5K0IA

Mpges1 bound to an inhibitor
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
148
structure length
147
Chain Sequence
SLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYRSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGKLRAPIRSVTYTLAQLPCASMALQILWEAARHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Characterization of 3,3-dimethyl substituted N-aryl piperidines as potent microsomal prostaglandin E synthase-1 inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/isomerase inhibitor
molecule keywords Prostaglandin E synthase
total genus 65
structure length 147
sequence length 148
ec nomenclature ec 5.3.99.3: Prostaglandin-E synthase.
pdb deposition date 2016-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 5k0iA00
4YL3A 5BQHA 2Q7RA 4NTBA 4J7TA 4BPMA 4AL1A 4JC7A 3PCVA 4NTAA 2UUIA 3LEOA 4YK5A 4AL0A 2H8AA 4YL0A 4J7YA 2UUHA 4JCZA 4WABA 4YL1A 3DWWA 5HV9A 2PNOA 3HKKA 5BQIA 5K0IA 4JRZA 4NTFA 5BQGA 3B29A
chains in the Genus database with same CATH superfamily
1QQ3A 1T6UA 1WATA 2R25A 2OG2A 1A41A 4JTAB 2L9JA 3GORA 4XQ1A 1BR1A 1M6TA 1PCXA 3SZRA 1AUEA 1C03A 3LJBA 3B0UX 2EPOA 3PCVA 3VYWA 4M63A 5E33A 2XLVA 3X1OA 4AL0A 4YWQA 3EGXB 3C8GD 3NG1A 5T3WA 3MLGA 3ZQYA 2EPKX 5A6BA 5L3QA 1Y4CA 3W8IA 2XM0A 3FMSA 4DXWA 1AVOB 4CS9C 3CAXA 2Q9CA 2PNOA 4C3BA 2JD3A 2XLOA 3M15A 3DM9B 5BQIA 4H54A 3KPHA 4G7HF 3H2VA 5KYWB 3NKDA 3WAQA 3GM3A 4BG0A 1T6QA 2V26A 3HNJA 4NTFA 1C17M 4YT4A 2NPUA 3UGPA 4U5BE 5CIVA 3QW0A 4KNWA 5BQHA 2A0UA 3W2WA 3RIPA 2J9VA 1FR0A 1LM3B 4G7ZF 4Z9IA 5KYXB 2O9XA 2IYLD 3K1HA 2WZFA 4U5HA 1YDIA 2WVQA 2Y3BA 1K40A 4OIOF 1ORSC 4GEHA 4EUKB 3ATPA 3K1IC 4J7YA 4JTCB 1T9KA 3F47A 3U5SA 2KSFA 4CS9A 2CGEA 2XS8A 3EHNA 4YL1A 2X0CA 5DVWA 2R7WA 1BDJB 4AK9A 4CJGA 1ZVZA 4PK4A 1BBHA 2EPNA 4IARA 2YLDA 5JT4A 5JRAA 5JS5A 2M64A 2VB6A 1OCCC 1TWAA 1LI7A 1G5ZA 1Q0KA 3K1IA 3T9OA 2R02A 2CDQA 3IQ5A 3OEOA 4JIOA 5F5HA 3RVYA 2FAPB 2RSEB 2XL8A 3MX3A 2M4EA 1Z5ZA 3HTKC 3LESA 2Y3HA 3Q7GA 3V5XA 3MFNA 4BJ6A 1MMNA 4NTBA 3B0PA 3TD7A 3L8IA 1XZPA 3O55A 1HE1A 1TWGA 4MVZA 4BPMA 2UUIA 5JUAA 1YZAA 1AEPA 3IQ6A 4CX9A 4YK5A 2WZLA 4WJ0A 2IXNA 1VYKA 3RKOF 1YJGA 1LKXA 3DJNB 2VC9A 4O6MA 4Q4ZF 4Z9JA 5DS4A 2J8WA 2ICWG 2CW0F 2OOCA 5JVEA 4X0RA 1T5OA 2JX0A 2KQ9A 1ST6A 3AQCA 4FWVA 1Z23A 3KYIA 3KMIA 3C63A 2IM8A 3IPMO 3UMHA 2Q3TA 2WZGA 4BEMJ 256BA 4CDYA 1OR3A 4BJ5A 1FNTc 1DOWA 3HKKA 1M2VA 3C8GB 1A7DA 2EINC 3KYJA 3IQCA 4O6YA 2E87A 3T6JA 1FFTC 2P61A 5L3VA 1V4AA 4D4NA 4DRIB 5EHHA 4F4BA 2XRHA 4C7OB 1EI7A 