4DVZA

Crystal structure of the helicobacter pylori caga oncoprotein
Total Genus 173
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
173
sequence length
522
structure length
459
Chain Sequence
LMGSHNGKVSLLYAGDKHDWNATVGYKDNVATLINVHMKNGSGLVIAGGEKGINNPSFYLYKEDQLTGSQRALSQEEIRNKVDFMEFLAQNNTKLDNLSEKEKEKFQNEIEDFQKDSKAYLDALGNDRIAFVSKKDTKHSALITEFNNGDLSYTLKDYEKNVTLQGSLKHDGVMFVDYSFNKVAVFNLPDLNNLAITSFVRRNLENKLTAKGLSLQEANKLIKDFLSSNKELAGKALNFNKAVAEAKSTGNYDEVKKAQKDLEKSLRKREHLEKEVEKKLESKSGNKKAQANSQKDEIFALINKEANRDARAIAYTQNLKGIKRELSDKLEKISKDLKDFSKSFDEFKNFSKAEETLKALKGSVKDLGINPEWISKVENLNAALNEFKNGDFSKVTQAKSDLENSVKDVIINQKVTDKVDNLNQAVSVAKAMGDFSRVEQVLADLKNFSKEQLAQQAQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oncoprotein
molecule keywords Cytotoxicity-associated immunodominant antigen
publication title Tertiary structure-function analysis reveals the pathogenic signaling potentiation mechanism of Helicobacter pylori oncogenic effector CagA
pubmed doi rcsb
source organism Helicobacter pylori
total genus 173
structure length 459
sequence length 522
ec nomenclature
pdb deposition date 2012-02-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1270 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4dvzA02
4DVZA 4G0HA 4DVYP
chains in the Genus database with same CATH superfamily
2D4UA 4J32B 1CGME 2R7OA 4U5HA 5B1AC 4YT8A 2HV6A 3NKEA 2O9XA 4JEAA 4AK9A 2YL7A 2GDCA 4PFPA 2VCAA 1FFHA 2Y3HA 3HNLA 4B6IA 3LS1A 2XLWA 4C3EA 3H2UA 3GWNA 1SR2A 1IW7F 2QUPA 4ANJA 4U5CE 3NMKA 4G78A 2FGYA 3NRHA 2BC5A 2XL8A 1QVXA 2XLMA 3CQZA 4O6NA 2W4MA 2P7VA 2HMQA 2C03A 4JEBA 1Z6AA 3C8ZA 2Y69C 2I15A 4HE8D 3GM3A 4HFKB 1YZAA 4G7OF 3MYIA 3EG9A 4R32A 3RFYA 1TR2A 3JZ0A 5KYWB 4E18A 1H9GA 4MVMA 2HMZA 4IARA 4JIOA 3QVYA 4LDRA 1IZMA 1TWAA 2XSEA 2YKZA 4AE4B 2ETSA 1ORJA 3UMIA 2P6VA 2Q9AA 1YVIA 4CDVA 1GS9A 3AQCA 1BR2A 1C02A 4MTFA 1LI5A 4CS8A 5JT4A 1QSPA 3NG1A 2OEXA 1YA7O 3IEEA 4D4XA 2EIMC 1D1CA 1NSGB 5FCLA 4NTBA 5B3IA 4BJ6A 3A11A 2OG2A 5COFA 1V54C 2H7BA 3V5ZA 1MMAA 2XS8A 3S27A 3CAXA 1PCXA 3HNIA 4OD5A 2R7SA 3O55A 5JLIA 2YHSA 2IXMA 3TOLA 2QTVA 2NSFA 5L3VA 2OKUA 3JRTA 3IQ6A 3ZWIA 2UUHA 1V74B 3GEHA 4CJGA 4CSAC 4F4BA 2F22A 1NFNA 3S90A 1JR8A 1VYIA 2RSEB 1OCCC 1XWJA 4W8KA 3DD7A 1U89A 1ZHTA 2OJED 3FVYA 3K1IA 3QMKA 2QY9A 4QI2A 2Q9CA 4YL0A 5COMA 3Q7GA 3H65A 4BG0A 1HE1A 1W2WA 4BEJA 2R7TA 3S9OA 5AC4A 4LDKA 2L81A 1KTMA 1C03A 1OW8A 1PV3A 3DI5A 2LIGA 1EKYA 3FOPA 3LEVA 1M2OA 3JRMO 1QPUA 1LKXA 2ASRA 1MMDA 1NLXA 5K0IA 3BRJA 2L7AA 1YA9A 2R7WA 2FFHA 5A6JA 1FFTC 2H7OA 3A9CA 2W45A 2VCCA 2KJGA 2OQMA 3ZVRA 1DOVA 5BQGA 2DB4A 3DJNB 1NU7D 4BPMA 3SXZA 4C7OB 2J45A 4H4KC 4O7GA 4U9EA 2JX0A 3DKAA 3E70C 1F1MA 3HNKA 3HTKC 3LUTB 3PCVA 4IJJA 2NUTA 1A7DA 2CYDA 5DLJA 3MBGA 3ASOC 4E17A 3B71A 3AJMA 1ORSC 5COGA 3U8VA 1LVKA 4MTOA 4EKWA 3ABLC 3JSZA 2ZD9A 4N6CA 1Z7Qc 3IHUA 2MYSA 2TMVP 4JC7A 4CIHA 4J30B 4J7TA 3N0TA 1VOMA 1YJGA 4QDLA 3S29A 3ZQVA 3US6A 2P61A 2Q3TA 3ZDLA 5B3SC 2XL4A 1PD0A 2BL2A 2HUJA 4NY3A 4Q7CA 4OD4A 4QI0A 1E84A 1Z23A 2KSFA 3HKKA 4AL1A 1VYKA 2XRHA 4YJWA 1Q0DA 3X1OA 5AC5A 4MVQA 2NPUA 3T6JA 4CDAA 1YZCA 4BJ1A 4U5BE 3Q6MA 4DRHB 3O10A 3ASNC 3EFOB 5EHHA 4D4NA 3FMSA 2YVKA 2IM8A 4MVOA 3SEOA 3C62A 2ZXOA 2FAPB 4U9DA 4KI2A 1LIHA 1RJ9A 1ZYRF 2QE9A 2R02A 4XQ1A 5TJ5E 2GFHA 3U9JA 4E7SA 4CS9A 2HSBA 3LESA 2QNLA 3CEXA 3DMDA 4WGYA 3VF0A 3RVYA 3M79A 5T3WA 2NG1A 2WL8A 2HJ3A 2WZLA 4K7BA 1K40A 2OJQA 4DVYP 1B68A 2NUPB 3ABKC 3DE9A 1CGNA 2CW0F 4BJ5A 3JYHA 2EPMX 4RD9A 1L7CA 3NDBB 3TK0A 3UNGC 2OEVA 2A0BA 2EPKX 2HSQA 3JTLO 4UDVA 5JVEA 3L8JA 