5K0IA

Mpges1 bound to an inhibitor
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
148
structure length
147
Chain Sequence
SLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYRSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGKLRAPIRSVTYTLAQLPCASMALQILWEAARHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Prostaglandin E synthase
publication title Characterization of 3,3-dimethyl substituted N-aryl piperidines as potent microsomal prostaglandin E synthase-1 inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/isomerase inhibitor
total genus 65
structure length 147
sequence length 148
ec nomenclature ec 5.3.99.3: Prostaglandin-E synthase.
pdb deposition date 2016-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 5k0iA00
4YL0A 3PCVA 4NTBA 3HKKA 4BPMA 4WABA 2PNOA 4J7TA 3B29A 2UUIA 2Q7RA 5BQIA 4JCZA 4AL0A 2H8AA 4JRZA 4YL1A 5BQHA 3DWWA 5HV9A 5K0IA 5BQGA 4AL1A 4J7YA 2UUHA 4YL3A 4JC7A 4NTAA 4NTFA 3LEOA 4YK5A
chains in the Genus database with same CATH superfamily
3DJNB 2GFHA 3K6BA 3DKAA 4RDAA 1G8XA 1YDIA 2VH3A 3SYNA 3F47A 4G7OF 3ZQYA 4CS7A 1LM3B 3CEXA 3RFYA 2EINC 1NFNA 3CSKA 3I4UA 1ZHXA 1YJGA 3ZQVA 3N2ZB 3N0TA 3EH2A 3GORA 1SMYF 2QE9A 2Q7RA 4XQ1A 4JTAB 3SXZA 3V5YA 5BQIA 3KPHA 1IW7F 2YRFA 3RVYA 4JKVA 2XLHA 3JYHA 1CGNA 2A6HF 3GEEA 4IB4A 2A6EF 1QKRA 2NUPB 3U8VA 1YA9A 2B0JA 4Z9JA 2B0HA 3NYMA 4FWVA 2QUPA 4XEKA 3TOLA 5AGFA 2ASRA 4O6MA 1YAUO 4U5BE 4YT4A 3IHUA 2Q9CA 2CCYA 2MYSA 4R32A 5D91A 4C3BA 1TWGA 1NBBA 2C04A 1ZVZA 1TFOB 2M4EA 4NTFA 1J8MF 3C8GD 1ZHYA 3KL4A 4Z9HA 3DE9A 2AWYA 1RMVA 3NDBB 2XS8A 2Q3TA 3DM9B 3H65A 5L0JA 1H9TA 3UMIA 3KH2A 1K05A 4LACB 3HLZA 4MW3A 1VLSA 3JSZA 4JTDB 2YWAA 2ZXWC 1FFHA 2AWCA 3KYIA 2PBEA 3LESA 5JP7A 2XLDA 1V74B 3TJ6A 2XXAB 3B29A 5TJ5E 2YKZA 4N6HA 4UDVA 1SR2A 4W8KA 4IJJA 2XSEA 4XLNF 2LFFA 3E70C 4ZLDA 4LDQA 3US6A 1K40A 1E84A 1ZHTA 3MBGA 1LVKA 2L7AA 4CS9A 2ZD9A 1B68A 2CNWA 5COFA 4CIPA 2OKUA 2WVNA 1R5ID 2VCCA 1A41A 2WZLA 2W9YA 1SYQA 3IPMO 3M4BA 4CDVA 1MMDA 2OU6A 3C63A 3ABLC 3ZTZA 2DYSC 3L1MA 3QVZA 3B0PA 3QTHA 5L0IA 1A7VA 2OJQA 3LEVA 4E17A 1TWAA 2KYHA 2RSEB 3SEOA 3UGPA 3C62A 4CJOA 3JYYA 2NUTA 3UMHA 1VYKA 3BRJA 2X51A 2OJED 3RYLA 3WHNA 1HMDA 3M4CA 3RQEA 2Q9AA 3EGDB 4PJJA 2HSBA 3A11A 3EZIA 2R25A 3L8IA 4EUKB 1M56C 3ZDLA 3LLKA 1OW8A 1YA7O 4E18A 4ULWA 3S27A 1APCA 1V4AA 1YZAA 3OA1A 3QW1A 3S90A 1ZU5A 4LERA 1OR2A 1TWCA 2L6HA 3EJNA 4BJ5C 1EKYA 2KNHA 4U5FE 3W8HA 5KYUB 3N24A 4U9DA 4CS8A 2G3KA 3EZHA 1U89A 3QVYA 2R7SA 3RQFA 3KMIA 3RW0A 