5K0IA

Mpges1 bound to an inhibitor
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
148
structure length
147
Chain Sequence
SLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYRSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGKLRAPIRSVTYTLAQLPCASMALQILWEAARHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase/isomerase inhibitor
molecule keywords Prostaglandin E synthase
publication title Characterization of 3,3-dimethyl substituted N-aryl piperidines as potent microsomal prostaglandin E synthase-1 inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 65
structure length 147
sequence length 148
ec nomenclature ec 5.3.99.3: Prostaglandin-E synthase.
pdb deposition date 2016-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 5k0iA00
4YL3A 4J7TA 5BQGA 5K0IA 3PCVA 4AL1A 4WABA 2UUHA 4YL0A 3DWWA 4BPMA 4YK5A 3LEOA 4JCZA 4NTBA 2Q7RA 4AL0A 2UUIA 4YL1A 2H8AA 2PNOA 4NTAA 4J7YA 5BQHA 3B29A 3HKKA 5HV9A 5BQIA 4NTFA 4JC7A 4JRZA
chains in the Genus database with same CATH superfamily
3V5XA 2YLIA 4ZLCA 2HJ3A 4Z9IA 2GWWA 4LDKA 5D91A 4DVYP 1Z3IX 1M2VB 1TQGA 3H65A 3MFNA 3MX3A 3UMIA 2B0HA 4CDAA 3EFOA 3EH1A 2H7OA 4BPMA 1RMVA 3POVA 2IXNA 2IXMA 2P6VA 1OCRC 3V5ZA 2VC9A 3I4UA 1V55C 3C8GA 3U8PA 2A6EF 2Y3GA 3TULA 2P0NA 3L0IA 4YL1A 2L6FA 1SF8A 4YT2A 1SZIA 3OA1A 4LLEA 2LP4A 3NG1A 4Q7CA 3SXYA 4EIYA 2W9YA 1L3PA 4WJ0A 1TWHA 5BQHA 2R03A 3W4YA 4C7OA 2LFDA 2XS8A 5JUAA 2OEVA 2XL8A 3EGDA 4PFPA 5JP7A 3VF0A 2YWAA 2ZXOA 4PJJA 3VM6A 4CS8A 2J9BA 3NKDA 4G7HF 4HFKB 1YYJA 2D5RB 1KNYA 1WOLA 3G50A 2VH3A 5DS6A 2KSFA 3PCVA 2AU5A 2RSEB 1I4YA 3VRCA 5A6BD 2HMQA 4YL0A 4P9TA 4DOZA 4MVQA 3BRJA 1NSGB 3H2VA 3JT1A 4GYTA 5L0JA 2Q7RA 1PV3A 4MVSA 1LS4A 1U0BB 4U5HA 4OD5A 1OW6A 3TK0A 1ZW3A 2OCCC 3FMSA 3LS1A 3LUTB 4K0DA 4BEJA 5E3CA 1CGME 3QVZA 5KYXB 2JPUA 4JTDB 2VB6A 2Q3TA 4O6NA 3NDBB 3DM9B 3LLIA 5DQTA 1T9KA 4P6IC 3HNLA 3V5YA 2MWQA 1ZW2A 5L3QA 3QVYA 3SYNA 1LPEA 1PCXA 2X0CA 1E85A 2A6HF 1GM5A 4I1MA 1JOGA 2A68F 3JYYA 5E3AA 3RVYA 4Z9JA 3W2WA 3WODF 4HFFB 2UUHA 2OJQA 2EPKX 4G78A 1ZZPA 1JPNA 1GQAA 1OW8A 1TKNA 2KQ9A 3KYJA 5DLJA 2XLWA 2G3KA 3JTLO 4I44A 5KYYB 3MBGA 5JRAA 3N2ZB 2EIJC 1IZMA 3RQFA 5KYUB 1HE9A 2R7VA 1GS9A 1RJ9A 2EPNA 4MW3A 2H8AA 3Q6NA 1M2OA 1IW7F 1Q0DA 3EHNA 5IY5C 4NC3A 2AWCA 2YL3A 4BJTA 4OIRF 5HV9A 1S05A 2O9XA 2LK4A 4C3BA 3EPVA 3DJUB 3JYHA 4CDYA 2HV6A 2VCCA 2I8BA 5JT4A 4J7TA 4PJMA 3G4ZA 2BL2A 5AGFA 3EG9A 2L81A 1V74B 2LFFA 4IARA 5E2QA 3E9VA 3T6BA 2KJGA 4E0IA 2EIMC 1NG1A 1HMOA 4H4KC 2E87A 