5K0IA

Mpges1 bound to an inhibitor
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
148
structure length
147
Chain Sequence
SLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYRSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGKLRAPIRSVTYTLAQLPCASMALQILWEAARHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Prostaglandin E synthase
publication title Characterization of 3,3-dimethyl substituted N-aryl piperidines as potent microsomal prostaglandin E synthase-1 inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/isomerase inhibitor
total genus 65
structure length 147
sequence length 148
ec nomenclature ec 5.3.99.3: Prostaglandin-E synthase.
pdb deposition date 2016-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 5k0iA00
3DWWA 4AL0A 2UUHA 5BQIA 4J7TA 5HV9A 4NTFA 4JC7A 4NTAA 3HKKA 4YK5A 2UUIA 4YL0A 4JCZA 3B29A 5K0IA 4WABA 4JRZA 2PNOA 5BQGA 3LEOA 2H8AA 4YL1A 4NTBA 3PCVA 4AL1A 2Q7RA 4YL3A 4J7YA 4BPMA 5BQHA
chains in the Genus database with same CATH superfamily
3JZ0A 5B3IA 3S29A 2KJGA 4JTAB 1HY5A 2W4MA 4XLNF 3AGTA 4N4WA 2DB4A 3U2LA 1LE2A 4LERA 2R25A 1D1BA 2PP4A 1CGOA 1RKEB 1MMNA 1AVOB 1YVIA 2YZSA 3AQCA 3S9OA 1L7CA 5EHHA 4K0DA 2RD9A 3QTHA 5E33A 5KYWA 2NPUA 3V5XA 2J0WA 3TJ6A 5KYYB 1ZYRF 3S84A 1V55C 3NMJA 1NG1A 3X1OA 3EJNA 2H8AA 4U9DA 1C03A 1IZMA 4WJ0A 2OEXA 1T01A 2GDCA 5T3WA 4E7SA 3DWWA 1GGQA 3AGUA 4I44A 3SP1A 1T6QA 1E86A 4XPXA 3IQ5A 3SEOA 2IBFA 3EGDA 2WL8A 3B0PA 2R03A 1D0ZA 2QTVA 3B9QA 5KYUA 1LI5A 4HFKB 3K66A 5FZTA 1K04A 1GQAA 1XZQA 1APCA 1H7IA 3CSKA 4CS7A 1T9KA 5DQZA 4IJJA 4XLPF 1VYKA 3HJCA 5BUOA 3MLGA 3NYLA 3ABMC 2KGOA 2PNOA 3FAJA 3FOPA 5EGYA 3C8ZA 4OIRF 3EHNA 3BEHA 2C03A 1H9TA 4L6RA 4G0HA 1J8YF 2KYHA 5KYWB 1PV3A 1Y6DA 3EG9A 3LNRA 4MS2A 5CIVA 5JP7A 4G7OF 3RF3A 5A6JA 2IXOA 2KK1A 2G62A 4CJGA 5E3CA 4AX2A 2Q4FA 3B71A 2LSEA 3ZVRA 3TD7A 5CI9A 3LJBA 1LKXA 3N24A 3RH3A 5HSWA 1EA8A 2EPNA 2G3VA 2KQ9A 5DQTA 1D1AA 4AK9A 2J9VA 2V3CC 3SYNA 3T9OA 3HKKA 4N06A 5E2QA 2Z15A 2CNWD 3DM9B 4U5GA 3EGDB 5KYUB 1HE9A 5JSLA 3N0TA 1YDIA 2HMZA 2J9BA 1I4YA 3MYFA 3U0CA 4UDVA 5DVWA 4Q7CA 5F5HA 1NLXA 4GYTA 3UMHA 2ETSA 4JTDB 1VMAA 4U5BE 2R7WA 4G7ZF 3B0VC 2QE9A 2OJED 4KNWA 4CDVA 4YT2A 1O5HA 3POVA 1I5NA 3EG9B 1YLMA 4NC3A 2O9XA 1OXBA 2WVOA 2HKVA 2PX0A 2A68F 3JYHA 3V5YA 3VAYA 2FGYA 4BJ5C 2Q9AA 4C3EA 1FR0A 2P6VA 2ZXRA 2CYDA 2X51A 4AL0A 5L0DA 3JCUQ 1R4TA 4U5CE 1OR3A 1HMOA 1DOVA 3SXYA 1YA9A 1ST6A 4YL0A 2AP3A 2LFDA 1D0XA 1G5ZA 2CDQA 1RMVA 1YJGA 4CIHA 3PMRA 2XSEA 3TULA 2Q3TA 