1PD0A 1IW7F 2AWYA 4N6CA 4FESA 3J06A 2HJMA 2W4MA 4J7TA 4XWJA 4B6IA 5TJ5E 4OIRF 4NTAA 2ZXPA 5GPGB 2D5RB 4EHPA 2LFDA 1BR2A 1WOLA 1WWPA 1KTMA 1JR8A 3ZG1A 2XLWA 2R7SA 1JAFA 4IAQA 4LDQA 1FMWA 1O3UA 3L1MA 2G62A 3PHF2 3S90A 4BJ5C 3DI5A 3CEXA 3FOOA 1I5NA 2P0NA 3OWTA 3U9JA 4E0IA 3E9VA 4XPWA 2GAQA 2LSEA 2WL8A 3F46A 4DRHB 4PJNA 5AC5A 1D1CA 3W2VA 1B68A 2VCCA 3SXKA 3T6BA 5L0GA 3WG7C 1ZU5A 1NBBA 1M2OA 2J9UA 2PX3A 3DKAA 5DQZA 4HFFB 4DJ9A 2R7UA 4KBLA 2V3CC 3ZWIA 1NFNA 3N24A 2PBEA 2G3KA 2Q9AA 4MW3A 2Q7RA 3DD7A 2D4UA 1PD1A 3JZ0A 4MS2A 1KNYA 2ZD9A 2ZXOA 1CPRA 2H7BA 2HV6A 4CS8C 4C7OA 3DE8A 2EPLX 2J0XA 3DJUB 3A9CA 1ZW2A 4JZAA 2H8AA 1HW2A 2OEVA 3LAYA 4XPXA 2YQYA 4JCZA 1OCZC 4RBNA 1NU7D 4ULVA 3MYFA 1DOVA 3K33A 3C62A 4BJTA 2R7TA 1H9GA 3DWWA 4LDRA 4JVSA 1YLMA 3AG2C 1CGOA 3GM2A 4Q7CA 3RH3A 3I4UA 1GQAA 1LE2A 2J7PA 2NUTA 2R7RA 1ZHTA 5E2QA 4CS7A 2XLHA 1EKYA 1M57C 1TKNA 5KYXA 2Y39A 1OW7A 4PFOA 5A6KA 5DLJA 4FAPB 3LNMB 4Q5SF 3H2UA 4IGGA 3NMKA 1ZYRF 4NY3A 3GWLA 2R7XA 4YT8A 4CIPA 1GM5A 1LVKA 1XWJA 2NSGA 1JMWA 4H4KC 2AU5A 3UR3C 3ECSA 3LS1A 2XLEA 2QTVA 5B3SC 3L34A 3ZDLA 1S7ZA 1A0BA 4FX5A 2XSEA 2I8BA 1LPEA 1H7IA 2EIKC 2YHSA 5DS6A 2GWWA 1RCPA 2CNWD 3FAJA 2QUPA 3HJCA 3MBGA 1SR2A 1H9TA 1UG7A 1FFHA 3BEHA 1VK5A 3NMIA 4DVZA 1Z3IX 3KH2A 3U8PA 3NRHA 2QE9A 4R32A 3QW1A 4AE4B 1V55C 2W4BA 3ZQVA 4JE9A 2YVKA 4YL3A 3DE9A 3L0IA 3VAYA 4E17A 1IZMA 1JPNA 5FCLA 3U2LA 2KC3A 3IEEA 4E7SA 4OIQF 2QNLA 3AG3C 4DBQA 5A6BD 3S0XA 3EGDB 5F5FA 4N06A 5CI8A 3NKEA 2A6EF 2AP3A 3HNIA 3TK0A 4XLNF 3Q6NA 2GA0A 3S29A 1D1BA 1ZHZA 2JPUA 3AOUA 1ORJA 3PMRA 4MNDA 2OKUA 4U5DE 2A69F 2NG1A 2PF4E 3AGTA 1NLXA 4DOZA 3FDQA 3LUTB 1VB5A 3JSEO 4U9DA 4E7ZA 3G4XA 2PP4A 1OKKA 2GDCA 3MYIA 3VRCA 3V5ZA 2OU6A 1WGWA 4HE8D 2ASRA 4I3MA 1JPJA 2YEVA 3FVYA 3W4YA 4XLPF 2IOQA 3X2QC 2W9YA 1ZZPA 1QKRA 3C7JA 5E3AA 3AG1C 4CJOA 2GFHA 3AG4C 4C3DA 4QI0A 1APCA 1MNEA 4ULWA 1HMDA 1UFBA 3GANA 3O6XA 3A11A 4KI2A 3LLIA 2EPMX 1V54C 3TJ5A 2VCBA 1LS4A 3L8JA 4DVYP 4PJMA 1OCRC 3DAFA 2QY9A 1NZEA 1SMYF 2FFHA 4XTKA 3RQGA 4JJGA 2PFDA 1CPQA 1RKEA 3QMKA 2OQMA 3M1CB 4I44A 1RXQA 2DI3A 3RQFA 4O6NA 3U2MA 3NYLA 1D0ZA 1T01A 3DMDA 3RW0A 3GEHA 1FAPB 3EGXA 3WHNA 2J0WA 4GQHA 3RQEA 4MTOA 5F28E 4BJ1A 3FXHA 3NMJA 3GM1A 4K7BA 3U8VA 3AGUA 3POVA 2XS1A 4MVSA 1RMVA 2J9BA 4XEVA 2L7AA 3TJ6A 4EWCA 4HFKB 3LEVA 3ASOC 2LCHA 3JT1A 3ZVRA 3R2PA 2LD6A 2YZSA 3EZHA 4CS8A 2H7VC 1LS1A 2DB4A 1U0BB 4WGZA 1LE4A 5L0HA 1QVXA 1G4US 3B71A 5L0DA 1TWHA 3CSKA 2OEXA 3HNLA 2CCYA 4JEBA 3VM6A 2HSBA 3G4ZA 2Y69C 3NYJA 4JURI 1T6IA 