3S90A

Human vinculin head domain vh1 (residues 1-252) in complex with murine talin (vbs33; residues 1512-1546)
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
248
structure length
248
Chain Sequence
VFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVEKMSAEINEIIRVLQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Vinculin
publication title Intermolecular versus intramolecular interactions of the vinculin binding site 33 of talin.
pubmed doi rcsb
source organism Homo sapiens
total genus 109
structure length 248
sequence length 248
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-05-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 3s90A02
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 3s90A01
1ST6A 2L7AA 5L0HA 1U6HA 1QKRA 3H2VA 3TJ6A 3S90A 5L0GA 1DOWA 1SYQA 4PR9A 2B0HA 1XWJA 4K1OA 1ZW3A 2GWWA 1ZVZA 2X0CA 1U89A 2IBFA 4IGGA 5L0FA 3H2UA 1RKEB 1TR2A 1RKCA 5L0JA 5L0IA 4P9TA 1L7CA 1T01A 5L0DA 2LQGA 3ZDLA 3TJ5A 3MYIA 3VF0A 1H6GA 4E18A 4ONSA 3RF3A 1YDIA 1RKEA 1DOVA 2GDCA 5FZTA 1ZW2A 4DJ9A 4EHPA 3T6GB 5L0CA 4E17A 4W8PA 2HSQA
chains in the Genus database with same CATH superfamily
4GQHA 1FTSA 3WHNA 2R7SA 5EGYA 1YLMA 3Q6NA 4O6NA 3S90A 3IEEA 3QTHA 4E7SA 1TFKB 3O39A 4Q5SF 2FFHA 3V5YA 5KYNA 1OXKA 3FAJA 4LACB 1A7EA 1MMNA 1RCPA 3GWLA 4YT5A 2PBEA 2XXAA 1FMWA 256BA 2R7WA 1RMVA 3CZ6A 1QPUA 1K05A 3LNRA 5JP7A 1AUEA 3N0TA 1WTYA 3KMIA 4O7GA 1WOLA 1EA8A 1KU2A 2EIMC 2W4MA 4U5FE 4Z9IA 4JCHA 4U9EA 4DRJB 1PD1A 2XL8A 2DB4A 2VC9A 2Q7RA 1YYJA 2CNWA 1RKEA 3AGUA 1K04A 4AL0A 1Q0MA 2NUPA 1ZHTA 2H8AA 3N24A 1FMVA 2BE5F 2PP4A 1QKRA 3JCUQ 4B6IA 2M64A 4K0DA 1G4WR 3GM1A 2ASRA 2YRFA 2W9YA 1ZW3A 3JSZA 3M15A 4FESA 2WVOA 3PHF2 4C7OB 3DE9A 4MVMA 1Q0KA 3EGXA 3W8HA 3LLIA 1HE1A 3S84A 2A6HF 2YL3A 5COMA 3C8GB 4BEJA 4D4XA 1ORJA 2R7UA 4C3EA 1C03A 1LM3B 2LFFA 4JRZA 3O10A 1L3PA 1Z23A 4MQ9F 5TJ5E 3NYJA 3SEOA 4CJGA 4E18A 4CIHA 3M4CA 5EHHA 3K1HA 4CBEA 3ITFA 3PDMP 2HSQA 2A6EF 2VCCA 4OD5A 2NUTB 4YJWA 3GORA 2OCCC 2J8WA 3MBGA 4CS9C 2HJ3A 3C7JA 1YA7O 3X1OA 4XEKA 5E3AA 3GEIA 3LEOA 3W2WA 4DVZA 3GEHA 2OQMA 3S27A 3FDQA 4Z9HA 1JMWA 3ECSA 1ZU4A 3C63A 4QI2A 3TD7A 4EBBA 1RJ9A 1G5ZA 2XM0A 1Y6DA 1NG1A 1RKEB 3U3FA 1SMYF 2JD3A 2ZPAA 4XWJA 3JT1A 2EPMX 1EQ1A 3DMDA 2NUPB 1JR8A 2ZXWC 3DE8A 4PJJA 2J46A 3LLKA 4BG0A 2BL2A 4H4KC 4BJTA 4JTAB 1B68A 2HV7A 2J7PA 3ABMC 4OD4A 4BJ6C 4OIOF 3POVA 4LDKA 1N1CA 1TFOB 1XZPA 4NY3A 1D0ZA 5F28E 4MNDA 3AJMA 5DQZA 1Z3IX 4JEBA 2QTVA 2G3VA 1UG7A 2P61A 5KYWB 3K7DA 4U5BE 2VCAA 4RBNA 1BZ4A 3DAGA 5BUOA 5JUAA 1VOMA 3IHUA 3LNMB 2B0HA 4XPXA 3DJUB 1OR3A 3ZTZA 2Q3TA 