5DS4A 3LNRA 3ZSUA 3C8GD 2G3VA 1ORSC 3DZAA 1TWAA 3KPHA 2J45A 4PJLA 1XZPA 2YRFA 3RW0A 3I5QA 4Q4ZF 4MVZA 4G7ZF 4EBKA 3UMHA 1QVXA 1G8XA 2HJMA 1RXQA 3RFYA 4N6CA 4N6HA 2IXOA 2AP3A 4FWVA 1W2WA 4NTAA 1VTMP 1TWGA 3SP1A 2ZXWC 2ASRA 3F46A 2PX3A 2IOQA 3GWLA 4FAPB 2QY9A 3PDMP 3GM1A 4Q5SF 3EHMA 3SXKA 2EPLX 4U5FE 2XRHA 1HY5A 3ZWIA 3GM2A 1CPRA 2WZFA 3AQBA 3O39A 3RH3A 3U9JA 3PHF2 5EK0A 5L0DA 4XQ1A 4ZLDA 1C03A 2H7BA 3HNKA 3OWTA 1Z23A 3Q7LA 3R2PA 2YLDA 5AC4A 2A1DD 1A0BA 2EILC 2X51A 1WGWA 1Z7Qc 1O3UA 3RQEA 4E7SA 1SYQA 3IQTA 3V7OA 1KTMA 4DRJB 4CX9A 2LQGA 3JRTA 3LEVA 3M4BA 3HNIA 3DMDA 1FAPB 1YJGA 1R4TA 2ZD9A 4ULVA 3SXZA 5BUOA 3LESA 2YEVA 3K66A 4JKVA 5L3VA 4JVSA 2VASA 1WATA 2P7VA 2CNWD 2L9JA 3DAGA 3US6A 4E17A 4E0HA 4J32B 4H54A 1FR0A 5BQIA 1BR4A 1LIHA 2IXPA 3HTKC 1YA9A 4CIHA 3LS0A 1C02A 3W8HA 5AC5A 3LAYA 5K0IA 4UDVA 2LCHA 3B0VC 4EBBA 4JTAB 1LS1A 1HE1A 3NYJA 2XL4A 3W2VA 2WB7A 3ECSA 3VAYA 4LDRA 4YN0B 5L0IA 3TJ5A 3Q6MA 2Q9CA 2WL8A 1MMGA 1UG7A 4KC9A 4O79A 4AX2A 3TQOA 1T01A 2XS1A 3J06A 1MQVA 2XLOA 2CYDA 2R7OA 2PFDA 2XXAB 2XLMA 3T6JA 1T6UA 3JRMO 1TWCA 5A6KA 1NLXA 1MMAA 4JE9A 4XWJA 1E86A 3G4XA 2IM8A 4DRIB 2QE9A 3U3BA 2XLDA 1QSPA 2JD3A 2R7QA 2XM4A 4YL3A 1EA8A 4MVUA 3U9MA 2R25A 5D92A 2QLAA 4XLNF 4JCHA 1E83A 1FNTc 3M1CB 1D0XA 256BA 2I15A 1ZHZA 4U5DE 4XEFA 4BJ6A 4BJ1A 1CPQA 3FDQA 3RIPA 2CW0F 2D4UA 2HKVA 3O10A 1QPUA 4JTCB 3K7DA 3QW1A 1ZHWA 5B1BC 4NTBA 4C3EA 1VLSA 3DXJF 1FFHA 3IPMO 5DVWA 3S29A 1A7DA 1SMYF 3EGXB 3T6GB 3UMKA 2LD6A 1MNEA 5JLIA 4I3MA 1LVKA 2LIGA 5FZTA 4CS8C 1KU2A 4J7YA 1I4ZA 3NMKA 3EFOB 4IRUA 3F47A 1OR3A 2ICWG 2W45A 3N0TA 3N24A 3QZCA 4QI0A 2HUJA 3SNHA 1O87A 2QNLA 1WASA 5KYYA 1M56C 2VCBA 3GWNA 1T6QA 2CNWA 4O7GA 2FAPB 3CSKA 3A11A 3L8JA 2ZPAA 4O6MA 3DAFA 5EHHA 2J0WA 3ASOC 2R9RB 1E2XA 4U5CE 3S84A 3Q7GA 2V26A 3DKAA 1EQ1A 4CIPA 1RKEB 2YL7A 4YT8A 2NPUA 2DGJA 1T6IA 4JW1A 4N06A 1HW2A 5JVEA 2HSBA 4L6RA 2IYLD 3NYLA 4MTOA 5L0FA 3A9CA 3ATPA 2W4BA 3K6BA 1JAFA 1Y4CA 2L6GA 5KYNA 1LI5A 2NUPB 1ST6A 1YZAA 2HS5A 4AE4B 3DJNB 3HKKA 1APCA 1UFBA 2WVQA 2WZLA 2YLGA 2M64A 2MHRA 1BZ4A 1LE4A 3CZ6A 4CS9A 1Z5ZA 5CIVA 1Q0GA 5HSWA 3AG4C 1LI7A 3OEOA 4JRZA 5F5HA 2KNHA 4HE8D 4OD4A 1K04A 2B0JA 2KW3C 1N1CA 1HW1A 3AQCA 2R7TA 3HJCA 3O55A 4IAQA 3ZIBA 3ZVRA 3ABMC 1ZYRF 2R7XA 4M63A 2MYSA 1FMVA 4WGYA 5B3IA 3DWWA 2YVKA 4IGGA 4U5BE 1F1MA 1XZQA 2DB4A 2KK1A 2R05A 4YJWA 1JRAA 3U5SA 3T4RA 2YQYA 5KYWB 4F4BA 1CGNA 3NMJA 2L6HA 4AL0A 3AG3C 4CS9C 1H9GA 2NUTB 2P61A 5B1AC 1ZHYA 3SZRA 3M4CA 3AGUA 3QW0A 2HSQA 1RKCA 3TJ6A 4W8PA 2L7AA 2XSEA 