1Z6AA 2P7VA 4WABA 2XXAA 2YRFA 4DRJB 3K6BA 1ZU4A 1W2WA 2HKVA 1YAUO 1A7EA 1FMVA 4LLEA 1VTMP 1XZQA 3M4BA 1OCOC 3SP1A 1QSPA 4MW8A 2KK1A 4G0HA 5EK0A 3KL4A 5K0IA 2A1DD 5D92A 3U3BA 3DAGA 2KJGA 2QLAA 3O10A 2OJQA 1S05A 1HE9A 2CNWA 2ETSA 2G3VA 3N2ZB 4MVUA 4CDAA 5L0CA 1D0XA 3CQZA 3G50A 4BEJA 3K7DA 4LACB 3S27A 3QTHA 3HNKA 4DBRA 1E86A 2R05A 1Z63A 2WVOA 1NSGB 2KW3C 2L6GA 1K05A 3EQLF 4P9TA 3VF0A 1WN0A 2ZPAA 3E70C 5COMA 1ZHWA 2AVKA 4RDAA 5A69A 3S84A 4ONSA 3LNRA 1KU2A 2HV7A 2J9WA 5HV9A 3M79A 4CDVA 1OW6A 1R4TA 3JTLO 5T3TA 4PR9A 5EGYA 2R03A 1V74B 1CGNA 4OD5A 1ZHXA 5B3IA 1U89A 1L7CA 2Q00A 1QPUA 4U5EE 3B29A 2MWQA 3JYHA 1O5HA 4W8KA 4PJJA 1QLEC 2HSQA 3GWNA 2LK4A 2R7VA 1Q0DA 4AE4A 5KYUB 1NFOA 3JYYA 2HJ3A 4G7OF 3I5PA 4O7GA 2Y3GA 3O39A 1D1AA 4YJWA 4MTFA 1BR4A 2A0BA 2RD9A 4I1MA 3RF3A 1E84A 4LDKA 2IXOA 1VMAA 3OA1A 2BC5A 1N1CA 2YL0A 3EFOB 1E2XA 3LS0A 5T1DB 1OW8A 2C04A 2J7PD 2KGOA 2PX0A 4L6RA 3CZ6A 2P1AA 1YARO 1HY5A 3JSZA 4ZLCA 2IXMA 1WASA 5DQTA 1YZCA 5HSWA 2Z15A 3EHMA 1NU9C 2NSFA 1YA9A 4PFPA 3N0TA 5KYYA 4N4WA 1TWCA 3EH1A 3H65A 3SXZA 1I4YA 3RVZA 1PV3A 3BRJA 4IAOA 1Q0FA 1GS9A 4U5CE 2NUTB 4K0DA 1U6HA 2DYSC 2NUPB 3EH2A 2VH3A 3EPVA 5KYYB 1VLTA 3ABMC 2X51A 3UMIA 5KYUA 1NG1A 2WVNA 3GEIA 3FAPB 3K66A 1M2VB 3C8GA 4MVRA 4IB4A 3FOPA 4O79A 2HFIA 4YT5A 3SYNA 1E85A 2EIMC 2YL1A 1HMOA 1YYJA 2YWAA 1VLSA 3EG9A 4IWBA 1CGME 3US6A 4U5FE 3C8ZA 2XLDA 3EFOA 2L81A 2WB7A 3IQTA 4J32B 4MQ9F 4NC3A 4E18A 2VASA 3GODA 1J8MF 1MQVA 2Y3DA 4ER9A 3PDMP 5L0FA 3S9OA 3HLZA 1YVIA 2EILC 5COFA 1J8YF 1A7VA 4EBBA 3T6GB 3DZAA 4EKWA 3W8HA 4MVQA 2BE5F 2NUPA 1QZXA 4OD4A 3EZIA 5JSLA 3RFYA 2HZ8A 1VYIA 2A68F 2J46A 2YKZA 5KYNA 3ITFA 2TMVP 1MNDA 4E0HA 2P6VA 1MMGA 4CSAC 4OINF 1M56C 2R7QA 2ZXWC 3V7OA 2XM4A 1RKCA 4CIHA 2YLIA 1YA7O 2LFFA 1OQCA 4WGYA 5A6JA 3EG9B 3U3FA 3DXJF 4W8PA 4EBJA 5DS5A 3R7CA 4NQFA 4KC9A 3QZCA 1JOGA 2HS5A 2KNHA 3ZC4A 5L0IA 4JCHA 3B9QA 3ABLC 1SYQA 1VOMA 4YN0B 3FHDA 4ANJA 4C3EA 1OXBA 5BQGA 1O87A 1R5ID 1TQGA 2FGYA 2LP4A 3V5YA 1YYXA 3C18A 5FZTA 1OKKD 3GEEA 3ZTMA 4P9FA 4U5GA 5CI9A 1SZIA 3NDBB 4XEFA 2L6FA 2XL6A 4KNVA 1BZ4A 4PACA 3M4CA 3RYLA 3QVZA 1L3PA 4JTDB 5B1AC 5JLIA 2HMQA 3KKBA 4LLCA 4D4XA 2KYHA 3EJNA 3ZSUA 3S28A 1FTSA 1WTYA 4YT2A 3QVYA 1G8XA 5BUOA 3IHUA 2XL4A 3ASNC 2I15A 4ZLDA 1EQ1A 1OXKA 1Q0MA 5AGFA 4MVOA 5B1BC 3SXMA 3UMKA 3DM5A 2H7OA 2A6HF 4CBEA 1TFOB 1Y6DA 4P6IC 2DGJA 4Z9HA 4RD9A 1TR2A 3JRTA 2R7OA 3WODF 2W45A 1F1MA 4I1OB 2EIJC 4QDLA 4EBKA 1HW1A 3I5QA 2C03A 4AL1A 3UGOA 3SXYA 1C02A 1E83A 4XPYA 1G4WR 4UDVA 4AX2A 2BL2A 2LQGA 