4DVZA

Crystal structure of the helicobacter pylori caga oncoprotein
Total Genus 173
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
173
sequence length
522
structure length
459
Chain Sequence
LMGSHNGKVSLLYAGDKHDWNATVGYKDNVATLINVHMKNGSGLVIAGGEKGINNPSFYLYKEDQLTGSQRALSQEEIRNKVDFMEFLAQNNTKLDNLSEKEKEKFQNEIEDFQKDSKAYLDALGNDRIAFVSKKDTKHSALITEFNNGDLSYTLKDYEKNVTLQGSLKHDGVMFVDYSFNKVAVFNLPDLNNLAITSFVRRNLENKLTAKGLSLQEANKLIKDFLSSNKELAGKALNFNKAVAEAKSTGNYDEVKKAQKDLEKSLRKREHLEKEVEKKLESKSGNKKAQANSQKDEIFALINKEANRDARAIAYTQNLKGIKRELSDKLEKISKDLKDFSKSFDEFKNFSKAEETLKALKGSVKDLGINPEWISKVENLNAALNEFKNGDFSKVTQAKSDLENSVKDVIINQKVTDKVDNLNQAVSVAKAMGDFSRVEQVLADLKNFSKEQLAQQAQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tertiary structure-function analysis reveals the pathogenic signaling potentiation mechanism of Helicobacter pylori oncogenic effector CagA
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Oncoprotein
molecule keywords Cytotoxicity-associated immunodominant antigen
total genus 173
structure length 459
sequence length 522
ec nomenclature
pdb deposition date 2012-02-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1270 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4dvzA02
4G0HA 4DVYP 4DVZA
chains in the Genus database with same CATH superfamily
4QI0A 2ZXOA 3B71A 4JCZA 1HY5A 2EPLX 1MMDA 3L0IA 2KJGA 1BBHA 1OKKD 1VK5A 2H7BA 4JTCB 1LI7A 3N2ZB 4WABA 5KYYB 5A69A 4DBRA 4YT8A 1R4TA 2A69F 3POVA 1TFOB 2XXAA 3QTHA 5L0HA 2LP4A 4WGYA 5BQHA 3H65A 2HMQA 3TOLA 3DAFA 3LESA 3U9MA 4JVSA 5CIVA 4JEAA 3HNJA 3I5QA 4CS8C 1H9TA 1XWJA 3AOUA 4L6RA 5L0IA 1G4WR 3LJBA 2R9RB 4JTDB 3S29A 4N4WA 4W8KA 1UFBA 3O10A 4DOZA 3RVZA 3ZQYA 4I44A 4MVRA 2DI3A 1YVIA 1T6IA 1HE1A 3KH2A 4YL0A 1N1CA 4I1MA 4U9DA 3QW0A 1NFOA 4XTKA 3GEIA 3K7DA 5L0DA 4G7HF 3NRHA 5L3QA 1CGME 1V55C 1H9GA 2OEVA 2ICWG 1D1BA 3MYIA 1JPJA 5A6BA 3A9CA 2BE5F 2LFFA 1A41A 2GWWA 2P61A 5BUOA 1OR2A 3UR3C 2IXMA 2L7AA 3NG1A 5BQIA 2HZ8A 1T6UA 2TMVP 2R7UA 1RCPA 2LD6A 1OW7A 1E86A 3W8HA 2QE9A 1ORSC 2WVOA 1ZHYA 2DYSC 4CJGA 1JRAA 4DVZA 2Y3BA 3W8IA 4EWCA 4OIPF 2CNWD 3FHDA 3LS0A 1EA8A 3FOPA 3S9OA 5B3SC 3M1CB 2EPOA 1MNEA 1Q0KA 1M2VA 4FX5A 2Q9AA 3V5XA 4Q5SF 1JR8A 2VCAA 3C62A 3EFOA 3AGTA 3FMSA 1ZVZA 3U8VA 1BDJB 2HSBA 3IEEA 4D4XA 2R25A 2B0JA 5B1AC 5JVEA 1Z6AA 4K0DA 5FCLA 4JIOA 2GA0A 4U5GA 1Q0MA 3LLKA 2L81A 4ULVA 3BEHA 4C3DA 4CS9C 2R7TA 1L7CA 4RBNA 1VOMA 1E83A 5A6BD 2R03A 3A11A 2XLHA 3FVYA 1FNTc 5CI9A 1FR0A 2Y39A 4F4BA 4IARA 2JPUA 4JEBA 3EH1A 3HJCA 2VB6A 2HSQA 4YT5A 1KTMA 2G3VA 2UUHA 1RKCA 3EPVA 3U5SA 3EJNA 4PJMA 1EQ1A 1LIHA 2IXOA 2ZD9A 3DM5A 2P1AA 3WG7C 3LUTB 3UNGC 1C03A 5A6AA 3MBGA 3ZDLA 3KYIA 4G78A 5L0GA 4Z9IA 3Q6MA 2BC5A 2W4BA 3AG3C 4IB4A 2FFHA 1VMAA 3JSZA 2KC3A 4MVSA 2A0BA 4MVOA 2J45A 2ETSA 3GM1A 2A1DD 4ZLDA 3ZQVA 2RD9A 5DVWA 3T6GB 3PCVA 2HUJA 3K1IA 4PFOA 3PMRA 2LSEA 3EH2A 3PHF2 2HV7A 1YDIA 2VASA 2Z15A 2UUIA 3HLZA 4YK5A 3RIPA 1G5ZA 1NZEA 4BJ6C 4C7OA 3DJNB 3VM6A 1CGOA 3I4UA 4CS9A 3R2PA 4NC3A 4DRHB 2L6FA 256BA 4PJLA 1QSPA 1E2XA 3EGDA 3TQOA 1ZHTA 3JTLO 3MFNA 4MVZA 1ZZPA 5T1DB 4XEVA 4EIYA 5E33A 3C8GB 2OQMA 3OEOA 4M63A 3UGPA 2F22A 1TKNA 1WASA 1I5NA 2KQ9A 4XLPF 4PFPA 2Q7RA 1FTSA 2W4MA 4NCQA 3NYLA 4JKVA 5HV9A 2CYDA 2EIJC 3AG2C 3LNMB 3M79A 5KYUB 2H7OA 1Q0DA 1BR1A 3G50A 3MLGA 4JE9A 4BJ5C 1F1MA 2J9VA 1T01A 5F28E 1SZIA 4FAPB 3NMKA 3DWWA 5AC4A 2NSGA 1M2OA 1JOGA 3KL4A 1VLSA 3K66A 5AC5A 3AG1C 4J7YA 3OA1A 4HE8D 2J46A 3X1OA 4MVMA 3SZRA 3ZIBA 1J8MF 2J9BA 4BJTA 1WOLA 1Y6DA 3AQBA 1APCA 4B6IA 3K6BA 4QI2A 3EG9A 2J0XA 4GYTA 3RYLA 