4EBKA 4CS8C 2DYRC 4A2NB 2CGEA 2XLHA 1Z5ZA 3R2PA 5CI9A 1MNEA 2KW3C 1M2VA 3EGDB 2YQYA 4C3BA 5KYUB 3UGPA 4CS7A 3C8GB 4Z9JA 3W4YA 4BJ6C 1MMNA 1PD1A 1G4WR 3WG7C 3IQ5A 1A7EA 1CPRA 3KL4A 4EHPA 1K05A 4XTKA 5L0CA 1OCZC 5JRAA 3TJ5A 2V3CC 1ZW3A 3GM2A 3QZCA 3ZG1A 5DQTA 5KYYA 2CCYA 2YL0A 4I1MA 5E33A 5KYXA 2Y3BA 5L0GA 1JAFA 3T6BA 1J8MF 4FAPB 2XXAB 4Q5SF 5BQHA 5L3QA 2CNWD 3H2VA 5JUAA 2DI3A 3OEOA 1E2XA 3EZIA 4YL1A 3UR3C 1NFOA 4YT2A 1ST6A 3K1IC 3M4CA 1TFKB 2XM4A 1Y4CA 1YYJA 3MLGA 1FNTc 2LP4A 2A6EF 4YL3A 4KNWA 3JSEO 4L6RA 1EI7A 3RKOF 5L0JA 2IYLD 5EGYA 5EK0A 2G62A 2AWCA 3GEIA 4FWVA 4AX2A 2YZSA 1EQ1A 2WVOA 4IWBA 3SXYA 3OA1A 1OW6A 4H54A 2IBFA 2V26A 4RDAA 1HW1A 1NBBA 4BJTA 3B0VC 5F5FA 1OXBA 4XPYA 3LNRA 4HFFB 4YK5A 3ZIBA 1E83A 4NCQA 2VC9A 2M64A 3DM9B 1Q0MA 3MX3A 4CBEA 2IXNA 3EGXB 4RBNA 2Z15A 5DS4A 5F28E 2XLEA 1FMWA 1T6QA 4IGGA 3T4RA 1D0ZA 2PP4A 1RKEA 3TQOA 3IQTA 5HSWA 2R03A 2X51A 1T5OA 2YLIA 3ZC4A 2YLGA 3WODF 2CNWA 3CSKA 5A6KA 1LE2A 2UUIA 3VAYA 1KNYA 1S05A 3S28A 3GODA 3CZ6A 3NYJA 3SP1A 1CGOA 3L8IA 3U8PA 1TQGA 1E85A 3Q6NA 1WTYA 3HNJA 1APCA 3EH1A 4P9TA 5GPGB 1JMWA 1ZHYA 3QTHA 4XLPF 4OIQF 1WASA 3ECSA 3EZHA 3PHF2 1TWHA 5DQZA 1VMAA 4Z9HA 2YEVA 3HJCA 3V5YA 5CIVA 2Q4FA 1LI7A 3FHDA 4LLEA 1XZPA 2GWWA 2WZGA 2Y3DA 3AG2C 3EG9B 3NKDA 4P6IC 2KYHA 2AP3A 3ZTZA 3DWWA 4E0HA 2Q9BA 1VLTA 1SZIA 2H7VC 2HJMA 5A6BD 3KYIA 4X0RA 3VM6A 4EUKB 2XLOA 1FMVA 3B9QA 1OQCA 4N6HA 2GA0A 3NYLA 2X0CA 1YDIA 3ATPA 4FX5A 4JTDB 3RH3A 1D0YA 2J9WA 2XLDA 2DGJA 3JYYA 3M4BA 1SYQA 2PX0A 1QKRA 1Y6DA 3O6XA 5JSLA 1GM5A 4MW8A 4ZLCA 5BUOA 2LCHA 4MW3A 5L0HA 1RMVA 2W9YA 2R25A 2PFDA 3C63A 1M56C 5AGFA 1M57C 3AQBA 1O5HA 5B1BC 4BJ5C 2H8AA 2YRFA 3AG1C 3S0XA 2WZFA 3N24A 3S84A 1OXKA 4LERA 3JT1A 3KMIA 1NU9C 2P0NA 2A69F 2HZ8A 3B0PA 3NMJA 1FAPB 2J9BA 1OKKD 3FOOA 4U5GA 5JP7A 4XWJA 1BZ4A 4CSAA 1U0BB 2WB7A 2KGOA 1V4AA 4P9FA 3TD7A 1AVOB 4KC9A 4U5FE 3DJUB 3ZSUA 4G7HF 5A6BA 3U2LA 1WGWA 2OOCA 1VK5A 4MQ9F 3QVZA 3LNMB 1O87A 2EPNA 3GEEA 4E0IA 2WVQA 4JTCB 4XEFA 3AGTA 4K1OA 5L0IA 2YLDA 5KYNA 1RKCA 4JKVA 1QLEC 2OCCC 4GYTA 2EILC 1A41A 4O6MA 2HS5A 3DAFA 2KNHA 5KYWA 5E2QA 3E9VA 1RCPA 3F47A 1MQVA 2M4EA 1OR2A 4AE4A 3EJNA 3I5QA 3N2ZB 4JURI 2PX3A 3TULA 4JTAB 4JJGA 5F5HA 1OKKA 1A7VA 3KPHA 5A6AA 1E86A 1OCOC 2NUTB 3AOUA 2R7RA 2W4BA 1BR1A 1A0BA 1VB5A 1ORYA 1RXQA 3AG3C 3ITFA 2IXPA 1CPQA 3LS0A 4JE9A 5CI8A 4C3DA 2HFIA 4G0HA 3R7CA 3V7OA 2LK4A 3MFNA 4PR9A 1K04A 2Y39A 2XLVA 4HEAJ 3VYWA 3L34A 1WWPA 2L6HA 3NMIA 5HV9A 2Q00A 2HV7A 4DRIB 2E87A 1GGQA 1XZQA 2J8WA 3L1MA 4JVSA 1H6GA 3FDQA 1L3PA 4JW1A 1ZHZA 3RIPA 2J0WA 2NSGA 2RD9A 2KK1A 4Q4ZF 2I8BA 1T6UA 2A1DD 2VB6A 1SMYF 2R9RB 4MNDA 4DXWA 3SNHA 1QQ3A 2EPLX 1OCRC 1RJ9B 2DYSC 2ZXRA 4FESA 3FAPB 4I1OB 2MHRA 3AGUA 1YARO 3LLIA 1J8YF 4JCHA 4EBJA 2EINC 5JS5A 3G50A 3SYNA 4ER9A 3GORA 1TFOB 3B29A 2VASA 3IQCA 4PACA 4WJ0A 4W8PA 5L0DA 1Q0FA 5T3TA 1JOGA 1YLMA 1SF8A 2AU5A 2D5RB 3G4ZA 2A68F 2B0HA 3K33A 5BQIA 3FAJA 4MS2A 2VH3A 1I4ZA 4IAOA 1U6HA 4NC3A 4ULWA 5D91A 3RVZA 3DE8A 4A4AA 1WN0A 2ZPAA 1I5NA 2Y3GA 1G8XA 1V55C 2LFFA 3I4UA 4N06A 4C7OA 3U3BA 2JD3A 3IPMO 4MVZA 2R7UA 1T6IA 2ICWG 4I3MA 3T6GB 2J0XA 2L9JA 1M2VB 2J9UA 2C04A 3SXMA 1TWCA 3W8HA 4CIPA 5L0FA 1LM3B 4YN0B 3SZRA 3M15A 1TKNA 2AWYA 1BR4A 4MVUA 1H7IA 3C18A 1R5ID 4O6YA 4XEVA 2J46A 4IB4A 1JPNA 5T1DB 4G7ZF 1LPEA 4DVZA 5DVWA 3OWTA 3TJ6A 2XL6A 2BE5F 2PNOA 3DZAA 3HLZA 4CX9A 3EH2A 3O39A 1H9TA 1T9KA 2ZXPA 5KYYB 3B0UX 4DOZA 4PJJA 1ZHWA 3ZQYA 3KYJA 2J7PD 5KYXB 4PJNA 1FR0A 2PBEA 3LJBA 3EFOA 2WVNA 2EIKC 2YWAA 2HKVA 3GWLA 3Q7LA 4JCZA 1BBHA 1HY5A 1ZVZA 3LLKA 3PMRA 3C8GD 2JPUA 1DOWA 