4NCQA 5T3WA 2EILC 2HV6A 2IBFA 2X0CA 3H2UA 2KK1A 2LD6A 1LI5A 1RXQA 4K7BA 2R7RA 4H54A 2IXPA 3SP1A 2XL4A 1LE2A 3WODF 1L7CA 5D91A 4U5DE 2OKUA 1M6TA 3ZTMA 3U2MA 3AG4C 1QSPA 3KYJA 4U5EE 2R7OA 3M1CB 4ONSA 3T9OA 5FCLA 4G7HF 2HKVA 1HMDA 4JZAA 2LP4A 1HW2A 2YVKA 3KYIA 3QVZA 2V26A 4NQFA 3ZWIA 2CCYA 2A0UA 4L6RA 4E0HA 2J9BA 4KC9A 4AE4A 5L0HA 4WGYA 4A4AA 1DOWA 2LSEA 3UGOA 2KJGA 2P0NA 1TKNA 1OR2A 2AU5A 3NYMA 4JC7A 3RIPA 4XLNF 4BJ5A 4OIPF 3ZVRA 4CDAA 2CDQA 2VCBA 3WG7C 1T5OA 3IQ6A 4OINF 5A6BA 2YL7A 1OCCC 3AQCA 1LE4A 4MVRA 3PCVA 3Q7LA 4MVZA 4MVOA 4I44A 1E84A 3V7OA 2VASA 4C7OA 3L0IA 2Q9CA 5HSWA 1ZHWA 2DYRC 1Z7Qc 2GDCA 1MNEA 2B0JA 1D0XA 3ASOC 3C18A 3H65A 3NMJA 1NU9C 3C8GA 3JSEO 4MW8A 2O9XA 2OJQA 4P9FA 5COFA 5KYYB 2RD9A 3DXJF 3JRMO 3H2VA 2DI3A 5DQTA 1YARO 2HUJA 5AGFA 2UUIA 3GWNA 3BRJA 4YL1A 3V5ZA 4PR9A 2MHRA 2C03A 1M56C 1D1AA 3GODA 2GWWA 2D5RB 1E86A 2NUTA 1A41A 2R25A 4PJMA 3T6JA 3CQZA 3SYNA 3HLZA 3HNJA 2MWQA 1I4ZA 4YWQA 2A69F 1FFHA 4MW3A 3S0XA 3FOPA 2OEXA 4JCZA 2QY9A 3E9VA 5DLJA 2I8BA 3F46A 3K66A 1LKXA 3NYLA 5JS5A 1OQCA 2RSEB 3EFOA 3OA1A 4AE4B 3RF3A 3U5SA 4C3DA 2X51A 2ZXOA 3VRCA 2QE9A 3HNLA 3MYFA 1Z5ZA 2HMZA 2EIKC 3EH2A 4AX2A 1VYKA 2XL6A 3IQCA 3A9CA 1AVOB 2DGJA 2H7BA 1U0BB 3KKBA 1HE9A 1ZHYA 2Q00A 2YKZA 4EBKA 2J9UA 5F5FA 2Z15A 1T6IA 3TOLA 4JEAA 5K0IA 1OCOC 2IM8A 4JW1A 3B29A 2YL0A 2ICWG 2R7XA 4DVYP 4IGGA 1SR2A 3LS1A 2BC5A 3SXYA 4XPWA 4U9DA 1V74B 3NRHA 5KYWA 3ABKC 1F1MA 3O6XA 2WL8A 3U8VA 1E83A 1J8YF 5AC4A 1OKKD 3QZCA 1O3UA 3K1IA 1ZU5A 4NTAA 3RKOF 1QLEC 1APCA 1KNYA 1MMGA 2YLIA 1MQVA 4U5CE 5FZTA 3RQFA 4CDYA 4KI2A 2GFHA 4MTGA 4NTFA 2A1DD 5A6AA 2ZXPA 2R9RB 2VH3A 1VLTA 4OIQF 1NBBA 2Y39A 3C8ZA 1VMAA 1W2WA 3OEOA 3B71A 2Y3HA 2ZD9A 4P6IC 1TWAA 1Z63A 4PFOA 2OOCA 3T6BA 3DI5A 5EK0A 2PX3A 2NSFA 4JURI 2L81A 5L3QA 3EFOB 4YT8A 3EGDA 2A0BA 3ZG1A 1H7IA 2A68F 1TR2A 1BBHA 3J06A 3M4BA 5E2QA 3KPHA 4BPMA 3RVZA 1ZYRF 5JT4A 3JYYA 5A69A 4CS8A 2NG1A 2XS1A 1LIHA 3MYIA 3SXKA 4RD9A 1Z6AA 2WVNA 2YQYA 1OXBA 3AG1C 3HNKA 4MS2A 4N06A 3SNHA 4YL3A 1JAFA 4JIOA 3T6GB 4E17A 1LPEA 3B0PA 3HTKC 2YLDA 4Q4ZF 1WGWA 1R5ID 3G4XA 3SXZA 4JTCB 4E7ZA 3JYHA 1FFTC 4PFPA 4PJLA 2G62A 4DOZA 1SYQA 1OW6A 1C02A 3ATPA 3LJBA 1LS4A 2UUHA 2XLEA 1ZHXA 3RFYA 1D0YA 4K1OA 2EPOA 2ZXRA 5JVEA 4WABA 4N4WA 2D4UA 2EPLX 1OW8A 4XEVA 4HE8D 5KYYA 5JRAA 1VYIA 3K33A 4ANJA 3TK0A 5B3IA 1SZIA 3A11A 4FWVA 4AL1A 1EI7A 2HSBA 3DJNB 1GQAA 3TJ5A 4CSAA 1V4AA 1M2VA 4IRUA 2XLMA 4MTOA 4DXWA 4DJ9A 3W4YA 4EHPA 2KQ9A 2L9JA 3NMIA 3DM9B 4WGZA 2L6GA 1VB5A 2HFIA 3LAYA 1JPJA 2XRHA 3EGDB 2CYDA 2EPNA 2WB7A 1YYXA 4EKWA 3U0CA 1S7ZA 3SXMA 2PF4E 2IOQA 1MNDA 1KTMA 3NKDA 