4O6YA 4N6CA 1RKEA 2A6HF 2AWYA 2KGOA 1RJ9A 4OIRF 4YJWA 2P0NA 3VAYA 2YL0A 1ZW2A 3DI5A 1Z23A 4D4NA 4E7SA 3L8JA 3NMJA 3ZTZA 5JUAA 3T6BA 1HW2A 1B68A 1VLTA 3WODF 1OXBA 3UGOA 3G4ZA 4EKWA 5KYXB 2Y3HA 3IQTA 2Q3TA 2YWAA 4G7OF 4JJFA 1TWCA 3KPHA 2IYLD 1OR3A 2XLVA 2XM4A 4LDRA 4JZAA 4EBJA 3ZSUA 1H6GA 4C3BA 1O3UA 5DS4A 2R7VA 1LS4A 2KW3C 2XM0A 2ZXPA 4U5CE 2I8BA 1QZXA 3N24A 4XEFA 4XPYA 3JYYA 2W9YA 4BPMA 3EGXA 4W8PA 2EINC 3PDMP 4CBEA 1TQGA 4J30B 1YAUO 4MS2A 4ER9A 1OKKA 2YLGA 4IJJA 5DQTA 1C17M 1EKYA 5DQZA 2YVKA 2J8WA 1FFTC 3X2QC 1GQAA 1D0ZA 2IM8A 4BJ1A 2R7RA 1LI5A 2AWCA 2J7PA 3EFOB 3RKOF 4AL1A 2XXAB 2XLWA 4PK4A 1ZW3A 3SXKA 3S0XA 2I15A 4OD5A 3F47A 3HNKA 4C3EA 3FOOA 3JZ0A 3QVZA 3SP1A 3SYNA 4CX9A 2A0UA 3K1IC 5GPGB 2EIMC 3RW0A 2R02A 3US6A 2YRFA 2J9UA 3ABLC 4U5BE 4YL3A 5EHHA 2AVKA 4BG0A 1HE9A 2ZXWC 3GORA 3MYFA 1KU2A 4CDVA 1NFNA 3TK0A 2YHSA 3ABMC 2R05A 1XZQA 2X0CA 4JRZA 1T5OA 1WN0A 2H7VC 4BJ6A 2FGYA 4BJ5A 3N0TA 2OKUA 2JD3A 3IQ6A 4HFKB 4JCHA 1AUEA 1QQ3A 1ZYRF 2E87A 3GEHA 3EHNA 4X0RA 1LM3B 4IWBA 3TJ6A 4KI2A 3JSEO 3DKAA 1RMVA 2OJED 3V5YA 3QW1A 5TJ5E 1DOWA 3NKEA 4IGGA 2C03A 3H2VA 1BZ4A 2L6HA 2LCHA 3FXHA 3Q7LA 4OD4A 4HEAJ 1GS9A 3QVYA 4EBKA 1M2VB 4IAOA 4DBQA 1WATA 4E7ZA 2ZPAA 3DXJF 5COFA 4N6HA 1T9KA 4J32B 2QTVA 3EZIA 1T6QA 1YA9A 2EIKC 3GM3A 3U0CA 1C02A 1H7IA 2EPNA 4GQHA 4XQ1A 3U2LA 1V74B 2NUPB 3QMKA 3HKKA 1YJGA 2R7XA 1OW6A 3BRJA 4AE4B 5L0CA 1NU9C 2ZXRA 1OCCC 4Q7CA 4PJJA 3GANA 1UG7A 3HTKC 1FAPB 3LS1A 1CPQA 5DLJA 3VRCA 4UDVA 4IRUA 3B0PA 3RQGA 1HMDA 1NG1A 4JJGA 4RDAA 3TOMA 5L0FA 3TULA 4AL0A 3U9JA 2PX0A 1RJ9B 4YT4A 1GM5A 1HMOA 2O9XA 3IQ5A 4DJ9A 3W2WA 5B3IA 4YL1A 5B1BC 1OXKA 1K05A 3IHUA 2CCYA 2C04A 1XZPA 4I3MA 1SMYF 3U3FA 1ZHWA 1JMWA 3V7OA 3VF0A 4DVYP 5DS6A 4HFFB 4E0HA 1LS1A 3GWNA 4DRIB 3QZCA 5COMA 1YYXA 5CI8A 4PACA 2M4EA 2HJMA 1I4ZA 3JRMO 4DXWA 4XPWA 2A6EF 1HW1A 1AVOB 2GFHA 5DS5A 3O55A 1G4US 4ONSA 1E84A 1MMNA 3S84A 2QUPA 1YA7O 1PV3A 2HFIA 2GAQA 1TWHA 2YL1A 4EBBA 1G8XA 5JS5A 4JURI 4MW8A 2LIGA 2CW0F 3OWTA 3V5ZA 4JC7A 2LQGA 2NUTA 4KNVA 5JP7A 4CIPA 3KYJA 3UMKA 3SXMA 4Q4ZF 2XL8A 5E2QA 4O7GA 4C7OB 4MTGA 2IOQA 2V26A 1YZAA 1M56C 1RKEB 2WB7A 2KNHA 3E70C 1WGWA 2DGJA 2AP3A 4R32A 2G3KA 5IY5C 2KYHA 2MWQA 2PX3A 2XLEA 3H2UA 4XPXA 3ZVRA 2JX0A 4KBLA 1OCRC 1MMGA 4MVUA 3F46A 4ANJA 4LLCA 5E3AA 2NUPA 3CZ6A 3DD7A 2ASRA 3HNLA 1K40A 1WWPA 3CEXA 4CSAC 3O39A 1E85A 3NYJA 1VYIA 2KK1A 2PP4A 1R5ID 2Q9CA 2XSEA 2YQYA 2YEVA 3G4XA 3JYHA 3ZG1A 5JT4A 3SNHA 5FZTA 1MNDA 4RD9A 1FMWA 2DB4A 3RFYA 2CNWA 3GM2A 3M4CA 3W2VA 2YL3A 1IW7F 2XS1A 1M6TA 3U2MA 2MHRA 2XLDA 3C8ZA 2HKVA 3RF3A 3IQCA 3L1MA 1W2WA 1JAFA 3UMHA 5A6KA 4LDKA 3T9OA 2J0WA 4LDQA 4PR9A 1NU7D 3C8GA 1A7VA 3AJMA 1SF8A 4MNDA 1YLMA 1ORYA 3FAJA 2X51A 2EPKX 2P7VA 3Q6NA 4KNWA 3LLIA 4Z9JA 3C63A 2KSFA 1Z63A 2W45A 2J9WA 3EGDB 2XS8A 3KKBA 3WHNA 4I1OB 1Q0GA 1OW8A 3DMDA 3KMIA 5KYNA 1D1CA 3E9VA 3S90A 2Q9BA 5KYWB 1M57C 2GDCA 2LK4A 4CS7A 2NPUA 2WZLA 4ULWA 1VTMP 2PF4E 1VYKA 5F5FA 1PCXA 3AG4C 1D1AA 4LLEA 1TWAA 1OCOC 4O79A 3FDQA 3SXZA 1MMAA 5KYWA 1QPUA 2NUTB 4FWVA 4NQFA 3U3BA 4CSAA 2IBFA 3CSKA 1FFHA 1QVXA 3EHMA 3GWLA 3C8GD 3MX3A 3W4YA 3GEEA 4U5EE 1S7ZA 1QLEC 4XWJA 5T3WA 4N06A 3CAXA 2H8AA 2YZSA 4MW3A 1ST6A 3RQEA 1ZU5A 2PNOA 2Y3GA 3ECSA 1LE2A 2CDQA 4H4KC 1QKRA 2Q4FA 5T3TA 1YARO 3L34A 1SR2A 1D0YA 2DYRC 2QNLA 2XRHA 4J7TA 1PD0A 3U8PA 3I5PA 4CDYA 3WAQA 2OOCA 1V54C 3C18A 1LE4A 1Z3IX 3HNIA 3RQFA 4YWQA 4CIHA 2VC9A 3ASOC 3EZHA 4K1OA 2HS5A 2XLOA 3RVYA 2VH3A 2R7SA 3K33A 1YZCA 2PFDA 3NKDA 3ASNC 5HSWA 2EILC 1U89A 1WTYA 3DE9A 1ZHZA 2B0HA 4H54A 2Q00A 3ZC4A 4BEJA 1TWGA 3B0VC 3JCUQ 