4C3DA 2JX0A 3GORA 4D4NA 2AVKA 2FGYA 4ANJA 3C8ZA 3WAQA 2EPMX 4X0RA 1G5ZA 2J46A 2Q9AA 1O5HA 1QZXA 5BQGA 4XPXA 1RJ9B 3H2UA 4B6IA 1EKYA 1LKXA 5COMA 2A0BA 4AL1A 4W8KA 2H7VC 4WABA 4XEKA 2R7SA 3KH2A 4ER9A 2W4MA 1Z6AA 4EUKB 2WZGA 3CAXA 3GEIA 3S90A 1VK5A 1YDIA 2G62A 2WVNA 4LERA 3LLKA 3M15A 1OR2A 2NG1A 1T5OA 3NRHA 4PJNA 4EHPA 2CCYA 3LJBA 3NYMA 3X2QC 1Z63A 1HMDA 4RDAA 3S9OA 4BG0A 2R7UA 3LNMB 3ZTZA 5COGA 1OQCA 1M2VA 1OCZC 5L0HA 2PNOA 4DRHB 2BC5A 1ZHTA 4OIPF 2YL0A 2OG2A 2XLVA 4K7BA 4BEMJ 1WWPA 3QTHA 3E70C 4FX5A 4IJJA 1LM3B 3ZDLA 3UGPA 2Q00A 3PMRA 4DJ9A 1G4US 2HFIA 1GGQA 1WTYA 1ZU5A 2J9WA 2OU6A 3ABLC 3CQZA 3JCUQ 2XL6A 3WHNA 1ORJA 3TD7A 1YARO 1JPJA 4MTFA 1DOWA 2GAQA 1JMWA 4YK5A 4EKWA 1MNDA 3GANA 3GEEA 2HV7A 1A41A 1VLTA 3KYIA 4JURI 2C04A 4CBEA 4YWQA 1QLEC 3W8IA 4EWCA 1MMNA 4K1OA 4XPWA 1AEPA 4OIOF 4OINF 3S27A 4JZAA 2BE5F 3FAPB 4QI2A 1VYKA 1C17M 2FFHA 2DYRC 1ZHXA 2A69F 4IAOA 2YKZA 1BR2A 2C03A 1Q0KA 3KKBA 1G4WR 1E84A 1A7VA 1B68A 3RYLA 4WGZA 2Q4FA 2M4EA 1VB5A 3EGXA 2J0XA 3GEHA 3B71A 3GM3A 3C62A 4JEAA 5T1DB 1CGOA 4LLCA 1ZU4A 1ZVZA 1YYXA 2OQMA 3EZIA 4P9FA 5E33A 4YT4A 5KYXA 3MLGA 1H7IA 1V54C 3NMIA 1PD1A 3KL4A 5JSLA 4YT5A 3L8IA 3SXMA 2WVOA 5FCLA 3T9OA 3MYIA 4CSAA 2F22A 1YA7O 4G7OF 5L0CA 2PBEA 2V3CC 4IB4A 2HMZA 3S0XA 1M57C 1FTSA 1NU7D 2KGOA 2J7PA 2PP4A 3FOPA 3U8VA 4CJOA 4PFOA 1WN0A 4QDLA 3RQGA 4XLPF 1U6HA 3ABKC 3B29A 4PR9A 5F28E 4DXWA 4DBRA 5EGYA 2R02A 1RKEA 2Y3HA 3UNGC 4BJ6C 1OKKD 3DI5A 5CI9A 1PD0A 2OOCA 3K1HA 4MQ9F 2IBFA 3U0CA 3NKEA 3QMKA 3C8GB 3I5PA 4CSAC 5KYUA 5B3SC 5GPGB 5F5FA 4MS2A 2NUPA 5TJ5E 1NFNA 3EJNA 4A2NB 3TOMA 1YVIA 4PK4A 1VYIA 2XLEA 4PACA 1OXBA 2EINC 3O6XA 4AE4A 5A6AA 2R7RA 2Q9BA 2VCAA 3C63A 4GEHA 4C7OB 3FAJA 3TOLA 1J8MF 4G0HA 1H9TA 4XPYA 2QUPA 3MYFA 3EGDB 4NY3A 4R32A 4D4XA 1VMAA 5DS5A 3B9QA 3EQLF 3K33A 4U5EE 2KC3A 3FHDA 1MMDA 2Y69C 2YHSA 3M79A 4RBNA 4OIQF 1NFOA 4MNDA 4XEVA 2NSGA 1D0YA 2J9UA 3WG7C 1SR2A 2Z15A 1H6GA 1OW7A 5KYWA 1M6TA 1J8YF 1Q0MA 1V4AA 3UGOA 2HZ8A 1FFTC 2NUTA 3DE8A 3AOUA 3HLZA 1LE2A 3UR3C 4BJ5A 1AUEA 3VYWA 3ZQVA 2Y3DA 2KYHA 2GDCA 3C18A 2AWYA 2LSEA 2GFHA 3ITFA 3L1MA 4NCQA 3AG1C 4DBQA 1OCOC 3DM5A 1YLMA 2R7WA 3JSEO 1JR8A 1ORYA 1K05A 2OKUA 3S28A 1OCCC 5COFA 1D1BA 2EPOA 3B0PA 4MW8A 1OXKA 1QKRA 3RF3A 2ZXRA 3KMIA 4U5GA 4E18A 1TFOB 1BDJB 3BEHA 3IHUA 4MVRA 1D0ZA 3U2MA 2YL1A 3JZ0A 4BJ5C 1L7CA 3U3FA 2Y3BA 1I5NA 1K40A 2GA0A 3ZTMA 4E7ZA 4NTFA 3K1IA 2CGEA 3U2LA 4AK9A 1D1CA 4GQHA 3IQCA 3ZG1A 4IWBA 3EZHA 1OKKA 2PX0A 3EH2A 4JJFA 1S7ZA 1A7EA 5DQZA 3L34A 4CS7A 2PF4E 