5A6AA 1K04A 2XLMA 4OIPF 4HEAJ 1GGQA 1SF8A 1Q0GA 2MHRA 2OCCC 2OJED 3JCUQ 2MYSA 4G78A 4NCQA 4JJFA 1MMAA 4JKVA 1ORYA 1ZHYA 3NYMA 5L0JA 4CSAA 5E3CA 4PJLA 1EA8A 1RKEB 2DYRC 4IRUA 3ZIBA 3AJMA 3T4RA 3UNGC 5D91A 2YL3A 3SEOA 2VCAA 3U9MA 2B0JA 2B0HA 2R9RB 1RJ9A 3JRMO 4N6HA 3ABKC 5JP7A 1Z7Qc 3TULA 2YLGA 3EGDA 3SNHA 2AWCA 4U9EA 3TOMA 1LIHA 2HUJA 3ZTZA 5KYWA 4JC7A 2LIGA 1RJ9B 3B0VC 1H6GA 4IJJA 5IY5C 3LEOA 2J45A 4J30B 4QI2A 4LERA 2ZXRA 1I4ZA 4K1OA 2L6HA 1MMDA 3AQBA 4YL0A 4A2NB 1ZW3A 2XXAB 4MTGA 2UUHA 1OR2A 4MVMA 3TOLA 4XEKA 4JEAA 5COGA 2IXPA 3LLKA 4BJ6C 2IBFA 2Q9BA 4EIYA 3U0CA 1D0YA 3Q6MA 2CYDA 2Q4FA 4A4AA 3TQOA 1JRAA 4GYTA 2HMZA 4JRZA 2F22A 4JW1A 3Q7LA 1TFKB 2YL7A 5AC4A 1LI5A
chains in the Genus database with same CATH topology
4YL3A 5BQHA 2Q7RA 4NTBA 4J7TA 4BPMA 4AL1A 4JC7A 3PCVA 4NTAA 2UUIA 3LEOA 4YK5A 4AL0A 2H8AA 4YL0A 4J7YA 2UUHA 4JCZA 4WABA 4YL1A 3DWWA 5HV9A 2PNOA 3HKKA 5BQIA 5K0IA 4JRZA 4NTFA 5BQGA 3B29A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YL3 A;  5BQH A;  2Q7R A;  4NTB A;  4J7T A;  4BPM A;  4AL1 A;  4JC7 A;  3PCV A;  4NTA A;  2UUI A;  3LEO A;  4YK5 A;  4AL0 A;  2H8A A;  4YL0 A;  4J7Y A;  2UUH A;  4JCZ A;  4WAB A;  4YL1 A;  3DWW A;  5HV9 A;  2PNO A;  3HKK A;  5BQI A;  5K0I A;  4JRZ A;  4NTF A;  5BQG A;  3B29 A; 
#chains in the Genus database with same CATH topology
 1QQ3 A;  1T6U A;  1WAT A;  2R25 A;  2OG2 A;  1A41 A;  4JTA B;  2L9J A;  3GOR A;  4XQ1 A;  1BR1 A;  1M6T A;  1PCX A;  3SZR A;  1AUE A;  1C03 A;  3LJB A;  3B0U X;  2EPO A;  3PCV A;  3VYW A;  4M63 A;  5E33 A;  2XLV A;  3X1O A;  4AL0 A;  4YWQ A;  3EGX B;  3C8G D;  3NG1 A;  5T3W A;  3MLG A;  3ZQY A;  2EPK X;  5A6B A;  5L3Q A;  1Y4C A;  3W8I A;  2XM0 A;  3FMS A;  4DXW A;  1AVO B;  4CS9 C;  3CAX A;  2Q9C A;  2PNO A;  4C3B A;  2JD3 A;  2XLO A;  3M15 A;  3DM9 B;  5BQI A;  4H54 A;  3KPH A;  4G7H F;  3H2V A;  5KYW B;  3NKD A;  3WAQ A;  3GM3 A;  4BG0 A;  1T6Q A;  2V26 A;  3HNJ A;  4NTF A;  1C17 M;  4YT4 A;  2NPU A;  3UGP A;  4U5B E;  5CIV A;  3QW0 A;  4KNW A;  5BQH A;  2A0U A;  3W2W A;  3RIP A;  2J9V A;  1FR0 A;  1LM3 B;  4G7Z F;  4Z9I A;  5KYX B;  2O9X A;  2IYL D;  3K1H A;  2WZF A;  4U5H A;  1YDI A;  2WVQ A;  2Y3B A;  1K40 A;  4OIO F;  1ORS C;  4GEH A;  4EUK B;  3ATP A;  3K1I C;  4J7Y A;  4JTC B;  1T9K A;  3F47 A;  3U5S A;  2KSF A;  4CS9 A;  2CGE A;  2XS8 A;  3EHN A;  4YL1 A;  2X0C A;  5DVW A;  2R7W A;  1BDJ B;  4AK9 A;  4CJG A;  1ZVZ A;  4PK4 A;  1BBH A;  2EPN A;  4IAR A;  2YLD A;  5JT4 A;  