3S90A

Human vinculin head domain vh1 (residues 1-252) in complex with murine talin (vbs33; residues 1512-1546)
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
248
structure length
248
Chain Sequence
b'VFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVEKMSAEINEIIRVLQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vinculin
publication title Intermolecular versus intramolecular interactions of the vinculin binding site 33 of talin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 109
structure length 248
sequence length 248
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-05-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 3s90A02
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 3s90A01
2GWWA 1YDIA 4E18A 5FZTA 3TJ5A 2L7AA 1ST6A 4P9TA 1L7CA 1U6HA 3T6GB 4PR9A 2X0CA 4ONSA 1U89A 2B0HA 1SYQA 5L0JA 2LQGA 4IGGA 5L0GA 3S90A 1ZVZA 1DOWA 1ZW2A 1RKCA 4E17A 2IBFA 1XWJA 3MYIA 3TJ6A 2GDCA 3VF0A 5L0HA 1DOVA 1RKEB 4K1OA 3RF3A 1H6GA 5L0DA 4W8PA 1ZW3A 1TR2A 3ZDLA 3H2UA 4DJ9A 5L0FA 5L0IA 2HSQA 4EHPA 1QKRA 5L0CA 1T01A 1RKEA 3H2VA
chains in the Genus database with same CATH superfamily
3FHDA 4JE9A 1AEPA 1QSPA 2B0JA 1L3PA 3TJ5A 4E0IA 2HJMA 3PCVA 2DI3A 1FMWA 1ST6A 3VAYA 2YWAA 4DVZA 5EK0A 1NZEA 2UUIA 3GM3A 3S84A 1Y4CA 2B0HA 2XM4A 1SYQA 2EPNA 2LQGA 3SXYA 2QY9A 1RCPA 3ABKC 2J46A 3GANA 4KNVA 1GS9A 4DOZA 1LM3B 4C7OA 2R7TA 2KW3C 4HEAJ 2G62A 4RD9A 1J8MF 3DM5A 3QW0A 2VC9A 4HE8D 5A6BA 3V7OA 1LS1A 1VK5A 2W9YA 2HMZA 3HTKC 4MVSA 1D0YA 2YL3A 3W2VA 3DE9A 1TR2A 2YKZA 2CW0F 2LSEA 3RH3A 3U2MA 4J7YA 1H6GA 1OQCA 1T01A 2MWQA 1V55C 3H2VA 3QVZA 4YN0B 3SXZA 3VRCA 1EQ1A 3FVYA 5JRAA 4MTGA 3FAJA 2PX3A 5KYUB 4P6IC 2WVNA 1G4WR 2NSGA 3IQ6A 3KYJA 1IZMA 3M4BA 3O39A 4PJMA 3C8GD 2IXPA 4G0HA 4NY3A 2CNWA 3J06A 3UGOA 1RKCA 1YZAA 5F28E 1T6IA 2Q4FA 1ZU5A 5B1AC 4EIYA 2QUPA 3MFNA 1VOMA 1M56C 1T6UA 4HFFB 2HV6A 4XQ1A 2A6EF 2A1DD 2AVKA 3KPHA 3GEIA 5B3IA 5A69A 2NUTB 1Q0KA 3LS0A 3U8VA 4KBLA 2EIKC 3B0VC 2EINC 4ULVA 4YL0A 2VB6A 2GFHA 2NUPB 2Z15A 5L3QA 1D0ZA 2R7QA 3SP1A 2V26A 2ZXPA 4YJWA 3UMIA 1HMDA 4H54A 3OA1A 2Q9BA 4O7GA 3TOMA 2D5RB 2XS1A 3UNGC 3ZQYA 4D4XA 2J9BA 3IPMO 4ZLCA 5A6BD 3RVYA 3C62A 1U6HA 4OIQF 3N2ZB 3X1OA 4XLPF 2XL4A 5CI8A 1VLTA 2RSEB 2Q00A 3GM2A 3WAQA 3ZTZA 1EA8A 5EGYA 4XPWA 1BZ4A 1OW6A 5AGFA 1FTSA 4JTDB 3U9MA 1G5ZA 3ZQVA 2EPKX 4CIPA 1BBHA 3ZTMA 4WGYA 4K1OA 4L6RA 3DZAA 3N0TA 5BUOA 3T6JA 1D1CA 1VMAA 3K6BA 1HW2A 1T5OA 1UG7A 4FWVA 4PJLA 4XEVA 1D1AA 4MNDA 4Z9HA 3ZDLA 4DRIB 1R4TA 2BE5F 3E70C 3QW1A 1MMNA 2EIJC 4JCZA 3RW0A 3US6A 1TKNA 3K33A 4ZLDA 3JYYA 3ECSA 3LESA 2HFIA 