1NZEA 3RKOF 2TMVP 3R7CA 4NQFA 3ZQYA 4ONSA 4JIOA 5A6BA 2P1AA 2RD9A 4MTGA 3ZC4A 4KI2A 2DI3A 5A6JA 4JCZA 1TR2A 2Y39A 1BBHA 1QQ3A 4LDQA 2EIKC 2J7PD 4RD9A 4O6YA 3FOOA 2UUIA 3B0UX 3K1IC 3FVYA 1FMWA 2XM0A 3EG9B 3AJMA 4JEBA 2J8WA 1NBBA 2QTVA 4U9DA 2CDQA 3IQ5A 5JS5A 4KNVA 1BR1A 1TFKB 1DOVA 4JJGA 1AVOB 4I1OB 4JC7A 2DYSC 2J9VA 3JSZA 4J30B 3SEOA 4MVOA 1R5ID 3X1OA 1XWJA 4CJGA 3AGTA 5T3WA 1D1AA 4MVMA 2ETSA 2XXAA 4LACB 1YAUO 4FESA 4KNWA 1VOMA 3DE9A 4U9EA 4ULWA 4A4AA 4KBLA 3AG2C 3LEOA 4HEAJ 2OEXA 4DVZA 2NSFA 2XLHA 3HNJA 2OJED 3ASNC 5CI8A 3FXHA 4XTKA 3CEXA 4EBJA 3IQ6A 5T3TA 3GODA 3DD7A 4N4WA 4CDVA 1Y6DA 1EI7A 3RVZA 2ZXPA 3IEEA 1NU9C 1YZCA 1U89A 5L0GA 2A0UA 5A69A 4Z9HA 1Q0FA 2YZSA 3C7JA 1RCPA
chains in the Genus database with same CATH topology
4YL3A 4J7TA 5BQGA 5K0IA 3PCVA 4AL1A 4WABA 2UUHA 4YL0A 3DWWA 4BPMA 4YK5A 3LEOA 4JCZA 4NTBA 2Q7RA 4AL0A 2UUIA 4YL1A 2H8AA 2PNOA 4NTAA 4J7YA 5BQHA 3B29A 3HKKA 5HV9A 5BQIA 4NTFA 4JC7A 4JRZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YL3 A;  4J7T A;  5BQG A;  5K0I A;  3PCV A;  4AL1 A;  4WAB A;  2UUH A;  4YL0 A;  3DWW A;  4BPM A;  4YK5 A;  3LEO A;  4JCZ A;  4NTB A;  2Q7R A;  4AL0 A;  2UUI A;  4YL1 A;  2H8A A;  2PNO A;  4NTA A;  4J7Y A;  5BQH A;  3B29 A;  3HKK A;  5HV9 A;  5BQI A;  4NTF A;  4JC7 A;  4JRZ A; 
#chains in the Genus database with same CATH topology
 3V5X A;  2YLI A;  4ZLC A;  2HJ3 A;  4Z9I A;  2GWW A;  4LDK A;  5D91 A;  4DVY P;  1Z3I X;  1M2V B;  1TQG A;  3H65 A;  3MFN A;  3MX3 A;  3UMI A;  2B0H A;  4CDA A;  3EFO A;  3EH1 A;  2H7O A;  4BPM A;  1RMV A;  3POV A;  2IXN A;  2IXM A;  2P6V A;  1OCR C;  3V5Z A;  2VC9 A;  3I4U A;  1V55 C;  3C8G A;  3U8P A;  2A6E F;  2Y3G A;  3TUL A;  2P0N A;  3L0I A;  4YL1 A;  2L6F A;  1SF8 A;  4YT2 A;  1SZI A;  3OA1 A;  4LLE A;  2LP4 A;  3NG1 A;  4Q7C A;  3SXY A;  4EIY A;  2W9Y A;  1L3P A;  4WJ0 A;  1TWH A;  5BQH A;  2R03 A;  3W4Y A;  4C7O A;  2LFD A;  2XS8 A;  5JUA A;  2OEV A;  2XL8 A;  3EGD A;  4PFP A;  5JP7 A;  3VF0 A;  2YWA A;  2ZXO A;  4PJJ A;  3VM6 A;  4CS8 A;  2J9B A;  3NKD A;  4G7H F;  4HFK B;  1YYJ A;  2D5R B;  1KNY A;  1WOL A;  3G50 A;  2VH3 A;  5DS6 A;  2KSF A;  3PCV A;  2AU5 A;  2RSE B;  1I4Y A;  3VRC A;  5A6B D;  2HMQ A;  4YL0 A;  4P9T A;  4DOZ A;  4MVQ A;  3BRJ A;  1NSG B;  3H2V A;  3JT1 A;  4GYT A;  5L0J A;  2Q7R A;  1PV3 A;  4MVS A;  1LS4 A;  1U0B B;  4U5H A;  4OD5 A;  1OW6 A;  3TK0 A;  1ZW3 A;  2OCC C;  3FMS A;  3LS1 A;  3LUT B;  4K0D A;  4BEJ A;  5E3C A;  1CGM E;  3QVZ A;  5KYX