5JRA A;  5JS5 A;  2M64 A;  2VB6 A;  1OCC C;  1TWA A;  1LI7 A;  1G5Z A;  1Q0K A;  3K1I A;  3T9O A;  2R02 A;  2CDQ A;  3IQ5 A;  3OEO A;  4JIO A;  5F5H A;  3RVY A;  2FAP B;  2RSE B;  2XL8 A;  3MX3 A;  2M4E A;  1Z5Z A;  3HTK C;  3LES A;  2Y3H A;  3Q7G A;  3V5X A;  3MFN A;  4BJ6 A;  1MMN A;  4NTB A;  3B0P A;  3TD7 A;  3L8I A;  1XZP A;  3O55 A;  1HE1 A;  1TWG A;  4MVZ A;  4BPM A;  2UUI A;  5JUA A;  1YZA A;  1AEP A;  3IQ6 A;  4CX9 A;  4YK5 A;  2WZL A;  4WJ0 A;  2IXN A;  1VYK A;  3RKO F;  1YJG A;  1LKX A;  3DJN B;  2VC9 A;  4O6M A;  4Q4Z F;  4Z9J A;  5DS4 A;  2J8W A;  2ICW G;  2CW0 F;  2OOC A;  5JVE A;  4X0R A;  1T5O A;  2JX0 A;  2KQ9 A;  1ST6 A;  3AQC A;  4FWV A;  1Z23 A;  3KYI A;  3KMI A;  3C63 A;  2IM8 A;  3IPM O;  3UMH A;  2Q3T A;  2WZG A;  4BEM J;  256B A;  4CDY A;  1OR3 A;  4BJ5 A;  1FNT c;  1DOW A;  3HKK A;  1M2V A;  3C8G B;  1A7D A;  2EIN C;  3KYJ A;  3IQC A;  4O6Y A;  2E87 A;  3T6J A;  1FFT C;  2P61 A;  5L3V A;  1V4A A;  4D4N A;  4DRI B;  5EHH A;  4F4B A;  2XRH A;  4C7O B;  1EI7 A;  1PD0 A;  1IW7 F;  2AWY A;  4N6C A;  4FES A;  3J06 A;  2HJM A;  2W4M A;  4J7T A;  4XWJ A;  4B6I A;  5TJ5 E;  4OIR F;  4NTA A;  2ZXP A;  5GPG B;  2D5R B;  4EHP A;  2LFD A;  1BR2 A;  1WOL A;  1WWP A;  1KTM A;  1JR8 A;  3ZG1 A;  2XLW A;  2R7S A;  1JAF A;  4IAQ A;  4LDQ A;  1FMW A;  1O3U A;  3L1M A;  2G62 A;  3PHF 2;  3S90 A;  4BJ5 C;  3DI5 A;  3CEX A;  3FOO A;  1I5N A;  2P0N A;  3OWT A;  3U9J A;  4E0I A;  3E9V A;  4XPW A;  2GAQ A;  2LSE A;  2WL8 A;  3F46 A;  4DRH B;  4PJN A;  5AC5 A;  1D1C A;  3W2V A;  1B68 A;  2VCC A;  3SXK A;  3T6B A;  5L0G A;  3WG7 C;  1ZU5 A;  1NBB A;  1M2O A;  2J9U A;  2PX3 A;  3DKA A;  5DQZ A;  4HFF B;  4DJ9 A;  2R7U A;  4KBL A;  2V3C C;  3ZWI A;  1NFN A;  3N24 A;  2PBE A;  2G3K A;  2Q9A A;  4MW3 A;  2Q7R A;  3DD7 A;  2D4U A;  1PD1 A;  3JZ0 A;  4MS2 A;  1KNY A;  2ZD9 A;  2ZXO A;  1CPR A;  2H7B A;  2HV6 A;  4CS8 C;  4C7O A;  3DE8 A;  2EPL X;  2J0X A;  3DJU B;  3A9C A;  1ZW2 A;  4JZA A;  2H8A A;  1HW2 A;  2OEV A;  3LAY A;  4XPX A;  2YQY A;  4JCZ A;  1OCZ C;  4RBN A;  1NU7 D;  4ULV A;  3MYF A;  1DOV A;  3K33 A;  3C62 A;  4BJT A;  2R7T A;  1H9G A;  3DWW A;  4LDR A;  4JVS A;  1YLM A;  3AG2 C;  1CGO A;  3GM2 A;  4Q7C A;  3RH3 A;  3I4U A;  1GQA A;  1LE2 A;  2J7P A;  2NUT A;  2R7R A;  1ZHT A;  5E2Q A;  4CS7 A;  2XLH A;  1EKY A;  1M57 C;  1TKN A;  5KYX A;  2Y39 A;  1OW7 A;  4PFO A;  5A6K A;  5DLJ A;  4FAP B;  3LNM B;  4Q5S F;  3H2U A;  4IGG A;  3NMK A;  1ZYR F;  