1SYQA 3ATPA 1K40A 1E84A 1LVKA 2XLMA 4DRJB 1Z3IX 4O6MA 3FXHA 1Q0KA 2I15A 1Z23A 3C8GD 3IHUA 3MX3A 1FTSA 3W8IA 3NMIA 4XEVA 1AUEA 2KC3A 2QY9A 2XL8A 3DXJF 4AE4B 4H54A 4CX9A 1MMGA 1OCZC 3F47A 1VYIA 2Q9BA 5L0HA 3K1HA 3KPHA 4PACA 1LE4A 1LM3B 5JVEA 3UNGC 2OKUA 3AJMA 2Y69C 1ORJA 4U5FE 4KI2A 2LQGA 1YA7O 3EZIA 1TR2A 1TWAA 2W45A 3KH2A 2H7OA 4EWCA 2P61A 1JOGA 3H2VA 4MTOA 3LAYA 4J32B 3SXKA 4BEMJ 4P6IC 2VH3A 3WG7C 4EBJA 3I5PA 3DI5A 4X0RA 4XEFA 2OOCA 1DOWA 3QVZA 3AG1C 1H9GA 1A7DA 2Y3GA 3L1MA 3ZQVA 4CIPA 2XLHA 3KKBA 4CS9A 3EFOA 5KYNA 2E87A 3JSZA 1WWPA 4W8KA 3NRHA 3EQLF 1PD0A 2XLEA 4N6HA 2CCYA 4BJ1A 2L6HA 5B1AC 2Y3HA 1ZZPA 5B1BC 3T4RA 5L0FA 1TWCA 1J8MF 1Q0FA 3RVYA 3ZIBA 2LIGA 2VCCA 2QLAA 5HV9A 2R7TA 1SR2A 1OW6A 2EIMC 2IXNA 4NTAA 1G4WR 2GAQA 2YLDA 1F1MA 3G50A 4YK5A 5KYXA 3TQOA 3GANA 2KNHA 4LDRA 3KMIA 5D91A 3WAQA 4C3DA 3UGOA 5L0GA 1QKRA 1KU2A 2AU5A 2Y39A 2LCHA 3NMKA 4JEBA 4XWJA 2R7VA 3V5ZA 1TWGA 5AC4A 1NZEA 1O3UA 4YWQA 3CQZA 4O79A 5A6BD 1U0BB 1CPRA 3RVZA 1IW7F 4JZAA 1YYJA 4PJJA 1ZHWA 3KYJA 2HSBA 4JEAA 4PJLA 3EFOB 5DS5A 2YWAA 5L3VA 2A0UA 2R7OA 4YL3A 4IRUA 3BRJA 1YYXA 4JURI 5DS6A 3ZSUA 3I4UA 5DLJA 1OW8A 1TFKB 1RCPA 1V74B 2XS1A 3RKOF 4HE8D 4FAPB 2J7PD 2NG1A 3QW0A 1S05A 1M2VA 2YL3A 3HNLA 4MTGA 5KYXB 1E83A 3O55A 3EGXB 3EPVA 3DJUB 3SXZA 2LFFA 3TJ5A 5AGFA 3W8HA 1U6HA 2V26A 4FX5A 1T5OA 1TFOB 3M79A 2IYLD 1TWHA 3RFYA 3EH2A 3VYWA 3ZTMA 5A6KA 1ZHXA 5T3TA 3O39A 1MMDA 4MTFA 1YARO 3ABLC 5JT4A 1QSPA 3PCVA 3S90A 1QLEC 3DD7A 3GWLA 1UFBA 3K1IA 1PCXA 1RJ9A 5GPGB 1TKNA 2EIJC 2BE5F 1Z7Qc 2PF4E 4P9FA 4A4AA 4DRHB 3Q6MA 2WB7A 2HUJA 2XRHA 4JCZA 3RQEA 1HMDA 2YHSA 3HNKA 4M63A 2YL1A 4YJWA 1HW2A 1M2VB 1E85A 2EINC 3HLZA 3Q7GA 4MVSA 2J0XA 3SNHA 3U8VA 4E0IA 1FAPB 3IQTA 3EZHA 3ABKC 3LLKA 3C8GB 2XS8A 2R7SA 2LK4A 4MW8A 5D92A 1XWJA 3U9JA 5COGA 3PHF2 1ORSC 1EQ1A 3IQ6A 2OQMA 2C04A 4XEKA 1BR4A 3TOMA 1ZHYA 2OEVA 3Q6NA 1V54C 1LS4A 1OQCA 2NSGA 3K7DA 4EBBA 4YT4A 3UGPA 2R02A 1SMYF 1RJ9B 3E9VA 4JC7A 4IAQA 4PK4A 1MNDA 4Z9HA 2L7AA 5CI8A 4FWVA 1CGME 4Z9JA 4CS9C 2GA0A 3H2UA 2ASRA 2KW3C 3DM5A 1FFHA 4OD5A 4WGZA 1KTMA 4LDQA 1LIHA 2ZXPA 4GEHA 2H7VC 2WVNA 1CGNA 3TOLA 4BJ6A 4E18A 1ZW3A 1A7EA 2IXMA 1KNYA 2VC9A 4EBKA 1OR2A 1A0BA 1V4AA 2YVKA 3MYIA 4DRIB 5L0CA 1WGWA 3DMDA 3LLIA 1ZU4A 1G8XA 1HE1A 1ZU5A 2NSFA 1OW7A 3DE8A 2LD6A 1D0YA 1WASA 4KC9A 3VF0A 2R9RB 3HTKC 4E7ZA 2J9UA 1GM5A 4HEAJ 2QUPA 1JMWA 1Q0GA 3LEVA 4CS8A 2IM8A 4OIPF 5A6AA 3RQFA 4J7YA 4I3MA 1ZW2A 2HSQA 2OU6A 2WZFA 3RQGA 3S27A 3ZG1A 4EKWA 4MW3A 4ZLDA 1JPNA 1OCRC 1ZHZA 2HZ8A 