3JCUQ 2KC3A 4PJMA 1C17M 1ZU5A 4U5EE 2L6FA 3RW0A 4EIYA 5DS5A 1G4US 1WOLA 4CS9C 4WGZA 4AL0A 2G3KA 1ZZPA 3U3FA 4U5DE 1O3UA 1ZU4A 3W2WA 4EBBA 5D92A 3W2VA 1VTMP 3J06A 4DBRA 3UMHA 4EWCA 4JRZA 3K6BA 2EIJC 3GM1A 2R7XA 3C7JA 1AEPA 3T9OA 4XPWA 2XS1A 2QLAA 3ABMC 3L0IA 4LDQA 4N4WA 3DM5A 2XM0A 1OW7A 2NUPA 3FXHA 3QW1A 4OINF 4O79A 3RQFA 4KBLA 1GQAA 3F46A 4WABA 1NZEA 1N1CA 1HMOA 4LLCA 4XLNF 3RQEA 1T01A 3KKBA 4YWQA 2LSEA 1HE9A 1RKEB 1UFBA 2R7QA 5IY5C 2J7PA 4MTGA 4CJOA 4J7YA 4MVSA 4MVRA 5DS6A 2G3VA 4IRUA 3M1CB 2LQGA 3EGDA 4K0DA 4JZAA 4KNVA 1D0XA 5KYUA 3RYLA 3V5XA 3K1HA 4CDYA 4DBQA 1EA8A 4YT4A 2CDQA 3C8GA 3EHMA 3RF3A 3TOMA 3PDMP 2YL3A 3EQLF 4NQFA 4NTAA 2OU6A 1UG7A 1WATA 2IOQA 4Z9IA 2Q7RA 1FTSA 1HW2A 2IXOA 3VRCA 2P1AA 2R05A 4JJFA 4E7ZA 2B0JA 3G4XA 1ZHXA 2MWQA 3LAYA 2AVKA 1S7ZA 1QZXA 1G5ZA 3EPVA 2L6GA 3K7DA 5FZTA 2J9VA 4NTFA 4OIRF 3UGOA 2YL1A 2A6HF 3EHNA 4GEHA 3RQGA 4OIOF 4PFOA 2XXAA 2R7VA 1VLSA 4ZLDA 3X2QC 1MNDA 3I5PA 1KU2A 3SXKA 2ZXWC 4OIPF 1BDJB 2GAQA 2A0UA 3LEOA 5E3CA 3U5SA 3U0CA 4XEKA 1JPJA 1TWGA 3U2MA 2PF4E 4DRJB 1MMGA 3POVA 3DAGA 1D1BA 1Z3IX 1D1AA 3DXJF 4IAQA 3NYMA 4M63A 1I4YA 1LS4A 256BA 1R4TA 1LS1A 2LD6A 3QW0A 4I44A 4ONSA 4XPXA 1Z63A 4ULVA 4YT5A 3WAQA 1Q0GA 1YAUO 1M6TA 3GANA 3K66A 1Q0KA 3KH2A 5E3AA 2VCBA 3AG4C 1LE4A 1OR3A 5A69A 4PJLA 2KQ9A 2LFDA 3ZTMA 4BEMJ 1AUEA 4DJ9A 3BEHA 4GQHA 1ZW2A 3WHNA 4PK4A 1HMDA 3EGXA 3MYFA 3U9MA 3UMKA 1NG1A 2EPOA 1JRAA 4LACB 3W8IA 1YYXA
chains in the Genus database with same CATH topology
4J32B 2R7OA 4U5HA 5B1AC 4YT8A 2HV6A 3NKEA 2O9XA 4PFPA 2Y3HA 1FFHA 4B6IA 3LS1A 4C3EA 1IW7F 4ANJA 4U5CE 2FGYA 3NRHA 3CQZA 4O6NA 2W4MA 2P7VA 2C03A 1Z6AA 2Y69C 4HE8D 4HFKB 4G7OF 3EG9A 3RFYA 1TR2A 5KYWB 1IZMA 1TWAA 2XSEA 4AE4B 3UMIA 2P6VA 2Q9AA 3AQCA 1BR2A 4CS8A 3NG1A 3IEEA 2EIMC 1D1CA 5FCLA 4BJ6A 2OG2A 1V54C 2H7BA 1MMAA 3S27A 1PCXA 4OD5A 2R7SA 2YHSA 2IXMA 2QTVA 5L3VA 3JRTA 4CSAC 4F4BA 1VYIA 1OCCC 4W8KA 3DD7A 1ZHTA 3QMKA 3FVYA 2QY9A 4QI2A 2Q9CA 3Q7GA 3H65A 4BG0A 1W2WA 4BEJA 2R7TA 2L81A 3LEVA 1M2OA 1LKXA 1MMDA 2R7WA 2FFHA 1FFTC 2H7OA 2W45A 2KJGA 3ZVRA 3DJNB 1NU7D 4C7OB 2J45A 4H4KC 4O7GA 5DS5A 3HTKC 3E70C 5DLJA 4IJJA 2NUTA 3ASOC 1LVKA 3ABLC 3JSZA 2MYSA 4CIHA 4J30B 3N0TA 1VOMA 4QDLA 3S29A 5B3SC 2Q3TA 2XL4A 1PD0A 4NY3A 4Q7CA 4QI0A 4OD4A 1Z23A 1VYKA 2XRHA 4YJWA 3X1OA 3T6JA 4BJ1A 4U5BE 3Q6MA 3ASNC 3EFOB 5EHHA 3SEOA 4KI2A 2ZXOA 1RJ9A 1ZYRF 2GFHA 4E7SA 4CS9A 3LESA 3DMDA 5T3WA 2NG1A 2WL8A 2WZLA 4K7BA 4DVYP 2NUPB 3ABKC 2CW0F 4BJ5A 3JYHA 4RD9A 3NDBB 3UNGC 4CS8C 2DYRC 4A2NB 2CGEA 1Z5ZA 5CI9A 1MNEA 2KW3C 1M2VA 3EGDB 4C3BA 5KYUB 3UGPA 4CS7A 4BJ6C 1MMNA 1PD1A 3WG7C 3KL4A 4XTKA 2V3CC 1OCZC 3ZG1A 3QZCA 5DQTA 5KYYA 4I1MA 5E33A 5KYXA 2Y3BA 3T6BA 2XXAB 1J8MF 4Q5SF 5L3QA 2CNWD 3OEOA 3EZIA 3UR3C 4YT2A 1ST6A 3K1IC 3MLGA 2A6EF 4KNWA 3RKOF 2IYLD 5EGYA 2G62A 4FWVA 4AX2A 2YZSA 2WVOA 4IWBA 3OA1A 4RDAA 2V26A 4BJTA 5F5FA 3B0VC 3LNRA 4HFFB 3ZIBA 3DM9B 3MX3A 4CBEA 2IXNA 3EGXB 4RBNA 2Z15A 5DS4A 1FMWA 3T4RA 1D0ZA 2PP4A 5HSWA 2X51A 3ZC4A 3WODF 2CNWA 3CSKA 3VAYA 3S28A 3GODA 3CZ6A 3NYJA 3SP1A 3Q6NA 3EH1A 4XLPF 1ZHYA 4OIQF 3ECSA 3EZHA 3PHF2 1TWHA 5DQZA 1VMAA 2YEVA 3HJCA 4LLEA 3FHDA 2WZGA 3AG2C 2Y3DA 3EG9B 3NKDA 4P6IC 2Q9BA 1SZIA 2H7VC 4X0RA 3B9QA 1FMVA 3NYLA 4FX5A 3RH3A 1D0YA 2J9WA 2DGJA 2PX0A 3O6XA 4ZLCA 5BUOA 2W9YA 2PFDA 1M56C 1M57C 3AQBA 1O5HA 5B1BC 4BJ5C 3AG1C 3S0XA 2WZFA 3N24A 4LERA 3JT1A 3KMIA 1NU9C 2A69F 3B0PA 1OKKD 4U5GA 4CSAA 4XWJA 2WB7A 2KGOA 3TD7A 4KC9A 4U5FE 3DJUB 3ZSUA 4G7HF 1WGWA 1VK5A 4MQ9F 1O87A 2WVQA 5KYNA 1QLEC 2OCCC 4GYTA 2EILC 4O6MA 3DAFA 2KNHA 5KYWA 