3Q6MA 2J0WA 1YA9A 3CSKA 4BJ1A 2HJMA 1Y4CA 3JZ0A 3G50A 5CI8A 3TOMA 3TULA 2IYLD 1HY5A 5D92A 5BQHA 1NLXA 5JLIA 2CGEA 4XEFA 4O6MA 1CPQA 3B9QA 1NFNA 2XSEA 2GA0A 1TWHA 3E70C 1YZCA 1Q0DA 3NMKA 1OW7A 3S28A 4EUKB 5BQIA 1T6UA 3U2LA 4U5HA 5E33A 2OG2A 3RQGA 3IQ5A 5AC5A 3S9OA 2R7QA 3HNIA 2V3CC 4EIYA 1XZQA 1G4US 2KSFA 3DAFA 3QVYA 4J30B 3ZIBA 1YJGA 2P1AA 4IARA 4JKVA 2R7VA 4ULVA 1GS9A 3EPVA 3FOOA 3LS0A 3EHNA 1NSGB 2M4EA 1BDJB 5JSLA 1Q0GA 4DRHB 4ZLDA 4O6YA 1YVIA 3ZQVA 3MFNA 3B0VC 1OCZC 1PV3A 4XPYA 5KYUB 3RYLA 3IQTA 4NTBA 2CW0F 2I15A 2XLHA 4IJJA 1ZVZA 4D4NA 2YEVA 4MVSA 3W2VA 4QDLA 1M2VB 3WAQA 1QZXA 3I5QA 4I3MA 3B0UX 4G7OF 1ORSC 1TWCA 1LS1A 2Y3DA 2ETSA 1K40A 3GM2A 3I4UA 2Y3GA 3L8JA 4ZLCA 1LVKA 2IXMA 1BR1A 1PD0A 2Q9BA 4MVUA 5KYXB 2J0XA 1A0BA 2XLDA 3SZRA 3EQLF 2R05A 1ZW2A 4JJGA 3RH3A 4LDRA 4CS9A 5COGA 1WASA 4MTFA 1I5NA 3V5XA 2NSGA 1ST6A 1JPNA 2C04A 4J32B 1AEPA 3BEHA 3NG1A 1JRAA 4G7ZF 3PMRA 4YK5A 5E3CA 1S05A 1XWJA 1VLSA 1Q0FA 4Q7CA 4U5GA 1U89A 2KNHA 2QUPA 3EG9A 1FR0A 2PFDA 2YL1A 3I5PA 4J7TA 3AG2C 3FXHA 4LDQA 2QNLA 3NKEA 1TWGA 3U3BA 4BJ5C 3ZSUA 5L0IA 2JPUA 3DKAA 3DD7A 5L0DA 2WVQA 3KH2A 3EZIA 3LUTB 1T6QA 3IPMO 4BJ6A 5B3SC 5A6JA 2R7TA 3HJCA 2Y3BA 1E2XA 1A7DA 3MLGA 3O55A 3FHDA 4X0RA 5L3VA 1YZAA 5DVWA 3DZAA 3RQEA 4YN0B 2L7AA 5DS4A 1MMDA 4IWBA 1WATA 3G4ZA 2GAQA 1U6HA 3NDBB 5BQGA 3U9MA 2FGYA 4MVQA 1T9KA 2FAPB 2W45A 2YWAA 3JTLO 4G0HA 3X2QC 3L34A 1O87A 1WN0A 3FMSA 2LK4A 2H7OA 1O5HA 1RKCA 3LEVA 3GEEA 2EIJC 3LESA 3L8IA 1ORYA 4CX9A 2LIGA 4JJFA 4E0IA 1OKKA 1YAUO 3ZDLA 4F4BA 4BEMJ 4IAOA 2AVKA 2J7PD 2IXNA 4M63A 2JX0A 4QI0A 2R02A 5T3TA 3UMHA 4CS7A 2AP3A 2AWCA 4A2NB 1V55C 3QW0A 2KYHA 1C17M 4CIPA 1CGME 2XXAB 4JVSA 4YT2A 3EG9B 1ZHZA 4GEHA 3S29A 5IY5C 4IB4A 2AWYA 3U8PA 3R2PA 5CI9A 1NU7D 2PX0A 3UGPA 1MMAA 3C62A 5DS6A 1JOGA 3N2ZB 1HW1A 2H7VC 2LCHA 2VB6A 1FAPB 5L0FA 3AOUA 3QMKA 4CJOA 4ER9A 3UR3C 2OJED 4G78A 2QLAA 5F5HA 1IZMA 1PCXA 3W8IA 3M79A 1NFOA 1WWPA 3US6A 1GGQA 1UFBA 3R7CA 5KYUA 1GM5A 1HMOA 2R03A 1E85A 3EJNA 2P7VA 4YL0A 5CIVA 3RVYA 1BR4A 2PNOA 3HKKA 2EPKX 4R32A 3K1IC 1TQGA 3DWWA 3CAXA 4W8PA 1V54C 4AK9A 2Y69C 3EZHA 2J45A 4Z9JA 3EGXB 3MX3A 2LFDA 1CGNA 4DRIB 4UDVA 2OEVA 4I1OB 4LLEA 2Q4FA 2J9VA 4ULWA 3F47A 2KGOA 3TJ6A 3UMIA 3VYWA 5L0GA 5KYXA 4FAPB 3GM3A 2XLVA 1A7VA 1D1CA 4W8KA 1VK5A 3VAYA 4O79A 1H9GA 3EHMA 4N6CA 4LLCA 4EWCA 2XS8A 3FAPB 4J7YA 5A6BD 5HV9A 2W4BA 2TMVP 4OIRF 3EH1A 1M2OA 4XTKA 3JRTA 3FVYA 2HMQA 5GPGB 5B1BC 5T1DB 5L0JA 2HS5A 2L6FA 2HZ8A 1BR2A 2MYSA 4P9TA 1T01A 1H9TA 2LQGA 3ZC4A 5DS5A 2EINC 4XQ1A 3KL4A 1D1BA 3ZQYA 3OWTA 4HFKB 4JTDB 4YT4A 4XLPF 1M57C 2OU6A 3TQOA 3U9JA 3UNGC 