4I1OB 2F22A 2E87A 2IYLD 4XLNF 4MW8A 3JSZA 1C02A 4KC9A 1VYIA 1OR2A 2FGYA 2H7OA 1A7DA 1D0XA 5E3CA 3V5ZA 2EPOA 1YYXA 2IBFA 2J8WA 2DYRC 2H7VC 2P61A 1OCOC 2ZD9A 2OKUA 5BQGA 1WATA 5A6KA 2C03A 2OJED 5KYWA 4N4WA 1Z63A 2I15A 2A69F 3MX3A 3CEXA 4PFPA 1S05A 3R2PA 2OEVA 3QZCA 5FCLA 3M15A 3TOLA 3UMKA 3EGXA 1Q0DA 2PNOA 3QTHA 2M64A 3G4XA 2EIMC 1OKKD 3EGDB 4F4BA 4IARA 3S28A 1PD0A 3N24A 4NTBA 1MQVA 5JSLA 1F1MA 1L7CA 5COFA 4Z9IA 2LFDA 3U5SA 4B6IA 5B3SC 1YZCA 2P7VA 3NKDA 1FAPB 1ZZPA 3NYJA 3OEOA 4PJNA 4CIHA 1QZXA 1JPNA 2X51A 2Y3BA 1A0BA 3C63A 3S90A 2R7WA 4CSAC 4E17A 3RFYA 2JD3A 3RQGA 2G3VA 2J7PD 1Q0MA 3DI5A 4YT5A 1NG1A 2L81A 3GWLA 2ASRA 4U5FE 5E2QA 3AQCA 4J30B 3AQBA 4XEKA 4YL3A 4NCQA 1RJ9B 3HLZA 3DM9B 3FAPB 4LLCA 4U9EA 2WVOA 4OD5A 3RF3A 1Q0GA 2R25A 3LNMB 1ZW3A 2R9RB 1YARO 3HNLA 3C8GA 1RMVA 5DS6A 4Q5SF 1Z23A 2XS8A 1TWHA 1BR2A 1HE9A 2ETSA 3JT1A 3S0XA 4PJJA 5F5FA 2WZLA 1CGME 3NMJA 4JURI 3GEEA 4C3DA 2AWYA 1OW7A 1NFNA 3I5PA 4N6HA 4ONSA 3CAXA 3AGUA 2H8AA 4LDRA 3WG7C 5A6JA 2R7SA 4YWQA 1M2VB 1ZHXA 1W2WA 3R7CA 2A68F 4MVRA 3B71A 1SF8A 2XXAA 1H7IA 1VB5A 2J45A 4MVUA 4GQHA 1S7ZA 2Y3GA 1O5HA 2HKVA 3GWNA 4JW1A 3TJ6A 3POVA 2LP4A 4DXWA 1KU2A 1E85A 4O79A 3GM1A 2PF4E 4CS8A 2BC5A 3F46A 2BL2A 2HZ8A 4MS2A 4LACB 4DRHB 4LERA 4Q4ZF 3U3BA 4EHPA 1VYKA 1R5ID 4DVYP 1QLEC 4YL1A 4G7ZF 3Q6NA 5AC4A 3LUTB 3EZIA 3W8IA 2R7UA 4KI2A 2L7AA 1EI7A 1Q0FA 4IRUA 4C7OB 4P9TA 3EFOA 1CGNA 1RXQA 2J0XA 2PP4A 4LLEA 2XLVA 2ZPAA 4NTFA 3ITFA 4AK9A 4BJ5C 1ZW2A 2Q9AA 3B29A 2HJ3A 1V54C 2OCCC 2D4UA 2XLWA 4JJGA 3KMIA 4CS8C 3BRJA 4DBQA 1OW8A 4WABA 4YK5A 5JT4A 1LIHA 2PFDA 3U0CA 4LDKA 5HSWA 3EQLF 4U5DE 1UFBA 3HNJA 3B0UX 4GYTA 2EPLX 3NKEA 3G4ZA 3A9CA 2QLAA 4WJ0A 3WODF 2P1AA 1A7EA 1I4YA 2YEVA 3LAYA 2OQMA 4U5GA 3V5YA 2KC3A 5GPGB 4O6MA 1RKEA 1C03A 2OU6A 3NMIA 3NYLA 1YDIA 5KYXA 1FFTC 4JKVA 4NTAA 5KYYA 1LI7A 5E3AA 3DWWA 2YVKA 1N1CA 1YJGA 3I4UA 3I5QA 4CS9C 4BPMA 4E7ZA 1YA7O 4JC7A 2GAQA 3Q7LA 4OIRF 3K7DA 4I1MA 1HMOA 3O10A 3U8PA 2J9UA 4YT8A 1SZIA 1OXBA 1JR8A 4O6YA 2J9VA 1C17M 2LD6A 3L8IA 2AU5A 3A11A 5IY5C 1ZHZA 1XWJA 2YLDA 3CZ6A 5DQTA 4JZAA 1OKKA 2FFHA 2XLDA 3T9OA 2XLEA 3JZ0A 4XEFA 3IHUA 1A41A 2IXNA 2LCHA 2ZXRA 5COMA 4C3EA 3H2UA 3ZWIA 5L0FA 1LS4A 5EHHA 2TMVP 5JVEA 1ZHWA 2IXOA 3FXHA 2J7PA 2L9JA 4MQ9F 4WGZA 5T3TA 4GEHA 3CQZA 1ZHTA 3BEHA 256BA 4U5HA 3UGPA 2M4EA 3X2QC 2WZGA 4H4KC 3W4YA 3SXMA 4U9DA 1OR3A 4ULWA 3FOOA 4FESA 3RKOF 5L0JA 1TFKB 4OIOF 2R7RA 3T6BA 1BDJB 2DB4A 3LEVA 4MVMA 2HMQA 2QTVA 3RIPA 4XPYA 3UMHA 2A6HF 3JSEO 3MYFA 1V74B 2QE9A 2WL8A 4CSAA 3LLIA 4EUKB 5T3WA 3KKBA 1T9KA 2YL1A 2ZXOA 4W8PA 2KK1A 4CDYA 4N6CA 1ZHYA 1YAUO 4BJ6A 