5E2QA 3E9VA 3F47A 2M4EA 4AE4A 3EJNA 3I5QA 3N2ZB 4JURI 2PX3A 5F5HA 4JJGA 1OKKA 1OCOC 2NUTB 2R7RA 2W4BA 1BR1A 5D91A 3LS0A 3ITFA 4C3DA 3AG3C 5CI8A 2IXPA 4G0HA 3V7OA 2Y39A 4HEAJ 3VYWA 3L34A 2HV7A 2E87A 4JVSA 3FDQA 4JW1A 1ZHZA 3RIPA 2J0WA 4Q4ZF 2I8BA 2A1DD 2VB6A 1SMYF 4MNDA 3SNHA 1OCRC 1RJ9B 2DYSC 2ZXRA 4FESA 4I1OB 3LLIA 1J8YF 4JCHA 2EINC 3SYNA 2VASA 4WJ0A 5T3TA 1SF8A 2D5RB 2A68F 3K33A 3FAJA 2VH3A 4IAOA 4ULWA 2ZPAA 2Y3GA 1G8XA 1V55C 3I4UA 4N06A 4C7OA 2JD3A 2R7UA 4I3MA 2J0XA 2L9JA 1M2VB 2J9UA 2C04A 1TWCA 3W8HA 4YN0B 3SZRA 1TKNA 1BR4A 4O6YA 2J46A 1JPNA 5T1DB 4G7ZF 4DVZA 5DVWA 3OWTA 2BE5F 3DZAA 3HLZA 3EH2A 3O39A 3B0UX 2ZXPA 5KYYB 4DOZA 4PJJA 1ZHWA 2J7PD 5KYXB 4PJNA 3LJBA 3EFOA 2WVNA 2EIKC 3Q7LA 3LLKA 3PMRA 4PJMA 3JCUQ 4U5EE 1ZU5A 4CS9C 2G3KA 4U5DE 1ZU4A 3W2WA 4EBBA 5D92A 3W2VA 4DBRA 3UMHA 4EWCA 3K6BA 2EIJC 2R7XA 3ABMC 3L0IA 3DM5A 2NUPA 4OINF 4O79A 4KBLA 3F46A 4XLNF 1NZEA 1N1CA 4LLCA 3KKBA 4YWQA 2LSEA 2R7QA 5IY5C 2J7PA 5DS6A 2G3VA 4IRUA 3M1CB 4K0DA 3EGDA 4JZAA 3RYLA 4KNVA 1D0XA 5KYUA 3K1HA 4DBQA 4YT4A 2CDQA 3EHMA 3EQLF 2IOQA 1FTSA 2IXOA 4JJFA 4E7ZA 2B0JA 1ZHXA 2MWQA 3LAYA 1S7ZA 1QZXA 3EPVA 4OIRF 3K7DA 2J9VA 3UGOA 2A6HF 3EHNA 4GEHA 4OIOF 2XXAA 4PFOA 2R7VA 4ZLDA 3X2QC 1MNDA 3I5PA 1KU2A 2ZXWC 4OIPF 5E3CA 1JPJA 1TWGA 2PF4E 1MMGA 3POVA 3DAGA 1D1BA 1Z3IX 1D1AA 3DXJF 3NYMA 4M63A 1LS1A 4I44A 1Z63A 4YT5A 3GANA 3K66A 3KH2A 5E3AA 3AG4C 4PJLA 2KQ9A 4PK4A 3EGXA 3UMKA 1NG1A 4AK9A 4LACB 3W8IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DVZ A;  4G0H A;  4DVY P; 
#chains in the Genus database with same CATH topology
 2D4U A;  4J32 B;  1CGM E;  2R7O A;  4U5H A;  5B1A C;  4YT8 A;  2HV6 A;  3NKE A;  2O9X A;  4JEA A;  4AK9 A;  2YL7 A;  2GDC A;  4PFP A;  2VCA A;  1FFH A;  2Y3H A;  3HNL A;  4B6I A;  3LS1 A;  2XLW A;  4C3E A;  3H2U A;  3GWN A;  1SR2 A;  1IW7 F;  2QUP A;  4ANJ A;  4U5C E;  3NMK A;  4G78 A;  2FGY A;  3NRH A;  2BC5 A;  2XL8 A;  1QVX A;  2XLM A;  3CQZ A;  4O6N A;  2W4M A;  2P7V A;  2HMQ A;  2C03 A;  4JEB A;  1Z6A A;  3C8Z A;  2Y69 C;  2I15 A;  4HE8 D;  3GM3 A;  4HFK B;  1YZA A;  4G7O F;  3MYI A;  3EG9 A;  4R32 A;  3RFY A;  1TR2 A;  3JZ0 A;  5KYW B;  4E18 A;  1H9G A;  4MVM A;  2HMZ A;  4IAR A;  4JIO A;  3QVY A;  4LDR A;  1IZM A;  1TWA A;  2XSE A;  2YKZ A;  4AE4 B;  2ETS A;  1ORJ A;  3UMI A;  2P6V A;  2Q9A A;  1YVI A;  4CDV A;  1GS9 A;  3AQC A;  1BR2 A;  1C02 A;  4MTF A;  1LI5 A;  4CS8 A;  5JT4 A;  1QSP A;  3NG1 A;  2OEX A;  1YA7 O;  3IEE A;  4D4X A;  2EIM C;  1D1C A;  1NSG B;  5FCL A;  4NTB A;  5B3I A;  4BJ6 A;  3A11 A;  2OG2 A;  5COF A;  1V54 C;  2H7B A;  3V5Z A;  1MMA A;  2XS8 A;  3S27 A;  3CAX A;  1PCX A;  3HNI A;  4OD5 A;  2R7S A;  3O55 A;  5JLI A;  2YHS A;  2IXM A;  3TOL A;  2QTV A;  2NSF A;  5L3V A;  2OKU A;  3JRT A;  3IQ6 A;  3ZWI A;  2UUH A;  1V74 B;  3GEH A;  4CJG A;  4CSA C;  4F4B A;  2F22 A;  1NFN A;  3S90 A;  1JR8 A;  1VYI A;  2RSE B;  1OCC C;  1XWJ A;  4W8K A;  3DD7 A;  1U89 A;  1ZHT A;  2OJE D;  3FVY A;  3K1I A;  3QMK A;  2QY9 A;  4QI2 A;  2Q9C A;  4YL0 A;  5COM A;  3Q7G A;  3H65 A;  4BG0 A;  1HE1 A;  1W2W A;  4BEJ A;  2R7T A;  3S9O A;  5AC4 A;  4LDK A;  2L81 A;  1KTM A;  1C03 A;  1OW8 A;  1PV3 A;  3DI5 A;  2LIG A;  1EKY A;  3FOP A;  3LEV A;  1M2O A;  3JRM O;  1QPU A;  1LKX A;  2ASR A;  1MMD A;  1NLX A;  5K0I A;  3BRJ A;  2L7A A;  1YA9 A;  2R7W A;  2FFH A;  5A6J A;  1FFT C;  2H7O A;  3A9C A;  2W45 A;  2VCC A;  2KJG A;  2OQM A;  3ZVR A;  1DOV A;  5BQG A;  2DB4 A;  3DJN B;  1NU7 D;  4BPM A;  3SXZ A;  4C7O B;  2J45 A;  4H4K C;  4O7G