 1Y6DA 5E33A 3F47A 2J9WA 1I4YA 4GQHA 4BEJA 1LE4A 4BG0A 2FFHA 4RDAA 1BR4A 3MLGA 3ZTZA 5KYUB 4G7HF 1TWCA 4IJJA 2PNOA 3H65A 2EPKX 4PJJA 1YVIA 1TWAA 2V3CC 3H2UA 2EPNA 4XLNF 2R7UA 5HSWA 4JCZA 4PFPA 1FMWA 1CGNA 4A2NB 3S0XA 3AQCA 2J8WA 2KQ9A 1H9TA 3HNIA 3UGPA 4OIQF 3ZVRA 3FOOA 4YJWA 2R7OA 2NUPB 2Y39A 1FMVA 5BQHA 5JP7A 3NKEA 2QTVA 4U5HA 4JJFA 1HE1A 1HW2A 3GORA 1RKEB 4XWJA 2KJGA 2H7BA 2XL6A 1J8MF 3VRCA 3LUTB 2EINC 2R7QA 2AU5A 2JD3A 3V5YA 1NBBA 3IEEA 4JTDB 4YT8A 1ST6A 4IGGA 4NC3A 4XQ1A 1QKRA 3EFOB 3SYNA 5JLIA 2KW3C 5L0GA 1QLEC 1TFOB 1BZ4A 1FAPB 2ETSA 2NSGA 3EGXB 1DOVA 3HNJA 3AOUA 1BDJB 4NTFA 4AX2A 2WVQA 1OR2A 4AE4B 4CS9C 5B3SC 2YKZA 2OEVA 3M15A 2WZLA 2PFDA 3E9VA 4YL0A 1T01A 3S84A 3EZIA 4J30B 3US6A 4WGYA 4PFOA 1B68A 4I44A 3ZWIA 1U0BB 4EKWA 1ZVZA 4P6IC 1G5ZA 1K05A 4MW3A 2CGEA 1RCPA 4MVZA 4CDAA 3GANA 4JW1A 4K7BA 4EBBA 4Q4ZF 1M2VB 4HE8D 5D92A 1QQ3A 3GEHA 2X51A 2HFIA 5A6BA 2LFDA 2XLVA 4Q5SF 2EIMC 3CAXA 3LAYA 4MVSA 3ZG1A 5KYYA 3I5PA 2EILC 1GGQA 3C8ZA 3NYJA 3OWTA 2ZXRA 3RQFA 1OQCA 3UMKA 2QY9A 2PX3A 2WZFA 3B0PA 1RKCA 3AG2C 3NYMA 3SXMA 3VF0A 3DAFA 5BQGA 2XLHA 1Q0GA 1G8XA 3L8JA 1CGME 2DYSC 2J0WA 3ZTMA 1ZW2A 3B9QA 3W2VA 4MQ9F 4DRIB 3PMRA 3W4YA 4E0HA 1ZYRF 2IXOA 3Q6MA 4QDLA 2R05A 3B29A 2VH3A 5A69A 2JPUA 4JVSA 2AWCA 1VYKA 5E3CA 2CW0F 2R7SA 3X2QC 3V5XA 1SMYF 5E2QA 5T1DB 2VCBA 3U9JA 1NU7D 3DJNB 2J7PD 3EH1A 3POVA 4O6YA 2A0UA 1IW7F 2PP4A 2ZD9A 2Q4FA 1VLTA 2J9VA 5AC4A 1RKEA 4XLPF 2BL2A 3C62A 1A0BA 1J8YF 1MMNA 2H7VC 3AG1C 1QSPA 1FTSA 1SZIA 3WODF 1Q0FA 1MNEA 3MFNA 3T9OA 1Y4CA 1D0XA 4BJ1A 1O5HA 5T3TA 3RW0A 2NUTB 2D4UA 1YYJA 1T5OA 3LNMB 4XEKA 2HJ3A 1OXKA 2HKVA 3ZC4A 2WZGA 2A6EF 3K66A 4MS2A 3EGDA 1SR2A 2Q00A 1G4WR 2KYHA 4FESA 3JTLO 2CDQA 2Q7RA 3LEOA 2DB4A 1QZXA 3H2VA 3RQGA 2R7XA 1WN0A 4N6HA 1ORJA 1RXQA 1AEPA 2AVKA 2I8BA 2WVNA 3RQEA 3U3FA 3U8VA 4C7OB 2F22A 1Q0MA 3RF3A 2NSFA 4DJ9A 1TWGA 3JRTA 1NFNA 2W4MA 3JCUQ 1D1BA 3KYJA 4DRHB 4JEBA 2XLWA 4H54A 4JTAB 4ULVA 4P9FA 2UUIA 3TJ6A 2P61A 3ASOC 1Z63A 2J9BA 4DBRA 4I1MA 3HTKC 3DWWA 3L1MA 2WB7A 3EG9B 1O3UA 4O79A 1JAFA 5JSLA 3WAQA 3ABLC 1N1CA 4EUKB 1XZQA 2B0HA 1E84A 2J0XA 5L0DA 4HEAJ 5B3IA 4RD9A 5EGYA 2W45A 3GWNA 2I15A 2WVOA 3RVZA 2R02A 3SXKA 1H6GA 4Z9IA 3T4RA 4CJGA 2VASA 1NSGB 1V55C 3LJBA 4O7GA 1LKXA 1VLSA 4CS8C 2DYRC 1OCRC 2RD9A 3VM6A 5KYXB 3DXJF 3PDMP 1H9GA 1K04A 3UMIA 1EI7A 3NMJA 3AG4C 2CCYA 3MBGA 2OKUA 2FAPB 1E85A 2OEXA 3C8GD 4QI2A 2W4BA 3SP1A 3EH2A 3IQCA 4I3MA 4AL1A 3OA1A 3M4BA 3O10A 1LI5A 3X1OA 5DS5A 4N06A 3LEVA 1KU2A 4LDQA 4YT4A 2KGOA 2XXAB 2UUHA 3GM2A 3JT1A 1CGOA 1K40A 2OU6A 5COGA 4D4XA 4IAOA 1WATA 1IZMA 2GA0A 3TJ5A 3VYWA 2HMZA 1I5NA 4BJ5A 3FXHA 3RH3A 2AWYA 2P1AA 3EHMA 3LLKA 2E87A 3ABKC 2NG1A 4PJLA 4FAPB 4JURI 3E70C 3LNRA 4GYTA 4L6RA 3L0IA 5BQIA 2LSEA 4HFFB 1E83A 1Z6AA 4EHPA 4PACA 5A6BD 3ECSA 3PHF2 3I5QA 5KYUA 1BR2A 3CEXA 2BC5A 2XL8A 1GQAA 5L3QA 4C3EA 4DRJB 3KL4A 4YK5A 3M4CA 3SEOA 1E2XA 1VB5A 1TKNA 2EPMX 2HV6A 2L9JA 3QW0A 4U5GA 1M2VA 2XLEA 3NMKA 3SZRA 2KSFA 2PF4E 5KYWA 4CSAA 3MYFA 5F5HA 3DE8A 1O87A 2YVKA 3C7JA 4NCQA 1VMAA 1AVOB 2PBEA 3KPHA 4U5CE 4BJ5C 2YLDA 5AGFA 2RSEB 4OD5A 4XPWA 1OXBA 3UGOA 1LPEA 4CDYA 5DLJA 3F46A 4Q7CA 2LD6A 1GS9A 1Z5ZA 2QE9A 2VCAA 5JUAA 1WWPA 2YWAA 3ASNC 3CZ6A 4O6MA 3AGUA 1U89A 2OCCC 2GWWA 1OW7A 1BR1A 2GAQA 1LS4A 3HLZA 1Q0DA 1NG1A 3W2WA 1SF8A 4AE4A 4A4AA 3J06A 2IYLD 4EBKA 4G0HA 5KYXA 5COFA 1T6UA 4BJ6C 3HNKA 3FHDA 2VB6A 5B1BC 