1I4ZA 4JVSA 3VM6A 3JYHA 5DS4A 3M4CA 3VF0A 5TJ5E 1QQ3A 3HKKA 3EJNA 2J0WA 3L1MA 3M79A 3PMRA 2I8BA 1WOLA 2PBEA 5DLJA 1AVOB 3T6GB 1GM5A 3G50A 2CCYA 2Q9CA 4CS7A 5B1BC 1NSGB 2LFFA 4EWCA 3NYMA 5BQHA 5DVWA 2NSFA 2L6HA 3SZRA 4ER9A 5KYWB 3VYWA 1BR1A 4PK4A 3T4RA 2VASA 3ABLC 3Q7GA 1SR2A 1XZQA 1MNDA 2Y69C 4BJ6C 2YZSA 4AE4A 2YL0A 3EGXB 2J9WA 4E0HA 1Z7Qc 3U9JA 4JJFA 2EILC 1NFOA 2C04A 3LEOA 2JPUA 2W4BA 5BQIA 1HY5A 5DQZA 1HE1A 3C8ZA 3C7JA 5JUAA 2KGOA 5D92A 4D4NA 5KYNA 3DJNB 5DS5A 4OINF 2W4MA 3KYIA 1M57C 5T1DB 4E18A 1YLMA 5FZTA 4O6NA 3S29A 3EZHA 4XTKA 3C18A 5F5HA 2VCBA 1I5NA 3AG4C 4Z9JA 3RVZA 4AX2A 1MMAA 3EPVA 4U5CE 5L0GA 2R03A 3MBGA 4DRJB 2H7BA 3ZIBA 3EG9A 3AG2C 2Q7RA 1TFOB 3LS1A 1ZU4A 1LE4A 4QDLA 4BJ1A 2P0NA 3RYLA 3S9OA 3C8GB 3TQOA 1NU7D 4CX9A 3GEHA 4BJ5A 4IAQA 1GQAA 1Z5ZA 4J7TA 2YQYA 1B68A 2CDQA 3B9QA 3JRMO 5L0DA 2W45A 1JRAA 2DGJA 3ASNC 4DJ9A 3TULA 3UR3C 1FMVA 3DE8A 1QKRA 4RBNA 3EH2A 4K0DA 2Y3HA 2P6VA 5L3VA 1TWCA 2FAPB 1LKXA 2GWWA 3ATPA 4I3MA 3O6XA 3DJUB 1FFHA 3U3FA 3EG9B 2EPMX 2V3CC 2NG1A 5CIVA 2XXAB 3LNRA 3RQEA 1E86A 3OWTA 1HW1A 1YVIA 2XM0A 2RD9A 2YHSA 3FMSA 3ZG1A 4JRZA 4JTCB 3FOPA 5K0IA 2KYHA 1VTMP 4G7HF 3F47A 3LJBA 5KYUA 4CS9A 1PV3A 4OD4A 4BEMJ 4IWBA 5L0HA 1YYJA 3E9VA 1APCA 2XSEA 3M1CB 4IJJA 3H65A 1G8XA 2QNLA 2Y39A 3DAGA 1OCZC 3IEEA 4AL1A 1WGWA 1JMWA 1WWPA 2AWCA 2KNHA 3DKAA 3EFOB 4IB4A 3ZC4A 4A2NB 2NUTA 2IXMA 2LIGA 2X0CA 4M63A 1XZPA 1NLXA 2XLOA 2VCCA 4NQFA 1O87A 3AGTA 3ZSUA 1E84A 1OXKA 2NUPA 2WZFA 5JLIA 3LLKA 4PR9A 4PACA 2YLIA 1VLSA 1BR4A 1OCCC 1WASA 3JTLO 4R32A 1WTYA 3FDQA 1DOWA 1AUEA 3HNKA 1FR0A 2CGEA 4CJGA 2XRHA 4JIOA 3AJMA 4BG0A 2OJQA 4E7SA 4U5EE 3K66A 4ANJA 2HS5A 2YRFA 1JOGA 2XL6A 2YL7A 3IQTA 1DOVA 1RKEB 4JEBA 2Q3TA 3V5XA 3ZVRA 1E2XA 2XLHA 5KYXB 1NBBA 5KYYB 3K1IA 1TQGA 1LE2A 5L0IA 4MVOA 4JCHA 4QI0A 3QMKA 3B0PA 4PFOA 1FNTc 3JRTA 2L6GA 2VCAA 4CDVA 3O55A 3RQFA 2CYDA 3NG1A 2A0BA 3DMDA 3DXJF 1QVXA 1MMDA 4W8KA 3IQ5A 2MHRA 2OOCA 2UUHA 1SMYF 1ZYRF 2G3KA 2R02A 1JAFA 4XWJA 1MMGA 4KNWA 4X0RA 1TWAA 3W2WA 3MLGA 1ORSC 4XPXA 4I44A 4K7BA 5JS5A 3Q6MA 1H9TA 3AG1C 4C3BA 2AP3A 4AL0A 3SXKA 3S27A 3K1IC 1Z6AA 4EKWA 3ASOC 2HV7A 4DBRA 4FAPB 2O9XA 1PD1A 3JCUQ 2KSFA 1J8YF 3NRHA 1Z3IX 1ORJA 2CNWD 2WVQA 3PHF2 2R05A 1Y6DA 3TK0A 4YT4A 2OEXA 2DYSC 4OIPF 4UDVA 2GA0A 1A7VA 1KNYA 3HJCA 1T6QA 2MYSA 1U89A 4MVQA 2A0UA 4QI2A 5A6AA 2XL8A 4MVZA 1LVKA 1IW7F 1ORYA 3DD7A 1O3UA 3K1HA 1M2OA 1LPEA 1MNEA 4JEAA 3SYNA 3SNHA 1CGOA 2KQ9A 3AOUA 4N06A 1M6TA 2ZXWC 2Y3DA 2OG2A 3EGDA 1ZVZA 1LI5A 1PCXA 2WB7A 3NDBB 4YT2A 1D1BA 4P9FA 3WHNA 3L34A 1K40A 1K05A 2LK4A 3MYIA 4LDQA 2GDCA 3GODA 4MTFA 4HFKB 