A;  4U9E A;  2JX0 A;  3DKA A;  3E70 C;  1F1M A;  3HNK A;  3HTK C;  3LUT B;  3PCV A;  4IJJ A;  2NUT A;  1A7D A;  2CYD A;  5DLJ A;  3MBG A;  3ASO C;  4E17 A;  3B71 A;  3AJM A;  1ORS C;  5COG A;  3U8V A;  1LVK A;  4MTO A;  4EKW A;  3ABL C;  3JSZ A;  2ZD9 A;  4N6C A;  1Z7Q c;  3IHU A;  2MYS A;  2TMV P;  4JC7 A;  4CIH A;  4J30 B;  4J7T A;  3N0T A;  1VOM A;  1YJG A;  4QDL A;  3S29 A;  3ZQV A;  3US6 A;  2P61 A;  2Q3T A;  3ZDL A;  5B3S C;  2XL4 A;  1PD0 A;  2BL2 A;  2HUJ A;  4NY3 A;  4Q7C A;  4OD4 A;  4QI0 A;  1E84 A;  1Z23 A;  2KSF A;  3HKK A;  4AL1 A;  1VYK A;  2XRH A;  4YJW A;  1Q0D A;  3X1O A;  5AC5 A;  4MVQ A;  2NPU A;  3T6J A;  4CDA A;  1YZC A;  4BJ1 A;  4U5B E;  3Q6M A;  4DRH B;  3O10 A;  3ASN C;  3EFO B;  5EHH A;  4D4N A;  3FMS A;  2YVK A;  2IM8 A;  4MVO A;  3SEO A;  3C62 A;  2ZXO A;  2FAP B;  4U9D A;  4KI2 A;  1LIH A;  1RJ9 A;  1ZYR F;  2QE9 A;  2R02 A;  4XQ1 A;  5TJ5 E;  2GFH A;  3U9J A;  4E7S A;  4CS9 A;  2HSB A;  3LES A;  2QNL A;  3CEX A;  3DMD A;  4WGY A;  3VF0 A;  3RVY A;  3M79 A;  5T3W A;  2NG1 A;  2WL8 A;  2HJ3 A;  2WZL A;  4K7B A;  1K40 A;  2OJQ A;  4DVY P;  1B68 A;  2NUP B;  3ABK C;  3DE9 A;  1CGN A;  2CW0 F;  4BJ5 A;  3JYH A;  2EPM X;  4RD9 A;  1L7C A;  3NDB B;  3TK0 A;  3UNG C;  2OEV A;  2A0B A;  2EPK X;  2HSQ A;  3JTL O;  4UDV A;  5JVE A;  3L8J A;  4EBK A;  4CS8 C;  2DYR C;  4A2N B;  2CGE A;  2XLH A;  1Z5Z A;  3R2P A;  5CI9 A;  1MNE A;  2KW3 C;  1M2V A;  3EGD B;  2YQY A;  4C3B A;  5KYU B;  3UGP A;  4CS7 A;  3C8G B;  4Z9J A;  3W4Y A;  4BJ6 C;  1MMN A;  1PD1 A;  1G4W R;  3WG7 C;  3IQ5 A;  1A7E A;  1CPR A;  3KL4 A;  4EHP A;  1K05 A;  4XTK A;  5L0C A;  1OCZ C;  5JRA A;  3TJ5 A;  2V3C C;  1ZW3 A;  3GM2 A;  3QZC A;  3ZG1 A;  5DQT A;  5KYY A;  2CCY A;  2YL0 A;  4I1M A;  5E33 A;  5KYX A;  2Y3B A;  5L0G A;  1JAF A;  3T6B A;  1J8M F;  4FAP B;  2XXA B;  4Q5S F;  5BQH A;  5L3Q A;  2CNW D;  3H2V A;  5JUA A;  2DI3 A;  3OEO A;  1E2X A;  3EZI A;  4YL1 A;  3UR3 C;  1NFO A;  4YT2 A;  1ST6 A;  3K1I C;  3M4C A;  1TFK B;  2XM4 A;  1Y4C A;  1YYJ A;  3MLG A;  1FNT c;  2LP4 A;  2A6E F;  4YL3 A;  4KNW A;  3JSE O;  4L6R A;  1EI7 A;  3RKO F;  5L0J A;  2IYL D;  5EGY A;  5EK0 A;  2G62 A;  2AWC A;  3GEI A;  4FWV A;  4AX2 A;  2YZS A;  1EQ1 A;  2WVO A;  4IWB A;  3SXY A;  3OA1 A;  1OW6 A;  4H54 A;  2IBF A;  2V26 A;  4RDA A;  1HW1 A;  1NBB A;  4BJT A;  3B0V C;  5F5F A;  1OXB A;  4XPY A;  3LNR A;  4HFF B;  4YK5 A;  3ZIB A;  1E83 A;  4NCQ A;  2VC9 A;  2M64 A;  3DM9 B;  1Q0M A;  3MX3 A;  4CBE A;  2IXN A;  3EGX B;  4RBN A;  2Z15 A;  5DS4 A;  5F28 E;  2XLE A;  1FMW A;  1T6Q A;  4IGG A;  3T4R A;  1D0Z A;  2PP4 A;  1RKE A;  3TQO A;  3IQT A;  5HSW A;  2R03 A;  2X51 A;  1T5O A;  2YLI A;  3ZC4 A;  2YLG A;  3WOD F;  2CNW A;  3CSK A;  5A6K A;  1LE2 A;  2UUI A;  3VAY A;  1KNY A;  1S05 A;  3S28 A;  3GOD A;  3CZ6 A;  3NYJ A;  3SP1 A;  1CGO A;  3L8I A;  3U8P A;  1TQG A;  1E85 A;  3Q6N A;  1WTY A;  3HNJ A;  1APC A;  3EH1 A;  4P9T A;  5GPG B;  1JMW A;  1ZHY A;  3QTH A;  4XLP F;  4OIQ F;  1WAS A;  3ECS A;  3EZH A;  3PHF 2;  1TWH A;  5DQZ A;  1VMA A;  4Z9H A;  2YEV A;  3HJC A;  3V5Y A;  5CIV A;  2Q4F A;  1LI7 A;  3FHD A;  4LLE A;  1XZP A;  2GWW A;  2WZG A;  2Y3D A;  3AG2 C;  3EG9 B;  3NKD A;  4P6I C;  2KYH A;  2AP3 A;  3ZTZ A;  3DWW A;  4E0H A;  2Q9B A;  1VLT A;  1SZI A;  2H7V C;  2HJM A;  5A6B D;  3KYI A;  4X0R A;  3VM6 A;  4EUK B;  2XLO A;  1FMV A;  3B9Q A;  1OQC A;  4N6H A;  2GA0 A;  3NYL A;  2X0C A;  1YDI A;  3ATP A;  4FX5 A;  4JTD B;  3RH3 A;  1D0Y A;  2J9W A;  2XLD