4NY3 A;  3GWL A;  2R7X A;  4YT8 A;  4CIP A;  1GM5 A;  1LVK A;  1XWJ A;  2NSG A;  1JMW A;  4H4K C;  2AU5 A;  3UR3 C;  3ECS A;  3LS1 A;  2XLE A;  2QTV A;  5B3S C;  3L34 A;  3ZDL A;  1S7Z A;  1A0B A;  4FX5 A;  2XSE A;  2I8B A;  1LPE A;  1H7I A;  2EIK C;  2YHS A;  5DS6 A;  2GWW A;  1RCP A;  2CNW D;  3FAJ A;  2QUP A;  3HJC A;  3MBG A;  1SR2 A;  1H9T A;  1UG7 A;  1FFH A;  3BEH A;  1VK5 A;  3NMI A;  4DVZ A;  1Z3I X;  3KH2 A;  3U8P A;  3NRH A;  2QE9 A;  4R32 A;  3QW1 A;  4AE4 B;  1V55 C;  2W4B A;  3ZQV A;  4JE9 A;  2YVK A;  4YL3 A;  3DE9 A;  3L0I A;  3VAY A;  4E17 A;  1IZM A;  1JPN A;  5FCL A;  3U2L A;  2KC3 A;  3IEE A;  4E7S A;  4OIQ F;  2QNL A;  3AG3 C;  4DBQ A;  5A6B D;  3S0X A;  3EGD B;  5F5F A;  4N06 A;  5CI8 A;  3NKE A;  2A6E F;  2AP3 A;  3HNI A;  3TK0 A;  4XLN F;  3Q6N A;  2GA0 A;  3S29 A;  1D1B A;  1ZHZ A;  2JPU A;  3AOU A;  1ORJ A;  3PMR A;  4MND A;  2OKU A;  4U5D E;  2A69 F;  2NG1 A;  2PF4 E;  3AGT A;  1NLX A;  4DOZ A;  3FDQ A;  3LUT B;  1VB5 A;  3JSE O;  4U9D A;  4E7Z A;  3G4X A;  2PP4 A;  1OKK A;  2GDC A;  3MYI A;  3VRC A;  3V5Z A;  2OU6 A;  1WGW A;  4HE8 D;  2ASR A;  4I3M A;  1JPJ A;  2YEV A;  3FVY A;  3W4Y A;  4XLP F;  2IOQ A;  3X2Q C;  2W9Y A;  1ZZP A;  1QKR A;  3C7J A;  5E3A A;  3AG1 C;  4CJO A;  2GFH A;  3AG4 C;  4C3D A;  4QI0 A;  1APC A;  1MNE A;  4ULW A;  1HMD A;  1UFB A;  3GAN A;  3O6X A;  3A11 A;  4KI2 A;  3LLI A;  2EPM X;  1V54 C;  3TJ5 A;  2VCB A;  1LS4 A;  3L8J A;  4DVY P;  4PJM A;  1OCR C;  3DAF A;  2QY9 A;  1NZE A;  1SMY F;  2FFH A;  4XTK A;  3RQG A;  4JJG A;  2PFD A;  1CPQ A;  1RKE A;  3QMK A;  2OQM A;  3M1C B;  4I44 A;  1RXQ A;  2DI3 A;  3RQF A;  4O6N A;  3U2M A;  3NYL A;  1D0Z A;  1T01 A;  3DMD A;  3RW0 A;  3GEH A;  1FAP B;  3EGX A;  3WHN A;  2J0W A;  4GQH A;  3RQE A;  4MTO A;  5F28 E;  4BJ1 A;  3FXH A;  3NMJ A;  3GM1 A;  4K7B A;  3U8V A;  3AGU A;  3POV A;  2XS1 A;  4MVS A;  1RMV A;  2J9B A;  4XEV A;  2L7A A;  3TJ6 A;  4EWC A;  4HFK B;  3LEV A;  3ASO C;  2LCH A;  3JT1 A;  3ZVR A;  3R2P A;  2LD6 A;  2YZS A;  3EZH A;  4CS8 A;  2H7V C;  1LS1 A;  2DB4 A;  1U0B B;  4WGZ A;  1LE4 A;  5L0H A;  1QVX A;  1G4U S;  3B71 A;  5L0D A;  1TWH A;  3CSK A;  2OEX A;  3HNL A;  2CCY A;  4JEB A;  3VM6 A;  2HSB A;  3G4Z A;  2Y69 C;  3NYJ A;  4JUR I;  1T6I A;  1Z6A A;  2P7V A;  4WAB A;  2XXA A;  2YRF A;  4DRJ B;  3K6B A;  1ZU4 A;  1W2W A;  2HKV A;  1YAU O;  1A7E A;  1FMV A;  4LLE A;  1VTM P;  1XZQ A;  3M4B A;  1OCO C;  3SP1 A;  1QSP A;  4MW8 A;  2KK1 A;  4G0H