2HV6A 1G4US 4U5GA 3AQBA 3FAJA 4PR9A 3V7OA 1GM5A 3HTKC 1HMOA 5DS6A 3T6GB 2EPMX 1N1CA 3EG9A 1HE1A 4XWJA 1SF8A 3DI5A 3CQZA 4AX2A 2L6GA 2ZXPA 1LPEA 4OIRF 1FMVA 2KSFA 2LFDA 1YYJA 1G4WR 2ZPAA 3EFOA 4MVRA 4PJLA 4DRJB 4FAPB 2V3CC 4O6YA 3AGTA 5D92A 2YLIA 1J8YF 2CGEA 4IARA 4DJ9A 4CSAA 1LS1A 3T6JA 1WWPA 4HFKB 4NTAA 2JPUA 2JD3A 3A9CA 2G3VA 2WZGA 3JSEO 1YLMA 1MMGA 2R7QA 2XLMA 2KGOA 3L8JA 4LDKA 3S28A 1Z23A 3QW0A 1BR1A 1FMWA 4MVSA 4WGYA 3RKOF 3NMKA 3S0XA 3ECSA 3AQCA 5FZTA 1JMWA 3AGUA 3I5PA 4G0HA 5B3IA 3B0VC 1MNEA 1WASA 1H6GA 2W4BA 3QMKA 4GYTA 2DB4A 5L3QA 4ANJA 3O10A 1U6HA 3C8GB 3KKBA 3W8IA 2OEVA 1D1AA 4OD4A 4YL1A 1TQGA 4HEAJ 3IQ5A 4JTCB 3ZSUA 4CDAA 4C3DA 3DMDA 5KYNA 4YJWA 2G62A 4C3EA 3GEHA 2KQ9A 1ZYRF 1LE2A 4DVYP 2W45A 2ZXOA 3NKEA 2MWQA 1WN0A 2MHRA 4IAQA 3W2VA 2CW0F 2EPOA 2NG1A 2Q4FA 5JVEA 4G7HF 1NLXA 1D1CA 3EHMA 4KBLA 3K7DA 4C7OA 1TKNA 1YARO 1D0ZA 3PCVA 4XPXA 1M6TA 3O39A 4A4AA 4KI2A 1H9GA 4EBJA 1A7EA 1CPRA 2A68F 3PHF2 2FAPB 1YZCA 2L6FA 2YL3A 4YWQA 1FR0A 3IEEA 2GA0A 2VASA 3G4XA 1G5ZA 3TD7A 1WGWA 1D0XA 2OCCC 3T9OA 1WATA 1QVXA 3SXYA 1Q0DA 1ZW3A 5B1BC 4LDRA 4AE4B 2HZ8A 2P0NA 3RF3A 4KNVA 4IGGA 3SXKA 4EBBA 2LD6A 1VK5A 1T9KA 3ASOC 3C7JA 4PFPA 1M2VA 4HFFB 3LEOA 1RJ9B 2IOQA 3FMSA 3TJ5A 3ABMC 5A6KA 3MLGA 1E86A 3W4YA 4C7OB 1C03A 1OXBA 4LLCA 5KYWA 4Z9IA 4P9FA 3IQ6A 5JSLA 3ZC4A 5HSWA 1KNYA 4OIOF 1OCRC 1AUEA 2IXOA 1S7ZA 4F4BA 3ATPA 4JE9A 5KYYB 1PV3A 3MYFA 4I1MA 4XPYA 4DRIB 1Y6DA 3RIPA 3WAQA 4NCQA 3EH1A 3BEHA 4JCHA 5BQHA 3AJMA 4YT2A 3FOOA 3K1HA 5A6AA 3EGXB 1DOVA 1JPNA 4WGZA 4ULVA 2J9WA 2GDCA 2LQGA 3LNMB 1L7CA 4B6IA 5B3SC 1OKKD 1RKEB 5E33A 4ONSA 3AG4C 2VC9A 2H7VC 3IQCA 5KYUA 1NG1A 1OCZC 2GWWA 1BDJB 3HNJA 3T6BA 5L0DA 1MQVA 5L0HA 4O7GA 2M64A 4YK5A 5K0IA 4BJ5A 2LSEA 5A6BA 1T01A 4WJ0A 4YL0A 1MMNA 4FX5A 4MTGA 1VOMA 4MNDA 3FVYA 1PD1A 4G78A 3X1OA 1FTSA 1H7IA 1Z3IX 3M1CB 4E0HA 4CX9A 1OXKA 3JZ0A 4EBKA 5AC4A 5CIVA 2FGYA 3DZAA 1F1MA 1PCXA 1FFTC 1T6IA 2EIMC 2L9JA 4J32B 4JZAA 4K1OA 4N06A 1CPQA 4O6NA 4CIHA 2VB6A 3DM5A 3B71A 1JPJA 2YLGA 3MX3A 2VCBA 2XM4A 2IYLD 4U9EA 3S9OA 1DOWA 4BJ6C 3VF0A 4QI2A 5EGYA 2IXNA 2P7VA 1Q0KA 1VB5A 1VTMP 3R7CA 256BA 3FHDA 3HNIA 1NZEA 4IAOA 5L3VA 3C18A 4RD9A 4U5HA 4DBRA 4OIPF 1K04A 2CYDA 2WVQA 3U9MA 3LLIA 3H2UA 5T1DB 4EWCA 1V55C 4HE8D 3ASNC 4XPWA 3SP1A 3Q7GA 1HY5A 4CJGA 1E85A 2JX0A 3NG1A 3SNHA 1FAPB 2WB7A 2DYRC 3TULA 1TWHA 1ST6A 2EPKX 4JCZA 3J06A 2HS5A 1OR3A 3C8GA 2DGJA 4X0RA 2XL8A 4JJFA 3U2MA 3MFNA 2HV7A 4JRZA 4CBEA 2LP4A 1V54C 3LUTB 3RVZA 1MNDA 1Z5ZA 3L0IA 4N4WA 4U5EE 