4CS8C 5L0CA 3DM5A 3C8GD 3K6BA 3VM6A 4CDVA 4RDAA 3RW0A 2DYSC 3CEXA 2WZLA 2XM4A 1RJ9B 3AG3C 1VTMP 2P6VA 4WJ0A 1G8XA 1OCRC 2YHSA 4PACA 2F22A 2XLOA 4N6HA 4PJNA 4KNVA 2WZFA 4DBRA 3Q7GA 4GYTA 1J8MF 2E87A 4HEAJ 2G3KA 1R4TA 2IXOA 3ASNC 1ZZPA 2YLGA 3QW1A 4C3BA 2XLWA 1NZEA 1FNTc 3AQBA 3GANA 4FX5A 1IW7F 4I1MA 3AGTA 3L1MA 2WZGA 5A6KA 2KC3A 4KNWA 4NC3A 1CGOA 3VF0A 2YZSA 1EKYA 1H6GA 1LI7A 2J9WA 4KBLA 1YDIA 2NPUA 2L6HA 4PK4A 4DBQA 4CSAC 1DOVA 1QQ3A 4HFFB 1I4YA 1QVXA 2CNWD 4IAQA 4JE9A 2Q9AA 3ABLC 1CPRA 2KW3C 4LERA 3T4RA 4EBJA 5B1AC 3UMKA 1SF8A
chains in the Genus database with same CATH topology
1ST6A 2L7AA 5L0HA 1U6HA 1QKRA 3H2VA 3TJ6A 3S90A 5L0GA 1DOWA 1SYQA 4PR9A 2B0HA 1XWJA 4K1OA 1ZW3A 2GWWA 1ZVZA 2X0CA 1U89A 2IBFA 4IGGA 5L0FA 3H2UA 1RKEB 1TR2A 1RKCA 5L0JA 5L0IA 4P9TA 1L7CA 1T01A 5L0DA 2LQGA 3ZDLA 3TJ5A 3MYIA 3VF0A 1H6GA 4E18A 4ONSA 3RF3A 1YDIA 1RKEA 1DOVA 2GDCA 5FZTA 1ZW2A 4DJ9A 4EHPA 3T6GB 5L0CA 4E17A 4W8PA 2HSQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ST6 A;  2L7A A;  5L0H A;  1U6H A;  1QKR A;  3H2V A;  3TJ6 A;  3S90 A;  5L0G A;  1DOW A;  1SYQ A;  4PR9 A;  2B0H A;  1XWJ A;  4K1O A;  1ZW3 A;  2GWW A;  1ZVZ A;  2X0C A;  1U89 A;  2IBF A;  4IGG A;  5L0F A;  3H2U A;  1RKE B;  1TR2 A;  1RKC A;  5L0J A;  5L0I A;  4P9T A;  1L7C A;  1T01 A;  5L0D A;  2LQG A;  3ZDL A;  3TJ5 A;  3MYI A;  3VF0 A;  1H6G A;  4E18 A;  4ONS A;  3RF3 A;  1YDI A;  1RKE A;  1DOV A;  2GDC A;  5FZT A;  1ZW2 A;  4DJ9 A;  4EHP A;  3T6G B;  5L0C A;  4E17 A;  4W8P A;  2HSQ A; 
#chains in the Genus database with same CATH topology
 4GQH A;  1FTS A;  3WHN A;  2R7S A;  5EGY A;  1YLM A;  3Q6N A;  4O6N A;  3S90 A;  3IEE A;  3QTH A;  4E7S A;  1TFK B;  3O39 A;  4Q5S F;  2FFH A;  3V5Y A;  5KYN A;  1OXK A;  3FAJ A;  4LAC B;  1A7E A;  1MMN A;  1RCP A;  3GWL A;  4YT5 A;  2PBE A;  2XXA A;  1FMW A;  256B A;  2R7W A;  1RMV A;  3CZ6 A;  1QPU A;  1K05 A;  3LNR A;  5JP7 A;  1AUE A;  3N0T A;  1WTY A;  3KMI A;  4O7G A;  1WOL A;  1EA8 A;  1KU2 A;  2EIM C;  2W4M A;  4U5F E;  4Z9I A;  4JCH A;  4U9E A;  4DRJ B;  1PD1 A;  2XL8 A;  2DB4 A;  2VC9 A;  2Q7R A;  1YYJ A;  2CNW A;  1RKE A;  3AGU A;  1K04 A;  4AL0 A;  1Q0M A;  2NUP A;  1ZHT A;  2H8A A;  3N24 A;  1FMV A;  2BE5 F;  2PP4 A;  1QKR A;  3JCU Q;  4B6I A;  2M64 A;  4K0D A;  1G4W R;  3GM1 A;  2ASR A;  2YRF A;  2W9Y A;  1ZW3 A;  3JSZ A;  3M15 A;  4FES A;  2WVO A;  3PHF 2;  4C7O B;  3DE9 A;  4MVM A;  1Q0K A;  3EGX A;  3W8H A;  3LLI A;  1HE1 A;  3S84 A;  2A6H F;  2YL3 A;  5COM A;  3C8G B;  4BEJ A;  4D4X A;  1ORJ A;  2R7U A;  4C3E A;  1C03 A;  1LM3 B;  2LFF