A;  2DGJ A;  3JYY A;  3M4B A;  1SYQ A;  2PX0 A;  1QKR A;  1Y6D A;  3O6X A;  5JSL A;  1GM5 A;  4MW8 A;  4ZLC A;  5BUO A;  2LCH A;  4MW3 A;  5L0H A;  1RMV A;  2W9Y A;  2R25 A;  2PFD A;  3C63 A;  1M56 C;  5AGF A;  1M57 C;  3AQB A;  1O5H A;  5B1B C;  4BJ5 C;  2H8A A;  2YRF A;  3AG1 C;  3S0X A;  2WZF A;  3N24 A;  3S84 A;  1OXK A;  4LER A;  3JT1 A;  3KMI A;  1NU9 C;  2P0N A;  2A69 F;  2HZ8 A;  3B0P A;  3NMJ A;  1FAP B;  2J9B A;  1OKK D;  3FOO A;  4U5G A;  5JP7 A;  4XWJ A;  1BZ4 A;  4CSA A;  1U0B B;  2WB7 A;  2KGO A;  1V4A A;  4P9F A;  3TD7 A;  1AVO B;  4KC9 A;  4U5F E;  3DJU B;  3ZSU A;  4G7H F;  5A6B A;  3U2L A;  1WGW A;  2OOC A;  1VK5 A;  4MQ9 F;  3QVZ A;  3LNM B;  1O87 A;  2EPN A;  3GEE A;  4E0I A;  2WVQ A;  4JTC B;  4XEF A;  3AGT A;  4K1O A;  5L0I A;  2YLD A;  5KYN A;  1RKC A;  4JKV A;  1QLE C;  2OCC C;  4GYT A;  2EIL C;  1A41 A;  4O6M A;  2HS5 A;  3DAF A;  2KNH A;  5KYW A;  5E2Q A;  3E9V A;  1RCP A;  3F47 A;  1MQV A;  2M4E A;  1OR2 A;  4AE4 A;  3EJN A;  3I5Q A;  3N2Z B;  4JUR I;  2PX3 A;  3TUL A;  4JTA B;  4JJG A;  5F5H A;  1OKK A;  1A7V A;  3KPH A;  5A6A A;  1E86 A;  1OCO C;  2NUT B;  3AOU A;  2R7R A;  2W4B A;  1BR1 A;  1A0B A;  1VB5 A;  1ORY A;  1RXQ A;  3AG3 C;  3ITF A;  2IXP A;  1CPQ A;  3LS0 A;  4JE9 A;  5CI8 A;  4C3D A;  2HFI A;  4G0H A;  3R7C A;  3V7O A;  2LK4 A;  3MFN A;  4PR9 A;  1K04 A;  2Y39 A;  2XLV A;  4HEA J;  3VYW A;  3L34 A;  1WWP A;  2L6H A;  3NMI A;  5HV9 A;  2Q00 A;  2HV7 A;  4DRI B;  2E87 A;  1GGQ A;  1XZQ A;  2J8W A;  3L1M A;  4JVS A;  1H6G A;  3FDQ A;  1L3P A;  4JW1 A;  1ZHZ A;  3RIP A;  2J0W A;  2NSG A;  2RD9 A;  2KK1 A;  4Q4Z F;  2I8B A;  1T6U A;  2A1D D;  2VB6 A;  1SMY F;  2R9R B;  4MND A;  4DXW A;  3SNH A;  1QQ3 A;  2EPL X;  1OCR C;  1RJ9 B;  2DYS C;  2ZXR A;  4FES A;  3FAP B;  4I1O B;  2MHR A;  3AGU A;  1YAR O;  3LLI A;  1J8Y F;  4JCH A;  4EBJ A;  2EIN C;  5JS5 A;  3G50 A;  3SYN A;  4ER9 A;  3GOR A;  1TFO B;  3B29 A;  2VAS A;  3IQC A;  4PAC A;  4WJ0 A;  4W8P A;  5L0D A;  1Q0F A;  5T3T A;  1JOG A;  1YLM A;  1SF8 A;  2AU5 A;  2D5R B;  3G4Z A;  2A68 F;  2B0H A;  3K33 A;  5BQI A;  3FAJ A;  4MS2 A;  2VH3 A;  1I4Z A;  4IAO A;  1U6H A;  4NC3 A;  4ULW A;  5D91 A;  3RVZ A;  3DE8 A;  4A4A A;  1WN0 A;  2ZPA A;  1I5N A;  2Y3G A;  1G8X A;  1V55 C;  2LFF A;  3I4U A;  4N06 A;  4C7O A;  3U3B A;  2JD3 A;  3IPM O;  4MVZ A;  2R7U A;  1T6I A;  2ICW G;  4I3M A;  3T6G B;  2J0X A;  2L9J A;  1M2V B;  2J9U A;  2C04 A;  3SXM A;  1TWC A;  3W8H A;  4CIP A;  5L0F A;  1LM3 B;  4YN0 B;  3SZR A;  3M15 A;  1TKN A;  2AWY A;  1BR4 A;  4MVU A;  1H7I A;  3C18 A;  1R5I D;  4O6Y A;  4XEV A;  2J46 A;  4IB4 A;  1JPN A;  5T1D B;  4G7Z F;  1LPE A;  4DVZ A;  5DVW A;  3OWT A;  3TJ6 A;  2XL6 A;  2BE5 F;  2PNO A;  3DZA A;  3HLZ A;  4CX9 A;  3EH2 A;  3O39 A;  1H9T A;  1T9K A;  2ZXP A;  5KYY B;  3B0U X;  4DOZ A;  4PJJ A;  1ZHW A;  3ZQY A;  3KYJ A;  2J7P D;  5KYX B;  4PJN A;  1FR0 A;  2PBE A;  3LJB A;  3EFO A;  2WVN A;  2EIK C;  2YWA A;  2HKV A;  3GWL A;  3Q7L A;  4JCZ A;  1BBH A;  1HY5 A;  1ZVZ A;  3LLK A;  3PMR A;  3C8G D;  2JPU A;  1DOW A;  3JCU Q;  2KC3 A;  4PJM A;  1C17 M;  1ZU5 A;  4U5E E;  2L6F A;  3RW0 A;  4EIY A;  5DS5 A;  1G4U S;  1WOL A;  4CS9 C;  4WGZ A;  4AL0 A;  2G3K A;  1ZZP A;  3U3F A;  4U5D E;  1O3U A;  1ZU4 A;  3W2W A;  4EBB A;  5D92 A;  3W2V A;  1VTM P;  3J06 A;  4DBR A;  3UMH A;  4EWC A;  4JRZ A;  3K6B A;  2EIJ C;  3GM1 A;  2R7X A;  3C7J A;  1AEP A;  3T9O A;  4XPW A;  2XS1 A;  2QLA A;  3ABM C;  3L0I A;  4LDQ A;  4N4W A;  3DM5 A;  