2R7XA 3UR3C 2J7PA 1C02A 2R9RB 1EA8A 4EKWA 1I5NA 3LJBA 3UNGC 2R03A 4DOZA 2XS1A 1L3PA 1OCCC 3DD7A 2Y3GA 3K66A 2VCAA 4JEBA 3FXHA 1QSPA 1RXQA 4JVSA 2AVKA 2H7BA 3WG7C 4NC3A 4XEFA 2PX0A 2YEVA 4NTBA 3JRTA 5E2QA 1OW7A 4E7SA 5AC5A 2J45A 4JEAA 1BBHA 1TR2A 5DLJA 1JRAA 1HW1A 4MVMA 3G4ZA 2QLAA 2Z15A 1Y4CA 3NMIA 3EQLF 2H8AA 5KYXB 4QDLA 4U5DE 1LE4A 1QQ3A 5L0GA 1ZHWA 2NUPA 4AE4A 4IRUA 2Y69C 5B1AC 4YT5A 3U9JA 2P6VA 4YL3A 4N6CA 4XTKA 1NSGB 3U3BA 3PDMP 2Y3DA 1A0BA 3M15A 2R7WA 1XZPA 1JAFA 4U5CE 1PD0A 2Y3BA 4MTFA 2XRHA 1E2XA 4EIYA 4MVQA 2R7RA 3L34A 1CGME 3HKKA 3TOMA 1OCOC 2Q00A 4BJTA 3QZCA 4DVZA 4MVOA 3K33A 1Q0GA 2PNOA 2CNWD 3RH3A 4I3MA 2EIJC 4DBQA 5KYYA 5COMA 2XXAA 2J8WA 3DAFA 3I5QA 1T6UA 3IQTA 1AVOB 2GAQA 4AK9A 5A6BD 1ZW2A 3VYWA 3S29A 4Q4ZF 3X2QC 1RKCA 2R7TA 1VYIA 4DXWA 4KC9A 4MS2A 4PACA 3UGOA 3OWTA 4P6IC 5E3AA 1W2WA 2OQMA 5DVWA 4AL1A 5IY5C 4CDYA 2KC3A 3H2VA 2PP4A 5COGA 4BG0A 2RD9A 2LCHA 2O9XA 1RKEA 3AG2C 2X0CA 3SZRA 4JC7A 3GM1A 3LAYA 4JURI 3K1IC 3MYIA 1KU2A 2L81A 3TQOA 3Q7LA 2KW3C 2HSQA 4E0IA 3Q6MA 2WL8A 3Q6NA 3U5SA 5E3CA 3U8PA 2Q9BA 4PJNA 1GS9A 4BPMA 1YYXA 1JOGA 4WABA 5T3TA 1R4TA 4J30B 2P1AA 1MMAA 3ZVRA 2A69F 2CDQA 3GANA 4K7BA 3DXJF 5L0CA 2Y3HA 2A0BA 3HNKA 2QY9A 3DAGA 4BEMJ 4XEVA 2F22A 4H4KC 2D4UA 3EGDA 3JCUQ 2KJGA 3LNRA 2NSFA 3ZG1A 3B9QA 3VAYA 1NU7D 3GM3A 2H7OA 5BQGA 4OD5A 5JT4A 2XM0A 2R7OA 5FCLA 4J7YA 4ZLCA 1LKXA 2HMQA 2W4MA 3EPVA 1OW6A 2UUHA 1LI5A 1GGQA 2HFIA 3G50A 3LS0A 4FESA 4BJ6A 3ABKC 2WVOA 3HJCA 1ZU4A 5F5HA 2BE5F 2R7VA 1ZZPA 3RQGA 2BC5A 2YL0A 3FDQA 2HJ3A 2YLDA 4PJMA 3E9VA 2LK4A 3O6XA 2J7PD 2XL4A 4Q5SF 5F28E 1YVIA 2YZSA 3EHNA 1XZQA 4L6RA 4BEJA 5DS4A 3AOUA 2HJMA 5EK0A 3M79A 2DI3A 3DJUB 2AP3A 3VM6A 2WZFA 5CI9A 1VLTA 2EIKC 1LI7A 2YHSA 1BR4A 3JTLO 4JIOA 2D5RB 2NSGA 4OINF 4G7ZF 4K0DA 1EI7A 4NY3A 1M2OA 5DQZA 1BR2A 3T4RA 5A6JA 2NPUA 3V5ZA 3KYJA 1C17M 4GQHA 4MQ9F 1KTMA 2IM8A 1M2VB 3GM2A 1JR8A 3NYLA 4PFOA 2BL2A 5CI8A 4QI0A 2ETSA 4YT8A 1Q0MA 5KYWB 5F5FA 3TK0A 1FNTc 4Q7CA 2OEXA 2YL1A 2ZXRA 1T6QA 3CZ6A 2V26A 1A7DA 2J9UA 5DS5A 3GWLA 2KK1A 2PFDA 1E83A 1LIHA 1I4YA 2J46A 2XLWA 3R2PA 1XWJA 4RBNA 4ER9A 1IZMA 4I44A 1ZHZA 4AL0A 4CS9C 1Q0FA 2XL6A 3HNLA 2HKVA 4BJ1A 5KYXA 3F46A 4OIQF 3JT1A 1NU9C 4W8PA 4PK4A 2TMVP 1Z6AA 2C03A 2P61A 3NYJA 4E7ZA 2IBFA 3GWNA 1D0YA 3POVA 3LS1A 1HW2A 3SXMA 3V5XA 5T3WA 2ICWG 3O55A 4MTOA 2PF4E 2LIGA 2XLOA 4YN0B 1M57C 2J9BA 5JLIA 4GEHA 2R02A 4EHPA 5EHHA 2I8BA 4LLEA 4A2NB 4D4NA 1HE9A 1ORSC 1WOLA 2XLVA 3NKDA 2J0WA 4NQFA 1CGOA 1NFOA 2HUJA 2NUTB 2OOCA 1RCPA 3S84A 3PMRA 