4E18A 1LKXA 1ZHXA 5JRAA 4EHPA 1DOVA 5K0IA 2QY9A 1JPNA 3B0UX 1AEPA 2P6VA 2YLDA 4JW1A 2RSEB 2HV6A 2XL6A 4XLNF 1U0BB 1S05A 2MYSA 3FAPB 4AK9A 3DM9B 1CGNA 2G62A 3EGXB 4MVQA 4PJNA 2OJQA 3GODA 2IXPA 3DJUB 2XLMA 5EK0A 5L3VA 2WL8A 4NY3A 2L9JA 1EI7A 4IAQA 2WZFA 1ORJA 3VYWA 2LFDA 4CDAA 4YN0B 2YL7A 4MTOA 3LEOA 2HMZA 1NSGB 3LAYA 2AU5A 4DRJB 1V4AA 5BQGA 5E3CA 1RXQA 4WGZA 4AX2A 1OQCA 2EPMX 5KYUA 1MQVA 3RH3A 4A4AA 2FAPB 2M64A 2WVNA 3ITFA 1K04A 2QLAA 5JSLA 1BR4A 1O87A 1TR2A 1CPRA 1LVKA 4K7BA 4NTFA 4NTBA 4O6NA 3ABKC 4P6IC 3S27A 3SEOA 3UMIA 2WZGA 3ZTMA 5L0JA 2YLIA 3B29A 2OEXA 2YKZA 1PD1A 3B9QA 3J06A 5KYYA 1TFKB 2Y3DA 1U6HA 4A2NB 2BL2A 1NLXA 4JTAB 2R7OA 4O6MA 1FMVA 1I4YA 4G0HA 4FESA 3JRTA 2R7WA 3L8IA 4LACB 4U5DE 2A68F 2OG2A 2PBEA 2D5RB 4MQ9F 4U9EA 4OINF 1NBBA 1O5HA 4KC9A 4EUKB 3TD7A 2CGEA 5AGFA 3JT1A 1L3PA 4MTFA 3NDBB 2R7QA 1Z5ZA 2WVQA 3NYMA 2VCBA 2Y69C 4OIQF 4LERA 1Y4CA 4GEHA 1BR2A 1VB5A 3T4RA 5JLIA 3EQLF 3EG9B 2XL4A 3K1HA 4G7ZF 1LPEA 3AQCA 3DAGA 4AE4A 1A7DA 4CJOA 3ZWIA 1D0XA 3O6XA 5COGA 3NMIA 3C7JA 3LNRA 4OIOF 5EGYA 2D4UA 2V3CC 1OCZC 2IXNA 1Z7Qc 1IZMA 2NSFA 3R7CA 3ATPA 1J8YF 3DZAA 4P9TA 2VCCA 3Q7GA 1A0BA 1KNYA 4P9FA 4XEKA 4WJ0A 4Z9HA 2HJ3A 5F5HA 4CS8A 5KYXA 5D91A 1A7EA 3DE8A 5A6JA 3AGUA 3SXYA 3CQZA 1GGQA 2OCCC 2L6GA 1Q0FA 2NG1A 1ZU4A 1YYJA 1SYQA 4BEMJ 3TJ5A 4U5HA 3S28A 3LEVA 3M4BA 4QDLA 3IPMO 4NTAA 5D92A 3T6JA 3M15A 4E17A 4ZLCA 4U5FE 2J7PD 4YT2A 4E0IA 2OU6A
chains in the Genus database with same CATH topology
4QI0A 2ZXOA 3L0IA 1MMDA 2KJGA 1OKKD 1VK5A 2H7BA 3N2ZB 5KYYB 4DBRA 4YT8A 2A69F 3POVA 2XXAA 3H65A 3DAFA 3LESA 4JVSA 3I5QA 4CS8C 3S29A 3LJBA 4W8KA 4DOZA 4I44A 3KH2A 1N1CA 4I1MA 4XTKA 3K7DA 4G7HF 3NRHA 5L3QA 1V55C 1D1BA 1JPJA 2BE5F 5BUOA 3UR3C 2IXMA 3NG1A 2R7UA 3W8HA 2WVOA 1ZHYA 2DYSC 2Y3BA 3W8IA 4EWCA 4OIPF 2CNWD 3FHDA 3LS0A 5B3SC 3M1CB 1MNEA 1M2VA 4FX5A 2Q9AA 4Q5SF 3EFOA 3IEEA 2B0JA 5B1AC 1Z6AA 4K0DA 5FCLA 4U5GA 3LLKA 2L81A 4C3DA 4CS9C 2R7TA 4RBNA 1VOMA 3FVYA 5CI9A 2Y39A 4F4BA 3EH1A 3HJCA 2VB6A 4YT5A 2G3VA 3EPVA 3EJNA 4PJMA 2IXOA 3DM5A 3WG7C 3UNGC 3Q6MA 2W4BA 3AG3C 2FFHA 1VMAA 3JSZA 2J45A 2A1DD 4ZLDA 5DVWA 4PFOA 3PMRA 2LSEA 3EH2A 3PHF2 2HV7A 2VASA 2Z15A 3HLZA 3RIPA 1NZEA 4BJ6C 4C7OA 3DJNB 3I4UA 4CS9A 4PJLA 3EGDA 1ZHTA 5T1DB 5E33A 3UGPA 3OEOA 4M63A 1TKNA 4XLPF 2KQ9A 4PFPA 1FTSA 2W4MA 3NYLA 3AG2C 2EIJC 5KYUB 2H7OA 3MLGA 1BR1A 4BJ5C 2J9VA 1SZIA 2XXAB 1M2OA 3KL4A 3K66A 3AG1C 3OA1A 4HE8D 2J46A 3SZRA 3ZIBA 4BJTA 1J8MF 3AQBA 4B6IA 4QI2A 3K6BA 3EG9A 2J0XA 4GYTA 3RYLA 4O6YA 2A6HF 2KGOA 1RJ9A 4OIRF 4YJWA 3VAYA 1Z23A 4E7SA 3T6BA 3WODF 3UGOA 5KYXB 2Y3HA 2Q3TA 4G7OF 4JJFA 1TWCA 2IYLD 4JZAA 3ZSUA 4C3BA 5DS4A 2KW3C 2ZXPA 4U5CE 2I8BA 1QZXA 3N24A 2W9YA 3EGXA 2EINC 4CBEA 4J30B 1OKKA 4IJJA 5DQTA 5DQZA 1FFTC 3X2QC 1D0ZA 2R7RA 4BJ1A 2J7PA 3EFOB 3RKOF 4PK4A 3S0XA 4OD5A 3F47A 4C3EA 3SP1A 3SYNA 3K1IC 2EIMC 2J9UA 3ABLC 4U5BE 5EHHA 4BG0A 2ZXWC 1KU2A 2YHSA 3ABMC 4BJ6A 2H7VC 4BJ5A 2FGYA 5HSWA 3N0TA 4HFKB 2JD3A 4JCHA 2E87A 1ZYRF 3EHNA 4X0RA 4IWBA 4KI2A 3NKEA 2C03A 3Q7LA 4OD4A 4HEAJ 1M2VB 4IAOA 4DBQA 4E7ZA 2ZPAA 3DXJF 4J32B 2QTVA 3EZIA 2EIKC 2NUPB 3QMKA 2R7XA 4AE4B 1NU9C 2ZXRA 1OCCC 4Q7CA 4PJJA 3GANA 3HTKC 3LS1A 5DLJA 4IRUA 3B0PA 4RDAA 1NG1A 4JJGA 2PX0A 1RJ9B 4YT4A 2O9XA 3W2WA 5B1BC 2C04A 4I3MA 1SMYF 3V7OA 1ZHWA 4DVYP 5DS6A 4HFFB 1LS1A 3QZCA 5CI8A 2M4EA 2A6EF 5DS5A 2GFHA 1MMNA 1TWHA 4EBBA 1G8XA 4JURI 3OWTA 2CW0F 2NUTA 4KNVA 3UMKA 4Q4ZF 5E2QA 4C7OB 4O7GA 2IOQA 2V26A 1M56C 2WB7A 3E70C 2KNHA 1WGWA 2DGJA 2G3KA 5IY5C 2MWQA 2PX3A 3ZVRA 4KBLA 1OCRC 1MMGA 4ANJA 3F46A 4LLCA 5E3AA 