2OJQA 1PD1A 4ANJA 1H6GA 3W4YA 3KL4A 1NU7D 2JX0A 4WABA 3AG2C 4YN0B 5AC5A 2R7RA 2HS5A 3L8JA 4O7GA 1BR2A 2L9JA 3JSEO 1Z6AA 4Z9IA 3RW0A 1C02A 4I1OB 2RSEB 1BR1A 3T6BA 1BBHA 256BA 4D4NA 2AWYA 1E2XA 1N1CA 3HNJA 3M4BA 4D4XA 2XM0A 2NUTA 5JS5A 1RXQA 3CZ6A 3DZAA 3FDQA 3ZTZA 1Z5ZA 2D5RB 3QMKA 4LLEA 1OKKD 2ZXWC 1WOLA 4JKVA 2YQYA 2YKZA 4DXWA 5DS4A 4JTCB 2GFHA 1TQGA 4RD9A 1ORYA 2XL4A 5E3AA 3ZWIA 2W9YA 1Q0DA 2HFIA 3C62A 4G7HF 2CNWA 3AG4C 2MWQA 3VM6A 4I1MA 1CPQA 2DYRC 3C18A 3NG1A 4IAOA 2J9WA 2YLGA 1O87A 2IXPA 2L6FA 1A7VA 3EGXA 3S0XA 3J06A 1WTYA 2YLIA 2FFHA 1MQVA 2EPKX 2W4BA 3E70C 2YL0A 3K1IC 2B0HA 3UR3C 1QZXA 4ER9A 2XLWA 4C7OA 2EILC 3JTLO 5BQGA 3PDMP 3GM3A 2PX3A 2OG2A 4U9EA 2XXAB 4CBEA 4MVQA 3UMIA 2R7UA 3GEEA 3JRTA 4O6NA 2GWWA 4WGYA 2VCBA 2ZD9A 2NUTB 3IQCA 4BEJA 4HFFB 2ZXOA 3NYMA 5FCLA 3ASNC 4BJTA 3NKDA 1VB5A 4PFPA 2PFDA 2UUHA 2EPLX 2VB6A 2ZPAA 2EIKC 1T6IA 3JT1A 3L8IA 4JIOA 4K1OA 4RBNA 3RIPA 3S28A 2BL2A 3V7OA 3U8PA 1NFNA 1A41A 3HNIA 3U2MA 3U9MA 4CSAA 3GODA 2R7QA 3B29A 4ONSA 3Q7LA 4CJOA 3C7JA 5COFA 4EIYA 2Y3DA 4E0HA 1VTMP 4RDAA 2L6GA 4U5DE 2M64A 2XL6A 2A0BA 1VLSA 3X2QC 4DOZA 1OCCC 1BDJB 2G3KA 3FOOA 4DVZA 3C8GA 4DBQA 1OCOC 1NU9C 4C7OB 2VCAA 3RYLA 5JLIA 4QI2A 3NKEA 4K7BA 2IOQA 1RKCA 2LP4A 3ASOC 3SZRA 4A2NB 2AVKA 4QI0A 4U5HA 1T6UA 3AOUA 3OA1A 1OXKA 1YAUO 3U3FA 1SZIA 4BJ6C 2PBEA 4Q4ZF 1FFTC 1BZ4A 1EKYA 5BQHA 1QPUA 3AG3C 4ZLCA 4NTFA 2P1AA 3LUTB 3K33A 1Y4CA 3ITFA 4JJGA 2MYSA 1B68A 1QVXA 3GM2A 2JPUA 3GWNA 4GQHA 1FNTc 1C17M 4PJMA 2DI3A 2XLVA 3FVYA 4BG0A 1HW1A 3FAPB 4CS8C 1WN0A 3FHDA 2F22A 1S7ZA 1LI7A 1NBBA 3R2PA 1LS1A 3GM1A 2HJMA 4C3BA 3M1CB 3AQBA 4OIQF 4ULWA 3G4ZA 1M2OA 3CAXA 4IARA 4U5EE 3R7CA 2HV6A 3W2WA 1OKKA 5L0JA 1L3PA 2M4EA 4YL1A 5TJ5E 1JRAA 3LS1A 4EUKB 1JR8A 2ICWG 5L0IA 3DAGA 3DJNB 4NCQA 4XTKA 5L3QA 3OWTA 3G4XA 4W8PA 1M6TA 3NYJA 1WATA 4F4BA 5F5FA 5BQIA 3K6BA 4J7TA 4G78A 1M56C 2XLOA 4ULVA 5JRAA 1D1CA 4JE9A 3W2VA 2BC5A 3M15A 1Q0MA 3IEEA 2QNLA 1MMAA 5T1DB 2TMVP 4JRZA 1U89A 3L34A 1EI7A 2CW0F 3O10A 4CDAA 2X0CA 2CGEA 1NFOA 3QVYA 2AWCA 1VK5A 4XPWA 2P0NA 5A6BA 1FMVA 3M4CA 3DAFA 4PR9A 2R05A 3US6A 3MFNA 4DJ9A 2A6HF 1Z63A 2A6EF 3GORA 3JRMO 2NUPA 4CDYA 4OIOF 4EHPA 4JCHA 3WHNA 4PFOA 4OINF 1I4ZA 2KSFA 1M57C 3QW1A 1W2WA 1SF8A 1MNEA 1JAFA 2HJ3A 3NDBB 2OCCC 1JPJA 5F28E 2A1DD 4Q5SF 4IB4A 2VASA 2H7BA 2HV7A 3GEHA 3WODF 2Q9CA 1ZHTA 3N2ZB 2J7PA 3CEXA 3O6XA 4IWBA 2UUIA 4YT5A 1FMWA 2B0JA 1LPEA 2J8WA 4IGGA 5JUAA 2MHRA 4LDKA 4MVOA 2EPOA 4R32A 4MVMA 4MVRA 4N6CA 4QDLA 3L0IA 2A69F 2XM4A 2J46A 4H4KC 3ZDLA 