3AG3C 3GEIA 1OKKA 2YQYA 1WTYA 2UUIA 4KNWA 4JW1A 1U0BB 1Z63A 3U2LA 5JRAA 1Z7Qc 5BUOA 1T5OA 2QNLA 2R05A 3FAPB 5L0FA 4MVZA 1AEPA 1UG7A 2IXMA 1LS4A 2IXPA 4XLPF 5JUAA 2QTVA 1O3UA 2AU5A 4JJGA 1EQ1A 1VMAA 4CS8C 2EPNA 2J9VA 3NRHA 5GPGB 1BZ4A 1D1BA 3FOPA 3ZWIA 2A1DD 3C8ZA 1OQCA 1QPUA 3DE8A 2HMZA 2OG2A 2YL7A 1RJ9A 3CAXA 3K1IA 4I1OB 4O79A 3WODF 3JRMO 1QZXA 1ORYA 3OEOA 2Y39A 1TFKB 2E87A 4M63A 2A0UA 4J7TA 3U3FA 2R7UA 3VRCA 1I4ZA 3UMKA 1SZIA 3EG9B 2I15A 3W2WA 2J0XA 1O5HA 1QLEC 5DQTA 4DRHB 5A69A 1ORJA 3ZTMA 3EFOB 4P9TA 4MVUA 1O87A 3DWWA 4MW8A 4D4XA 1UFBA 5HV9A 1GQAA 5JS5A 4CSAC 2YVKA 4H54A 3EGXA 3NMJA 2EPLX 3ZIBA 3ITFA 1S05A 2EILC 2FFHA 2PX3A 3AG1C 4IWBA 3GODA 3B0UX 3U0CA 2XLEA
chains in the Genus database with same CATH topology
4YL0A 3PCVA 4NTBA 3HKKA 4BPMA 4WABA 2PNOA 4J7TA 3B29A 2UUIA 2Q7RA 5BQIA 4JCZA 4AL0A 2H8AA 4JRZA 4YL1A 5BQHA 3DWWA 5HV9A 5K0IA 5BQGA 4AL1A 4J7YA 2UUHA 4YL3A 4JC7A 4NTAA 4NTFA 3LEOA 4YK5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YL0 A;  3PCV A;  4NTB A;  3HKK A;  4BPM A;  4WAB A;  2PNO A;  4J7T A;  3B29 A;  2UUI A;  2Q7R A;  5BQI A;  4JCZ A;  4AL0 A;  2H8A A;  4JRZ A;  4YL1 A;  5BQH A;  3DWW A;  5HV9 A;  5K0I A;  5BQG A;  4AL1 A;  4J7Y A;  2UUH A;  4YL3 A;  4JC7 A;  4NTA A;  4NTF A;  3LEO A;  4YK5 A; 
#chains in the Genus database with same CATH topology
 3DJN B;  2GFH A;  3K6B A;  3DKA A;  4RDA A;  1G8X A;  1YDI A;  2VH3 A;  3SYN A;  3F47 A;  4G7O F;  3ZQY A;  4CS7 A;  1LM3 B;  3CEX A;  3RFY A;  2EIN C;  1NFN A;  3CSK A;  3I4U A;  1ZHX A;  1YJG A;  3ZQV A;  3N2Z B;  3N0T A;  3EH2 A;  3GOR A;  1SMY F;  2QE9 A;  2Q7R A;  4XQ1 A;  4JTA B;  3SXZ A;  3V5Y A;  5BQI A;  3KPH A;  1IW7 F;  2YRF A;  3RVY A;  4JKV A;  2XLH A;  3JYH A;  1CGN A;  2A6H F;  3GEE A;  4IB4 A;  2A6E F;  1QKR A;  2NUP B;  3U8V A;  1YA9 A;  2B0J A;  4Z9J A;  2B0H A;  3NYM A;  4FWV A;  2QUP A;  4XEK A;  3TOL A;  5AGF A;  2ASR A;  4O6M A;  1YAU O;  4U5B E;  4YT4 A;  3IHU A;  2Q9C A;  2CCY A;  2MYS A;  4R32 A;  5D91 A;  4C3B A;  1TWG A;  1NBB A;  2C04 A;  1ZVZ A;  1TFO B;  2M4E A;  4NTF A;  1J8M F;  3C8G D;  1ZHY A;  3KL4 A;  4Z9H A;  3DE9 A;  2AWY A;  1RMV A;  3NDB B;  2XS8 A;  2Q3T A;  3DM9 B;  3H65 A;  5L0J A;  1H9T A;  3UMI A;  3KH2 A;  1K05 A;  4LAC B;  3HLZ A;  4MW3 A;  1VLS A;  3JSZ A;  4JTD B;  2YWA A;  2ZXW C;  1FFH A;  2AWC A;  3KYI A;  2PBE A;  3LES A;  5JP7 A;  2XLD A;  1V74 B;  3TJ6 A;  2XXA B;  3B29 A;  5TJ5 E;  2YKZ A;  4N6H A;  4UDV A;  1SR2 A;  4W8K A;  