2NUPA 3CZ6A 3DD7A 4CSAC 3O39A 3NYJA 1VYIA 2PP4A 2Q9CA 2XSEA 2YEVA 3JYHA 3ZG1A 3SNHA 1MNDA 4RD9A 1FMWA 3RFYA 2CNWA 3W2VA 1IW7F 3UMHA 1W2WA 2J0WA 1NU7D 1SF8A 4MNDA 3FAJA 2X51A 2P7VA 3Q6NA 4KNWA 3LLIA 1Z63A 2W45A 2J9WA 3EGDB 3KKBA 4I1OB 3B0VC 3DMDA 5KYNA 3KMIA 1D1CA 3E9VA 2Q9BA 1M57C 4CS7A 4ULWA 2WZLA 2PF4E 1VYKA 5F5FA 1PCXA 3AG4C 1D1AA 4LLEA 1TWAA 1OCOC 4O79A 3FDQA 1MMAA 5KYWA 4FWVA 2NUTB 4CSAA 3CSKA 1FFHA 3EHMA 3MX3A 4U5EE 1S7ZA 1QLEC 4XWJA 5T3WA 4N06A 2YZSA 1ST6A 1ZU5A 2Y3GA 3ECSA 2CDQA 4H4KC 5T3TA 2R7VA 3L34A 2DYRC 1D0YA 2XRHA 1PD0A 3I5PA 1V54C 4YWQA 4CIHA 1Z3IX 2R7SA 3ASOC 3EZHA 2VH3A 3K33A 2PFDA 3NKDA 3ASNC 2EILC 1ZHZA 3ZC4A 4BEJA 1TWGA 3JCUQ 1LKXA 1ZHXA 2QY9A 1JPNA 3B0UX 2P6VA 4JW1A 2HV6A 4XLNF 2MYSA 4AK9A 3DM9B 2G62A 3EGXB 4PJNA 3GODA 2IXPA 3DJUB 5L3VA 2WL8A 4NY3A 2L9JA 2WZFA 3VYWA 4YN0B 3LAYA 5E3CA 4AX2A 5KYUA 3RH3A 2WVNA 3ITFA 1TR2A 1O87A 1BR4A 4K7BA 1LVKA 4P6IC 3X1OA 4DVZA 4O6NA 3ABKC 3S27A 3SEOA 3UMIA 2WZGA 1PD1A 3B9QA 5KYYA 2Y3DA 4A2NB 2R7OA 4O6MA 1FMVA 4G0HA 4FESA 3JRTA 2R7WA 4LACB 4U5DE 2A68F 2OG2A 4MQ9F 2D5RB 4OINF 1O5HA 4KC9A 3TD7A 2CGEA 3JT1A 3NDBB 2R7QA 1Z5ZA 2WVQA 3NYMA 4OIQF 2Y69C 4LERA 4GEHA 3T4RA 1BR2A 3EQLF 3EG9B 2XL4A 3K1HA 4G7ZF 3AQCA 3DAGA 4AE4A 1D0XA 3O6XA 3LNRA 4OIOF 5EGYA 2V3CC 1OCZC 2IXNA 1IZMA 3DZAA 1J8YF 5KYWB 3Q7GA 4CS8A 5F5HA 5KYXA 4WJ0A 5D91A 3CQZA 2OCCC 2NG1A 1ZU4A 4U5HA 3S28A 3LEVA 4QDLA 5D92A 4ZLCA 3T6JA 4U5FE 2J7PD 4YT2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G0H A;  4DVY P;  4DVZ A; 
#chains in the Genus database with same CATH topology
 4QI0 A;  2ZXO A;  3B71 A;  4JCZ A;  1HY5 A;  2EPL X;  1MMD A;  3L0I A;  2KJG A;  1BBH A;  1OKK D;  1VK5 A;  2H7B A;  4JTC B;  1LI7 A;  3N2Z B;  4WAB A;  5KYY B;  5A69 A;  4DBR A;  4YT8 A;  1R4T A;  2A69 F;  3POV A;  1TFO B;  2XXA A;  3QTH A;  5L0H A;  2LP4 A;  4WGY A;  5BQH A;  3H65 A;  2HMQ A;  3TOL A;  3DAF A;  3LES A;  3U9M A;  4JVS A;  5CIV A;  4JEA A;  3HNJ A;  3I5Q A;  4CS8 C;  1H9T A;  1XWJ A;  3AOU A;  4L6R A;  5L0I A;  1G4W R;  3LJB A;  2R9R B;  4JTD B;  3S29 A;  4N4W A;  4W8K A;  1UFB A;  3O10 A;  4DOZ A;  3RVZ A;  3ZQY A;  4I44 A;  4MVR A;  2DI3 A;  1YVI A;  1T6I A;  1HE1 A;  3KH2 A;  4YL0 A;  1N1C A;  4I1M A;  4U9D A;  3QW0 A;  1NFO A;  4XTK A;  3GEI A;  3K7D A;  5L0D A;  4G7H F;  3NRH A;  5L3Q A;  1CGM E;  1V55 C;  1H9G A;  2OEV A;  2ICW G;  1D1B A;  3MYI A;  1JPJ A;  5A6B A;  3A9C A;  2BE5 F;  2LFF A;  1A41 A;  2GWW A;  2P61 A;  5BUO A;  1OR2 A;  3UR3 C;  2IXM A;  2L7A A;  3NG1 A;  5BQI A;  2HZ8 A;  1T6U A;  2TMV P;  2R7U A;  1RCP A;  2LD6 A;  1OW7 A;  1E86 A;  3W8H A;  2QE9 A;  1ORS C;  2WVO A;  1ZHY A;  2DYS C;  4CJG A;  1JRA A;  4DVZ A;  2Y3B A;  3W8I A;  4EWC A;  4OIP F;  2CNW D;  3FHD A;  3LS0 A;  1EA8 A;  3FOP A;  3S9O A;  5B3S C;  3M1C B;  2EPO A;  1MNE A;  1Q0K A;  1M2V A;  4FX5 A;  2Q9A A;  3V5X A;  4Q5S F;  1JR8 A;  2VCA A;  3C62 A;  3EFO A;  3AGT A;  3FMS A;  1ZVZ A;  3U8V A;  1BDJ B;  2HSB A;  3IEE A;  4D4X A;  2R25 A;  2B0J A;  5B1A C;  5JVE A;  1Z6A A;  4K0D A;  5FCL A;  4JIO A;  2GA0 A;  4U5G A;  1Q0M A;  3LLK A;  2L81 A;  4ULV A;  3BEH A;  4C3D A;  4CS9 C;  2R7T A;  1L7C A;  4RBN A;  1VOM A;  1E83 A;  5A6B D;  2R03 A;  3A11 A;  2XLH A;  3FVY A;  1FNT c;  5CI9 A;  1FR0 A;  2Y39 A;  4F4B A;  4IAR A;  2JPU A;  4JEB A;  3EH1 A;  3HJC A;  2VB6 A;  2HSQ A;  4YT5 A;  1KTM A;  2G3V A;  2UUH A;  1RKC A;  3EPV A;  3U5S A;  3EJN A;  4PJM A;  1EQ1 A;  1LIH A;  2IXO A;  2ZD9 A;  3DM5 A;  2P1A A;  3WG7 C;  3LUT B;  3UNG C;  1C03 