1LS1A 5E3AA 3GODA 3LS1A 3U5SA 2Q9AA 5CI9A 4JEAA 3FVYA 3GEEA 1TWHA 2D5RB 4MVQA 3ITFA 4G78A 4CIHA 2A1DD 1VOMA 4JZAA 1CPRA 2C04A 2FGYA 3G50A 4PJNA 2YZSA 4LERA 2W9YA 3AGTA 1R5ID 3O39A 4PJMA 4U5EE 3HJCA 1A7VA 4GEHA 4OD4A 5GPGB 1WTYA 1QPUA 1H7IA 3FDQA 3CQZA 2LFFA 3S29A 1NU9C 4P9TA 4JKVA 3DE9A 2HJMA 2Z15A 3BRJA 2R7WA 2L6GA 3R2PA 3HKKA 1A7DA 2DGJA 2Q9CA 5CI8A 1KTMA 3EGDB 4MVRA 1SYQA 3M79A 2MYSA 3O6XA 4AL0A 3WG7C 1GM5A 3FMSA 3Q7LA 4Z9JA 3RIPA 3AQBA 3DD7A 4MVMA 5CIVA 3GWLA 2LK4A 3QZCA 2LP4A 3GM1A 5L0JA 5K0IA 4CSAC 4DVZA 4MNDA 2XSEA 3UR3C 2HUJA 4ANJA 3EZHA 1OW6A 2HS5A 1PCXA 5B1AC 4K0DA 1YYXA 3T6BA 3W8IA 3ZIBA 2PX0A 2XRHA 3QVZA 2LCHA 2R7VA 2HSQA 1YA9A 2CNWA 3TD7A 3G4XA 2KNHA 1LIHA 4LDRA 1OR3A 5JS5A 4E7ZA 1OCOC 4UDVA 2AP3A 3QTHA 3QMKA 4E17A 2MHRA 3JRMO 4E7SA 2YHSA 4JE9A 1JR8A 2QLAA 3N2ZB 4MTOA 1F1MA 3TOMA 4YT2A 2HZ8A 5L0CA 3DZAA 1EQ1A 1A7EA 3C18A 1ZHZA 1L3PA 4XEFA 3U3BA 4ONSA 1L7CA 1RJ9B 2CYDA 4OINF 3EJNA 1JPNA 5KYYB 2OOCA 5COMA 1V74B 1YDIA 1HMOA 2L7AA 3EPVA 1VK5A 2LQGA 3EQLF 1YARO 2XM0A 2R9RB 2YL3A 2GDCA 3C8GA 3JSZA 2OG2A 5DVWA 2A6HF 4BJTA 2IXPA 2P7VA 3DJUB 2Y3GA 5FZTA 5DQZA 4C3BA 4JRZA 3SXYA 2B0JA 2MWQA 2QNLA 4PR9A 4NY3A 4CS9A 5JT4A 2Y69C 1Z3IX 3G4ZA 2ASRA 3IQ6A 1OKKD 2BE5F 4LLEA 2XL4A 4IWBA 3EGXA 2R7RA 3KYIA 1MMGA 3C63A 4B6IA 5IY5C 4E0IA 3DKAA 1VTMP 4CS8A 5A6AA 2YLGA 2YL0A 3NMIA 3MYIA 4J7TA 3SNHA 4NQFA 4CDVA 3VAYA 3B0VC 1ZHWA 2YRFA 4U5BE 2R03A 4FX5A 4J32B 4XTKA 1JPJA 1TQGA 4EWCA 4KNWA 2IXNA 4Z9HA 3FAPB 1FFHA 2ZXPA 3M1CB 2J45A 5F28E 5T3WA 1G4US 1UG7A 1LE2A 1ZU4A 1PV3A 5DS4A 3KKBA 3O55A 3K7DA 3U2MA 5HV9A 4JJGA 4JCHA 4YT5A 4YN0B 4DVYP 2G3KA 4KBLA 1M6TA 2L6HA 1MMDA 1XWJA 3ATPA 4AK9A 3Q6NA 2EIKC 1Z7Qc 5EHHA 3I4UA 3U8PA 2NUTA 5FCLA 4KI2A 4U5FE 2IM8A 2KK1A 1YZAA 1E86A 4ZLDA 2G3VA 2Y3DA 1D1AA 3N24A 1W2WA 1HE9A 2OQMA 2XS8A 3L8IA 3V5ZA 2QUPA 3L34A 3NYLA 3ABMC 3SXZA 2NPUA 1M56C 3EFOA 4ULWA 1ZHXA 3S9OA 5D91A 1LM3B 2EPLX 2XLOA 4BEMJ 5BUOA 1A41A 2Y3BA 3TK0A 3TQOA 5JVEA 2LIGA 1M2OA 3T6JA 3K6BA 4QI0A 3NKDA 4LDKA 4OIRF 3N0TA 5JRAA 3B0UX 4OIOF 3IHUA 1C17M 2ICWG 3GM3A 1KNYA 3CSKA 4BPMA 3S90A 2NUPA 2YLIA 1CPQA 5A6JA 3DMDA 3QVYA 4LLCA 2X0CA 1S05A 3A9CA 3RVYA 3TULA 1EA8A 2M64A 5KYNA 4MTGA 1U6HA 2EPOA 2O9XA 2IXMA 2YL7A 4JIOA 2VCCA 1NZEA 1ZW3A 3JZ0A 3ZQVA 3U9MA 4U9EA 4XPXA 4CJOA 4MVOA 1C03A 4N4WA 4G7OF 2XS1A 4K1OA 2A69F 1D0YA 1AUEA 1WGWA 2HV7A 2ZXOA 3S28A 4ER9A 2ZXWC 4LACB 2OJED 1VYIA 4MVUA 1NLXA 2Q9BA 3S27A 4DBQA 4CIPA 2L6FA 4NTAA 3RFYA 4YL3A 3DI5A 2XM4A 4JC7A 1YAUO 3MX3A 4WJ0A 2V26A 4PK4A 1ZZPA 5L0IA 1Q0KA 1DOWA 1T6QA 3DAGA 4IAQA 3AG3C 2XXAA 4CX9A 3K1HA 1YA7O 2CNWD 4NTBA 4YL1A 3PCVA 1C02A 3EG9A 3V7OA 4ZLCA 2TMVP 3AJMA 3B71A 1S7ZA 4XPYA 3T6GB 3QW1A 3RKOF 1T6IA 1MQVA 1MMAA 2P0NA 2YL1A 3K33A 2J7PA 2XLMA 1D0ZA 3ZSUA 1PD0A 4E18A 3LESA 1ORSC 4IRUA 3NRHA 4J7YA 4F4BA 1JMWA 3UMHA 4OIPF 4YWQA 1JRAA 5L0HA 4DOZA 4C7OA 4EIYA 1HY5A 5EK0A 1M57C 4D4NA 2C03A 1ORYA 1FNTc 4M63A 3LS0A 1MNDA 1WASA 4MTFA 3DM9B 256BA 4R32A 2M4EA 3GEIA 4BJ6A 5KYWB 2VC9A 3A11A 3LLIA 1ZHTA 1NFOA 4JTCB 2DI3A 2A0BA 2HMQA 1XZPA 3IQ5A 3U0CA 1JOGA 4CS7A 5TJ5E 2JX0A 2GFHA 3NG1A 2WL8A 4X0RA 3K1IA 2R25A 2XLDA 1WOLA 3ZDLA 1ZU5A 3UNGC 3WHNA 2G62A 2Y3HA 3JYYA 1V54C 1OCCC 2KC3A 4HFKB 1PD1A 2P6VA 4WGZA 4U9DA 3R7CA 4IB4A 1D1CA 2IOQA 1LI7A 1YLMA 2L81A 3W8HA 3Q7GA 1I4ZA 1Z23A 2HSBA 1LVKA 1T9KA 2Q3TA 3OEOA 5A6KA 4XEVA 5L3VA 3TOLA 3IQTA 1OCZC 2A68F 4C3DA 2YEVA 2R7TA 5L0FA 4DXWA 1RMVA 2IBFA 3BEHA 5DQTA 2J9UA 1YZCA 3KMIA 3RYLA 4IARA 4N6CA 2J46A 2OJQA 1ZHYA 4RBNA 2H8AA 1APCA 1FFTC 1TR2A 5DS6A 4EBJA 3KH2A 3NDBB 3DM5A 3IPMO 4FWVA 2ZPAA 1TFKB 3K1IC 4O6NA 1FR0A 4KNVA 1OKKA 1EKYA 1RJ9A 4U5DE 5F5FA 3ZQYA 1BBHA 1HW1A 1QVXA 1OW8A 2YQYA 4KC9A 3FOPA 2EIJC 4W8KA 1HMDA 4MW8A