A;  4JRZ A;  3O10 A;  1L3P A;  1Z23 A;  4MQ9 F;  5TJ5 E;  3NYJ A;  3SEO A;  4CJG A;  4E18 A;  4CIH A;  3M4C A;  5EHH A;  3K1H A;  4CBE A;  3ITF A;  3PDM P;  2HSQ A;  2A6E F;  2VCC A;  4OD5 A;  2NUT B;  4YJW A;  3GOR A;  2OCC C;  2J8W A;  3MBG A;  4CS9 C;  2HJ3 A;  3C7J A;  1YA7 O;  3X1O A;  4XEK A;  5E3A A;  3GEI A;  3LEO A;  3W2W A;  4DVZ A;  3GEH A;  2OQM A;  3S27 A;  3FDQ A;  4Z9H A;  1JMW A;  3ECS A;  1ZU4 A;  3C63 A;  4QI2 A;  3TD7 A;  4EBB A;  1RJ9 A;  1G5Z A;  2XM0 A;  1Y6D A;  1NG1 A;  1RKE B;  3U3F A;  1SMY F;  2JD3 A;  2ZPA A;  4XWJ A;  3JT1 A;  2EPM X;  1EQ1 A;  3DMD A;  2NUP B;  1JR8 A;  2ZXW C;  3DE8 A;  4PJJ A;  2J46 A;  3LLK A;  4BG0 A;  2BL2 A;  4H4K C;  4BJT A;  4JTA B;  1B68 A;  2HV7 A;  2J7P A;  3ABM C;  4OD4 A;  4BJ6 C;  4OIO F;  3POV A;  4LDK A;  1N1C A;  1TFO B;  1XZP A;  4NY3 A;  1D0Z A;  5F28 E;  4MND A;  3AJM A;  5DQZ A;  1Z3I X;  4JEB A;  2QTV A;  2G3V A;  1UG7 A;  2P61 A;  5KYW B;  3K7D A;  4U5B E;  2VCA A;  4RBN A;  1BZ4 A;  3DAG A;  5BUO A;  5JUA A;  1VOM A;  3IHU A;  3LNM B;  2B0H A;  4XPX A;  3DJU B;  1OR3 A;  3ZTZ A;  2Q3T A;  4NCQ A;  5T3W A;  2EIL C;  2HV6 A;  2IBF A;  2X0C A;  3H2U A;  2KK1 A;  2LD6 A;  1LI5 A;  1RXQ A;  4K7B A;  2R7R A;  4H54 A;  2IXP A;  3SP1 A;  2XL4 A;  1LE2 A;  3WOD F;  1L7C A;  5D91 A;  4U5D E;  2OKU A;  1M6T A;  3ZTM A;  3U2M A;  3AG4 C;  1QSP A;  3KYJ A;  4U5E E;  2R7O A;  3M1C B;  4ONS A;  3T9O A;  5FCL A;  4G7H F;  2HKV A;  1HMD A;  4JZA A;  2LP4 A;  1HW2 A;  2YVK A;  3KYI A;  3QVZ A;  2V26 A;  4NQF A;  3ZWI A;  2CCY A;  2A0U A;  4L6R A;  4E0H A;  2J9B A;  4KC9 A;  4AE4 A;  5L0H A;  4WGY A;  4A4A A;  1DOW A;  2LSE A;  3UGO A;  2KJG A;  2P0N A;  1TKN A;  1OR2 A;  2AU5 A;  3NYM A;  4JC7 A;  3RIP A;  4XLN F;  4BJ5 A;  4OIP F;  3ZVR A;  4CDA A;  2CDQ A;  2VCB A;  3WG7 C;  1T5O A;  3IQ6 A;  4OIN F;  5A6B A;  2YL7 A;  1OCC C;  3AQC A;  1LE4 A;  4MVR A;  3PCV A;  3Q7L A;  4MVZ A;  4MVO A;  4I44 A;  1E84 A;  3V7O A;  2VAS A;  4C7O A;  3L0I A;  2Q9C A;  5HSW A;  1ZHW A;  2DYR C;  1Z7Q c;  2GDC A;  1MNE A;  2B0J A;  1D0X A;  3ASO C;  3C18 A;  3H65 A;  3NMJ A;  1NU9 C;  3C8G A;  3JSE O;  4MW8 A;  2O9X A;  2OJQ A;  4P9F A;  5COF A;  5KYY B;  2RD9 A;  3DXJ F;  3JRM O;  3H2V A;  2DI3 A;  5DQT A;  1YAR O;  2HUJ A;  5AGF A;  2UUI A;  3GWN A;  3BRJ A;  4YL1 A;  3V5Z A;  4PR9 A;  2MHR A;  2C03 A;  1M56 C;  1D1A A;  3GOD A;  2GWW A;  2D5R B;  1E86 A;  2NUT A;  1A41 A;  2R25 A;  4PJM A;  3T6J A;  3CQZ A;  3SYN A;  3HLZ A;  3HNJ A;  2MWQ A;  1I4Z A;  4YWQ A;  2A69 F;  1FFH A;  4MW3 A;  3S0X A;  