2JX0A 4Q7CA 1H9GA 3KL4A 3IQCA 2PX0A 1V4AA 2KJGA 4FX5A 3KH2A 1EKYA 3L8JA 2NPUA 2R7VA 4JTAB 4BJTA 2YLGA 5E33A 2HSQA 1NU9C 1RJ9A 2ICWG 2IM8A 2L6FA 2XLMA 3GORA 1TWGA 4EBKA 1CPRA 4BEJA 1G4US 4NC3A 4RDAA 5COGA 4EBJA 3PDMP 4MW3A 4MTOA 2HUJA 3TD7A 4AE4B 1KTMA 3QVYA 4IGGA 4G7OF 1JPJA 1CPQA 1K04A 4J32B 5CI9A 4CBEA 3EHNA 2IOQA 4EBBA 1E83A 1U0BB 2VH3A 3ABMC 3U2LA 5HV9A 1YA9A 1OCRC 3DAFA 3EHMA 1M2VA 4G78A 3SEOA 3AG3C 5D91A 4CDAA 3W8HA 1WN0A 1QPUA 3HNIA 2R7OA 3CSKA 4U5BE 3EH1A 5AC5A 5L0CA 4A4AA 3NMKA 4IAOA 4CJOA 2HSBA 2R7XA 3L0IA 5JP7A 1GGQA
chains in the Genus database with same CATH topology
2GWWA 1YDIA 4E18A 5FZTA 3TJ5A 2L7AA 1ST6A 4P9TA 1L7CA 1U6HA 3T6GB 4PR9A 2X0CA 4ONSA 1U89A 2B0HA 1SYQA 5L0JA 2LQGA 4IGGA 5L0GA 3S90A 1ZVZA 1DOWA 1ZW2A 1RKCA 4E17A 2IBFA 1XWJA 3MYIA 3TJ6A 2GDCA 3VF0A 5L0HA 1DOVA 1RKEB 4K1OA 3RF3A 1H6GA 5L0DA 4W8PA 1ZW3A 1TR2A 3ZDLA 3H2UA 4DJ9A 5L0FA 5L0IA 2HSQA 4EHPA 1QKRA 5L0CA 1T01A 1RKEA 3H2VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GWW A;  1YDI A;  4E18 A;  5FZT A;  3TJ5 A;  2L7A A;  1ST6 A;  4P9T A;  1L7C A;  1U6H A;  3T6G B;  4PR9 A;  2X0C A;  4ONS A;  1U89 A;  2B0H A;  1SYQ A;  5L0J A;  2LQG A;  4IGG A;  5L0G A;  3S90 A;  1ZVZ A;  1DOW A;  1ZW2 A;  1RKC A;  4E17 A;  2IBF A;  1XWJ A;  3MYI A;  3TJ6 A;  2GDC A;  3VF0 A;  5L0H A;  1DOV A;  1RKE B;  4K1O A;  3RF3 A;  1H6G A;  5L0D A;  4W8P A;  1ZW3 A;  1TR2 A;  3ZDL A;  3H2U A;  4DJ9 A;  5L0F A;  5L0I A;  2HSQ A;  4EHP A;  1QKR A;  5L0C A;  1T01 A;  1RKE A;  3H2V A; 
#chains in the Genus database with same CATH topology
 3FHD A;  4JE9 A;  1AEP A;  1QSP A;  2B0J A;  1L3P A;  3TJ5 A;  4E0I A;  2HJM A;  3PCV A;  2DI3 A;  1FMW A;  1ST6 A;  3VAY A;  2YWA A;  4DVZ A;  5EK0 A;  1NZE A;  2UUI A;  3GM3 A;  3S84 A;  1Y4C A;  2B0H A;  2XM4 A;  1SYQ A;  2EPN A;  2LQG A;  3SXY A;  2QY9 A;  1RCP A;  3ABK C;  2J46 A;  3GAN A;  4KNV A;  1GS9 A;  4DOZ A;  1LM3 B;  4C7O A;  2R7T A;  2KW3 C;  4HEA J;  2G62 A;  4RD9 A;  1J8M F;  3DM5 A;  3QW0 A;  2VC9 A;  4HE8 D;  5A6B A;  3V7O A;  1LS1 A;  1VK5 A;  2W9Y A;  2HMZ A;  3HTK C;  4MVS A;  1D0Y A;  2YL3 A;  3W2V A;  3DE9 A;  1TR2 A;  2YKZ A;  2CW0 F;  2LSE A;  3RH3 A;  3U2M A;  4J7Y A;  1H6G A;  1OQC A;  1T01 A;  2MWQ A;  1V55 C;  3H2V A;  3QVZ A;  4YN0 B;  3SXZ A;  3VRC A;  1EQ1 A;  3FVY A;  5JRA A;  4MTG A;  3FAJ A;  2PX3 A;  5KYU B;  4P6I C;  2WVN A;  1G4W R;  2NSG A;  3IQ6 A;  3KYJ A;  1IZM A;  3M4B A;  3O39 A;  4PJM A;  3C8G D;  2IXP A;  4G0H A;  4NY3 A;  2CNW A;  3J06 A;  3UGO A;  1RKC A;  1YZA A;  5F28 E;  1T6I A;  2Q4F A;  1ZU5 A;  5B1A