A;  5A6A A;  3MBG A;  3ZDL A;  3KYI A;  4G78 A;  5L0G A;  4Z9I A;  3Q6M A;  2BC5 A;  2W4B A;  3AG3 C;  4IB4 A;  2FFH A;  1VMA A;  3JSZ A;  2KC3 A;  4MVS A;  2A0B A;  4MVO A;  2J45 A;  2ETS A;  3GM1 A;  2A1D D;  4ZLD A;  3ZQV A;  2RD9 A;  5DVW A;  3T6G B;  3PCV A;  2HUJ A;  3K1I A;  4PFO A;  3PMR A;  2LSE A;  3EH2 A;  3PHF 2;  2HV7 A;  1YDI A;  2VAS A;  2Z15 A;  2UUI A;  3HLZ A;  4YK5 A;  3RIP A;  1G5Z A;  1NZE A;  4BJ6 C;  4C7O A;  3DJN B;  3VM6 A;  1CGO A;  3I4U A;  4CS9 A;  3R2P A;  4NC3 A;  4DRH B;  2L6F A;  256B A;  4PJL A;  1QSP A;  1E2X A;  3EGD A;  3TQO A;  1ZHT A;  3JTL O;  3MFN A;  4MVZ A;  1ZZP A;  5T1D B;  4XEV A;  4EIY A;  5E33 A;  3C8G B;  2OQM A;  3OEO A;  4M63 A;  3UGP A;  2F22 A;  1TKN A;  1WAS A;  1I5N A;  2KQ9 A;  4XLP F;  4PFP A;  2Q7R A;  1FTS A;  2W4M A;  4NCQ A;  3NYL A;  4JKV A;  5HV9 A;  2CYD A;  2EIJ C;  3AG2 C;  3LNM B;  3M79 A;  5KYU B;  2H7O A;  1Q0D A;  1BR1 A;  3G50 A;  3MLG A;  4JE9 A;  4BJ5 C;  1F1M A;  2J9V A;  1T01 A;  5F28 E;  1SZI A;  4FAP B;  3NMK A;  3DWW A;  5AC4 A;  2NSG A;  1M2O A;  1JOG A;  3KL4 A;  1VLS A;  3K66 A;  5AC5 A;  3AG1 C;  4J7Y A;  3OA1 A;  4HE8 D;  2J46 A;  3X1O A;  4MVM A;  3SZR A;  3ZIB A;  1J8M F;  2J9B A;  4BJT A;  1WOL A;  1Y6D A;  3AQB A;  1APC A;  4B6I A;  3K6B A;  4QI2 A;  3EG9 A;  2J0X A;  4GYT A;  3RYL A;  4O6Y A;  4N6C A;  1RKE A;  2A6H F;  2AWY A;  2KGO A;  1RJ9 A;  4OIR F;  4YJW A;  2P0N A;  3VAY A;  2YL0 A;  1ZW2 A;  3DI5 A;  1Z23 A;  4D4N A;  4E7S A;  3L8J A;  3NMJ A;  3ZTZ A;  5JUA A;  3T6B A;  1HW2 A;  1B68 A;  1VLT A;  3WOD F;  1OXB A;  3UGO A;  3G4Z A;  4EKW A;  5KYX B;  2Y3H A;  3IQT A;  2Q3T A;  2YWA A;  4G7O F;  4JJF A;  1TWC A;  3KPH A;  2IYL D;  1OR3 A;  2XLV A;  2XM4 A;  4LDR A;  4JZA A;  4EBJ A;  3ZSU A;  1H6G A;  4C3B A;  1O3U A;  5DS4 A;  2R7V A;  1LS4 A;  2KW3 C;  2XM0 A;  2ZXP A;  4U5C E;  2I8B A;  1QZX A;  3N24 A;  4XEF A;  4XPY A;  3JYY A;  2W9Y A;  4BPM A;  3EGX A;  4W8P A;  2EIN C;  3PDM P;  4CBE A;  1TQG A;  4J30 B;  1YAU O;  4MS2 A;  4ER9 A;  1OKK A;  2YLG A;  4IJJ A;  5DQT A;  1C17 M;  1EKY A;  5DQZ A;  2YVK A;  2J8W A;  1FFT C;  3X2Q C;  1GQA A;  1D0Z A;  2IM8 A;  4BJ1 A;  2R7R A;  1LI5 A;  2AWC A;  2J7P A;  3EFO B;  3RKO F;  4AL1 A;  2XXA B;  2XLW A;  4PK4 A;  1ZW3 A;  3SXK A;  3S0X A;  2I15 A;  4OD5 A;  3F47 A;  3HNK A;  4C3E A;  3FOO A;  3JZ0 A;  3QVZ A;  3SP1 A;  3SYN A;  4CX9 A;  2A0U A;  3K1I C;  5GPG B;  2EIM C;  3RW0 A;  2R02 A;  3US6 A;  2YRF A;  2J9U A;  3ABL C;  4U5B E;  4YL3 A;  5EHH A;  2AVK A;  4BG0 A;  1HE9 A;  2ZXW C;  3GOR A;  3MYF A;  1KU2 A;  4CDV A;  1NFN A;  3TK0 A;  2YHS A;  3ABM C;  2R05 A;  1XZQ A;  2X0C A;  4JRZ A;  1T5O A;  1WN0 A;  2H7V C;  4BJ6 A;  2FGY A;  4BJ5 A;  3N0T A;  2OKU A;  2JD3 A;  3IQ6 A;  4HFK B;  4JCH A;  1AUE A;  1QQ3 A;  1ZYR F;  2E87 A;  3GEH A;  3EHN A;  4X0R A;  1LM3 B;  4IWB A;  3TJ6 A;  4KI2 A;  3JSE O;  3DKA A;  1RMV A;  2OJE D;  3V5Y A;  3QW1 A;  5TJ5 E;  1DOW A;  3NKE A;  4IGG A;  2C03 A;  3H2V A;  1BZ4 A;  2L6H A;  2LCH A;  3FXH A;  3Q7L A;  4OD4 A;  4HEA J;  1GS9 A;  3QVY A;  4EBK A;  1M2V B;  4IAO A;  4DBQ A;  1WAT A;  4E7Z A;  2ZPA A;  3DXJ F;  5COF A;  4N6H A;  1T9K A;  4J32 B;  2QTV A;  3EZI A;  1T6Q A;  1YA9 A;  2EIK C;  3GM3 A;  3U0C A;  1C02 A;  1H7I A;  2EPN A;  4GQH A;  4XQ1 A;  3U2L A;  1V74 B;  2NUP B;  3QMK A;  3HKK A;  1YJG A;  2R7X A;  1OW6 A;  3BRJ A;  4AE4 B;  5L0C A;  1NU9 C;  2ZXR A;  1OCC C;  4Q7C A;  4PJJ A;  3GAN A;  1UG7 A;  3HTK C;  1FAP B;  3LS1 A;  1CPQ A;  