B;  2JPU A;  4JTD B;  2VB6 A;  2Q3T A;  4O6N A;  3NDB B;  3DM9 B;  3LLI A;  5DQT A;  1T9K A;  4P6I C;  3HNL A;  3V5Y A;  2MWQ A;  1ZW2 A;  5L3Q A;  3QVY A;  3SYN A;  1LPE A;  1PCX A;  2X0C A;  1E85 A;  2A6H F;  1GM5 A;  4I1M A;  1JOG A;  2A68 F;  3JYY A;  5E3A A;  3RVY A;  4Z9J A;  3W2W A;  3WOD F;  4HFF B;  2UUH A;  2OJQ A;  2EPK X;  4G78 A;  1ZZP A;  1JPN A;  1GQA A;  1OW8 A;  1TKN A;  2KQ9 A;  3KYJ A;  5DLJ A;  2XLW A;  2G3K A;  3JTL O;  4I44 A;  5KYY B;  3MBG A;  5JRA A;  3N2Z B;  2EIJ C;  1IZM A;  3RQF A;  5KYU B;  1HE9 A;  2R7V A;  1GS9 A;  1RJ9 A;  2EPN A;  4MW3 A;  2H8A A;  3Q6N A;  1M2O A;  1IW7 F;  1Q0D A;  3EHN A;  5IY5 C;  4NC3 A;  2AWC A;  2YL3 A;  4BJT A;  4OIR F;  5HV9 A;  1S05 A;  2O9X A;  2LK4 A;  4C3B A;  3EPV A;  3DJU B;  3JYH A;  4CDY A;  2HV6 A;  2VCC A;  2I8B A;  5JT4 A;  4J7T A;  4PJM A;  3G4Z A;  2BL2 A;  5AGF A;  3EG9 A;  2L81 A;  1V74 B;  2LFF A;  4IAR A;  5E2Q A;  3E9V A;  3T6B A;  2KJG A;  4E0I A;  2EIM C;  1NG1 A;  1HMO A;  4H4K C;  2E87 A;  5DS4 A;  3LNR A;  3ZSU A;  3C8G D;  2G3V A;  1ORS C;  3DZA A;  1TWA A;  3KPH A;  2J45 A;  4PJL A;  1XZP A;  2YRF A;  3RW0 A;  3I5Q A;  4Q4Z F;  4MVZ A;  4G7Z F;  4EBK A;  3UMH A;  1QVX A;  1G8X A;  2HJM A;  1RXQ A;  3RFY A;  4N6C A;  4N6H A;  2IXO A;  2AP3 A;  4FWV A;  1W2W A;  4NTA A;  1VTM P;  1TWG A;  3SP1 A;  2ZXW C;  2ASR A;  3F46 A;  2PX3 A;  2IOQ A;  3GWL A;  4FAP B;  2QY9 A;  3PDM P;  3GM1 A;  4Q5S F;  3EHM A;  3SXK A;  2EPL X;  4U5F E;  2XRH A;  1HY5 A;  3ZWI A;  3GM2 A;  1CPR A;  2WZF A;  3AQB A;  3O39 A;  3RH3 A;  3U9J A;  3PHF 2;  5EK0 A;  5L0D A;  4XQ1 A;  4ZLD A;  1C03 A;  2H7B A;  3HNK A;  3OWT A;  1Z23 A;  3Q7L A;  3R2P A;  2YLD A;  5AC4 A;  2A1D D;  1A0B A;  2EIL C;  2X51 A;  1WGW A;  1Z7Q c;  1O3U A;  3RQE A;  4E7S A;  1SYQ A;  3IQT A;  3V7O A;  1KTM A;  4DRJ B;  4CX9 A;  2LQG A;  3JRT A;  3LEV A;  3M4B A;  3HNI A;  3DMD A;  1FAP B;  1YJG A;  1R4T A;  2ZD9 A;  4ULV A;  3SXZ A;  5BUO A;  3LES A;  2YEV A;  3K66 A;  4JKV A;  5L3V A;  4JVS A;  2VAS A;  1WAT A;  2P7V A;  2CNW D;  2L9J A;  3DAG A;  3US6 A;  4E17 A;  4E0H A;  4J32 B;  4H54 A;  1FR0 A;  5BQI A;  1BR4 A;  1LIH A;  2IXP A;  3HTK C;  1YA9 A;  4CIH A;  3LS0 A;  1C02 A;  3W8H A;  5AC5 A;  3LAY A;  5K0I A;  4UDV A;  2LCH A;  3B0V C;  4EBB A;  4JTA B;  1LS1 A;  1HE1 A;  3NYJ A;  2XL4 A;  3W2V A;  2WB7 A;  3ECS A;  3VAY A;  4LDR A;  4YN0 B;  5L0I A;  3TJ5 A;  3Q6M A;  2Q9C A;  2WL8 A;  1MMG A;  1UG7 A;  4KC9 A;  4O79 