chains in the Genus database with same CATH topology
2H7OA 4H4KC 3EHNA 4G7ZF 3FAJA 4I1OB 4CBEA 3JYHA 5E33A 3F47A 2J9WA 4BEJA 4BG0A 2FFHA 4RDAA 1BR4A 3MLGA 5KYUB 4G7HF 1TWCA 4IJJA 3H65A 4PJJA 1TWAA 2V3CC 2R7UA 4XLNF 5HSWA 4PFPA 1FMWA 4A2NB 3S0XA 3AQCA 2KQ9A 3UGPA 4OIQF 3ZVRA 4YJWA 2R7OA 2NUPB 2Y39A 1FMVA 3NKEA 2QTVA 4U5HA 4JJFA 4XWJA 2KJGA 2H7BA 1J8MF 2EINC 2R7QA 2JD3A 3IEEA 4YT8A 1ST6A 3SYNA 3EFOB 2KW3C 1QLEC 3EGXB 4AX2A 4CS9C 2WVQA 4AE4B 5B3SC 2WZLA 2PFDA 3E9VA 3EZIA 4J30B 4PFOA 4I44A 4P6IC 2CGEA 3GANA 4JW1A 4K7BA 4EBBA 4Q4ZF 1M2VB 4HE8D 5D92A 2X51A 4Q5SF 2EIMC 3LAYA 3ZG1A 5KYYA 3I5PA 2EILC 3NYJA 3OWTA 2ZXRA 3UMKA 2QY9A 2PX3A 2WZFA 3B0PA 3AG2C 3NYMA 3DAFA 1G8XA 2DYSC 2J0WA 3B9QA 3W2VA 4MQ9F 3PMRA 1ZYRF 2IXOA 3Q6MA 4QDLA 2VH3A 4JVSA 1VYKA 5E3CA 2CW0F 2R7SA 3X2QC 1SMYF 5E2QA 5T1DB 1NU7D 3DJNB 2J7PD 3EH1A 3POVA 4O6YA 1IW7F 2PP4A 2J9VA 4XLPF 1J8YF 1MMNA 2H7VC 3AG1C 3WODF 1FTSA 1SZIA 1MNEA 4BJ1A 1D0XA 1O5HA 5T3TA 2NUTB 3ZC4A 2WZGA 2A6EF 3K66A 3EGDA 4FESA 2CDQA 1QZXA 2R7XA 2I8BA 2WVNA 4C7OB 1TWGA 3JRTA 2W4MA 3JCUQ 1D1BA 1Z63A 3ASOC 4DBRA 4I1MA 3HTKC 2WB7A 3EG9B 4O79A 3ABLC 1N1CA 2J0XA 4HEAJ 5EGYA 2W45A 2WVOA 3T4RA 2VASA 1V55C 3LJBA 4O7GA 1LKXA 4CS8C 2DYRC 1OCRC 5KYXB 3DXJF 3UMIA 3AG4C 4QI2A 2W4BA 3SP1A 3EH2A 4I3MA 3OA1A 3X1OA 5DS5A 4N06A 3LEVA 1KU2A 4YT4A 2KGOA 2XXAB 3JT1A 4IAOA 3VYWA 1IZMA 4BJ5A 3RH3A 3EHMA 3LLKA 2E87A 3ABKC 2NG1A 4PJLA 4JURI 3E70C 3LNRA 4GYTA 3L0IA 2LSEA 4HFFB 1Z6AA 3ECSA 3PHF2 3I5QA 5KYUA 1BR2A 5L3QA 4C3EA 3KL4A 3SEOA 2L9JA 1TKNA 2HV6A 4U5GA 1M2VA 3SZRA 2PF4E 5KYWA 4CSAA 5F5HA 1O87A 1VMAA 4U5CE 4BJ5C 4OD5A 3UGOA 5DLJA 3F46A 4Q7CA 1Z5ZA 3ASNC 3CZ6A 4O6MA 2OCCC 1BR1A 3HLZA 1NG1A 3W2WA 1SF8A 4AE4A 2IYLD 4G0HA 5KYXA 4BJ6C 3FHDA 2VB6A 5B1BC 1LS1A 5E3AA 3GODA 3LS1A 2Q9AA 5CI9A 3FVYA 1TWHA 2D5RB 4CIHA 3ITFA 2A1DD 1VOMA 4JZAA 2C04A 2FGYA 4PJNA 2YZSA 4LERA 2W9YA 4PJMA 3O39A 4U5EE 3HJCA 4GEHA 4OD4A 3FDQA 3CQZA 3S29A 1NU9C 2Z15A 2R7WA 2DGJA 2Q9CA 5CI8A 3EGDB 2MYSA 3O6XA 3WG7C 3Q7LA 3RIPA 3AQBA 3DD7A 3QZCA 4CSAC 4DVZA 4MNDA 2XSEA 3UR3C 4ANJA 3EZHA 5B1AC 1PCXA 4K0DA 3T6BA 3W8IA 3ZIBA 2PX0A 2XRHA 2R7VA 2CNWA 3TD7A 2KNHA 4E7ZA 1OCOC 3QMKA 4E7SA 2YHSA 3N2ZB 4YT2A 3DZAA 1ZHZA 1RJ9B 4OINF 3EJNA 1JPNA 5KYYB 3EPVA 1VK5A 3EQLF 3JSZA 2OG2A 5DVWA 2A6HF 4BJTA 2IXPA 2P7VA 3DJUB 2Y3GA 5DQZA 4C3BA 4CS9A 2B0JA 2MWQA 4NY3A 2Y69C 1Z3IX 1OKKD 2BE5F 4LLEA 2XL4A 4IWBA 3EGXA 2R7RA 1MMGA 4B6IA 5IY5C 4CS8A 3SNHA 3VAYA 3B0VC 1ZHWA 4U5BE 4FX5A 4J32B 4XTKA 1JPJA 4EWCA 4KNWA 2IXNA 1FFHA 2ZXPA 3M1CB 2J45A 5T3WA 1ZU4A 5DS4A 3KKBA 3K7DA 4JJGA 4JCHA 4YT5A 4YN0B 4DVYP 2G3KA 4KBLA 1MMDA 4AK9A 3Q6NA 2EIKC 5EHHA 3I4UA 2NUTA 5FCLA 4KI2A 4U5FE 4ZLDA 2G3VA 2Y3DA 1D1AA 3N24A 1W2WA 3L34A 3NYLA 3ABMC 3EFOA 1M56C 4ULWA 1ZHXA 5D91A 5BUOA 2Y3BA 1M2OA 3T6JA 3K6BA 4QI0A 3NKDA 4OIRF 3B0UX 3N0TA 4OIOF 3CSKA 2NUPA 3DMDA 4LLCA 5KYNA 2O9XA 2IXMA 1NZEA 4G7OF 2A69F 1D0YA 1WGWA 2HV7A 2ZXOA 3S28A 2ZXWC 4LACB 1VYIA 3S27A 2Q9BA 4DBQA 3RFYA 3MX3A 4WJ0A 2V26A 4PK4A 3DAGA 3AG3C 2XXAA 3K1HA 2CNWD 3V7OA 