A;  5EK0 A;  3KL4 A;  5K0I A;  2A1D D;  5D92 A;  3U3B A;  3DAG A;  2KJG A;  2QLA A;  3O10 A;  2OJQ A;  1S05 A;  1HE9 A;  2CNW A;  2ETS A;  2G3V A;  3N2Z B;  4MVU A;  4CDA A;  5L0C A;  1D0X A;  3CQZ A;  3G50 A;  4BEJ A;  3K7D A;  4LAC B;  3S27 A;  3QTH A;  3HNK A;  4DBR A;  1E86 A;  2R05 A;  1Z63 A;  2WVO A;  1NSG B;  2KW3 C;  2L6G A;  1K05 A;  3EQL F;  4P9T A;  3VF0 A;  1WN0 A;  2ZPA A;  3E70 C;  5COM A;  1ZHW A;  2AVK A;  4RDA A;  5A69 A;  3S84 A;  4ONS A;  3LNR A;  1KU2 A;  2HV7 A;  2J9W A;  5HV9 A;  3M79 A;  4CDV A;  1OW6 A;  1R4T A;  3JTL O;  5T3T A;  4PR9 A;  5EGY A;  2R03 A;  1V74 B;  1CGN A;  4OD5 A;  1ZHX A;  5B3I A;  1U89 A;  1L7C A;  2Q00 A;  1QPU A;  4U5E E;  3B29 A;  2MWQ A;  3JYH A;  1O5H A;  4W8K A;  4PJJ A;  1QLE C;  2HSQ A;  3GWN A;  2LK4 A;  2R7V A;  1Q0D A;  4AE4 A;  5KYU B;  1NFO A;  3JYY A;  2HJ3 A;  4G7O F;  3I5P A;  4O7G A;  2Y3G A;  3O39 A;  1D1A A;  4YJW A;  4MTF A;  1BR4 A;  2A0B A;  2RD9 A;  4I1M A;  3RF3 A;  1E84 A;  4LDK A;  2IXO A;  1VMA A;  3OA1 A;  2BC5 A;  1N1C A;  2YL0 A;  3EFO B;  1E2X A;  3LS0 A;  5T1D B;  1OW8 A;  2C04 A;  2J7P D;  2KGO A;  2PX0 A;  4L6R A;  3CZ6 A;  2P1A A;  1YAR O;  1HY5 A;  3JSZ A;  4ZLC A;  2IXM A;  1WAS A;  5DQT A;  1YZC A;  5HSW A;  2Z15 A;  3EHM A;  1NU9 C;  2NSF A;  1YA9 A;  4PFP A;  3N0T A;  5KYY A;  4N4W A;  1TWC A;  3EH1 A;  3H65 A;  3SXZ A;  1I4Y A;  3RVZ A;  1PV3 A;  3BRJ A;  4IAO A;  1Q0F A;  1GS9 A;  4U5C E;  2NUT B;  4K0D A;  1U6H A;  2DYS C;  2NUP B;  3EH2 A;  2VH3 A;  3EPV A;  5KYY B;  1VLT A;  3ABM C;  2X51 A;  3UMI A;  5KYU A;  1NG1 A;  2WVN A;  3GEI A;  3FAP B;  3K66 A;  1M2V B;  3C8G A;  4MVR A;  4IB4 A;  3FOP A;  4O79 A;  2HFI A;  4YT5 A;  3SYN A;  1E85 A;  2EIM C;  2YL1 A;  1HMO A;  1YYJ A;  2YWA A;  1VLS A;  3EG9 A;  4IWB A;  1CGM E;  3US6 A;  4U5F E;  3C8Z A;  2XLD A;  3EFO A;  2L81 A;  2WB7 A;  3IQT A;  4J32 B;  4MQ9 F;  4NC3 A;  4E18 A;  2VAS A;  3GOD A;  1J8M F;  1MQV A;  2Y3D A;  4ER9 A;  3PDM P;  5L0F A;  3S9O A;  3HLZ A;  1YVI A;  2EIL C;  5COF A;  1J8Y F;  1A7V A;  4EBB A;  3T6G B;  3DZA A;  4EKW A;  3W8H A;  4MVQ A;  2BE5 F;  2NUP A;  1QZX A;  4OD4 A;  3EZI A;  5JSL A;  3RFY A;  2HZ8 A;  1VYI A;  2A68 F;  2J46 A;  2YKZ A;  5KYN A;  3ITF A;  2TMV P;  1MND A;  4E0H A;  2P6V A;  1MMG A;  4CSA C;  4OIN F;  1M56 C;  2R7Q A;  2ZXW C;  3V7O A;  2XM4 A;  1RKC A;  4CIH A;  2YLI A;  1YA7 O;  2LFF A;  1OQC A;  4WGY A;  5A6J A;  3EG9 B;  3U3F A;  3DXJ F;  4W8P A;  4EBJ A;  5DS5 