A;  4AX2 A;  3TQO A;  1T01 A;  2XS1 A;  3J06 A;  1MQV A;  2XLO A;  2CYD A;  2R7O A;  2PFD A;  2XXA B;  2XLM A;  3T6J A;  1T6U A;  3JRM O;  1TWC A;  5A6K A;  1NLX A;  1MMA A;  4JE9 A;  4XWJ A;  1E86 A;  3G4X A;  2IM8 A;  4DRI B;  2QE9 A;  3U3B A;  2XLD A;  1QSP A;  2JD3 A;  2R7Q A;  2XM4 A;  4YL3 A;  1EA8 A;  4MVU A;  3U9M A;  2R25 A;  5D92 A;  2QLA A;  4XLN F;  4JCH A;  1E83 A;  1FNT c;  3M1C B;  1D0X A;  256B A;  2I15 A;  1ZHZ A;  4U5D E;  4XEF A;  4BJ6 A;  4BJ1 A;  1CPQ A;  3FDQ A;  3RIP A;  2CW0 F;  2D4U A;  2HKV A;  3O10 A;  1QPU A;  4JTC B;  3K7D A;  3QW1 A;  1ZHW A;  5B1B C;  4NTB A;  4C3E A;  1VLS A;  3DXJ F;  1FFH A;  3IPM O;  5DVW A;  3S29 A;  1A7D A;  1SMY F;  3EGX B;  3T6G B;  3UMK A;  2LD6 A;  1MNE A;  5JLI A;  4I3M A;  1LVK A;  2LIG A;  5FZT A;  4CS8 C;  1KU2 A;  4J7Y A;  1I4Z A;  3NMK A;  3EFO B;  4IRU A;  3F47 A;  1OR3 A;  2ICW G;  2W45 A;  3N0T A;  3N24 A;  3QZC A;  4QI0 A;  2HUJ A;  3SNH A;  1O87 A;  2QNL A;  1WAS A;  5KYY A;  1M56 C;  2VCB A;  3GWN A;  1T6Q A;  2CNW A;  4O7G A;  2FAP B;  3CSK A;  3A11 A;  3L8J A;  2ZPA A;  4O6M A;  3DAF A;  5EHH A;  2J0W A;  3ASO C;  2R9R B;  1E2X A;  4U5C E;  3S84 A;  3Q7G A;  2V26 A;  3DKA A;  1EQ1 A;  4CIP A;  1RKE B;  2YL7 A;  4YT8 A;  2NPU A;  2DGJ A;  1T6I A;  4JW1 A;  4N06 A;  1HW2 A;  5JVE A;  2HSB A;  4L6R A;  2IYL D;  3NYL A;  4MTO A;  5L0F A;  3A9C A;  3ATP A;  2W4B A;  3K6B A;  1JAF A;  1Y4C A;  2L6G A;  5KYN A;  1LI5 A;  2NUP B;  1ST6 A;  1YZA A;  2HS5 A;  4AE4 B;  3DJN B;  3HKK A;  1APC A;  1UFB A;  2WVQ A;  2WZL A;  2YLG A;  2M64 A;  2MHR A;  1BZ4 A;  1LE4 A;  3CZ6 A;  4CS9 A;  1Z5Z A;  5CIV A;  1Q0G A;  5HSW A;  3AG4 C;  1LI7 A;  3OEO A;  4JRZ A;  5F5H A;  2KNH A;  4HE8 D;  4OD4 A;  1K04 A;  2B0J A;  2KW3 C;  1N1C A;  1HW1 A;  3AQC A;  2R7T A;  3HJC A;  3O55 A;  4IAQ A;  3ZIB A;  3ZVR A;  3ABM C;  1ZYR F;  2R7X A;  4M63 A;  2MYS A;  1FMV A;  4WGY A;  5B3I A;  3DWW A;  2YVK A;  4IGG A;  4U5B E;  1F1M A;  1XZQ A;  2DB4 A;  2KK1 A;  2R05 A;  4YJW A;  1JRA A;  3U5S A;  3T4R A;  2YQY A;  5KYW B;  4F4B A;  1CGN A;  3NMJ A;  2L6H A;  4AL0 A;  3AG3 C;  4CS9 C;  1H9G A;  2NUT B;  2P61 A;  5B1A C;  1ZHY A;  3SZR A;  3M4C A;  3AGU A;  3QW0 A;  2HSQ A;  1RKC A;  3TJ6 A;  4W8P A;  2L7A A;  2XSE A;  4C3D A;  2JX0 A;  3GOR A;  4D4N A;  2AVK A;  2FGY A;  4ANJ A;  3C8Z A;  3WAQ A;  2EPM X;  4X0R A;  1G5Z A;  2J46 A;  2Q9A A;  1O5H A;  1QZX A;  5BQG A;  4XPX A;  1RJ9 B;  3H2U A;  4B6I A;  1EKY A;  1LKX A;  