4ZLCA 3EG9A 1S7ZA 3RKOF 1MMAA 3K33A 2J7PA 1D0ZA 3ZSUA 1PD0A 4F4BA 3LESA 4IRUA 3NRHA 3UMHA 4OIPF 4YWQA 4DOZA 4C7OA 1M57C 2C03A 4M63A 3LS0A 1MNDA 3DM9B 2M4EA 4BJ6A 5KYWB 3LLIA 1ZHTA 4CS7A 2GFHA 3NG1A 2WL8A 4X0RA 1ZU5A 3UNGC 2G62A 2Y3HA 1V54C 1OCCC 4HFKB 1PD1A 2P6VA 1D1CA 2IOQA 2L81A 3W8HA 3Q7GA 1Z23A 1LVKA 2Q3TA 3OEOA 5L3VA 1OCZC 2A68F 4C3DA 2YEVA 2R7TA 5DQTA 2J9UA 3KMIA 3RYLA 2J46A 1ZHYA 4RBNA 1FFTC 1TR2A 5DS6A 3NDBB 3KH2A 3DM5A 4FWVA 2ZPAA 3K1IC 4O6NA 4KNVA 1OKKA 1RJ9A 4U5DE 5F5FA 4KC9A 2EIJC 4W8KA 4RD9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DVZ A;  4DVY P;  4G0H A; 
#chains in the Genus database with same CATH topology
 3JSE O;  4WAB A;  2H7O A;  4H4K C;  3EHN A;  3HNL A;  4W8P A;  3U2L A;  5AC5 A;  3C8G B;  1YJG A;  4G7Z F;  3FAJ A;  4I1O B;  1R4T A;  1UFB A;  1V4A A;  3JYH A;  4CBE A;  1Y6D A;  5E33 A;  3F47 A;  2J9W A;  1I4Y A;  4GQH A;  4BEJ A;  1LE4 A;  4BG0 A;  2FFH A;  4RDA A;  1BR4 A;  3MLG A;  3ZTZ A;  5KYU B;  4G7H F;  1TWC A;  4IJJ A;  2PNO A;  3H65 A;  2EPK X;  4PJJ A;  1YVI A;  1TWA A;  2V3C C;  3H2U A;  2EPN A;  4XLN F;  2R7U A;  5HSW A;  4JCZ A;  4PFP A;  1FMW A;  1CGN A;  4A2N B;  3S0X A;  3AQC A;  2J8W A;  2KQ9 A;  1H9T A;  3HNI A;  3UGP A;  4OIQ F;  3ZVR A;  3FOO A;  4YJW A;  2R7O A;  2NUP B;  2Y39 A;  1FMV A;  5BQH A;  5JP7 A;  3NKE A;  2QTV A;  4U5H A;  4JJF A;  1HE1 A;  1HW2 A;  3GOR A;  1RKE B;  4XWJ A;  2KJG A;  2H7B A;  2XL6 A;  1J8M F;  3VRC A;  3LUT B;  2EIN C;  2R7Q A;  2AU5 A;  2JD3 A;  3V5Y A;  1NBB A;  3IEE A;  4JTD B;  4YT8 A;  1ST6 A;  4IGG A;  4NC3 A;  4XQ1 A;  1QKR A;  3EFO B;  3SYN A;  5JLI A;  2KW3 C;  5L0G A;  1QLE C;  1TFO B;  1BZ4 A;  1FAP B;  2ETS A;  2NSG A;  3EGX B;  1DOV A;  3HNJ A;  3AOU A;  1BDJ B;  4NTF A;  4AX2 A;  2WVQ A;  1OR2 A;  4AE4 B;  4CS9 C;  5B3S C;  2YKZ A;  2OEV A;  3M15 A;  2WZL A;  2PFD A;  3E9V A;  4YL0 A;  1T01 A;  3S84 A;  3EZI A;  4J30 B;  3US6 A;  4WGY A;  4PFO A;  1B68 A;  4I44 A;  3ZWI A;  1U0B B;  4EKW A;  1ZVZ A;  4P6I C;  1G5Z A;  1K05 A;  4MW3 A;  2CGE A;  1RCP A;  4MVZ A;  4CDA A;  3GAN A;  4JW1 A;  4K7B A;  4EBB A;  4Q4Z F;  1M2V B;  4HE8 D;  5D92 A;  1QQ3 A;  3GEH A;  2X51 A;  2HFI A;  5A6B A;  2LFD A;  2XLV A;  4Q5S F;  2EIM C;  3CAX A;  3LAY A;  4MVS A;  3ZG1 A;  5KYY A;  3I5P A;  2EIL C;  1GGQ A;  3C8Z A;  3NYJ A;  3OWT A;  2ZXR A;  3RQF A;  1OQC A;  3UMK A;  2QY9 A;  2PX3 A;  2WZF A;  3B0P A;  1RKC A;  3AG2 C;  3NYM A;  3SXM A;  3VF0 A;  3DAF A;  5BQG A;  2XLH A;  1Q0G A;  1G8X A;  3L8J A;  1CGM E;  2DYS C;  2J0W A;  3ZTM A;  1ZW2 A;  3B9Q A;  3W2V A;  4MQ9 F;  4DRI B;  3PMR A;  3W4Y A;  4E0H A;  1ZYR F;  2IXO A;  3Q6M A;  4QDL A;  2R05 A;  3B29 A;  2VH3 A;  5A69 A;  2JPU A;  4JVS A;  2AWC A;  1VYK A;  5E3C A;  2CW0 F;  2R7S A;  3X2Q C;  3V5X A;  1SMY F;  5E2Q A;  5T1D B;  2VCB A;  3U9J A;  1NU7 D;  3DJN B;  2J7P D;  3EH1 A;  3POV A;  4O6Y A;  2A0U A;  1IW7 F;  2PP4 A;  2ZD9 A;  2Q4F A;  1VLT A;  2J9V A;  5AC4 A;  1RKE A;  4XLP F;  2BL2 A;  3C62 A;  1A0B A;  1J8Y F;  1MMN A;  2H7V C;  3AG1 C;  1QSP A;  1FTS A;  1SZI A;  3WOD F;  1Q0F A;  1MNE A;  3MFN A;  3T9O A;  1Y4C A;  1D0X A;  4BJ1 A;  1O5H A;  5T3T A;  3RW0 A;  2NUT B;  2D4U A;  1YYJ A;  1T5O A;  3LNM B;  4XEK A;  2HJ3 A;  1OXK A;  2HKV A;  3ZC4 A;  2WZG A;  2A6E F;  3K66 A;  4MS2 A;  3EGD A;  1SR2 A;  2Q00 