3FOP A;  2OEX A;  4JCZ A;  2QY9 A;  3E9V A;  5DLJ A;  2I8B A;  3F46 A;  3K66 A;  1LKX A;  3NYL A;  5JS5 A;  1OQC A;  2RSE B;  3EFO A;  3OA1 A;  4AE4 B;  3RF3 A;  3U5S A;  4C3D A;  2X51 A;  2ZXO A;  3VRC A;  2QE9 A;  3HNL A;  3MYF A;  1Z5Z A;  2HMZ A;  2EIK C;  3EH2 A;  4AX2 A;  1VYK A;  2XL6 A;  3IQC A;  3A9C A;  1AVO B;  2DGJ A;  2H7B A;  1U0B B;  3KKB A;  1HE9 A;  1ZHY A;  2Q00 A;  2YKZ A;  4EBK A;  2J9U A;  5F5F A;  2Z15 A;  1T6I A;  3TOL A;  4JEA A;  5K0I A;  1OCO C;  2IM8 A;  4JW1 A;  3B29 A;  2YL0 A;  2ICW G;  2R7X A;  4DVY P;  4IGG A;  1SR2 A;  3LS1 A;  2BC5 A;  3SXY A;  4XPW A;  4U9D A;  1V74 B;  3NRH A;  5KYW A;  3ABK C;  1F1M A;  3O6X A;  2WL8 A;  3U8V A;  1E83 A;  1J8Y F;  5AC4 A;  1OKK D;  3QZC A;  1O3U A;  3K1I A;  1ZU5 A;  4NTA A;  3RKO F;  1QLE C;  1APC A;  1KNY A;  1MMG A;  2YLI A;  1MQV A;  4U5C E;  5FZT A;  3RQF A;  4CDY A;  4KI2 A;  2GFH A;  4MTG A;  4NTF A;  2A1D D;  5A6A A;  2ZXP A;  2R9R B;  2VH3 A;  1VLT A;  4OIQ F;  1NBB A;  2Y39 A;  3C8Z A;  1VMA A;  1W2W A;  3OEO A;  3B71 A;  2Y3H A;  2ZD9 A;  4P6I C;  1TWA A;  1Z63 A;  4PFO A;  2OOC A;  3T6B A;  3DI5 A;  5EK0 A;  2PX3 A;  2NSF A;  4JUR I;  2L81 A;  5L3Q A;  3EFO B;  4YT8 A;  3EGD A;  2A0B A;  3ZG1 A;  1H7I A;  2A68 F;  1TR2 A;  1BBH A;  3J06 A;  3M4B A;  5E2Q A;  3KPH A;  4BPM A;  3RVZ A;  1ZYR F;  5JT4 A;  3JYY A;  5A69 A;  4CS8 A;  2NG1 A;  2XS1 A;  1LIH A;  3MYI A;  3SXK A;  4RD9 A;  1Z6A A;  2WVN A;  2YQY A;  1OXB A;  3AG1 C;  3HNK A;  4MS2 A;  4N06 A;  3SNH A;  4YL3 A;  1JAF A;  4JIO A;  3T6G B;  4E17 A;  1LPE A;  3B0P A;  3HTK C;  2YLD A;  4Q4Z F;  1WGW A;  1R5I D;  3G4X A;  3SXZ A;  4JTC B;  4E7Z A;  3JYH A;  1FFT C;  4PFP A;  4PJL A;  2G62 A;  4DOZ A;  1SYQ A;  1OW6 A;  1C02 A;  3ATP A;  3LJB A;  1LS4 A;  2UUH A;  2XLE A;  1ZHX A;  3RFY A;  1D0Y A;  4K1O A;  2EPO A;  2ZXR A;  5JVE A;  4WAB A;  4N4W A;  2D4U A;  2EPL X;  1OW8 A;  4XEV A;  4HE8 D;  5KYY A;  5JRA A;  1VYI A;  3K33 A;  4ANJ A;  3TK0 A;  5B3I A;  1SZI A;  3A11 A;  4FWV A;  4AL1 A;  1EI7 A;  2HSB A;  3DJN B;  1GQA A;  3TJ5 A;  4CSA A;  1V4A A;  1M2V A;  4IRU A;  2XLM A;  4MTO A;  4DXW A;  4DJ9 A;  3W4Y A;  4EHP A;  2KQ9 A;  2L9J A;  3NMI A;  3DM9 B;  4WGZ A;  2L6G A;  1VB5 A;  2HFI A;  3LAY A;  1JPJ A;  2XRH A;  3EGD B;  2CYD A;  2EPN A;  2WB7 A;  1YYX A;  4EKW A;  3U0C A;  1S7Z A;  3SXM A;  2PF4 E;  2IOQ A;  1MND A;  1KTM A;  3NKD A;  3Q6M A;  2J0W A;  1YA9 A;  3CSK A;  4BJ1 A;  2HJM A;  1Y4C A;  3JZ0 A;  3G50 A;  5CI8 A;  3TOM A;  3TUL A;  2IYL D;  1HY5 A;  5D92 A;  5BQH A;  1NLX A;  5JLI A;  