C;  4EIY A;  2QUP A;  3MFN A;  1VOM A;  1M56 C;  1T6U A;  4HFF B;  2HV6 A;  4XQ1 A;  2A6E F;  2A1D D;  2AVK A;  3KPH A;  3GEI A;  5B3I A;  5A69 A;  2NUT B;  1Q0K A;  3LS0 A;  3U8V A;  4KBL A;  2EIK C;  3B0V C;  2EIN C;  4ULV A;  4YL0 A;  2VB6 A;  2GFH A;  2NUP B;  2Z15 A;  5L3Q A;  1D0Z A;  2R7Q A;  3SP1 A;  2V26 A;  2ZXP A;  4YJW A;  3UMI A;  1HMD A;  4H54 A;  3OA1 A;  2Q9B A;  4O7G A;  3TOM A;  2D5R B;  2XS1 A;  3UNG C;  3ZQY A;  4D4X A;  2J9B A;  3IPM O;  4ZLC A;  5A6B D;  3RVY A;  3C62 A;  1U6H A;  4OIQ F;  3N2Z B;  3X1O A;  4XLP F;  2XL4 A;  5CI8 A;  1VLT A;  2RSE B;  2Q00 A;  3GM2 A;  3WAQ A;  3ZTZ A;  1EA8 A;  5EGY A;  4XPW A;  1BZ4 A;  1OW6 A;  5AGF A;  1FTS A;  4JTD B;  3U9M A;  1G5Z A;  3ZQV A;  2EPK X;  4CIP A;  1BBH A;  3ZTM A;  4WGY A;  4K1O A;  4L6R A;  3DZA A;  3N0T A;  5BUO A;  3T6J A;  1D1C A;  1VMA A;  3K6B A;  1HW2 A;  1T5O A;  1UG7 A;  4FWV A;  4PJL A;  4XEV A;  1D1A A;  4MND A;  4Z9H A;  3ZDL A;  4DRI B;  1R4T A;  2BE5 F;  3E70 C;  3QW1 A;  1MMN A;  2EIJ C;  4JCZ A;  3RW0 A;  3US6 A;  1TKN A;  3K33 A;  4ZLD A;  3JYY A;  3ECS A;  3LES A;  2HFI A;  4I1O B;  2F22 A;  2E87 A;  2IYL D;  4XLN F;  4MW8 A;  3JSZ A;  1C02 A;  4KC9 A;  1VYI A;  1OR2 A;  2FGY A;  2H7O A;  1A7D A;  1D0X A;  5E3C A;  3V5Z A;  2EPO A;  1YYX A;  2IBF A;  2J8W A;  2DYR C;  2H7V C;  2P61 A;  1OCO C;  2ZD9 A;  2OKU A;  5BQG A;  1WAT A;  5A6K A;  2C03 A;  2OJE D;  5KYW A;  4N4W A;  1Z63 A;  2I15 A;  2A69 F;  3MX3 A;  3CEX A;  4PFP A;  1S05 A;  3R2P A;  2OEV A;  3QZC A;  5FCL A;  3M15 A;  3TOL A;  3UMK A;  3EGX A;  1Q0D A;  2PNO A;  3QTH A;  2M64 A;  3G4X A;  2EIM C;  1OKK D;  3EGD B;  4F4B A;  4IAR A;  3S28 A;  1PD0 A;  3N24 A;  4NTB A;  1MQV A;  5JSL A;  1F1M A;  1L7C A;  5COF A;  4Z9I A;  2LFD A;  3U5S A;  4B6I A;  5B3S C;  1YZC A;  2P7V A;  3NKD A;  1FAP B;  1ZZP A;  3NYJ A;  3OEO A;  4PJN A;  4CIH A;  1QZX A;  1JPN A;  2X51 A;  2Y3B A;  1A0B A;  3C63 A;  3S90 A;  2R7W A;  4CSA C;  4E17 A;  3RFY A;  2JD3 A;  3RQG A;  2G3V A;  2J7P D;  1Q0M A;  3DI5 A;  4YT5 A;  1NG1 A;  2L81 A;  3GWL A;  2ASR A;  4U5F E;  5E2Q A;  3AQC A;  4J30 B;  3AQB A;  4XEK A;  4YL3 A;  4NCQ A;  1RJ9 B;  3HLZ A;  3DM9 B;  3FAP B;  4LLC A;  4U9E A;  2WVO A;  4OD5 A;  3RF3 A;  1Q0G A;  2R25 A;  3LNM B;  1ZW3 A;  2R9R B;  1YAR O;  3HNL A;  3C8G A;  1RMV A;  5DS6 A;  4Q5S F;  1Z23 A;  2XS8 A;  1TWH A;  1BR2 A;  1HE9 A;  2ETS A;  3JT1 A;  3S0X A;  4PJJ A;  5F5F A;  2WZL A;  1CGM E;  3NMJ A;  4JUR I;  3GEE A;  4C3D A;  2AWY A;  1OW7 A;  1NFN A;  3I5P A;  4N6H A;  4ONS A;  3CAX A;  3AGU