A;  1G4W R;  2KYH A;  4FES A;  3JTL O;  2CDQ A;  2Q7R A;  3LEO A;  2DB4 A;  1QZX A;  3H2V A;  3RQG A;  2R7X A;  1WN0 A;  4N6H A;  1ORJ A;  1RXQ A;  1AEP A;  2AVK A;  2I8B A;  2WVN A;  3RQE A;  3U3F A;  3U8V A;  4C7O B;  2F22 A;  1Q0M A;  3RF3 A;  2NSF A;  4DJ9 A;  1TWG A;  3JRT A;  1NFN A;  2W4M A;  3JCU Q;  1D1B A;  3KYJ A;  4DRH B;  4JEB A;  2XLW A;  4H54 A;  4JTA B;  4ULV A;  4P9F A;  2UUI A;  3TJ6 A;  2P61 A;  3ASO C;  1Z63 A;  2J9B A;  4DBR A;  4I1M A;  3HTK C;  3DWW A;  3L1M A;  2WB7 A;  3EG9 B;  1O3U A;  4O79 A;  1JAF A;  5JSL A;  3WAQ A;  3ABL C;  1N1C A;  4EUK B;  1XZQ A;  2B0H A;  1E84 A;  2J0X A;  5L0D A;  4HEA J;  5B3I A;  4RD9 A;  5EGY A;  2W45 A;  3GWN A;  2I15 A;  2WVO A;  3RVZ A;  2R02 A;  3SXK A;  1H6G A;  4Z9I A;  3T4R A;  4CJG A;  2VAS A;  1NSG B;  1V55 C;  3LJB A;  4O7G A;  1LKX A;  1VLS A;  4CS8 C;  2DYR C;  1OCR C;  2RD9 A;  3VM6 A;  5KYX B;  3DXJ F;  3PDM P;  1H9G A;  1K04 A;  3UMI A;  1EI7 A;  3NMJ A;  3AG4 C;  2CCY A;  3MBG A;  2OKU A;  2FAP B;  1E85 A;  2OEX A;  3C8G D;  4QI2 A;  2W4B A;  3SP1 A;  3EH2 A;  3IQC A;  4I3M A;  4AL1 A;  3OA1 A;  3M4B A;  3O10 A;  1LI5 A;  3X1O A;  5DS5 A;  4N06 A;  3LEV A;  1KU2 A;  4LDQ A;  4YT4 A;  2KGO A;  2XXA B;  2UUH A;  3GM2 A;  3JT1 A;  1CGO A;  1K40 A;  2OU6 A;  5COG A;  4D4X A;  4IAO A;  1WAT A;  1IZM A;  2GA0 A;  3TJ5 A;  3VYW A;  2HMZ A;  1I5N A;  4BJ5 A;  3FXH A;  3RH3 A;  2AWY A;  2P1A A;  3EHM A;  3LLK A;  2E87 A;  3ABK C;  2NG1 A;  4PJL A;  4FAP B;  4JUR I;  3E70 C;  3LNR A;  4GYT A;  4L6R A;  3L0I A;  5BQI A;  2LSE A;  4HFF B;  1E83 A;  1Z6A A;  4EHP A;  4PAC A;  5A6B D;  3ECS A;  3PHF 2;  3I5Q A;  5KYU A;  1BR2 A;  3CEX A;  2BC5 A;  2XL8 A;  1GQA A;  5L3Q A;  4C3E A;  4DRJ B;  3KL4 A;  4YK5 A;  3M4C A;  3SEO A;  1E2X A;  1VB5 A;  1TKN A;  2EPM X;  2HV6 A;  2L9J A;  3QW0 A;  4U5G A;  1M2V A;  2XLE A;  3NMK A;  3SZR A;  2KSF A;  2PF4 E;  5KYW A;  4CSA A;  3MYF A;  5F5H A;  3DE8 A;  1O87 A;  2YVK A;  3C7J A;  4NCQ A;  1VMA A;  1AVO B;  2PBE A;  3KPH A;  4U5C E;  4BJ5 C;  2YLD A;  5AGF A;  2RSE B;  4OD5 A;  4XPW A;  1OXB A;  3UGO A;  1LPE A;  4CDY A;  5DLJ A;  3F46 A;  4Q7C A;  2LD6 A;  1GS9 A;  1Z5Z A;  2QE9 A;  2VCA A;  5JUA A;  1WWP A;  2YWA A;  3ASN C;  3CZ6 A;  4O6M A;  3AGU A;  1U89 A;  2OCC C;  2GWW A;  1OW7 A;  1BR1 A;  2GAQ A;  1LS4 A;  3HLZ A;  1Q0D A;  1NG1 A;  3W2W A;  1SF8 A;  4AE4 A;  4A4A A;  3J06 A;  2IYL D;  4EBK A;  4G0H A;  5KYX A;  5COF A;  1T6U A;  4BJ6 C;  3HNK A;  3FHD A;  2VB6 A;  5B1B C;  1LS1 A;  5E3A A;  3GOD A;  3LS1 A;  3U5S A;  2Q9A A;  5CI9 A;  4JEA A;  3FVY A;  3GEE A;  1TWH A;  2D5R B;  4MVQ A;  3ITF A;  4G78 A;  4CIH A;  2A1D D;  1VOM A;  4JZA A;  1CPR A;  2C04 A;  2FGY A;  3G50 A;  4PJN A;  2YZS A;  4LER A;  2W9Y A;  3AGT A;  1R5I D;  3O39 A;  4PJM A;  4U5E E;  3HJC A;  1A7V A;  4GEH A;  4OD4 A;  5GPG B;  1WTY A;  1QPU A;  1H7I A;  3FDQ A;  3CQZ A;  2LFF A;  3S29 A;  1NU9 C;  4P9T A;  4JKV A;  3DE9 A;  2HJM A;  2Z15 A;  3BRJ A;  2R7W A;  2L6G A;  3R2P A;  3HKK A;  1A7D A;  2DGJ A;  2Q9C A;  5CI8 A;  1KTM A;  3EGD B;  4MVR A;  1SYQ A;  3M79 A;  2MYS A;  3O6X A;  4AL0 A;  3WG7 C;  1GM5 A;  3FMS A;  3Q7L A;  4Z9J A;  3RIP A;  3AQB A;  3DD7 A;  4MVM A;  5CIV A;  3GWL A;  2LK4 A;  3QZC A;  2LP4 A;  3GM1 A;  5L0J A;  5K0I A;  4CSA C;  4DVZ A;  4MND A;  2XSE A;  