4IJJ A;  2XSE A;  4XLN F;  2LFF A;  3E70 C;  4ZLD A;  4LDQ A;  3US6 A;  1K40 A;  1E84 A;  1ZHT A;  3MBG A;  1LVK A;  2L7A A;  4CS9 A;  2ZD9 A;  1B68 A;  2CNW A;  5COF A;  4CIP A;  2OKU A;  2WVN A;  1R5I D;  2VCC A;  1A41 A;  2WZL A;  2W9Y A;  1SYQ A;  3IPM O;  3M4B A;  4CDV A;  1MMD A;  2OU6 A;  3C63 A;  3ABL C;  3ZTZ A;  2DYS C;  3L1M A;  3QVZ A;  3B0P A;  3QTH A;  5L0I A;  1A7V A;  2OJQ A;  3LEV A;  4E17 A;  1TWA A;  2KYH A;  2RSE B;  3SEO A;  3UGP A;  3C62 A;  4CJO A;  3JYY A;  2NUT A;  3UMH A;  1VYK A;  3BRJ A;  2X51 A;  2OJE D;  3RYL A;  3WHN A;  1HMD A;  3M4C A;  3RQE A;  2Q9A A;  3EGD B;  4PJJ A;  2HSB A;  3A11 A;  3EZI A;  2R25 A;  3L8I A;  4EUK B;  1M56 C;  3ZDL A;  3LLK A;  1OW8 A;  1YA7 O;  4E18 A;  4ULW A;  3S27 A;  1APC A;  1V4A A;  1YZA A;  3OA1 A;  3QW1 A;  3S90 A;  1ZU5 A;  4LER A;  1OR2 A;  1TWC A;  2L6H A;  3EJN A;  4BJ5 C;  1EKY A;  2KNH A;  4U5F E;  3W8H A;  5KYU B;  3N24 A;  4U9D A;  4CS8 A;  2G3K A;  3EZH A;  1U89 A;  3QVY A;  2R7S A;  3RQF A;  3KMI A;  3RW0 A;  2HV6 A;  1G4U S;  4U5G A;  3AQB A;  3FAJ A;  4PR9 A;  3V7O A;  1GM5 A;  3HTK C;  1HMO A;  5DS6 A;  3T6G B;  2EPM X;  1N1C A;  3EG9 A;  1HE1 A;  4XWJ A;  1SF8 A;  3DI5 A;  3CQZ A;  4AX2 A;  2L6G A;  2ZXP A;  1LPE A;  4OIR F;  1FMV A;  2KSF A;  2LFD A;  1YYJ A;  1G4W R;  2ZPA A;  3EFO A;  4MVR A;  4PJL A;  4DRJ B;  4FAP B;  2V3C C;  4O6Y A;  3AGT A;  5D92 A;  2YLI A;  1J8Y F;  2CGE A;  4IAR A;  4DJ9 A;  4CSA A;  1LS1 A;  3T6J A;  1WWP A;  4HFK B;  4NTA A;  2JPU A;  2JD3 A;  3A9C A;  2G3V A;  2WZG A;  3JSE O;  1YLM A;  1MMG A;  2R7Q A;  2XLM A;  2KGO A;  3L8J A;  4LDK A;  3S28 A;  1Z23 A;  3QW0 A;  1BR1 A;  1FMW A;  4MVS A;  4WGY A;  3RKO F;  3NMK A;  3S0X A;  3ECS A;  3AQC A;  5FZT A;  1JMW A;  3AGU A;  3I5P A;  4G0H A;  5B3I A;  3B0V C;  1MNE A;  1WAS A;  1H6G A;  2W4B A;  3QMK A;  4GYT A;  2DB4 A;  5L3Q A;  4ANJ A;  3O10 A;  1U6H A;  3C8G B;  3KKB A;  3W8I A;  2OEV A;  1D1A A;  4OD4 A;  4YL1 A;  1TQG A;  4HEA J;  3IQ5 A;  4JTC B;  3ZSU A;  4CDA A;  4C3D A;  3DMD A;  5KYN A;  4YJW A;  2G62 A;  4C3E A;  3GEH A;  2KQ9 A;  1ZYR F;  1LE2 A;  4DVY P;  2W45 A;  2ZXO A;  3NKE A;  2MWQ A;  1WN0 A;  2MHR A;  4IAQ A;  3W2V A;  2CW0 F;  2EPO A;  2NG1 A;  2Q4F A;  5JVE A;  4G7H F;  1NLX A;  1D1C A;  3EHM A;  4KBL A;  3K7D A;  4C7O A;  1TKN A;  1YAR O;  1D0Z A;  3PCV A;  4XPX A;  1M6T A;  3O39 A;  4A4A A;  4KI2 A;  1H9G A;  4EBJ A;  1A7E A;  1CPR A;  2A68 F;  3PHF 2;  2FAP B;  1YZC A;  