5COM A;  2A0B A;  4AL1 A;  4W8K A;  2H7V C;  4WAB A;  4XEK A;  2R7S A;  3KH2 A;  4ER9 A;  2W4M A;  1Z6A A;  4EUK B;  2WZG A;  3CAX A;  3GEI A;  3S90 A;  1VK5 A;  1YDI A;  2G62 A;  2WVN A;  4LER A;  3LLK A;  3M15 A;  1OR2 A;  2NG1 A;  1T5O A;  3NRH A;  4PJN A;  4EHP A;  2CCY A;  3LJB A;  3NYM A;  3X2Q C;  1Z63 A;  1HMD A;  4RDA A;  3S9O A;  4BG0 A;  2R7U A;  3LNM B;  3ZTZ A;  5COG A;  1OQC A;  1M2V A;  1OCZ C;  5L0H A;  2PNO A;  4DRH B;  2BC5 A;  1ZHT A;  4OIP F;  2YL0 A;  2OG2 A;  2XLV A;  4K7B A;  4BEM J;  1WWP A;  3QTH A;  3E70 C;  4FX5 A;  4IJJ A;  1LM3 B;  3ZDL A;  3UGP A;  2Q00 A;  3PMR A;  4DJ9 A;  1G4U S;  2HFI A;  1GGQ A;  1WTY A;  1ZU5 A;  2J9W A;  2OU6 A;  3ABL C;  3CQZ A;  3JCU Q;  2XL6 A;  3WHN A;  1ORJ A;  3TD7 A;  1YAR O;  1JPJ A;  4MTF A;  1DOW A;  2GAQ A;  1JMW A;  4YK5 A;  4EKW A;  1MND A;  3GAN A;  3GEE A;  2HV7 A;  1A41 A;  1VLT A;  3KYI A;  4JUR I;  2C04 A;  4CBE A;  4YWQ A;  1QLE C;  3W8I A;  4EWC A;  1MMN A;  4K1O A;  4XPW A;  1AEP A;  4OIO F;  4OIN F;  3S27 A;  4JZA A;  2BE5 F;  3FAP B;  4QI2 A;  1VYK A;  1C17 M;  2FFH A;  2DYR C;  1ZHX A;  2A69 F;  4IAO A;  2YKZ A;  1BR2 A;  2C03 A;  1Q0K A;  3KKB A;  1G4W R;  1E84 A;  1A7V A;  1B68 A;  3RYL A;  4WGZ A;  2Q4F A;  2M4E A;  1VB5 A;  3EGX A;  2J0X A;  3GEH A;  3B71 A;  3GM3 A;  3C62 A;  4JEA A;  5T1D B;  1CGO A;  4LLC A;  1ZU4 A;  1ZVZ A;  1YYX A;  2OQM A;  3EZI A;  4P9F A;  5E33 A;  4YT4 A;  5KYX A;  3MLG A;  1H7I A;  1V54 C;  3NMI A;  1PD1 A;  3KL4 A;  5JSL A;  4YT5 A;  3L8I A;  3SXM A;  2WVO A;  5FCL A;  3T9O A;  3MYI A;  4CSA A;  2F22 A;  1YA7 O;  4G7O F;  5L0C A;  2PBE A;  2V3C C;  4IB4 A;  2HMZ A;  3S0X A;  1M57 C;  1FTS A;  1NU7 D;  2KGO A;  2J7P A;  2PP4 A;  3FOP A;  3U8V A;  4CJO A;  4PFO A;  1WN0 A;  4QDL A;  3RQG A;  4XLP F;  1U6H A;  3ABK C;  3B29 A;  4PR9 A;  5F28 E;  4DXW A;  4DBR A;  5EGY A;  2R02 A;  1RKE A;  2Y3H A;  3UNG C;  4BJ6 C;  1OKK D;  3DI5 A;  5CI9 A;  1PD0 A;  2OOC A;  3K1H A;  4MQ9 F;  2IBF A;  3U0C A;  3NKE A;  3QMK A;  3C8G B;  3I5P A;  4CSA C;  5KYU A;  5B3S C;  5GPG B;  5F5F A;  4MS2 A;  2NUP A;  5TJ5 E;  1NFN A;  3EJN A;  4A2N B;  3TOM A;  1YVI A;  4PK4 A;  1VYI A;  2XLE A;  4PAC A;  1OXB A;  2EIN C;  3O6X A;  4AE4 A;  5A6A A;  2R7R A;  2Q9B A;  2VCA A;  3C63 A;  4GEH A;  4C7O B;  3FAJ A;  3TOL A;  1J8M F;  4G0H A;  1H9T A;  4XPY A;  2QUP A;  3MYF A;  3EGD B;  4NY3 A;  4R32 A;  4D4X A;  1VMA A;  5DS5 A;  3B9Q A;  3EQL F;  3K33 A;  4U5E E;  2KC3 A;  3FHD