3UR3 C;  2HUJ A;  4ANJ A;  3EZH A;  1OW6 A;  2HS5 A;  1PCX A;  5B1A C;  4K0D A;  1YYX A;  3T6B A;  3W8I A;  3ZIB A;  2PX0 A;  2XRH A;  3QVZ A;  2LCH A;  2R7V A;  2HSQ A;  1YA9 A;  2CNW A;  3TD7 A;  3G4X A;  2KNH A;  1LIH A;  4LDR A;  1OR3 A;  5JS5 A;  4E7Z A;  1OCO C;  4UDV A;  2AP3 A;  3QTH A;  3QMK A;  4E17 A;  2MHR A;  3JRM O;  4E7S A;  2YHS A;  4JE9 A;  1JR8 A;  2QLA A;  3N2Z B;  4MTO A;  1F1M A;  3TOM A;  4YT2 A;  2HZ8 A;  5L0C A;  3DZA A;  1EQ1 A;  1A7E A;  3C18 A;  1ZHZ A;  1L3P A;  4XEF A;  3U3B A;  4ONS A;  1L7C A;  1RJ9 B;  2CYD A;  4OIN F;  3EJN A;  1JPN A;  5KYY B;  2OOC A;  5COM A;  1V74 B;  1YDI A;  1HMO A;  2L7A A;  3EPV A;  1VK5 A;  2LQG A;  3EQL F;  1YAR O;  2XM0 A;  2R9R B;  2YL3 A;  2GDC A;  3C8G A;  3JSZ A;  2OG2 A;  5DVW A;  2A6H F;  4BJT A;  2IXP A;  2P7V A;  3DJU B;  2Y3G A;  5FZT A;  5DQZ A;  4C3B A;  4JRZ A;  3SXY A;  2B0J A;  2MWQ A;  2QNL A;  4PR9 A;  4NY3 A;  4CS9 A;  5JT4 A;  2Y69 C;  1Z3I X;  3G4Z A;  2ASR A;  3IQ6 A;  1OKK D;  2BE5 F;  4LLE A;  2XL4 A;  4IWB A;  3EGX A;  2R7R A;  3KYI A;  1MMG A;  3C63 A;  4B6I A;  5IY5 C;  4E0I A;  3DKA A;  1VTM P;  4CS8 A;  5A6A A;  2YLG A;  2YL0 A;  3NMI A;  3MYI A;  4J7T A;  3SNH A;  4NQF A;  4CDV A;  3VAY A;  3B0V C;  1ZHW A;  2YRF A;  4U5B E;  2R03 A;  4FX5 A;  4J32 B;  4XTK A;  1JPJ A;  1TQG A;  4EWC A;  4KNW A;  2IXN A;  4Z9H A;  3FAP B;  1FFH A;  2ZXP A;  3M1C B;  2J45 A;  5F28 E;  5T3W A;  1G4U S;  1UG7 A;  1LE2 A;  1ZU4 A;  1PV3 A;  5DS4 A;  3KKB A;  3O55 A;  3K7D A;  3U2M A;  5HV9 A;  4JJG A;  4JCH A;  4YT5 A;  4YN0 B;  4DVY P;  2G3K A;  4KBL A;  1M6T A;  2L6H A;  1MMD A;  1XWJ A;  3ATP A;  4AK9 A;  3Q6N A;  2EIK C;  1Z7Q c;  5EHH A;  3I4U A;  3U8P A;  2NUT A;  5FCL A;  4KI2 A;  4U5F E;  2IM8 A;  2KK1 A;  1YZA A;  1E86 A;  4ZLD A;  2G3V A;  2Y3D A;  1D1A A;  3N24 A;  1W2W A;  1HE9 A;  2OQM A;  2XS8 A;  3L8I A;  3V5Z A;  2QUP A;  3L34 A;  3NYL A;  3ABM C;  3SXZ A;  2NPU A;  1M56 C;  3EFO A;  4ULW A;  1ZHX A;  3S9O A;  5D91 A;  1LM3 B;  2EPL X;  2XLO A;  4BEM J;  5BUO A;  1A41 A;  2Y3B A;  3TK0 A;  3TQO A;  5JVE A;  2LIG A;  1M2O A;  3T6J A;  3K6B A;  4QI0 A;  3NKD A;  4LDK A;  4OIR F;  3N0T A;  5JRA A;  3B0U X;  4OIO F;  3IHU A;  1C17 M;  2ICW G;  3GM3 A;  1KNY A;  3CSK A;  4BPM A;  3S90 A;  2NUP A;  2YLI A;  1CPQ A;  5A6J A;  3DMD A;  3QVY A;  4LLC A;  2X0C A;  1S05 A;  3A9C A;  3RVY A;  3TUL A;  1EA8 A;  2M64 A;  5KYN A;  4MTG A;  1U6H A;  2EPO A;  2O9X A;  2IXM A;  2YL7 A;  4JIO A;  2VCC A;  1NZE A;  1ZW3 A;  3JZ0 A;  3ZQV A;  3U9M A;  4U9E A;  4XPX A;  4CJO A;  4MVO A;  1C03 A;  4N4W A;  4G7O F;  2XS1 A;  4K1O A;  2A69 F;  1D0Y A;  1AUE A;  1WGW A;  2HV7 A;  2ZXO A;  3S28 A;  4ER9 A;  2ZXW C;  4LAC B;  2OJE D;  1VYI A;  4MVU A;  1NLX A;  2Q9B A;  3S27 A;  4DBQ A;  4CIP A;  2L6F A;  4NTA A;  3RFY A;  4YL3 A;  3DI5 A;  2XM4 A;  4JC7 A;  1YAU O;  3MX3 A;  4WJ0 A;  2V26 A;  4PK4 A;  1ZZP A;  5L0I A;  1Q0K A;  1DOW A;  1T6Q A;  3DAG A;  4IAQ A;  3AG3 C;  2XXA A;  4CX9 A;  3K1H A;  1YA7 O;  2CNW D;  4NTB A;  4YL1 A;  3PCV A;  1C02 A;  3EG9 A;  3V7O A;  4ZLC A;  2TMV P;  3AJM A;  3B71 A;  1S7Z A;  4XPY A;  3T6G B;  3QW1 A;  3RKO F;  1T6I A;  1MQV A;  1MMA A;  2P0N A;  2YL1 A;  3K33 A;  2J7P A;  2XLM A;  1D0Z A;  3ZSU A;  1PD0 A;  4E18 A;  3LES A;  1ORS C;  4IRU A;  3NRH A;  4J7Y A;  