5DLJ A;  3VRC A;  4UDV A;  4IRU A;  3B0P A;  3RQG A;  1HMD A;  1NG1 A;  4JJG A;  4RDA A;  3TOM A;  5L0F A;  3TUL A;  4AL0 A;  3U9J A;  2PX0 A;  1RJ9 B;  4YT4 A;  1GM5 A;  1HMO A;  2O9X A;  3IQ5 A;  4DJ9 A;  3W2W A;  5B3I A;  4YL1 A;  5B1B C;  1OXK A;  1K05 A;  3IHU A;  2CCY A;  2C04 A;  1XZP A;  4I3M A;  1SMY F;  3U3F A;  1ZHW A;  1JMW A;  3V7O A;  3VF0 A;  4DVY P;  5DS6 A;  4HFF B;  4E0H A;  1LS1 A;  3GWN A;  4DRI B;  3QZC A;  5COM A;  1YYX A;  5CI8 A;  4PAC A;  2M4E A;  2HJM A;  1I4Z A;  3JRM O;  4DXW A;  4XPW A;  2A6E F;  1HW1 A;  1AVO B;  2GFH A;  5DS5 A;  3O55 A;  1G4U S;  4ONS A;  1E84 A;  1MMN A;  3S84 A;  2QUP A;  1YA7 O;  1PV3 A;  2HFI A;  2GAQ A;  1TWH A;  2YL1 A;  4EBB A;  1G8X A;  5JS5 A;  4JUR I;  4MW8 A;  2LIG A;  2CW0 F;  3OWT A;  3V5Z A;  4JC7 A;  2LQG A;  2NUT A;  4KNV A;  5JP7 A;  4CIP A;  3KYJ A;  3UMK A;  3SXM A;  4Q4Z F;  2XL8 A;  5E2Q A;  4O7G A;  4C7O B;  4MTG A;  2IOQ A;  2V26 A;  1YZA A;  1M56 C;  1RKE B;  2WB7 A;  2KNH A;  3E70 C;  1WGW A;  2DGJ A;  2AP3 A;  4R32 A;  2G3K A;  5IY5 C;  2KYH A;  2MWQ A;  2PX3 A;  2XLE A;  3H2U A;  4XPX A;  3ZVR A;  2JX0 A;  4KBL A;  1OCR C;  1MMG A;  4MVU A;  3F46 A;  4ANJ A;  4LLC A;  5E3A A;  2NUP A;  3CZ6 A;  3DD7 A;  2ASR A;  3HNL A;  1K40 A;  1WWP A;  3CEX A;  4CSA C;  3O39 A;  1E85 A;  3NYJ A;  1VYI A;  2KK1 A;  2PP4 A;  1R5I D;  2Q9C A;  2XSE A;  2YQY A;  2YEV A;  3G4X A;  3JYH A;  3ZG1 A;  5JT4 A;  3SNH A;  5FZT A;  1MND A;  4RD9 A;  1FMW A;  2DB4 A;  3RFY A;  2CNW A;  3GM2 A;  3M4C A;  3W2V A;  2YL3 A;  1IW7 F;  2XS1 A;  1M6T A;  3U2M A;  2MHR A;  2XLD A;  3C8Z A;  2HKV A;  3RF3 A;  3IQC A;  3L1M A;  1W2W A;  1JAF A;  3UMH A;  5A6K A;  4LDK A;  3T9O A;  2J0W A;  4LDQ A;  4PR9 A;  1NU7 D;  3C8G A;  1A7V A;  3AJM A;  1SF8 A;  4MND A;  1YLM A;  1ORY A;  3FAJ A;  2X51 A;  2EPK X;  2P7V A;  3Q6N A;  4KNW A;  3LLI A;  4Z9J A;  3C63 A;  2KSF A;  1Z63 A;  2W45 A;  2J9W A;  3EGD B;  2XS8 A;  3KKB A;  3WHN A;  4I1O B;  1Q0G A;  1OW8 A;  3DMD A;  3KMI A;  5KYN A;  1D1C A;  3E9V A;  3S90 A;  2Q9B A;  5KYW B;  1M57 C;  2GDC A;  2LK4 A;  4CS7 A;  2NPU A;  2WZL A;  4ULW A;  1VTM P;  2PF4 E;  1VYK A;  5F5F A;  1PCX A;  3AG4 C;  1D1A A;  4LLE A;  1TWA A;  1OCO C;  4O79 A;  3FDQ A;  3SXZ A;  1MMA A;  5KYW A;  1QPU A;  2NUT B;  4FWV A;  4NQF A;  3U3B A;  4CSA A;  2IBF A;  3CSK A;  1FFH A;  1QVX A;  3EHM A;  3GWL A;  3C8G D;  3MX3 A;  3W4Y A;  3GEE A;  4U5E E;  1S7Z A;  1QLE C;  4XWJ A;  5T3W A;  4N06 A;  3CAX A;  2H8A A;  2YZS A;  4MW3 A;  1ST6 A;  3RQE A;  1ZU5 A;  2PNO A;  2Y3G A;  3ECS A;  1LE2 A;  2CDQ A;  4H4K C;  1QKR A;  2Q4F A;  5T3T A;  1YAR O;  3L34 A;  1SR2 A;  1D0Y A;  2DYR C;  2QNL A;  2XRH A;  4J7T A;  1PD0 A;  3U8P A;  3I5P A;  4CDY A;  3WAQ A;  2OOC A;  1V54 C;  3C18 A;  1LE4 A;  1Z3I X;  3HNI A;  3RQF A;  4YWQ A;  4CIH A;  2VC9 A;  3ASO C;  3EZH A;  4K1O A;  2HS5 A;  2XLO A;  3RVY A;  2VH3 A;  2R7S A;  3K33 A;  1YZC A;  2PFD A;  3NKD A;  3ASN C;  5HSW A;  2EIL C;  1U89 A;  1WTY A;  3DE9 A;  1ZHZ A;  2B0H A;  4H54 A;  2Q00 A;  3ZC4 A;  4BEJ A;  1TWG A;  3B0V C;  3JCU Q;  4E18 A;  1LKX A;  1ZHX A;  5JRA A;  4EHP A;  1DOV A;  5K0I A;  2QY9 A;  1JPN A;  3B0U X;  1AEP A;  2P6V A;  2YLD A;  4JW1 A;  2RSE B;  2HV6 A;  2XL6 A;  4XLN F;  1U0B B;  1S05 A;  2MYS A;  3FAP B;  4AK9 A;  3DM9 B;  1CGN A;  2G62 A;  3EGX B;  4MVQ A;  4PJN A;  2OJQ A;  3GOD A;  2IXP A;  3DJU B;  2XLM A;  5EK0 A;  5L3V A;  2WL8 A;  4NY3 A;  2L9J A;  1EI7 A;  4IAQ A;  2WZF A;  1ORJ A;  3VYW A;  2LFD