A;  2H8A A;  4LDR A;  3WG7 C;  5A6J A;  2R7S A;  4YWQ A;  1M2V B;  1ZHX A;  1W2W A;  3R7C A;  2A68 F;  4MVR A;  3B71 A;  1SF8 A;  2XXA A;  1H7I A;  1VB5 A;  2J45 A;  4MVU A;  4GQH A;  1S7Z A;  2Y3G A;  1O5H A;  2HKV A;  3GWN A;  4JW1 A;  3TJ6 A;  3POV A;  2LP4 A;  4DXW A;  1KU2 A;  1E85 A;  4O79 A;  3GM1 A;  2PF4 E;  4CS8 A;  2BC5 A;  3F46 A;  2BL2 A;  2HZ8 A;  4MS2 A;  4LAC B;  4DRH B;  4LER A;  4Q4Z F;  3U3B A;  4EHP A;  1VYK A;  1R5I D;  4DVY P;  1QLE C;  4YL1 A;  4G7Z F;  3Q6N A;  5AC4 A;  3LUT B;  3EZI A;  3W8I A;  2R7U A;  4KI2 A;  2L7A A;  1EI7 A;  1Q0F A;  4IRU A;  4C7O B;  4P9T A;  3EFO A;  1CGN A;  1RXQ A;  2J0X A;  2PP4 A;  4LLE A;  2XLV A;  2ZPA A;  4NTF A;  3ITF A;  4AK9 A;  4BJ5 C;  1ZW2 A;  2Q9A A;  3B29 A;  2HJ3 A;  1V54 C;  2OCC C;  2D4U A;  2XLW A;  4JJG A;  3KMI A;  4CS8 C;  3BRJ A;  4DBQ A;  1OW8 A;  4WAB A;  4YK5 A;  5JT4 A;  1LIH A;  2PFD A;  3U0C A;  4LDK A;  5HSW A;  3EQL F;  4U5D E;  1UFB A;  3HNJ A;  3B0U X;  4GYT A;  2EPL X;  3NKE A;  3G4Z A;  3A9C A;  2QLA A;  4WJ0 A;  3WOD F;  2P1A A;  1A7E A;  1I4Y A;  2YEV A;  3LAY A;  2OQM A;  4U5G A;  3V5Y A;  2KC3 A;  5GPG B;  4O6M A;  1RKE A;  1C03 A;  2OU6 A;  3NMI A;  3NYL A;  1YDI A;  5KYX A;  1FFT C;  4JKV A;  4NTA A;  5KYY A;  1LI7 A;  5E3A A;  3DWW A;  2YVK A;  1N1C A;  1YJG A;  3I4U A;  3I5Q A;  4CS9 C;  4BPM A;  4E7Z A;  1YA7 O;  4JC7 A;  2GAQ A;  3Q7L A;  4OIR F;  3K7D A;  4I1M A;  1HMO A;  3O10 A;  3U8P A;  2J9U A;  4YT8 A;  1SZI A;  1OXB A;  1JR8 A;  4O6Y A;  2J9V A;  1C17 M;  2LD6 A;  3L8I A;  2AU5 A;  3A11 A;  5IY5 C;  1ZHZ A;  1XWJ A;  2YLD A;  3CZ6 A;  5DQT A;  4JZA A;  1OKK A;  2FFH A;  2XLD A;  3T9O A;  2XLE A;  3JZ0 A;  4XEF A;  3IHU A;  1A41 A;  2IXN A;  2LCH A;  2ZXR A;  5COM A;  4C3E A;  3H2U A;  3ZWI A;  5L0F A;  1LS4 A;  5EHH A;  2TMV P;  5JVE A;  1ZHW A;  2IXO A;  3FXH A;  2J7P A;  2L9J A;  4MQ9 F;  4WGZ A;  5T3T A;  4GEH A;  3CQZ A;  1ZHT A;  3BEH A;  256B A;  4U5H A;  3UGP A;  2M4E A;  3X2Q C;  2WZG A;  4H4K C;  3W4Y A;  3SXM A;  4U9D A;  1OR3 A;  4ULW A;  3FOO A;  4FES A;  3RKO F;  5L0J A;  1TFK B;  4OIO F;  2R7R A;  3T6B A;  1BDJ B;  2DB4 A;  3LEV A;  4MVM A;  2HMQ A;  2QTV A;  3RIP A;  4XPY A;  3UMH A;  2A6H F;  3JSE O;  3MYF A;  1V74 B;  2QE9 A;  2WL8 A;  4CSA A;  3LLI A;  4EUK B;  5T3W A;  3KKB A;  1T9K A;  2YL1 A;  2ZXO A;  4W8P A;  2KK1 A;  4CDY A;  4N6C A;  1ZHY A;  1YAU O;  4BJ6 A;  1I4Z A;  4JVS A;  3VM6 A;  3JYH A;  5DS4 A;  3M4C A;  3VF0 A;  5TJ5 E;  1QQ3 A;  3HKK A;  3EJN A;  2J0W A;  3L1M A;  3M79 A;  3PMR A;  2I8B A;  1WOL A;  