4F4B A;  1JMW A;  3UMH A;  4OIP F;  4YWQ A;  1JRA A;  5L0H A;  4DOZ A;  4C7O A;  4EIY A;  1HY5 A;  5EK0 A;  1M57 C;  4D4N A;  2C03 A;  1ORY A;  1FNT c;  4M63 A;  3LS0 A;  1MND A;  1WAS A;  4MTF A;  3DM9 B;  256B A;  4R32 A;  2M4E A;  3GEI A;  4BJ6 A;  5KYW B;  2VC9 A;  3A11 A;  3LLI A;  1ZHT A;  1NFO A;  4JTC B;  2DI3 A;  2A0B A;  2HMQ A;  1XZP A;  3IQ5 A;  3U0C A;  1JOG A;  4CS7 A;  5TJ5 E;  2JX0 A;  2GFH A;  3NG1 A;  2WL8 A;  4X0R A;  3K1I A;  2R25 A;  2XLD A;  1WOL A;  3ZDL A;  1ZU5 A;  3UNG C;  3WHN A;  2G62 A;  2Y3H A;  3JYY A;  1V54 C;  1OCC C;  2KC3 A;  4HFK B;  1PD1 A;  2P6V A;  4WGZ A;  4U9D A;  3R7C A;  4IB4 A;  1D1C A;  2IOQ A;  1LI7 A;  1YLM A;  2L81 A;  3W8H A;  3Q7G A;  1I4Z A;  1Z23 A;  2HSB A;  1LVK A;  1T9K A;  2Q3T A;  3OEO A;  5A6K A;  4XEV A;  5L3V A;  3TOL A;  3IQT A;  1OCZ C;  2A68 F;  4C3D A;  2YEV A;  2R7T A;  5L0F A;  4DXW A;  1RMV A;  2IBF A;  3BEH A;  5DQT A;  2J9U A;  1YZC A;  3KMI A;  3RYL A;  4IAR A;  4N6C A;  2J46 A;  2OJQ A;  1ZHY A;  4RBN A;  2H8A A;  1APC A;  1FFT C;  1TR2 A;  5DS6 A;  4EBJ A;  3KH2 A;  3NDB B;  3DM5 A;  3IPM O;  4FWV A;  2ZPA A;  1TFK B;  3K1I C;  4O6N A;  1FR0 A;  4KNV A;  1OKK A;  1EKY A;  1RJ9 A;  4U5D E;  5F5F A;  3ZQY A;  1BBH A;  1HW1 A;  1QVX A;  1OW8 A;  2YQY A;  4KC9 A;  3FOP A;  2EIJ C;  4W8K A;  1HMD A;  4MW8 A; 
#chains in the Genus database with same CATH homology
 2H7O A;  4H4K C;  3EHN A;  4G7Z F;  3FAJ A;  4I1O B;  4CBE A;  3JYH A;  5E33 A;  3F47 A;  2J9W A;  4BEJ A;  4BG0 A;  2FFH A;  4RDA A;  1BR4 A;  3MLG A;  5KYU B;  4G7H F;  1TWC A;  4IJJ A;  3H65 A;  4PJJ A;  1TWA A;  2V3C C;  2R7U A;  4XLN F;  5HSW A;  4PFP A;  1FMW A;  4A2N B;  3S0X A;  3AQC A;  2KQ9 A;  3UGP A;  4OIQ F;  3ZVR A;  4YJW A;  2R7O A;  2NUP B;  2Y39 A;  1FMV A;  3NKE A;  2QTV A;  4U5H A;  4JJF A;  4XWJ A;  2KJG A;  2H7B A;  1J8M F;  2EIN C;  2R7Q A;  2JD3 A;  3IEE A;  4YT8 A;  1ST6 A;  3SYN A;  3EFO B;  2KW3 C;  1QLE C;  3EGX B;  4AX2 A;  4CS9 C;  2WVQ A;  4AE4 B;  5B3S C;  2WZL A;  2PFD A;  3E9V A;  3EZI A;  4J30 B;  4PFO A;  4I44 A;  4P6I C;  2CGE A;  3GAN A;  4JW1 A;  4K7B A;  4EBB A;  4Q4Z F;  1M2V B;  4HE8 D;  5D92 A;  2X51 A;  4Q5S F;  2EIM C;  3LAY A;  3ZG1 A;  5KYY A;  3I5P A;  2EIL C;  3NYJ A;  3OWT A;  2ZXR A;  3UMK A;  2QY9 A;  2PX3 A;  2WZF A;  3B0P A;  3AG2 C;  3NYM A;  3DAF A;  1G8X A;  2DYS C;  2J0W A;  3B9Q A;  3W2V A;  4MQ9 F;  3PMR A;  1ZYR F;  2IXO A;  3Q6M A;  4QDL A;  2VH3 A;  4JVS A;  1VYK A;  5E3C A;  2CW0 F;  2R7S A;  3X2Q C;  1SMY F;  5E2Q A;  5T1D B;  1NU7 D;  3DJN B;  2J7P D;  3EH1 A;  3POV A;  4O6Y A;  1IW7 F;  2PP4 A;  2J9V A;  4XLP F;  1J8Y F;  1MMN A;  2H7V C;  3AG1 C;  3WOD F;  1FTS A;  1SZI A;  1MNE A;  4BJ1 A;  1D0X A;  1O5H A;  5T3T A;  2NUT B;  3ZC4 A;  2WZG A;  2A6E F;  3K66 A;  3EGD A;  4FES A;  2CDQ A;  1QZX A;  2R7X A;  2I8B A;  2WVN A;  4C7O B;  1TWG A;  3JRT A;  2W4M A;  3JCU Q;  1D1B A;  1Z63 A;  3ASO C;  4DBR A;  4I1M A;  3HTK C;  2WB7 A;  3EG9 B;  4O79 A;  3ABL C;  1N1C A;  2J0X A;  4HEA J;  5EGY A;  2W45 A;  2WVO A;  3T4R A;  2VAS A;  1V55 C;  3LJB A;  4O7G A;  1LKX A;  4CS8 C;  2DYR C;  1OCR C;  5KYX B;  3DXJ F;  3UMI A;  3AG4 C;  4QI2 A;  2W4B A;  3SP1 A;  3EH2 A;  4I3M A;  3OA1 A;  3X1O A;  5DS5 A;  4N06 A;  3LEV A;  1KU2 A;  4YT4 A;  2KGO A;  2XXA B;  3JT1 A;  4IAO A;  3VYW