2CGE A;  4XEF A;  4O6M A;  1CPQ A;  3B9Q A;  1NFN A;  2XSE A;  2GA0 A;  1TWH A;  3E70 C;  1YZC A;  1Q0D A;  3NMK A;  1OW7 A;  3S28 A;  4EUK B;  5BQI A;  1T6U A;  3U2L A;  4U5H A;  5E33 A;  2OG2 A;  3RQG A;  3IQ5 A;  5AC5 A;  3S9O A;  2R7Q A;  3HNI A;  2V3C C;  4EIY A;  1XZQ A;  1G4U S;  2KSF A;  3DAF A;  3QVY A;  4J30 B;  3ZIB A;  1YJG A;  2P1A A;  4IAR A;  4JKV A;  2R7V A;  4ULV A;  1GS9 A;  3EPV A;  3FOO A;  3LS0 A;  3EHN A;  1NSG B;  2M4E A;  1BDJ B;  5JSL A;  1Q0G A;  4DRH B;  4ZLD A;  4O6Y A;  1YVI A;  3ZQV A;  3MFN A;  3B0V C;  1OCZ C;  1PV3 A;  4XPY A;  5KYU B;  3RYL A;  3IQT A;  4NTB A;  2CW0 F;  2I15 A;  2XLH A;  4IJJ A;  1ZVZ A;  4D4N A;  2YEV A;  4MVS A;  3W2V A;  4QDL A;  1M2V B;  3WAQ A;  1QZX A;  3I5Q A;  4I3M A;  3B0U X;  4G7O F;  1ORS C;  1TWC A;  1LS1 A;  2Y3D A;  2ETS A;  1K40 A;  3GM2 A;  3I4U A;  2Y3G A;  3L8J A;  4ZLC A;  1LVK A;  2IXM A;  1BR1 A;  1PD0 A;  2Q9B A;  4MVU A;  5KYX B;  2J0X A;  1A0B A;  2XLD A;  3SZR A;  3EQL F;  2R05 A;  1ZW2 A;  4JJG A;  3RH3 A;  4LDR A;  4CS9 A;  5COG A;  1WAS A;  4MTF A;  1I5N A;  3V5X A;  2NSG A;  1ST6 A;  1JPN A;  2C04 A;  4J32 B;  1AEP A;  3BEH A;  3NG1 A;  1JRA A;  4G7Z F;  3PMR A;  4YK5 A;  5E3C A;  1S05 A;  1XWJ A;  1VLS A;  1Q0F A;  4Q7C A;  4U5G A;  1U89 A;  2KNH A;  2QUP A;  3EG9 A;  1FR0 A;  2PFD A;  2YL1 A;  3I5P A;  4J7T A;  3AG2 C;  3FXH A;  4LDQ A;  2QNL A;  3NKE A;  1TWG A;  3U3B A;  4BJ5 C;  3ZSU A;  5L0I A;  2JPU A;  3DKA A;  3DD7 A;  5L0D A;  2WVQ A;  3KH2 A;  3EZI A;  3LUT B;  1T6Q A;  3IPM O;  4BJ6 A;  5B3S C;  5A6J A;  2R7T A;  3HJC A;  2Y3B A;  1E2X A;  1A7D A;  3MLG A;  3O55 A;  3FHD A;  4X0R A;  5L3V A;  1YZA A;  5DVW A;  3DZA A;  3RQE A;  4YN0 B;  2L7A A;  5DS4 A;  1MMD A;  4IWB A;  1WAT A;  3G4Z A;  2GAQ A;  1U6H A;  3NDB B;  5BQG A;  3U9M A;  2FGY A;  4MVQ A;  1T9K A;  2FAP B;  2W45 A;  2YWA A;  3JTL O;  4G0H A;  3X2Q C;  3L34 A;  1O87 A;  1WN0 A;  3FMS A;  2LK4 A;  2H7O A;  1O5H A;  1RKC A;  3LEV A;  3GEE A;  2EIJ C;  3LES A;  3L8I A;  1ORY A;  4CX9 A;  2LIG A;  4JJF A;  4E0I A;  1OKK A;  1YAU O;  3ZDL A;  4F4B A;  4BEM J;  4IAO A;  2AVK A;  2J7P D;  2IXN A;  4M63 A;  2JX0 A;  4QI0 A;  2R02 A;  5T3T A;  3UMH A;  4CS7 A;  2AP3 A;  2AWC A;  4A2N B;  1V55 C;  3QW0 A;  2KYH A;  1C17 M;  4CIP A;  1CGM E;  2XXA B;  4JVS A;  4YT2 A;  3EG9 B;  1ZHZ A;  4GEH A;  3S29 A;  5IY5 C;  4IB4 A;  2AWY A;  3U8P A;  3R2P A;  5CI9 A;  1NU7 D;  2PX0 A;  3UGP A;  1MMA A;  3C62 A;  5DS6 A;  1JOG A;  3N2Z B;  1HW1 A;  2H7V C;  2LCH A;  2VB6 A;  1FAP B;  5L0F A;  3AOU A;  3QMK A;  