2XM0 A;  1OW7 A;  2NUP A;  3FXH A;  3QW1 A;  4OIN F;  4O79 A;  3RQF A;  4KBL A;  1GQA A;  3F46 A;  4WAB A;  1NZE A;  1N1C A;  1HMO A;  4LLC A;  4XLN F;  3RQE A;  1T01 A;  3KKB A;  4YWQ A;  2LSE A;  1HE9 A;  1RKE B;  1UFB A;  2R7Q A;  5IY5 C;  2J7P A;  4MTG A;  4CJO A;  4J7Y A;  4MVS A;  4MVR A;  5DS6 A;  2G3V A;  4IRU A;  3M1C B;  2LQG A;  3EGD A;  4K0D A;  4JZA A;  4KNV A;  1D0X A;  5KYU A;  3RYL A;  3V5X A;  3K1H A;  4CDY A;  4DBQ A;  1EA8 A;  4YT4 A;  2CDQ A;  3C8G A;  3EHM A;  3RF3 A;  3TOM A;  3PDM P;  2YL3 A;  3EQL F;  4NQF A;  4NTA A;  2OU6 A;  1UG7 A;  1WAT A;  2IOQ A;  4Z9I A;  2Q7R A;  1FTS A;  1HW2 A;  2IXO A;  3VRC A;  2P1A A;  2R05 A;  4JJF A;  4E7Z A;  2B0J A;  3G4X A;  1ZHX A;  2MWQ A;  3LAY A;  2AVK A;  1S7Z A;  1QZX A;  1G5Z A;  3EPV A;  2L6G A;  3K7D A;  5FZT A;  2J9V A;  4NTF A;  4OIR F;  3UGO A;  2YL1 A;  2A6H F;  3EHN A;  4GEH A;  3RQG A;  4OIO F;  4PFO A;  2XXA A;  2R7V A;  1VLS A;  4ZLD A;  3X2Q C;  1MND A;  3I5P A;  1KU2 A;  3SXK A;  2ZXW C;  4OIP F;  1BDJ B;  2GAQ A;  2A0U A;  3LEO A;  5E3C A;  3U5S A;  3U0C A;  4XEK A;  1JPJ A;  1TWG A;  3U2M A;  2PF4 E;  4DRJ B;  1MMG A;  3POV A;  3DAG A;  1D1B A;  1Z3I X;  1D1A A;  3DXJ F;  4IAQ A;  3NYM A;  4M63 A;  1I4Y A;  1LS4 A;  256B A;  1R4T A;  1LS1 A;  2LD6 A;  3QW0 A;  4I44 A;  4ONS A;  4XPX A;  1Z63 A;  4ULV A;  4YT5 A;  3WAQ A;  1Q0G A;  1YAU O;  1M6T A;  3GAN A;  3K66 A;  1Q0K A;  3KH2 A;  5E3A A;  2VCB A;  3AG4 C;  1LE4 A;  1OR3 A;  5A69 A;  4PJL A;  2KQ9 A;  2LFD A;  3ZTM A;  4BEM J;  1AUE A;  4DJ9 A;  3BEH A;  4GQH A;  1ZW2 A;  3WHN A;  4PK4 A;  1HMD A;  3EGX A;  3MYF A;  3U9M A;  3UMK A;  1NG1 A;  2EPO A;  1JRA A;  4LAC B;  3W8I A;  1YYX A; 
#chains in the Genus database with same CATH homology
 4J32 B;  2R7O A;  4U5H A;  5B1A C;  4YT8 A;  2HV6 A;  3NKE A;  2O9X A;  4PFP A;  2Y3H A;  1FFH A;  4B6I A;  3LS1 A;  4C3E A;  1IW7 F;  4ANJ A;  4U5C E;  2FGY A;  3NRH A;  3CQZ A;  4O6N A;  2W4M A;  2P7V A;  2C03 A;  1Z6A A;  2Y69 C;  4HE8 D;  4HFK B;  4G7O F;  3EG9 A;  3RFY A;  1TR2 A;  5KYW B;  1IZM A;  1TWA A;  2XSE A;  4AE4 B;  3UMI A;  2P6V A;  2Q9A A;  3AQC A;  1BR2 A;  4CS8 A;  3NG1 A;  3IEE A;  2EIM C;  1D1C A;  5FCL A;  4BJ6 A;  2OG2 A;  1V54 C;  2H7B A;  1MMA A;  3S27 A;  1PCX A;  4OD5 A;  2R7S A;  2YHS A;  2IXM A;  2QTV A;  5L3V A;  3JRT A;  4CSA C;  4F4B A;  1VYI A;  1OCC C;  4W8K A;  3DD7 A;  1ZHT A;  3QMK A;  3FVY A;  2QY9 A;  4QI2 A;  2Q9C A;  3Q7G A;  3H65 A;  4BG0 A;  1W2W A;  4BEJ A;  2R7T A;  2L81 A;  3LEV A;  1M2O A;  1LKX A;  1MMD A;  2R7W A;  2FFH A;  1FFT C;  2H7O A;  2W45 A;  2KJG A;  3ZVR A;  3DJN B;  1NU7 D;  4C7O B;  2J45 A;  4H4K C;  4O7G A;  5DS5 A;  3HTK C;  3E70 C;  5DLJ A;  4IJJ A;  2NUT A;  3ASO C;  1LVK A;  3ABL C;  3JSZ A;  2MYS A;  4CIH A;  4J30 B;  3N0T A;  1VOM A;  4QDL A;  3S29 A;  5B3S C;  2Q3T A;  2XL4 A;  1PD0 A;  4NY3 A;  4Q7C A;  4QI0 A;  4OD4 A;  1Z23 A;  1VYK A;  2XRH A;  4YJW A;  3X1O A;  3T6J A;  4BJ1 A;  4U5B E;  3Q6M A;  3ASN C;  3EFO B;  5EHH A;  3SEO A;  4KI2 A;  2ZXO A;  1RJ9 A;  1ZYR F;  2GFH A;  4E7S A;  4CS9 A;  3LES A;  3DMD A;  5T3W A;  2NG1 A;  2WL8 A;  2WZL A;  4K7B A;  4DVY P;  2NUP B;  3ABK C;  2CW0 F;  4BJ5 A;  3JYH A;  4RD9 A;  3NDB B;  3UNG C;  4CS8 C;  2DYR C;  4A2N B;  2CGE A;  1Z5Z A;  5CI9 A;  1MNE A;  2KW3 C;  1M2V A;  3EGD B;  4C3B A;  5KYU B;  3UGP A;  4CS7 A;  4BJ6 C;  1MMN A;  1PD1 A;  3WG7 C;  3KL4 A;  4XTK A;  2V3C C;  1OCZ C;  3ZG1 A;  3QZC A;  5DQT A;  5KYY A;  4I1M A;  5E33 A;  5KYX A;  