2L6F A;  2YL3 A;  4YWQ A;  1FR0 A;  3IEE A;  2GA0 A;  2VAS A;  3G4X A;  1G5Z A;  3TD7 A;  1WGW A;  1D0X A;  2OCC C;  3T9O A;  1WAT A;  1QVX A;  3SXY A;  1Q0D A;  1ZW3 A;  5B1B C;  4LDR A;  4AE4 B;  2HZ8 A;  2P0N A;  3RF3 A;  4KNV A;  4IGG A;  3SXK A;  4EBB A;  2LD6 A;  1VK5 A;  1T9K A;  3ASO C;  3C7J A;  4PFP A;  1M2V A;  4HFF B;  3LEO A;  1RJ9 B;  2IOQ A;  3FMS A;  3TJ5 A;  3ABM C;  5A6K A;  3MLG A;  1E86 A;  3W4Y A;  4C7O B;  1C03 A;  1OXB A;  4LLC A;  5KYW A;  4Z9I A;  4P9F A;  3IQ6 A;  5JSL A;  3ZC4 A;  5HSW A;  1KNY A;  4OIO F;  1OCR C;  1AUE A;  2IXO A;  1S7Z A;  4F4B A;  3ATP A;  4JE9 A;  5KYY B;  1PV3 A;  3MYF A;  4I1M A;  4XPY A;  4DRI B;  1Y6D A;  3RIP A;  3WAQ A;  4NCQ A;  3EH1 A;  3BEH A;  4JCH A;  5BQH A;  3AJM A;  4YT2 A;  3FOO A;  3K1H A;  5A6A A;  3EGX B;  1DOV A;  1JPN A;  4WGZ A;  4ULV A;  2J9W A;  2GDC A;  2LQG A;  3LNM B;  1L7C A;  4B6I A;  5B3S C;  1OKK D;  1RKE B;  5E33 A;  4ONS A;  3AG4 C;  2VC9 A;  2H7V C;  3IQC A;  5KYU A;  1NG1 A;  1OCZ C;  2GWW A;  1BDJ B;  3HNJ A;  3T6B A;  5L0D A;  1MQV A;  5L0H A;  4O7G A;  2M64 A;  4YK5 A;  5K0I A;  4BJ5 A;  2LSE A;  5A6B A;  1T01 A;  4WJ0 A;  4YL0 A;  1MMN A;  4FX5 A;  4MTG A;  1VOM A;  4MND A;  3FVY A;  1PD1 A;  4G78 A;  3X1O A;  1FTS A;  1H7I A;  1Z3I X;  3M1C B;  4E0H A;  4CX9 A;  1OXK A;  3JZ0 A;  4EBK A;  5AC4 A;  5CIV A;  2FGY A;  3DZA A;  1F1M A;  1PCX A;  1FFT C;  1T6I A;  2EIM C;  2L9J A;  4J32 B;  4JZA A;  4K1O A;  4N06 A;  1CPQ A;  4O6N A;  4CIH A;  2VB6 A;  3DM5 A;  3B71 A;  1JPJ A;  2YLG A;  3MX3 A;  2VCB A;  2XM4 A;  2IYL D;  4U9E A;  3S9O A;  1DOW A;  4BJ6 C;  3VF0 A;  4QI2 A;  5EGY A;  2IXN A;  2P7V A;  1Q0K A;  1VB5 A;  1VTM P;  3R7C A;  256B A;  3FHD A;  3HNI A;  1NZE A;  4IAO A;  5L3V A;  3C18 A;  4RD9 A;  4U5H A;  4DBR A;  4OIP F;  1K04 A;  2CYD A;  2WVQ A;  3U9M A;  3LLI A;  3H2U A;  5T1D B;  4EWC A;  1V55 C;  4HE8 D;  3ASN C;  4XPW A;  3SP1 A;  3Q7G A;  1HY5 A;  4CJG A;  1E85 A;  2JX0 A;  3NG1 A;  3SNH A;  1FAP B;  2WB7 A;  2DYR C;  3TUL A;  1TWH A;  1ST6 A;  2EPK X;  4JCZ A;  3J06 A;  2HS5 A;  1OR3 A;  3C8G A;  2DGJ A;  4X0R A;  2XL8 A;  4JJF A;  3U2M A;  3MFN A;  2HV7 A;  4JRZ A;  4CBE A;  2LP4 A;  1V54 C;  3LUT B;  3RVZ A;  1MND A;  1Z5Z A;  3L0I A;  4N4W A;  4U5E E;  2R7X A;  3UR3 C;  2J7P A;  1C02 A;  2R9R B;  1EA8 A;  4EKW A;  1I5N A;  3LJB A;  3UNG C;  2R03 A;  4DOZ A;  2XS1 A;  1L3P A;  1OCC C;  3DD7 A;  2Y3G A;  3K66 A;  2VCA A;  4JEB A;  3FXH A;  1QSP A;  1RXQ A;  4JVS A;  2AVK A;  2H7B A;  3WG7 C;  4NC3 A;  4XEF A;  2PX0 A;  2YEV A;  4NTB A;  3JRT A;  5E2Q A;  1OW7 A;  4E7S A;  5AC5 A;  2J45 A;  4JEA A;  1BBH A;  1TR2 A;  5DLJ A;  1JRA A;  1HW1 A;  4MVM A;  3G4Z A;  2QLA A;  2Z15 A;  1Y4C A;  3NMI A;  3EQL F;  2H8A A;  5KYX B;  4QDL A;  4U5D E;  1LE4 A;  1QQ3 A;  5L0G A;  1ZHW A;  2NUP A;  4AE4 A;  4IRU A;  2Y69 C;  5B1A C;  4YT5 A;  3U9J A;  2P6V A;  4YL3 A;  4N6C A;  4XTK A;  1NSG B;  3U3B A;  3PDM P;  2Y3D A;  1A0B A;  3M15 A;  2R7W A;  1XZP A;  1JAF A;  4U5C E;  1PD0 A;  2Y3B A;  4MTF A;  2XRH A;  1E2X A;  4EIY A;  4MVQ A;  2R7R A;  3L34 A;  1CGM E;  3HKK A;  3TOM A;  1OCO C;  2Q00 A;  4BJT A;  3QZC A;  4DVZ A;  4MVO A;  3K33 A;  1Q0G A;  2PNO A;  2CNW D;  3RH3 A;  4I3M A;  2EIJ C;  4DBQ A;  5KYY A;  5COM A;  2XXA A;  2J8W A;  3DAF A;  3I5Q A;  1T6U A;  3IQT A;  1AVO B;  2GAQ A;  4AK9 A;  5A6B D;  1ZW2 A;  3VYW A;  3S29 A;  4Q4Z F;  3X2Q C;  1RKC A;  2R7T A;  1VYI A;  4DXW A;  4KC9 A;  4MS2 A;  4PAC A;  3UGO A;  3OWT A;  4P6I C;  5E3A A;  1W2W A;  2OQM A;  5DVW A;  4AL1 A;  5IY5 C;  4CDY A;  2KC3 A;  3H2V A;  2PP4 A;  5COG A;  4BG0 A;  2RD9 A;  2LCH A;  2O9X A;  1RKE A;  3AG2 C;  2X0C A;  3SZR A;  4JC7 A;  3GM1 A;  3LAY A;  4JUR I;  3K1I C;  3MYI A;  1KU2 A;  2L81 A;  3TQO A;  3Q7L A;  2KW3 C;  2HSQ A;  4E0I A;  3Q6M A;  2WL8 A;  3Q6N A;  3U5S A;  5E3C A;  3U8P A;  2Q9B A;  4PJN A;  1GS9 A;  4BPM A;  1YYX A;  1JOG A;  4WAB A;  5T3T A;  1R4T A;  4J30 B;  2P1A A;  1MMA A;  3ZVR A;  2A69 F;  2CDQ A;  3GAN A;  4K7B A;  3DXJ F;  5L0C A;  2Y3H A;  2A0B A;  3HNK A;  2QY9 A;  3DAG A;  4BEM J;  4XEV A;  2F22 A;  4H4K C;  2D4U A;  3EGD A;  3JCU Q;  2KJG A;  3LNR A;  2NSF A;  3ZG1 A;  3B9Q A;  3VAY A;  1NU7 D;  3GM3 A;  2H7O A;  5BQG A;  4OD5 A;  5JT4 A;  2XM0 A;  2R7O A;  5FCL A;  4J7Y A;  4ZLC A;  1LKX A;  2HMQ A;  2W4M A;  3EPV A;  1OW6 A;  2UUH A;  1LI5 A;  1GGQ A;  2HFI A;  3G50 A;  3LS0 A;  4FES A;  4BJ6 A;  3ABK C;  2WVO A;  3HJC A;  1ZU4 A;  5F5H A;  2BE5 F;  2R7V A;  1ZZP A;  3RQG A;  2BC5 A;  2YL0 A;  3FDQ A;  2HJ3 A;  2YLD A;  4PJM A;  3E9V A;  2LK4 A;  3O6X A;  2J7P D;  2XL4 A;  4Q5S F;  5F28 E;  1YVI A;  2YZS A;  3EHN A;  1XZQ A;  4L6R A;  4BEJ A;  5DS4 A;  3AOU A;  2HJM A;  5EK0 A;  3M79 A;  2DI3 A;  3DJU B;  2AP3 A;  3VM6 A;  2WZF A;  5CI9 A;  1VLT A;  2EIK C;  1LI7 A;  2YHS A;  1BR4 A;  3JTL O;  4JIO A;  2D5R B;  2NSG A;  4OIN F;  4G7Z F;  4K0D A;  1EI7 A;  4NY3 A;  1M2O A;  5DQZ A;  1BR2 A;  3T4R