4CJO A;  4ER9 A;  3UR3 C;  2OJE D;  4G78 A;  2QLA A;  5F5H A;  1IZM A;  1PCX A;  3W8I A;  3M79 A;  1NFO A;  1WWP A;  3US6 A;  1GGQ A;  1UFB A;  3R7C A;  5KYU A;  1GM5 A;  1HMO A;  2R03 A;  1E85 A;  3EJN A;  2P7V A;  4YL0 A;  5CIV A;  3RVY A;  1BR4 A;  2PNO A;  3HKK A;  2EPK X;  4R32 A;  3K1I C;  1TQG A;  3DWW A;  3CAX A;  4W8P A;  1V54 C;  4AK9 A;  2Y69 C;  3EZH A;  2J45 A;  4Z9J A;  3EGX B;  3MX3 A;  2LFD A;  1CGN A;  4DRI B;  4UDV A;  2OEV A;  4I1O B;  4LLE A;  2Q4F A;  2J9V A;  4ULW A;  3F47 A;  2KGO A;  3TJ6 A;  3UMI A;  3VYW A;  5L0G A;  5KYX A;  4FAP B;  3GM3 A;  2XLV A;  1A7V A;  1D1C A;  4W8K A;  1VK5 A;  3VAY A;  4O79 A;  1H9G A;  3EHM A;  4N6C A;  4LLC A;  4EWC A;  2XS8 A;  3FAP B;  4J7Y A;  5A6B D;  5HV9 A;  2W4B A;  2TMV P;  4OIR F;  3EH1 A;  1M2O A;  4XTK A;  3JRT A;  3FVY A;  2HMQ A;  5GPG B;  5B1B C;  5T1D B;  5L0J A;  2HS5 A;  2L6F A;  2HZ8 A;  1BR2 A;  2MYS A;  4P9T A;  1T01 A;  1H9T A;  2LQG A;  3ZC4 A;  5DS5 A;  2EIN C;  4XQ1 A;  3KL4 A;  1D1B A;  3ZQY A;  3OWT A;  4HFK B;  4JTD B;  4YT4 A;  4XLP F;  1M57 C;  2OU6 A;  3TQO A;  3U9J A;  3UNG C;  4CS8 C;  5L0C A;  3DM5 A;  3C8G D;  3K6B A;  3VM6 A;  4CDV A;  4RDA A;  3RW0 A;  2DYS C;  3CEX A;  2WZL A;  2XM4 A;  1RJ9 B;  3AG3 C;  1VTM P;  2P6V A;  4WJ0 A;  1G8X A;  1OCR C;  2YHS A;  4PAC A;  2F22 A;  2XLO A;  4N6H A;  4PJN A;  4KNV A;  2WZF A;  4DBR A;  3Q7G A;  4GYT A;  1J8M F;  2E87 A;  4HEA J;  2G3K A;  1R4T A;  2IXO A;  3ASN C;  1ZZP A;  2YLG A;  3QW1 A;  4C3B A;  2XLW A;  1NZE A;  1FNT c;  3AQB A;  3GAN A;  4FX5 A;  1IW7 F;  4I1M A;  3AGT A;  3L1M A;  2WZG A;  5A6K A;  2KC3 A;  4KNW A;  4NC3 A;  1CGO A;  3VF0 A;  2YZS A;  1EKY A;  1H6G A;  1LI7 A;  2J9W A;  4KBL A;  1YDI A;  2NPU A;  2L6H A;  4PK4 A;  4DBQ A;  4CSA C;  1DOV A;  1QQ3 A;  4HFF B;  1I4Y A;  1QVX A;  2CNW D;  4IAQ A;  4JE9 A;  2Q9A A;  3ABL C;  1CPR A;  2KW3 C;  4LER A;  3T4R A;  4EBJ A;  5B1A C;  3UMK A;  1SF8 A; 
#chains in the Genus database with same CATH homology
 1ST6 A;  2L7A A;  5L0H A;  1U6H A;  1QKR A;  3H2V A;  3TJ6 A;  3S90 A;  5L0G A;  1DOW A;  1SYQ A;  4PR9 A;  2B0H A;  1XWJ A;  4K1O A;  1ZW3 A;  2GWW A;  1ZVZ A;  2X0C A;  1U89 A;  2IBF A;  4IGG A;  5L0F A;  3H2U A;  1RKE B;  1TR2 A;  1RKC A;  5L0J A;  5L0I A;  4P9T A;  1L7C A;  1T01 A;  5L0D A;  2LQG A;  3ZDL A;  3TJ5 A;  3MYI A;  3VF0 A;  1H6G A;  4E18 A;  4ONS A;  3RF3 A;  1YDI A;  1RKE A;  1DOV A;  2GDC A;  5FZT A;  1ZW2 A;  4DJ9 A;  4EHP A;  3T6G B;  5L0C A;  4E17 A;  4W8P A;  2HSQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...