3ZC4A 4MVUA 3T6JA 3MBGA 4PJNA 2WZGA 3DE9A 1YZCA 2Y3BA 3TK0A 2EPMX 3FMSA 3ZQYA 2XXAA 1AEPA 1VOMA 3LEOA 4LACB 2D4UA 2XLDA 3ECSA 4CSAC 3U5SA 2JD3A 2WVQA 4MNDA 5B3SC 4LLCA 4MQ9F 4E17A 4AL1A 2NUPB 4J30B 5EK0A 3SXMA 4JVSA 4P9TA 1ZVZA 3QZCA 1QQ3A 4KBLA 2YEVA 4KNVA 3VRCA 1NSGB 5IY5C 3KYIA 4JJFA 1RKEA 1XZPA 2DYSC 2Q00A 1YZAA 2YL7A 1R5ID 2L81A 4XPYA 4DVYP 3A11A 5K0IA 4O6YA 3F46A 2DGJA 3LESA 1G4US 2R7XA 4BJ5A 4NQFA 3LS0A 3EH1A 3GEIA 4XQ1A 4YT8A 5A69A 5KYYA 3B0UX 4DBRA 1GS9A 2YRFA 4MVZA 3JYYA 4NY3A 4B6IA 1VLTA 3I5QA 3A9CA 3C63A 2P7VA 3OEOA 4OD4A 1UG7A 3H65A 3T6GB 2HMQA 4FESA 3DKAA 2WZLA 3EHMA 5COMA 3UMKA 4AE4A 2FAPB 2I8BA 4JW1A 4NTBA 3LNMB 3U3BA 1K05A 3IPMO 2J45A 2Q7RA 4BPMA
chains in the Genus database with same CATH topology
3DWWA 4AL0A 2UUHA 5BQIA 4J7TA 5HV9A 4NTFA 4JC7A 4NTAA 3HKKA 4YK5A 2UUIA 4YL0A 4JCZA 3B29A 5K0IA 4WABA 4JRZA 2PNOA 5BQGA 3LEOA 2H8AA 4YL1A 4NTBA 3PCVA 4AL1A 2Q7RA 4YL3A 4J7YA 4BPMA 5BQHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DWW A;  4AL0 A;  2UUH A;  5BQI A;  4J7T A;  5HV9 A;  4NTF A;  4JC7 A;  4NTA A;  3HKK A;  4YK5 A;  2UUI A;  4YL0 A;  4JCZ A;  3B29 A;  5K0I A;  4WAB A;  4JRZ A;  2PNO A;  5BQG A;  3LEO A;  2H8A A;  4YL1 A;  4NTB A;  3PCV A;  4AL1 A;  2Q7R A;  4YL3 A;  4J7Y A;  4BPM A;  5BQH A; 
#chains in the Genus database with same CATH topology
 3JZ0 A;  5B3I A;  3S29 A;  2KJG A;  4JTA B;  1HY5 A;  2W4M A;  4XLN F;  3AGT A;  4N4W A;  2DB4 A;  3U2L A;  1LE2 A;  4LER A;  2R25 A;  1D1B A;  2PP4 A;  1CGO A;  1RKE B;  1MMN A;  1AVO B;  1YVI A;  2YZS A;  3AQC A;  3S9O A;  1L7C A;  5EHH A;  4K0D A;  2RD9 A;  3QTH A;  5E33 A;  5KYW A;  2NPU A;  3V5X A;  2J0W A;  3TJ6 A;  5KYY B;  1ZYR F;  3S84 A;  1V55 C;  3NMJ A;  1NG1 A;  3X1O A;  3EJN A;  2H8A A;  4U9D A;  1C03 A;  1IZM A;  4WJ0 A;  2OEX A;  1T01 A;  2GDC A;  5T3W A;  4E7S A;  3DWW A;  1GGQ A;  3AGU A;  4I44 A;  3SP1 A;  1T6Q A;  1E86 A;  4XPX A;  3IQ5 A;  3SEO A;  2IBF A;  3EGD A;  2WL8 A;  3B0P A;  2R03 A;  1D0Z A;  2QTV A;  3B9Q A;  5KYU A;  1LI5 A;  4HFK B;  3K66 A;  5FZT A;  1K04 A;  1GQA A;  1XZQ A;  1APC A;  1H7I A;  3CSK A;  4CS7 A;  1T9K A;  5DQZ A;  4IJJ A;  4XLP F;  1VYK A;  3HJC A;  5BUO A;  3MLG A;  3NYL A;  3ABM C;  2KGO A;  2PNO A;  3FAJ A;  3FOP A;  5EGY A;  3C8Z A;  4OIR F;  3EHN A;  3BEH A;  2C03 A;  1H9T A;  4L6R A;  4G0H A;  1J8Y F;  2KYH A;  5KYW B;  1PV3 A;  1Y6D A;  3EG9 A;  3LNR A;  4MS2 A;  5CIV A;  5JP7 A;  4G7O F;  3RF3 A;  5A6J A;  2IXO A;  2KK1 A;  