A;  3R7C A;  4NQF A;  4KC9 A;  3QZC A;  1JOG A;  2HS5 A;  2KNH A;  3ZC4 A;  5L0I A;  4JCH A;  3B9Q A;  3ABL C;  1SYQ A;  1VOM A;  4YN0 B;  3FHD A;  4ANJ A;  4C3E A;  1OXB A;  5BQG A;  1O87 A;  1R5I D;  1TQG A;  2FGY A;  2LP4 A;  3V5Y A;  1YYX A;  3C18 A;  5FZT A;  1OKK D;  3GEE A;  3ZTM A;  4P9F A;  4U5G A;  5CI9 A;  1SZI A;  3NDB B;  4XEF A;  2L6F A;  2XL6 A;  4KNV A;  1BZ4 A;  4PAC A;  3M4C A;  3RYL A;  3QVZ A;  1L3P A;  4JTD B;  5B1A C;  5JLI A;  2HMQ A;  3KKB A;  4LLC A;  4D4X A;  2KYH A;  3EJN A;  3ZSU A;  3S28 A;  1FTS A;  1WTY A;  4YT2 A;  3QVY A;  1G8X A;  5BUO A;  3IHU A;  2XL4 A;  3ASN C;  2I15 A;  4ZLD A;  1EQ1 A;  1OXK A;  1Q0M A;  5AGF A;  4MVO A;  5B1B C;  3SXM A;  3UMK A;  3DM5 A;  2H7O A;  2A6H F;  4CBE A;  1TFO B;  1Y6D A;  4P6I C;  2DGJ A;  4Z9H A;  4RD9 A;  1TR2 A;  3JRT A;  2R7O A;  3WOD F;  2W45 A;  1F1M A;  4I1O B;  2EIJ C;  4QDL A;  4EBK A;  1HW1 A;  3I5Q A;  2C03 A;  4AL1 A;  3UGO A;  3SXY A;  1C02 A;  1E83 A;  4XPY A;  1G4W R;  4UDV A;  4AX2 A;  2BL2 A;  2LQG A;  5A6A A;  1K04 A;  2XLM A;  4OIP F;  4HEA J;  1GGQ A;  1SF8 A;  1Q0G A;  2MHR A;  2OCC C;  2OJE D;  3JCU Q;  2MYS A;  4G78 A;  4NCQ A;  4JJF A;  1MMA A;  4JKV A;  1ORY A;  1ZHY A;  3NYM A;  5L0J A;  4CSA A;  5E3C A;  4PJL A;  1EA8 A;  1RKE B;  2DYR C;  4IRU A;  3ZIB A;  3AJM A;  3T4R A;  3UNG C;  5D91 A;  2YL3 A;  3SEO A;  2VCA A;  3U9M A;  2B0J A;  2B0H A;  2R9R B;  1RJ9 A;  3JRM O;  4N6H A;  3ABK C;  5JP7 A;  1Z7Q c;  3TUL A;  2YLG A;  3EGD A;  3SNH A;  2AWC A;  4U9E A;  3TOM A;  1LIH A;  2HUJ A;  3ZTZ A;  5KYW A;  4JC7 A;  2LIG A;  1RJ9 B;  3B0V C;  1H6G A;  4IJJ A;  5IY5 C;  3LEO A;  2J45 A;  4J30 B;  4QI2 A;  4LER A;  2ZXR A;  1I4Z A;  4K1O A;  2L6H A;  1MMD A;  3AQB A;  4YL0 A;  4A2N B;  1ZW3 A;  2XXA B;  4MTG A;  2UUH A;  1OR2 A;  4MVM A;  3TOL A;  4XEK A;  4JEA A;  5COG A;  2IXP A;  3LLK A;  4BJ6 C;  2IBF A;  2Q9B A;  4EIY A;  3U0C A;  1D0Y A;  3Q6M A;  2CYD A;  2Q4F A;  4A4A A;  3TQO A;  1JRA A;  4GYT A;  2HMZ A;  4JRZ A;  2F22 A;  4JW1 A;  3Q7L A;  1TFK B;  2YL7 A;  5AC4 A;  1LI5 A; 
#chains in the Genus database with same CATH homology
 4YL3 A;  5BQH A;  2Q7R A;  4NTB A;  4J7T A;  4BPM A;  4AL1 A;  4JC7 A;  3PCV A;  4NTA A;  2UUI A;  3LEO A;  4YK5 A;  4AL0 A;  2H8A A;  4YL0 A;  4J7Y A;  2UUH A;  4JCZ A;  4WAB A;  4YL1 A;  3DWW A;  5HV9 A;  2PNO A;  3HKK A;  5BQI A;  5K0I A;  4JRZ A;  4NTF A;  5BQG A;  3B29 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...