2Y3B A;  3T6B A;  2XXA B;  1J8M F;  4Q5S F;  5L3Q A;  2CNW D;  3OEO A;  3EZI A;  3UR3 C;  4YT2 A;  1ST6 A;  3K1I C;  3MLG A;  2A6E F;  4KNW A;  3RKO F;  2IYL D;  5EGY A;  2G62 A;  4FWV A;  4AX2 A;  2YZS A;  2WVO A;  4IWB A;  3OA1 A;  4RDA A;  2V26 A;  4BJT A;  5F5F A;  3B0V C;  3LNR A;  4HFF B;  3ZIB A;  3DM9 B;  3MX3 A;  4CBE A;  2IXN A;  3EGX B;  4RBN A;  2Z15 A;  5DS4 A;  1FMW A;  3T4R A;  1D0Z A;  2PP4 A;  5HSW A;  2X51 A;  3ZC4 A;  3WOD F;  2CNW A;  3CSK A;  3VAY A;  3S28 A;  3GOD A;  3CZ6 A;  3NYJ A;  3SP1 A;  3Q6N A;  3EH1 A;  4XLP F;  1ZHY A;  4OIQ F;  3ECS A;  3EZH A;  3PHF 2;  1TWH A;  5DQZ A;  1VMA A;  2YEV A;  3HJC A;  4LLE A;  3FHD A;  2WZG A;  3AG2 C;  2Y3D A;  3EG9 B;  3NKD A;  4P6I C;  2Q9B A;  1SZI A;  2H7V C;  4X0R A;  3B9Q A;  1FMV A;  3NYL A;  4FX5 A;  3RH3 A;  1D0Y A;  2J9W A;  2DGJ A;  2PX0 A;  3O6X A;  4ZLC A;  5BUO A;  2W9Y A;  2PFD A;  1M56 C;  1M57 C;  3AQB A;  1O5H A;  5B1B C;  4BJ5 C;  3AG1 C;  3S0X A;  2WZF A;  3N24 A;  4LER A;  3JT1 A;  3KMI A;  1NU9 C;  2A69 F;  3B0P A;  1OKK D;  4U5G A;  4CSA A;  4XWJ A;  2WB7 A;  2KGO A;  3TD7 A;  4KC9 A;  4U5F E;  3DJU B;  3ZSU A;  4G7H F;  1WGW A;  1VK5 A;  4MQ9 F;  1O87 A;  2WVQ A;  5KYN A;  1QLE C;  2OCC C;  4GYT A;  2EIL C;  4O6M A;  3DAF A;  2KNH A;  5KYW A;  5E2Q A;  3E9V A;  3F47 A;  2M4E A;  4AE4 A;  3EJN A;  3I5Q A;  3N2Z B;  4JUR I;  2PX3 A;  5F5H A;  4JJG A;  1OKK A;  1OCO C;  2NUT B;  2R7R A;  2W4B A;  1BR1 A;  5D91 A;  3LS0 A;  3ITF A;  4C3D A;  3AG3 C;  5CI8 A;  2IXP A;  4G0H A;  3V7O A;  2Y39 A;  4HEA J;  3VYW A;  3L34 A;  2HV7 A;  2E87 A;  4JVS A;  3FDQ A;  4JW1 A;  1ZHZ A;  3RIP A;  2J0W A;  4Q4Z F;  2I8B A;  2A1D D;  2VB6 A;  1SMY F;  4MND A;  3SNH A;  1OCR C;  1RJ9 B;  2DYS C;  2ZXR A;  4FES A;  4I1O B;  3LLI A;  1J8Y F;  4JCH A;  2EIN C;  3SYN A;  2VAS A;  4WJ0 A;  5T3T A;  1SF8 A;  2D5R B;  2A68 F;  3K33 A;  3FAJ A;  2VH3 A;  4IAO A;  4ULW A;  2ZPA A;  2Y3G A;  1G8X A;  1V55 C;  3I4U A;  4N06 A;  4C7O A;  2JD3 A;  2R7U A;  4I3M A;  2J0X A;  2L9J A;  1M2V B;  2J9U A;  2C04 A;  1TWC A;  3W8H A;  4YN0 B;  3SZR A;  1TKN A;  1BR4 A;  4O6Y A;  2J46 A;  1JPN A;  5T1D B;  4G7Z F;  4DVZ A;  5DVW A;  3OWT A;  2BE5 F;  3DZA A;  3HLZ A;  3EH2 A;  3O39 A;  3B0U X;  2ZXP A;  5KYY B;  4DOZ A;  4PJJ A;  1ZHW A;  2J7P D;  5KYX B;  4PJN A;  3LJB A;  3EFO A;  2WVN A;  2EIK C;  3Q7L A;  3LLK A;  3PMR A;  4PJM A;  3JCU Q;  4U5E E;  1ZU5 A;  4CS9 C;  2G3K A;  4U5D E;  1ZU4 A;  3W2W A;  4EBB A;  5D92 A;  3W2V A;  4DBR A;  3UMH A;  4EWC A;  3K6B A;  2EIJ C;  2R7X A;  3ABM C;  3L0I A;  3DM5 A;  2NUP A;  4OIN F;  4O79 A;  4KBL A;  3F46 A;  4XLN F;  1NZE A;  1N1C A;  4LLC A;  3KKB A;  4YWQ A;  2LSE A;  2R7Q A;  5IY5 C;  2J7P A;  5DS6 A;  2G3V A;  4IRU A;  3M1C B;  4K0D A;  3EGD A;  4JZA A;  3RYL A;  4KNV A;  1D0X A;  5KYU A;  3K1H A;  4DBQ A;  4YT4 A;  2CDQ A;  3EHM A;  3EQL F;  2IOQ A;  1FTS A;  2IXO A;  4JJF A;  4E7Z A;  2B0J A;  1ZHX A;  2MWQ A;  3LAY A;  1S7Z A;  1QZX A;  3EPV A;  4OIR F;  3K7D A;  2J9V A;  3UGO A;  2A6H F;  3EHN A;  4GEH A;  4OIO F;  2XXA A;  4PFO A;  2R7V A;  4ZLD A;  3X2Q C;  1MND A;  3I5P A;  1KU2 A;  2ZXW C;  4OIP F;  5E3C A;  1JPJ A;  1TWG A;  2PF4 E;  1MMG A;  3POV A;  3DAG A;  1D1B A;  1Z3I X;  1D1A A;  3DXJ F;  3NYM A;  4M63 A;  1LS1 A;  4I44 A;  1Z63 A;  4YT5 A;  3GAN A;  3K66 A;  3KH2 A;  5E3A A;  3AG4 C;  4PJL A;  2KQ9 A;  4PK4 A;  3EGX A;  3UMK A;  1NG1 A;  4AK9 A;  4LAC B;  3W8I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...