A;  4CDA A;  4YN0 B;  2YL7 A;  4MTO A;  3LEO A;  2HMZ A;  1NSG B;  3LAY A;  2AU5 A;  4DRJ B;  1V4A A;  5BQG A;  5E3C A;  1RXQ A;  4WGZ A;  4AX2 A;  1OQC A;  2EPM X;  5KYU A;  1MQV A;  3RH3 A;  4A4A A;  2FAP B;  2M64 A;  2WVN A;  3ITF A;  1K04 A;  2QLA A;  5JSL A;  1BR4 A;  1O87 A;  1TR2 A;  1CPR A;  1LVK A;  4K7B A;  4NTF A;  4NTB A;  4O6N A;  3ABK C;  4P6I C;  3S27 A;  3SEO A;  3UMI A;  2WZG A;  3ZTM A;  5L0J A;  2YLI A;  3B29 A;  2OEX A;  2YKZ A;  1PD1 A;  3B9Q A;  3J06 A;  5KYY A;  1TFK B;  2Y3D A;  1U6H A;  4A2N B;  2BL2 A;  1NLX A;  4JTA B;  2R7O A;  4O6M A;  1FMV A;  1I4Y A;  4G0H A;  4FES A;  3JRT A;  2R7W A;  3L8I A;  4LAC B;  4U5D E;  2A68 F;  2OG2 A;  2PBE A;  2D5R B;  4MQ9 F;  4U9E A;  4OIN F;  1NBB A;  1O5H A;  4KC9 A;  4EUK B;  3TD7 A;  2CGE A;  5AGF A;  3JT1 A;  1L3P A;  4MTF A;  3NDB B;  2R7Q A;  1Z5Z A;  2WVQ A;  3NYM A;  2VCB A;  2Y69 C;  4OIQ F;  4LER A;  1Y4C A;  4GEH A;  1BR2 A;  1VB5 A;  3T4R A;  5JLI A;  3EQL F;  3EG9 B;  2XL4 A;  3K1H A;  4G7Z F;  1LPE A;  3AQC A;  3DAG A;  4AE4 A;  1A7D A;  4CJO A;  3ZWI A;  1D0X A;  3O6X A;  5COG A;  3NMI A;  3C7J A;  3LNR A;  4OIO F;  5EGY A;  2D4U A;  2V3C C;  1OCZ C;  2IXN A;  1Z7Q c;  1IZM A;  2NSF A;  3R7C A;  3ATP A;  1J8Y F;  3DZA A;  4P9T A;  2VCC A;  3Q7G A;  1A0B A;  1KNY A;  4P9F A;  4XEK A;  4WJ0 A;  4Z9H A;  2HJ3 A;  5F5H A;  4CS8 A;  5KYX A;  5D91 A;  1A7E A;  3DE8 A;  5A6J A;  3AGU A;  3SXY A;  3CQZ A;  1GGQ A;  2OCC C;  2L6G A;  1Q0F A;  2NG1 A;  1ZU4 A;  1YYJ A;  1SYQ A;  4BEM J;  3TJ5 A;  4U5H A;  3S28 A;  3LEV A;  3M4B A;  4QDL A;  3IPM O;  4NTA A;  5D92 A;  3T6J A;  3M15 A;  4E17 A;  4ZLC A;  4U5F E;  2J7P D;  4YT2 A;  4E0I A;  2OU6 A; 
#chains in the Genus database with same CATH homology
 4QI0 A;  2ZXO A;  3L0I A;  1MMD A;  2KJG A;  1OKK D;  1VK5 A;  2H7B A;  3N2Z B;  5KYY B;  4DBR A;  4YT8 A;  2A69 F;  3POV A;  2XXA A;  3H65 A;  3DAF A;  3LES A;  4JVS A;  3I5Q A;  4CS8 C;  3S29 A;  3LJB A;  4W8K A;  4DOZ A;  4I44 A;  3KH2 A;  1N1C A;  4I1M A;  4XTK A;  3K7D A;  4G7H F;  3NRH A;  5L3Q A;  1V55 C;  1D1B A;  1JPJ A;  2BE5 F;  5BUO A;  3UR3 C;  2IXM A;  3NG1 A;  2R7U A;  3W8H A;  2WVO A;  1ZHY A;  2DYS C;  2Y3B A;  3W8I A;  4EWC A;  4OIP F;  2CNW D;  3FHD A;  3LS0 A;  5B3S C;  3M1C B;  1MNE A;  1M2V A;  4FX5 A;  2Q9A A;  4Q5S F;  3EFO A;  3IEE A;  2B0J A;  5B1A C;  1Z6A A;  4K0D A;  5FCL A;  4U5G A;  3LLK A;  2L81 A;  4C3D A;  4CS9 C;  2R7T A;  4RBN A;  1VOM A;  3FVY A;  5CI9 A;  2Y39 A;  4F4B A;  3EH1 A;  3HJC A;  2VB6 A;  4YT5 A;  2G3V A;  3EPV A;  3EJN A;  4PJM A;  2IXO A;  3DM5 A;  3WG7 C;  3UNG C;  3Q6M A;  2W4B A;  3AG3 C;  2FFH A;  1VMA A;  3JSZ A;  2J45 A;  2A1D D;  4ZLD A;  5DVW A;  4PFO A;  3PMR A;  2LSE A;  3EH2 A;  3PHF 2;  2HV7 A;  2VAS A;  2Z15 A;  3HLZ A;  3RIP A;  1NZE A;  4BJ6 C;  4C7O A;  3DJN B;  3I4U A;  4CS9 A;  4PJL A;  3EGD A;  1ZHT A;  5T1D B;  5E33 A;  3UGP A;  3OEO A;  4M63 A;  1TKN A;  4XLP F;  2KQ9 A;  4PFP A;  1FTS A;  2W4M A;  3NYL A;  3AG2 C;  2EIJ C;  5KYU B;  2H7O A;  3MLG A;  1BR1 A;  4BJ5 C;  2J9V A;  1SZI A;  2XXA B;  1M2O A;  3KL4 A;  3K66 A;  3AG1 C;  3OA1 A;  4HE8 D;  2J46 A;  3SZR A;  3ZIB A;  4BJT A;  1J8M F;  3AQB A;  4B6I A;  4QI2 A;  3K6B A;  3EG9 A;  2J0X A;  4GYT A;  3RYL A;  4O6Y A;  2A6H F;  2KGO A;  1RJ9 A;  4OIR F;  4YJW A;  3VAY A;  1Z23 A;  4E7S A;  3T6B A;  3WOD F;  3UGO A;  5KYX B;  2Y3H A;  2Q3T A;  4G7O F;  4JJF A;  1TWC A;  2IYL D;  4JZA A;  3ZSU A;  4C3B A;  5DS4 A;  2KW3 C;  2ZXP A;  4U5C E;  