A;  1MMD A;  2Y69 C;  2YHS A;  3M79 A;  4RBN A;  4OIQ F;  1NFO A;  4MND A;  4XEV A;  2NSG A;  1D0Y A;  2J9U A;  3WG7 C;  1SR2 A;  2Z15 A;  1H6G A;  1OW7 A;  5KYW A;  1M6T A;  1J8Y F;  1Q0M A;  1V4A A;  3UGO A;  2HZ8 A;  1FFT C;  2NUT A;  3DE8 A;  3AOU A;  3HLZ A;  1LE2 A;  3UR3 C;  4BJ5 A;  1AUE A;  3VYW A;  3ZQV A;  2Y3D A;  2KYH A;  2GDC A;  3C18 A;  2AWY A;  2LSE A;  2GFH A;  3ITF A;  3L1M A;  4NCQ A;  3AG1 C;  4DBQ A;  1OCO C;  3DM5 A;  1YLM A;  2R7W A;  3JSE O;  1JR8 A;  1ORY A;  1K05 A;  2OKU A;  3S28 A;  1OCC C;  5COF A;  1D1B A;  2EPO A;  3B0P A;  4MW8 A;  1OXK A;  1QKR A;  3RF3 A;  2ZXR A;  3KMI A;  4U5G A;  4E18 A;  1TFO B;  1BDJ B;  3BEH A;  3IHU A;  4MVR A;  1D0Z A;  3U2M A;  2YL1 A;  3JZ0 A;  4BJ5 C;  1L7C A;  3U3F A;  2Y3B A;  1I5N A;  1K40 A;  2GA0 A;  3ZTM A;  4E7Z A;  4NTF A;  3K1I A;  2CGE A;  3U2L A;  4AK9 A;  1D1C A;  4GQH A;  3IQC A;  3ZG1 A;  4IWB A;  3EZH A;  1OKK A;  2PX0 A;  3EH2 A;  4JJF A;  1S7Z A;  1A7E A;  5DQZ A;  3L34 A;  4CS7 A;  2PF4 E;  1NZE A;  3RKO F;  2TMV P;  3R7C A;  4NQF A;  3ZQY A;  4ONS A;  4JIO A;  5A6B A;  2P1A A;  2RD9 A;  4MTG A;  3ZC4 A;  4KI2 A;  2DI3 A;  5A6J A;  4JCZ A;  1TR2 A;  2Y39 A;  1BBH A;  1QQ3 A;  4LDQ A;  2EIK C;  2J7P D;  4RD9 A;  4O6Y A;  3FOO A;  2UUI A;  3B0U X;  3K1I C;  3FVY A;  1FMW A;  2XM0 A;  3EG9 B;  3AJM A;  4JEB A;  2J8W A;  1NBB A;  2QTV A;  4U9D A;  2CDQ A;  3IQ5 A;  5JS5 A;  4KNV A;  1BR1 A;  1TFK B;  1DOV A;  4JJG A;  1AVO B;  4I1O B;  4JC7 A;  2DYS C;  2J9V A;  3JSZ A;  4J30 B;  3SEO A;  4MVO A;  1R5I D;  3X1O A;  1XWJ A;  4CJG A;  3AGT A;  5T3W A;  1D1A A;  4MVM A;  2ETS A;  2XXA A;  4LAC B;  1YAU O;  4FES A;  4KNW A;  1VOM A;  3DE9 A;  4U9E A;  4ULW A;  4A4A A;  4KBL A;  3AG2 C;  3LEO A;  4HEA J;  2OEX A;  4DVZ A;  2NSF A;  2XLH A;  3HNJ A;  2OJE D;  3ASN C;  5CI8 A;  3FXH A;  4XTK A;  3CEX A;  4EBJ A;  3IQ6 A;  5T3T A;  3GOD A;  3DD7 A;  4N4W A;  4CDV A;  1Y6D A;  1EI7 A;  3RVZ A;  2ZXP A;  3IEE A;  1NU9 C;  1YZC A;  1U89 A;  5L0G A;  2A0U A;  5A69 A;  4Z9H A;  1Q0F A;  2YZS A;  3C7J A;  1RCP A; 
#chains in the Genus database with same CATH homology
 4YL3 A;  4J7T A;  5BQG A;  5K0I A;  3PCV A;  4AL1 A;  4WAB A;  2UUH A;  4YL0 A;  3DWW A;  4BPM A;  4YK5 A;  3LEO A;  4JCZ A;  4NTB A;  2Q7R A;  4AL0 A;  2UUI A;  4YL1 A;  2H8A A;  2PNO A;  4NTA A;  4J7Y A;  5BQH A;  3B29 A;  3HKK A;  5HV9 A;  5BQI A;  4NTF A;  4JC7 A;  4JRZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...