A;  5A6J A;  2NPU A;  3V5Z A;  3KYJ A;  1C17 M;  4GQH A;  4MQ9 F;  1KTM A;  2IM8 A;  1M2V B;  3GM2 A;  1JR8 A;  3NYL A;  4PFO A;  2BL2 A;  5CI8 A;  4QI0 A;  2ETS A;  4YT8 A;  1Q0M A;  5KYW B;  5F5F A;  3TK0 A;  1FNT c;  4Q7C A;  2OEX A;  2YL1 A;  2ZXR A;  1T6Q A;  3CZ6 A;  2V26 A;  1A7D A;  2J9U A;  5DS5 A;  3GWL A;  2KK1 A;  2PFD A;  1E83 A;  1LIH A;  1I4Y A;  2J46 A;  2XLW A;  3R2P A;  1XWJ A;  4RBN A;  4ER9 A;  1IZM A;  4I44 A;  1ZHZ A;  4AL0 A;  4CS9 C;  1Q0F A;  2XL6 A;  3HNL A;  2HKV A;  4BJ1 A;  5KYX A;  3F46 A;  4OIQ F;  3JT1 A;  1NU9 C;  4W8P A;  4PK4 A;  2TMV P;  1Z6A A;  2C03 A;  2P61 A;  3NYJ A;  4E7Z A;  2IBF A;  3GWN A;  1D0Y A;  3POV A;  3LS1 A;  1HW2 A;  3SXM A;  3V5X A;  5T3W A;  2ICW G;  3O55 A;  4MTO A;  2PF4 E;  2LIG A;  2XLO A;  4YN0 B;  1M57 C;  2J9B A;  5JLI A;  4GEH A;  2R02 A;  4EHP A;  5EHH A;  2I8B A;  4LLE A;  4A2N B;  4D4N A;  1HE9 A;  1ORS C;  1WOL A;  2XLV A;  3NKD A;  2J0W A;  4NQF A;  1CGO A;  1NFO A;  2HUJ A;  2NUT B;  2OOC A;  1RCP A;  3S84 A;  3PMR A;  3AG3 C;  3GEI A;  1OKK A;  2YQY A;  1WTY A;  2UUI A;  4KNW A;  4JW1 A;  1U0B B;  1Z63 A;  3U2L A;  5JRA A;  1Z7Q c;  5BUO A;  1T5O A;  2QNL A;  2R05 A;  3FAP B;  5L0F A;  4MVZ A;  1AEP A;  1UG7 A;  2IXM A;  1LS4 A;  2IXP A;  4XLP F;  5JUA A;  2QTV A;  1O3U A;  2AU5 A;  4JJG A;  1EQ1 A;  1VMA A;  4CS8 C;  2EPN A;  2J9V A;  3NRH A;  5GPG B;  1BZ4 A;  1D1B A;  3FOP A;  3ZWI A;  2A1D D;  3C8Z A;  1OQC A;  1QPU A;  3DE8 A;  2HMZ A;  2OG2 A;  2YL7 A;  1RJ9 A;  3CAX A;  3K1I A;  4I1O B;  4O79 A;  3WOD F;  3JRM O;  1QZX A;  1ORY A;  3OEO A;  2Y39 A;  1TFK B;  2E87 A;  4M63 A;  2A0U A;  4J7T A;  3U3F A;  2R7U A;  3VRC A;  1I4Z A;  3UMK A;  1SZI A;  3EG9 B;  2I15 A;  3W2W A;  2J0X A;  1O5H A;  1QLE C;  5DQT A;  4DRH B;  5A69 A;  1ORJ A;  3ZTM A;  3EFO B;  4P9T A;  4MVU A;  1O87 A;  3DWW A;  4MW8 A;  4D4X A;  1UFB A;  5HV9 A;  1GQA A;  5JS5 A;  4CSA C;  2YVK A;  4H54 A;  3EGX A;  3NMJ A;  2EPL X;  3ZIB A;  3ITF A;  1S05 A;  2EIL C;  2FFH A;  2PX3 A;  3AG1 C;  4IWB A;  3GOD A;  3B0U X;  3U0C A;  2XLE A; 
#chains in the Genus database with same CATH homology
 4YL0 A;  3PCV A;  4NTB A;  3HKK A;  4BPM A;  4WAB A;  2PNO A;  4J7T A;  3B29 A;  2UUI A;  2Q7R A;  5BQI A;  4JCZ A;  4AL0 A;  2H8A A;  4JRZ A;  4YL1 A;  5BQH A;  3DWW A;  5HV9 A;  5K0I A;  5BQG A;  4AL1 A;  4J7Y A;  2UUH A;  4YL3 A;  4JC7 A;  4NTA A;  4NTF A;  3LEO A;  4YK5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...