2I8B A;  1QZX A;  3N24 A;  2W9Y A;  3EGX A;  2EIN C;  4CBE A;  4J30 B;  1OKK A;  4IJJ A;  5DQT A;  5DQZ A;  1FFT C;  3X2Q C;  1D0Z A;  2R7R A;  4BJ1 A;  2J7P A;  3EFO B;  3RKO F;  4PK4 A;  3S0X A;  4OD5 A;  3F47 A;  4C3E A;  3SP1 A;  3SYN A;  3K1I C;  2EIM C;  2J9U A;  3ABL C;  4U5B E;  5EHH A;  4BG0 A;  2ZXW C;  1KU2 A;  2YHS A;  3ABM C;  4BJ6 A;  2H7V C;  4BJ5 A;  2FGY A;  5HSW A;  3N0T A;  4HFK B;  2JD3 A;  4JCH A;  2E87 A;  1ZYR F;  3EHN A;  4X0R A;  4IWB A;  4KI2 A;  3NKE A;  2C03 A;  3Q7L A;  4OD4 A;  4HEA J;  1M2V B;  4IAO A;  4DBQ A;  4E7Z A;  2ZPA A;  3DXJ F;  4J32 B;  2QTV A;  3EZI A;  2EIK C;  2NUP B;  3QMK A;  2R7X A;  4AE4 B;  1NU9 C;  2ZXR A;  1OCC C;  4Q7C A;  4PJJ A;  3GAN A;  3HTK C;  3LS1 A;  5DLJ A;  4IRU A;  3B0P A;  4RDA A;  1NG1 A;  4JJG A;  2PX0 A;  1RJ9 B;  4YT4 A;  2O9X A;  3W2W A;  5B1B C;  2C04 A;  4I3M A;  1SMY F;  3V7O A;  1ZHW A;  4DVY P;  5DS6 A;  4HFF B;  1LS1 A;  3QZC A;  5CI8 A;  2M4E A;  2A6E F;  5DS5 A;  2GFH A;  1MMN A;  1TWH A;  4EBB A;  1G8X A;  4JUR I;  3OWT A;  2CW0 F;  2NUT A;  4KNV A;  3UMK A;  4Q4Z F;  5E2Q A;  4C7O B;  4O7G A;  2IOQ A;  2V26 A;  1M56 C;  2WB7 A;  3E70 C;  2KNH A;  1WGW A;  2DGJ A;  2G3K A;  5IY5 C;  2MWQ A;  2PX3 A;  3ZVR A;  4KBL A;  1OCR C;  1MMG A;  4ANJ A;  3F46 A;  4LLC A;  5E3A A;  2NUP A;  3CZ6 A;  3DD7 A;  4CSA C;  3O39 A;  3NYJ A;  1VYI A;  2PP4 A;  2Q9C A;  2XSE A;  2YEV A;  3JYH A;  3ZG1 A;  3SNH A;  1MND A;  4RD9 A;  1FMW A;  3RFY A;  2CNW A;  3W2V A;  1IW7 F;  3UMH A;  1W2W A;  2J0W A;  1NU7 D;  1SF8 A;  4MND A;  3FAJ A;  2X51 A;  2P7V A;  3Q6N A;  4KNW A;  3LLI A;  1Z63 A;  2W45 A;  2J9W A;  3EGD B;  3KKB A;  4I1O B;  3B0V C;  3DMD A;  5KYN A;  3KMI A;  1D1C A;  3E9V A;  2Q9B A;  1M57 C;  4CS7 A;  4ULW A;  2WZL A;  2PF4 E;  1VYK A;  5F5F A;  1PCX A;  3AG4 C;  1D1A A;  4LLE A;  1TWA A;  1OCO C;  4O79 A;  3FDQ A;  1MMA A;  5KYW A;  4FWV A;  2NUT B;  4CSA A;  3CSK A;  1FFH A;  3EHM A;  3MX3 A;  4U5E E;  1S7Z A;  1QLE C;  4XWJ A;  5T3W A;  4N06 A;  2YZS A;  1ST6 A;  1ZU5 A;  2Y3G A;  3ECS A;  2CDQ A;  4H4K C;  5T3T A;  2R7V A;  3L34 A;  2DYR C;  1D0Y A;  2XRH A;  1PD0 A;  3I5P A;  1V54 C;  4YWQ A;  4CIH A;  1Z3I X;  2R7S A;  3ASO C;  3EZH A;  2VH3 A;  3K33 A;  2PFD A;  3NKD A;  3ASN C;  2EIL C;  1ZHZ A;  3ZC4 A;  4BEJ A;  1TWG A;  3JCU Q;  1LKX A;  1ZHX A;  2QY9 A;  1JPN A;  3B0U X;  2P6V A;  4JW1 A;  2HV6 A;  4XLN F;  2MYS A;  4AK9 A;  3DM9 B;  2G62 A;  3EGX B;  4PJN A;  3GOD A;  2IXP A;  3DJU B;  5L3V A;  2WL8 A;  4NY3 A;  2L9J A;  2WZF A;  3VYW A;  4YN0 B;  3LAY A;  5E3C A;  4AX2 A;  5KYU A;  3RH3 A;  2WVN A;  3ITF A;  1TR2 A;  1O87 A;  1BR4 A;  4K7B A;  1LVK A;  4P6I C;  3X1O A;  4DVZ A;  4O6N A;  3ABK C;  3S27 A;  3SEO A;  3UMI A;  2WZG A;  1PD1 A;  3B9Q A;  5KYY A;  2Y3D A;  4A2N B;  2R7O A;  4O6M A;  1FMV A;  4G0H A;  4FES A;  3JRT A;  2R7W A;  4LAC B;  4U5D E;  2A68 F;  2OG2 A;  4MQ9 F;  2D5R B;  4OIN F;  1O5H A;  4KC9 A;  3TD7 A;  2CGE A;  3JT1 A;  3NDB B;  2R7Q A;  1Z5Z A;  2WVQ A;  3NYM A;  4OIQ F;  2Y69 C;  4LER A;  4GEH A;  3T4R A;  1BR2 A;  3EQL F;  3EG9 B;  2XL4 A;  3K1H A;  4G7Z F;  3AQC A;  3DAG A;  4AE4 A;  1D0X A;  3O6X A;  3LNR A;  4OIO F;  5EGY A;  2V3C C;  1OCZ C;  2IXN A;  1IZM A;  3DZA A;  1J8Y F;  5KYW B;  3Q7G A;  4CS8 A;  5F5H A;  5KYX A;  4WJ0 A;  5D91 A;  3CQZ A;  2OCC C;  2NG1 A;  1ZU4 A;  4U5H A;  3S28 A;  3LEV A;  4QDL A;  5D92 A;  4ZLC A;  3T6J A;  4U5F E;  2J7P D;  4YT2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...