2G62 A;  4CJG A;  5E3C A;  4AX2 A;  2Q4F A;  3B71 A;  2LSE A;  3ZVR A;  3TD7 A;  5CI9 A;  3LJB A;  1LKX A;  3N24 A;  3RH3 A;  5HSW A;  1EA8 A;  2EPN A;  2G3V A;  2KQ9 A;  5DQT A;  1D1A A;  4AK9 A;  2J9V A;  2V3C C;  3SYN A;  3T9O A;  3HKK A;  4N06 A;  5E2Q A;  2Z15 A;  2CNW D;  3DM9 B;  4U5G A;  3EGD B;  5KYU B;  1HE9 A;  5JSL A;  3N0T A;  1YDI A;  2HMZ A;  2J9B A;  1I4Y A;  3MYF A;  3U0C A;  4UDV A;  5DVW A;  4Q7C A;  5F5H A;  1NLX A;  4GYT A;  3UMH A;  2ETS A;  4JTD B;  1VMA A;  4U5B E;  2R7W A;  4G7Z F;  3B0V C;  2QE9 A;  2OJE D;  4KNW A;  4CDV A;  4YT2 A;  1O5H A;  3POV A;  1I5N A;  3EG9 B;  1YLM A;  4NC3 A;  2O9X A;  1OXB A;  2WVO A;  2HKV A;  2PX0 A;  2A68 F;  3JYH A;  3V5Y A;  3VAY A;  2FGY A;  4BJ5 C;  2Q9A A;  4C3E A;  1FR0 A;  2P6V A;  2ZXR A;  2CYD A;  2X51 A;  4AL0 A;  5L0D A;  3JCU Q;  1R4T A;  4U5C E;  1OR3 A;  1HMO A;  1DOV A;  3SXY A;  1YA9 A;  1ST6 A;  4YL0 A;  2AP3 A;  2LFD A;  1D0X A;  1G5Z A;  2CDQ A;  1RMV A;  1YJG A;  4CIH A;  3PMR A;  2XSE A;  3TUL A;  2Q3T A;  1SYQ A;  3ATP A;  1K40 A;  1E84 A;  1LVK A;  2XLM A;  4DRJ B;  1Z3I X;  4O6M A;  3FXH A;  1Q0K A;  2I15 A;  1Z23 A;  3C8G D;  3IHU A;  3MX3 A;  1FTS A;  3W8I A;  3NMI A;  4XEV A;  1AUE A;  2KC3 A;  2QY9 A;  2XL8 A;  3DXJ F;  4AE4 B;  4H54 A;  4CX9 A;  1MMG A;  1OCZ C;  3F47 A;  1VYI A;  2Q9B A;  5L0H A;  3K1H A;  3KPH A;  4PAC A;  1LE4 A;  1LM3 B;  5JVE A;  3UNG C;  2OKU A;  3AJM A;  2Y69 C;  1ORJ A;  4U5F E;  4KI2 A;  2LQG A;  1YA7 O;  3EZI A;  1TR2 A;  1TWA A;  2W45 A;  3KH2 A;  2H7O A;  4EWC A;  2P61 A;  1JOG A;  3H2V A;  4MTO A;  3LAY A;  4J32 B;  3SXK A;  4BEM J;  4P6I C;  2VH3 A;  3WG7 C;  4EBJ A;  3I5P A;  3DI5 A;  4X0R A;  4XEF A;  2OOC A;  1DOW A;  3QVZ A;  3AG1 C;  1H9G A;  1A7D A;  2Y3G A;  3L1M A;  3ZQV A;  4CIP A;  2XLH A;  3KKB A;  4CS9 A;  3EFO A;  5KYN A;  2E87 A;  3JSZ A;  1WWP A;  4W8K A;  3NRH A;  3EQL F;  1PD0 A;  2XLE A;  4N6H A;  2CCY A;  4BJ1 A;  2L6H A;  5B1A C;  2Y3H A;  1ZZP A;  5B1B C;  3T4R A;  5L0F A;  1TWC A;  1J8M F;  1Q0F A;  3RVY A;  3ZIB A;  2LIG A;  2VCC A;  2QLA A;  5HV9 A;  2R7T A;  1SR2 A;  1OW6 A;  2EIM C;  2IXN A;  4NTA A;  1G4W R;  2GAQ A;  2YLD A;  1F1M A;  3G50 A;  4YK5 A;  5KYX A;  3TQO A;  3GAN A;  2KNH A;  4LDR A;  3KMI A;  5D91 A;  3WAQ A;  4C3D A;  3UGO A;  5L0G A;  1QKR A;  1KU2 A;  2AU5 A;  2Y39 A;  2LCH A;  3NMK A;  4JEB A;  4XWJ A;  2R7V A;  3V5Z A;  1TWG A;  5AC4 A;  1NZE A;  1O3U A;  4YWQ A;  3CQZ A;  4O79 A;  5A6B D;  