2PBE A;  5DLJ A;  1AVO B;  3T6G B;  1GM5 A;  3G50 A;  2CCY A;  2Q9C A;  4CS7 A;  5B1B C;  1NSG B;  2LFF A;  4EWC A;  3NYM A;  5BQH A;  5DVW A;  2NSF A;  2L6H A;  3SZR A;  4ER9 A;  5KYW B;  3VYW A;  1BR1 A;  4PK4 A;  3T4R A;  2VAS A;  3ABL C;  3Q7G A;  1SR2 A;  1XZQ A;  1MND A;  2Y69 C;  4BJ6 C;  2YZS A;  4AE4 A;  2YL0 A;  3EGX B;  2J9W A;  4E0H A;  1Z7Q c;  3U9J A;  4JJF A;  2EIL C;  1NFO A;  2C04 A;  3LEO A;  2JPU A;  2W4B A;  5BQI A;  1HY5 A;  5DQZ A;  1HE1 A;  3C8Z A;  3C7J A;  5JUA A;  2KGO A;  5D92 A;  4D4N A;  5KYN A;  3DJN B;  5DS5 A;  4OIN F;  2W4M A;  3KYI A;  1M57 C;  5T1D B;  4E18 A;  1YLM A;  5FZT A;  4O6N A;  3S29 A;  3EZH A;  4XTK A;  3C18 A;  5F5H A;  2VCB A;  1I5N A;  3AG4 C;  4Z9J A;  3RVZ A;  4AX2 A;  1MMA A;  3EPV A;  4U5C E;  5L0G A;  2R03 A;  3MBG A;  4DRJ B;  2H7B A;  3ZIB A;  3EG9 A;  3AG2 C;  2Q7R A;  1TFO B;  3LS1 A;  1ZU4 A;  1LE4 A;  4QDL A;  4BJ1 A;  2P0N A;  3RYL A;  3S9O A;  3C8G B;  3TQO A;  1NU7 D;  4CX9 A;  3GEH A;  4BJ5 A;  4IAQ A;  1GQA A;  1Z5Z A;  4J7T A;  2YQY A;  1B68 A;  2CDQ A;  3B9Q A;  3JRM O;  5L0D A;  2W45 A;  1JRA A;  2DGJ A;  3ASN C;  4DJ9 A;  3TUL A;  3UR3 C;  1FMV A;  3DE8 A;  1QKR A;  4RBN A;  3EH2 A;  4K0D A;  2Y3H A;  2P6V A;  5L3V A;  1TWC A;  2FAP B;  1LKX A;  2GWW A;  3ATP A;  4I3M A;  3O6X A;  3DJU B;  1FFH A;  3U3F A;  3EG9 B;  2EPM X;  2V3C C;  2NG1 A;  5CIV A;  2XXA B;  3LNR A;  3RQE A;  1E86 A;  3OWT A;  1HW1 A;  1YVI A;  2XM0 A;  2RD9 A;  2YHS A;  3FMS A;  3ZG1 A;  4JRZ A;  4JTC B;  3FOP A;  5K0I A;  2KYH A;  1VTM P;  4G7H F;  3F47 A;  3LJB A;  5KYU A;  4CS9 A;  1PV3 A;  4OD4 A;  4BEM J;  4IWB A;  5L0H A;  1YYJ A;  3E9V A;  1APC A;  2XSE A;  3M1C B;  4IJJ A;  3H65 A;  1G8X A;  2QNL A;  2Y39 A;  3DAG A;  1OCZ C;  3IEE A;  4AL1 A;  1WGW A;  1JMW A;  1WWP A;  2AWC A;  2KNH A;  3DKA A;  3EFO B;  4IB4 A;  3ZC4 A;  4A2N B;  2NUT A;  2IXM A;  2LIG A;  2X0C A;  4M63 A;  1XZP A;  1NLX A;  2XLO A;  2VCC A;  4NQF A;  1O87 A;  3AGT A;  3ZSU A;  1E84 A;  1OXK A;  2NUP A;  2WZF A;  5JLI A;  3LLK A;  4PR9 A;  4PAC A;  2YLI A;  1VLS A;  1BR4 A;  1OCC C;  1WAS A;  3JTL O;  4R32 A;  1WTY A;  3FDQ A;  1DOW A;  1AUE A;  3HNK A;  1FR0 A;  2CGE A;  4CJG A;  2XRH A;  4JIO A;  3AJM A;  4BG0 A;  2OJQ A;  4E7S A;  4U5E E;  3K66 A;  4ANJ A;  2HS5 A;  2YRF A;  1JOG A;  2XL6 A;  2YL7 A;  3IQT A;  1DOV A;  1RKE B;  4JEB A;  2Q3T A;  3V5X A;  3ZVR A;  1E2X A;  2XLH A;  5KYX B;  1NBB A;  5KYY B;  3K1I A;  1TQG A;  1LE2 A;  5L0I A;  4MVO A;  4JCH A;  4QI0 A;  3QMK A;  3B0P A;  4PFO A;  1FNT c;  3JRT A;  2L6G A;  2VCA A;  4CDV A;  3O55 A;  3RQF A;  2CYD A;  3NG1 A;  2A0B A;  3DMD A;  3DXJ F;  1QVX A;  1MMD A;  4W8K A;  3IQ5 A;  2MHR A;  2OOC A;  2UUH A;  1SMY F;  1ZYR F;  2G3K A;  2R02 A;  1JAF A;  4XWJ A;  1MMG A;  4KNW A;  4X0R A;  1TWA A;  3W2W A;  3MLG A;  1ORS C;  4XPX A;  4I44 A;  4K7B A;  5JS5 A;  3Q6M A;  1H9T A;  3AG1 C;  4C3B A;  2AP3 A;  4AL0 A;  3SXK A;  3S27 A;  3K1I C;  1Z6A A;  4EKW A;  3ASO C;  2HV7 A;  4DBR A;  4FAP B;  2O9X A;  1PD1 A;  3JCU Q;  2KSF A;  1J8Y F;  3NRH A;  1Z3I X;  1ORJ A;  2CNW D;  2WVQ A;  3PHF 2;  2R05 A;  1Y6D A;  3TK0 A;  4YT4 A;  2OEX A;  2DYS C;  4OIP F;  4UDV A;  2GA0 A;  1A7V A;  1KNY A;  3HJC A;  1T6Q A;  2MYS A;  1U89 A;  4MVQ A;  2A0U A;  4QI2 A;  5A6A A;  2XL8 A;  4MVZ A;  1LVK A;  1IW7 F;  1ORY A;  3DD7 A;  1O3U A;  3K1H A;  1M2O A;  1LPE A;  1MNE A;  4JEA A;  3SYN A;  3SNH A;  1CGO A;  2KQ9 A;  3AOU A;  4N06 A;  1M6T A;  2ZXW C;  2Y3D A;  2OG2 A;  3EGD A;  1ZVZ A;  1LI5 A;  1PCX A;  2WB7 A;  3NDB B;  4YT2 A;  1D1B A;  4P9F A;  3WHN A;  3L34 A;  1K40 A;  1K05 A;  2LK4 A;  3MYI A;  4LDQ A;  2GDC A;  3GOD A;  4MTF A;  4HFK B;  2JX0 A;  4Q7C A;  1H9G A;  3KL4 A;  3IQC A;  2PX0 A;  1V4A A;  2KJG A;  4FX5 A;  3KH2 A;  1EKY A;  3L8J A;  2NPU A;  2R7V A;  4JTA B;  4BJT A;  2YLG A;  5E33 A;  2HSQ A;  1NU9 C;  1RJ9 A;  2ICW G;  2IM8 A;  2L6F A;  2XLM A;  3GOR A;  1TWG A;  4EBK A;  1CPR A;  4BEJ A;  1G4U S;  4NC3 A;  4RDA A;  5COG A;  4EBJ A;  3PDM P;  4MW3 A;  4MTO A;  2HUJ A;  3TD7 A;  4AE4 B;  1KTM A;  3QVY A;  4IGG A;  4G7O F;  1JPJ A;  1CPQ A;  1K04 A;  4J32 B;  5CI9 A;  4CBE A;  3EHN A;  2IOQ A;  4EBB A;  1E83 A;  1U0B B;  2VH3 A;  3ABM C;  3U2L A;  5HV9 A;  1YA9 A;  1OCR C;  3DAF A;  3EHM A;  1M2V A;  4G78 A;  3SEO A;  3AG3 C;  5D91 A;  4CDA A;  3W8H A;  1WN0 A;  1QPU A;  3HNI A;  2R7O A;  3CSK A;  4U5B E;  3EH1 A;  5AC5 A;  5L0C A;  4A4A A;  3NMK A;  4IAO A;  4CJO A;  2HSB A;  2R7X A;  3L0I A;  5JP7 A;  1GGQ A; 
#chains in the Genus database with same CATH homology
 2GWW A;  1YDI A;  4E18 A;  5FZT A;  3TJ5 A;  2L7A A;  1ST6 A;  4P9T A;  1L7C A;  1U6H A;  3T6G B;  4PR9 A;  2X0C A;  4ONS A;  1U89 A;  2B0H A;  1SYQ A;  5L0J A;  2LQG A;  4IGG A;  5L0G A;  3S90 A;  1ZVZ A;  1DOW A;  1ZW2 A;  1RKC A;  4E17 A;  2IBF A;  1XWJ A;  3MYI A;  3TJ6 A;  2GDC A;  3VF0 A;  5L0H A;  1DOV A;  1RKE B;  4K1O A;  3RF3 A;  1H6G A;  5L0D A;  4W8P A;  1ZW3 A;  1TR2 A;  3ZDL A;  3H2U A;  4DJ9 A;  5L0F A;  5L0I A;  2HSQ A;  4EHP A;  1QKR A;  5L0C A;  1T01 A;  1RKE A;  3H2V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...