A;  1IZM A;  4BJ5 A;  3RH3 A;  3EHM A;  3LLK A;  2E87 A;  3ABK C;  2NG1 A;  4PJL A;  4JUR I;  3E70 C;  3LNR A;  4GYT A;  3L0I A;  2LSE A;  4HFF B;  1Z6A A;  3ECS A;  3PHF 2;  3I5Q A;  5KYU A;  1BR2 A;  5L3Q A;  4C3E A;  3KL4 A;  3SEO A;  2L9J A;  1TKN A;  2HV6 A;  4U5G A;  1M2V A;  3SZR A;  2PF4 E;  5KYW A;  4CSA A;  5F5H A;  1O87 A;  1VMA A;  4U5C E;  4BJ5 C;  4OD5 A;  3UGO A;  5DLJ A;  3F46 A;  4Q7C A;  1Z5Z A;  3ASN C;  3CZ6 A;  4O6M A;  2OCC C;  1BR1 A;  3HLZ A;  1NG1 A;  3W2W A;  1SF8 A;  4AE4 A;  2IYL D;  4G0H A;  5KYX A;  4BJ6 C;  3FHD A;  2VB6 A;  5B1B C;  1LS1 A;  5E3A A;  3GOD A;  3LS1 A;  2Q9A A;  5CI9 A;  3FVY A;  1TWH A;  2D5R B;  4CIH A;  3ITF A;  2A1D D;  1VOM A;  4JZA A;  2C04 A;  2FGY A;  4PJN A;  2YZS A;  4LER A;  2W9Y A;  4PJM A;  3O39 A;  4U5E E;  3HJC A;  4GEH A;  4OD4 A;  3FDQ A;  3CQZ A;  3S29 A;  1NU9 C;  2Z15 A;  2R7W A;  2DGJ A;  2Q9C A;  5CI8 A;  3EGD B;  2MYS A;  3O6X A;  3WG7 C;  3Q7L A;  3RIP A;  3AQB A;  3DD7 A;  3QZC A;  4CSA C;  4DVZ A;  4MND A;  2XSE A;  3UR3 C;  4ANJ A;  3EZH A;  5B1A C;  1PCX A;  4K0D A;  3T6B A;  3W8I A;  3ZIB A;  2PX0 A;  2XRH A;  2R7V A;  2CNW A;  3TD7 A;  2KNH A;  4E7Z A;  1OCO C;  3QMK A;  4E7S A;  2YHS A;  3N2Z B;  4YT2 A;  3DZA A;  1ZHZ A;  1RJ9 B;  4OIN F;  3EJN A;  1JPN A;  5KYY B;  3EPV A;  1VK5 A;  3EQL F;  3JSZ A;  2OG2 A;  5DVW A;  2A6H F;  4BJT A;  2IXP A;  2P7V A;  3DJU B;  2Y3G A;  5DQZ A;  4C3B A;  4CS9 A;  2B0J A;  2MWQ A;  4NY3 A;  2Y69 C;  1Z3I X;  1OKK D;  2BE5 F;  4LLE A;  2XL4 A;  4IWB A;  3EGX A;  2R7R A;  1MMG A;  4B6I A;  5IY5 C;  4CS8 A;  3SNH A;  3VAY A;  3B0V C;  1ZHW A;  4U5B E;  4FX5 A;  4J32 B;  4XTK A;  1JPJ A;  4EWC A;  4KNW A;  2IXN A;  1FFH A;  2ZXP A;  3M1C B;  2J45 A;  5T3W A;  1ZU4 A;  5DS4 A;  3KKB A;  3K7D A;  4JJG A;  4JCH A;  4YT5 A;  4YN0 B;  4DVY P;  2G3K A;  4KBL A;  1MMD A;  4AK9 A;  3Q6N A;  2EIK C;  5EHH A;  3I4U A;  2NUT A;  5FCL A;  4KI2 A;  4U5F E;  4ZLD A;  2G3V A;  2Y3D A;  1D1A A;  3N24 A;  1W2W A;  3L34 A;  3NYL A;  3ABM C;  3EFO A;  1M56 C;  4ULW A;  1ZHX A;  5D91 A;  5BUO A;  2Y3B A;  1M2O A;  3T6J A;  3K6B A;  4QI0 A;  3NKD A;  4OIR F;  3B0U X;  3N0T A;  4OIO F;  3CSK A;  2NUP A;  3DMD A;  4LLC A;  5KYN A;  2O9X A;  2IXM A;  1NZE A;  4G7O F;  2A69 F;  1D0Y A;  1WGW A;  2HV7 A;  2ZXO A;  3S28 A;  2ZXW C;  4LAC B;  1VYI A;  3S27 A;  2Q9B A;  4DBQ A;  3RFY A;  3MX3 A;  4WJ0 A;  2V26 A;  4PK4 A;  3DAG A;  3AG3 C;  2XXA A;  3K1H A;  2CNW D;  3V7O A;  4ZLC A;  3EG9 A;  1S7Z A;  3RKO F;  1MMA A;  3K33 A;  2J7P A;  1D0Z A;  3ZSU A;  1PD0 A;  4F4B A;  3LES A;  4IRU A;  3NRH A;  3UMH A;  4OIP F;  4YWQ A;  4DOZ A;  4C7O A;  1M57 C;  2C03 A;  4M63 A;  3LS0 A;  1MND A;  3DM9 B;  2M4E A;  4BJ6 A;  5KYW B;  3LLI A;  1ZHT A;  4CS7 A;  2GFH A;  3NG1 A;  2WL8 A;  4X0R A;  1ZU5 A;  3UNG C;  2G62 A;  2Y3H A;  1V54 C;  1OCC C;  4HFK B;  1PD1 A;  2P6V A;  1D1C A;  2IOQ A;  2L81 A;  3W8H A;  3Q7G A;  1Z23 A;  1LVK A;  2Q3T A;  3OEO A;  5L3V A;  1OCZ C;  2A68 F;  4C3D A;  2YEV A;  2R7T A;  5DQT A;  2J9U A;  3KMI A;  3RYL A;  2J46 A;  1ZHY A;  4RBN A;  1FFT C;  1TR2 A;  5DS6 A;  3NDB B;  3KH2 A;  3DM5 A;  4FWV A;  2ZPA A;  3K1I C;  4O6N A;  4KNV A;  1OKK A;  1RJ9 A;  4U5D E;  5F5F A;  4KC9 A;  2EIJ C;  4W8K A;  4RD9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...