1U0B B;  1CPR A;  3RVZ A;  1IW7 F;  4JZA A;  1YYJ A;  4PJJ A;  1ZHW A;  3KYJ A;  2HSB A;  4JEA A;  4PJL A;  3EFO B;  5DS5 A;  2YWA A;  5L3V A;  2A0U A;  2R7O A;  4YL3 A;  4IRU A;  3BRJ A;  1YYX A;  4JUR I;  5DS6 A;  3ZSU A;  3I4U A;  5DLJ A;  1OW8 A;  1TFK B;  1RCP A;  1V74 B;  2XS1 A;  3RKO F;  4HE8 D;  4FAP B;  2J7P D;  2NG1 A;  3QW0 A;  1S05 A;  1M2V A;  2YL3 A;  3HNL A;  4MTG A;  5KYX B;  1E83 A;  3O55 A;  3EGX B;  3EPV A;  3DJU B;  3SXZ A;  2LFF A;  3TJ5 A;  5AGF A;  3W8H A;  1U6H A;  2V26 A;  4FX5 A;  1T5O A;  1TFO B;  3M79 A;  2IYL D;  1TWH A;  3RFY A;  3EH2 A;  3VYW A;  3ZTM A;  5A6K A;  1ZHX A;  5T3T A;  3O39 A;  1MMD A;  4MTF A;  1YAR O;  3ABL C;  5JT4 A;  1QSP A;  3PCV A;  3S90 A;  1QLE C;  3DD7 A;  3GWL A;  1UFB A;  3K1I A;  1PCX A;  1RJ9 A;  5GPG B;  1TKN A;  2EIJ C;  2BE5 F;  1Z7Q c;  2PF4 E;  4P9F A;  4A4A A;  4DRH B;  3Q6M A;  2WB7 A;  2HUJ A;  2XRH A;  4JCZ A;  3RQE A;  1HMD A;  2YHS A;  3HNK A;  4M63 A;  2YL1 A;  4YJW A;  1HW2 A;  1M2V B;  1E85 A;  2EIN C;  3HLZ A;  3Q7G A;  4MVS A;  2J0X A;  3SNH A;  3U8V A;  4E0I A;  1FAP B;  3IQT A;  3EZH A;  3ABK C;  3LLK A;  3C8G B;  2XS8 A;  2R7S A;  2LK4 A;  4MW8 A;  5D92 A;  1XWJ A;  3U9J A;  5COG A;  3PHF 2;  1ORS C;  1EQ1 A;  3IQ6 A;  2OQM A;  2C04 A;  4XEK A;  1BR4 A;  3TOM A;  1ZHY A;  2OEV A;  3Q6N A;  1V54 C;  1LS4 A;  1OQC A;  2NSG A;  3K7D A;  4EBB A;  4YT4 A;  3UGP A;  2R02 A;  1SMY F;  1RJ9 B;  3E9V A;  4JC7 A;  4IAQ A;  4PK4 A;  1MND A;  4Z9H A;  2L7A A;  5CI8 A;  4FWV A;  1CGM E;  4Z9J A;  4CS9 C;  2GA0 A;  3H2U A;  2ASR A;  2KW3 C;  3DM5 A;  1FFH A;  4OD5 A;  4WGZ A;  1KTM A;  4LDQ A;  1LIH A;  2ZXP A;  4GEH A;  2H7V C;  2WVN A;  1CGN A;  3TOL A;  4BJ6 A;  4E18 A;  1ZW3 A;  1A7E A;  2IXM A;  1KNY A;  2VC9 A;  4EBK A;  1OR2 A;  1A0B A;  1V4A A;  2YVK A;  3MYI A;  4DRI B;  5L0C A;  1WGW A;  3DMD A;  3LLI A;  1ZU4 A;  1G8X A;  1HE1 A;  1ZU5 A;  2NSF A;  1OW7 A;  3DE8 A;  2LD6 A;  1D0Y A;  1WAS A;  4KC9 A;  3VF0 A;  2R9R B;  3HTK C;  4E7Z A;  2J9U A;  1GM5 A;  4HEA J;  2QUP A;  1JMW A;  1Q0G A;  3LEV A;  4CS8 A;  2IM8 A;  4OIP F;  5A6A A;  3RQF A;  4J7Y A;  4I3M A;  1ZW2 A;  2HSQ A;  2OU6 A;  2WZF A;  3RQG A;  3S27 A;  3ZG1 A;  4EKW A;  4MW3 A;  4ZLD A;  1JPN A;  1OCR C;  1ZHZ A;  2HZ8 A;  2OJQ A;  1PD1 A;  4ANJ A;  1H6G A;  3W4Y A;  3KL4 A;  1NU7 D;  2JX0 A;  4WAB A;  3AG2 C;  4YN0 B;  5AC5 A;  2R7R A;  2HS5 A;  3L8J A;  4O7G A;  1BR2 A;  2L9J A;  3JSE O;  1Z6A A;  4Z9I A;  3RW0 A;  1C02 A;  4I1O B;  2RSE B;  1BR1 A;  3T6B A;  1BBH A;  256B A;  4D4N A;  2AWY A;  1E2X A;  1N1C A;  3HNJ A;  3M4B A;  4D4X A;  2XM0 A;  2NUT A;  5JS5 A;  1RXQ A;  3CZ6 A;  3DZA A;  3FDQ A;  3ZTZ A;  1Z5Z A;  2D5R B;  3QMK A;  4LLE A;  1OKK D;  2ZXW C;  1WOL A;  4JKV A;  2YQY A;  2YKZ A;  4DXW A;  5DS4 A;  4JTC B;  2GFH A;  1TQG A;  4RD9 A;  1ORY A;  2XL4 A;  5E3A A;  3ZWI A;  2W9Y A;  1Q0D A;  2HFI A;  3C62 A;  4G7H F;  2CNW A;  3AG4 C;  2MWQ A;  3VM6 A;  4I1M A;  1CPQ A;  2DYR C;  3C18 A;  3NG1 A;  4IAO A;  2J9W A;  2YLG A;  1O87 A;  2IXP A;  2L6F A;  1A7V A;  3EGX A;  3S0X A;  3J06 A;  1WTY A;  2YLI A;  2FFH A;  1MQV A;  2EPK X;  2W4B A;  3E70 C;  2YL0 A;  3K1I C;  2B0H A;  3UR3 C;  1QZX A;  4ER9 A;  2XLW A;  4C7O A;  2EIL C;  3JTL O;  5BQG A;  3PDM P;  3GM3 A;  2PX3 A;  2OG2 A;  4U9E A;  2XXA B;  4CBE A;  4MVQ A;  3UMI A;  2R7U A;  3GEE A;  3JRT A;  4O6N A;  2GWW A;  4WGY A;  2VCB A;  2ZD9 A;  2NUT B;  3IQC A;  4BEJ A;  4HFF B;  2ZXO A;  3NYM A;  5FCL A;  3ASN C;  4BJT A;  3NKD A;  1VB5 A;  4PFP A;  2PFD A;  2UUH A;  2EPL X;  2VB6 A;  2ZPA A;  2EIK C;  1T6I A;  3JT1 A;  3L8I A;  4JIO A;  4K1O A;  4RBN A;  3RIP A;  3S28 A;  2BL2 A;  3V7O A;  3U8P A;  1NFN A;  1A41 A;  3HNI A;  3U2M A;  3U9M A;  4CSA A;  3GOD A;  2R7Q A;  3B29 A;  4ONS A;  3Q7L A;  4CJO A;  3C7J A;  5COF A;  4EIY A;  2Y3D A;  4E0H A;  1VTM P;  4RDA A;  2L6G A;  4U5D E;  2M64 A;  2XL6 A;  2A0B A;  1VLS A;  3X2Q C;  4DOZ A;  1OCC C;  1BDJ B;  2G3K A;  3FOO A;  4DVZ A;  3C8G A;  4DBQ A;  1OCO C;  1NU9 C;  4C7O B;  2VCA A;  3RYL A;  5JLI A;  4QI2 A;  3NKE A;  4K7B A;  2IOQ A;  1RKC A;  2LP4 A;  3ASO C;  3SZR A;  4A2N B;  2AVK A;  4QI0 A;  4U5H A;  1T6U A;  3AOU A;  3OA1 A;  1OXK A;  1YAU O;  3U3F A;  1SZI A;  4BJ6 C;  2PBE A;  4Q4Z F;  1FFT C;  1BZ4 A;  1EKY A;  5BQH A;  1QPU A;  3AG3 C;  4ZLC A;  4NTF A;  2P1A A;  3LUT B;  3K33 A;  1Y4C A;  3ITF A;  4JJG A;  2MYS A;  1B68 A;  1QVX A;  3GM2 A;  2JPU A;  3GWN A;  4GQH A;  1FNT c;  1C17 M;  4PJM A;  2DI3 A;  2XLV A;  3FVY A;  4BG0 A;  1HW1 A;  3FAP B;  4CS8 C;  1WN0 A;  3FHD A;  2F22 A;  1S7Z A;  1LI7 A;  1NBB A;  3R2P A;  1LS1 A;  3GM1 A;  2HJM A;  4C3B A;  3M1C B;  3AQB A;  4OIQ F;  4ULW A;  3G4Z A;  1M2O A;  3CAX A;  4IAR A;  4U5E E;  3R7C A;  2HV6 A;  3W2W A;  1OKK A;  5L0J A;  1L3P A;  2M4E A;  4YL1 A;  5TJ5 E;  1JRA A;  3LS1 A;  4EUK B;  1JR8 A;  2ICW G;  5L0I A;  3DAG A;  3DJN B;  4NCQ A;  4XTK A;  5L3Q A;  3OWT A;  3G4X A;  4W8P A;  1M6T A;  3NYJ A;  1WAT A;  4F4B A;  5F5F A;  5BQI A;  3K6B A;  4J7T A;  4G78 A;  1M56 C;  2XLO A;  4ULV A;  5JRA A;  1D1C A;  4JE9 A;  3W2V A;  2BC5 A;  3M15 A;  1Q0M A;  3IEE A;  2QNL A;  1MMA A;  5T1D B;  2TMV P;  4JRZ A;  1U89 A;  3L34 A;  1EI7 A;  2CW0 F;  3O10 A;  4CDA A;  2X0C A;  2CGE A;  1NFO A;  3QVY A;  2AWC A;  1VK5 A;  4XPW A;  2P0N A;  5A6B A;  1FMV A;  3M4C A;  3DAF A;  4PR9 A;  2R05 A;  3US6 A;  3MFN A;  4DJ9 A;  2A6H F;  1Z63 A;  2A6E F;  3GOR A;  3JRM O;  2NUP A;  4CDY A;  4OIO F;  4EHP A;  4JCH A;  3WHN A;  4PFO A;  4OIN F;  1I4Z A;  2KSF A;  1M57 C;  3QW1 A;  1W2W A;  1SF8 A;  1MNE A;  1JAF A;  2HJ3 A;  3NDB B;  2OCC C;  1JPJ A;  5F28 E;  2A1D D;  4Q5S F;  4IB4 A;  2VAS A;  2H7B A;  2HV7 A;  3GEH A;  3WOD F;  2Q9C A;  1ZHT A;  3N2Z B;  2J7P A;  3CEX A;  3O6X A;  4IWB A;  2UUI A;  4YT5 A;  1FMW A;  2B0J A;  1LPE A;  2J8W A;  4IGG A;  5JUA A;  2MHR A;  4LDK A;  4MVO A;  2EPO A;  4R32 A;  4MVM A;  4MVR A;  4N6C A;  4QDL A;  3L0I A;  2A69 F;  2XM4 A;  2J46 A;  4H4K C;  3ZDL A;  3ZC4 A;  4MVU A;  3T6J A;  3MBG A;  4PJN A;  2WZG A;  3DE9 A;  1YZC A;  2Y3B A;  3TK0 A;  2EPM X;  3FMS A;  3ZQY A;  2XXA A;  1AEP A;  1VOM A;  3LEO A;  4LAC B;  2D4U A;  2XLD A;  3ECS A;  4CSA C;  3U5S A;  2JD3 A;  2WVQ A;  4MND A;  5B3S C;  4LLC A;  4MQ9 F;  4E17 A;  4AL1 A;  2NUP B;  4J30 B;  5EK0 A;  3SXM A;  4JVS A;  4P9T A;  1ZVZ A;  3QZC A;  1QQ3 A;  4KBL A;  2YEV A;  4KNV A;  3VRC A;  1NSG B;  5IY5 C;  3KYI A;  4JJF A;  1RKE A;  1XZP A;  2DYS C;  2Q00 A;  1YZA A;  2YL7 A;  1R5I D;  2L81 A;  4XPY A;  4DVY P;  3A11 A;  5K0I A;  4O6Y A;  3F46 A;  2DGJ A;  3LES A;  1G4U S;  2R7X A;  4BJ5 A;  4NQF A;  3LS0 A;  3EH1 A;  3GEI A;  4XQ1 A;  4YT8 A;  5A69 A;  5KYY A;  3B0U X;  4DBR A;  1GS9 A;  2YRF A;  4MVZ A;  3JYY A;  4NY3 A;  4B6I A;  1VLT A;  3I5Q A;  3A9C A;  3C63 A;  2P7V A;  3OEO A;  4OD4 A;  1UG7 A;  3H65 A;  3T6G B;  2HMQ A;  4FES A;  3DKA A;  2WZL A;  3EHM A;  5COM A;  3UMK A;  4AE4 A;  2FAP B;  2I8B A;  4JW1 A;  4NTB A;  3LNM B;  3U3B A;  1K05 A;  3IPM O;  2J45 A;  2Q7R A;  4BPM A; 
#chains in the Genus database with same CATH homology
 3DWW A;  4AL0 A;  2UUH A;  5BQI A;  4J7T A;  5HV9 A;  4NTF A;  4JC7 A;  4NTA A;  3HKK A;  4YK5 A;  2UUI A;  4YL0 A;  4JCZ A;  3B29 A;  5K0I A;  4WAB A;  4JRZ A;  2PNO A;  5BQG A;  3LEO A;  2H8A A;  4YL1 A;  4NTB A;  3PCV A;  4AL1 A;  2Q7R A;  4YL3 A;  4J7Y A;  4BPM A;  5BQH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...