3S90A

Human vinculin head domain vh1 (residues 1-252) in complex with murine talin (vbs33; residues 1512-1546)
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
248
structure length
248
Chain Sequence
VFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVEKMSAEINEIIRVLQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Intermolecular versus intramolecular interactions of the vinculin binding site 33 of talin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Vinculin
total genus 109
structure length 248
sequence length 248
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-05-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 3s90A02
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 3s90A01
4DJ9A 1ZW3A 4P9TA 1DOVA 3TJ6A 1H6GA 1RKEA 3H2UA 1YDIA 1ST6A 4IGGA 5L0CA 1RKCA 2HSQA 2GDCA 5L0JA 2IBFA 4E17A 5L0DA 3VF0A 2B0HA 5L0HA 1SYQA 1ZVZA 4W8PA 3S90A 3T6GB 1QKRA 1T01A 3TJ5A 1U6HA 1RKEB 3MYIA 3ZDLA 3H2VA 5L0IA 2LQGA 2GWWA 4ONSA 1TR2A 1DOWA 4EHPA 1XWJA 5FZTA 5L0FA 4E18A 1U89A 4K1OA 2L7AA 4PR9A 2X0CA 1L7CA 1ZW2A 5L0GA 3RF3A
chains in the Genus database with same CATH superfamily
3B0PA 1TQGA 2P7VA 1M2VA 2A6EF 3U2LA 4DVYP 4O6YA 1HMOA 1H6GA 1RKEA 2KSFA 1NSGB 1NFOA 1YARO 5E3CA 2GDCA 1FMVA 4U9DA 1S05A 1OCOC 3EHNA 3T6JA 1ZHYA 1NBBA 4WJ0A 5EHHA 4EBJA 4JZAA 1MMGA 3DJUB 5F5FA 2YWAA 3GEHA 3LNRA 3T6GB 4R32A 5AC5A 2R7RA 4JTCB 2IM8A 4WABA 3ZSUA 1RKEB 2CGEA 2EILC 3MYIA 5COMA 1E86A 3ZWIA 4CS9C 5BUOA 1FFTC 1N1CA 3HNIA 1V74B 1WATA 3C18A 2R7SA 2J9UA 1Y4CA 4ZLCA 1GGQA 2X0CA 4P6IC 3SNHA 4WGZA 1KNYA 2OU6A 4WGYA 4PJLA 5DS6A 1BR4A 2KYHA 1YLMA 5JT4A 2P1AA 4N6HA 4MVZA 1HMDA 1MQVA 4HE8D 5KYYA 4CDYA 1YDIA 1ST6A 2VB6A 4I1OB 2EINC 2YL3A 3ZTZA 4BJ6C 3ASOC 4RDAA 4XTKA 2BL2A 3DXJF 4OD4A 1GS9A 1CGNA 1I5NA 3VF0A 4CDVA 1VLSA 5JS5A 3PMRA 4MVMA 3LAYA 2J7PA 2QLAA 4BJTA 4IB4A 1K40A 1A7DA 2IXMA 3SEOA 2XLOA 3V5XA 2GFHA 4ULVA 3M1CB 1BR1A 2D4UA 4JTAB 4CBEA 2YL7A 1ZU4A 5A69A 2NUTA 4LDKA 3IPMO 2G3KA 2L81A 2HJ3A 2HZ8A 2YLIA 4CDAA 2HV6A 5BQGA 1RJ9A 2XRHA 2BC5A 1B68A 3QW0A 1E84A 4J30B 3TJ6A 1V55C 2H7BA 1HE9A 4YJWA 3CQZA 1VLTA 4JIOA 3NYJA 2YHSA 2HKVA 3AJMA 3JYYA 1LS4A 1UG7A 4W8PA 2A68F 3B9QA 3GM3A 2HV7A 3AOUA 2LQGA 2M64A 4OIPF 4BEMJ 3TOMA 3G4ZA 4G7OF 4C7OB 4XEVA 3TD7A 4RD9A 1VB5A 4XQ1A 3FVYA 2Y39A 1LIHA 3C8GA 4JCZA 3SP1A 3EZHA 5DS5A 4NTAA 1M2VB 3L1MA 2CYDA 3DKAA 1CGOA 3M15A 3S84A 5L0HA 3ABLC 4JTDB 4N06A 3MYFA 1YJGA 1NU7D 2NUPA 4NC3A 2Y3HA 3LS1A 1Z3IX 1AEPA 4JEBA 4MVOA 5EK0A 1YA9A 3H2VA 3NG1A 3PCVA 1TR2A 3DM9B 3JRMO 4OINF 1ORSC 1T6IA 5T3WA 4C3BA 1J8MF 1OCRC 1JPNA 3AG3C 4XEKA 4BJ5A 5A6JA 3EG9A 1K04A 1QVXA 2OCCC 2XS8A 2YKZA 4PJJA 1D0ZA 2YQYA 4M63A 4AK9A 5GPGB 3R2PA 4C7OA 1G4WR 4YT5A 2C03A 3FOPA 1MNEA 3QTHA 3C7JA 4IGGA 4EWCA 3C8ZA 2PX0A 4CX9A 1HE1A 3FOOA 5A6BA 1WTYA 4F4BA 3GORA 1LE2A 4HFKB 2PF4E 2QUPA 2MHRA 2H7VC 4JURI 4ULWA 3VRCA 1Q0KA 5BQIA 2NPUA 3UNGC 3U9MA 1MMDA 3PHF2 4CJGA 1SR2A 3IQ6A 2OEXA 1XZQA 3FAJA 3RW0A 1FMWA 3U8PA 1QQ3A 5AC4A 1RMVA 1YZCA 3TJ5A 2CCYA 3AGUA 3EHMA 3GANA 4QI2A 3AG1C 4PJMA 2I15A 3ATPA 2ZXRA 2A0BA 2I8BA 2EPOA 1JRAA 2MYSA 2L9JA 2LSEA 4U5BE 3W2VA 3JRTA 4LLCA 1RJ9B 3ABMC 2EIKC 2ETSA 2Q00A 4P9FA 3RQFA 1ORYA 2DYSC 2EPNA 1D0XA 2G62A 2J8WA 1I4ZA 3H65A 3WHNA 4CIPA 1WGWA 2W4BA 3RFYA 1FR0A 4AE4A 2KW3C 1ZU5A 2CNWA 1T5OA 2ZXOA 1LS1A 3V5YA 4IWBA 2L6GA 2OOCA 1M6TA 2J9VA 2XLWA 5D92A 1JOGA 3C8GB 3GM2A 3EZIA 2EPLX 2XLMA 5TJ5E 3CAXA 1JR8A 5DVWA 5CIVA 1JAFA 2UUHA 1XZPA 1TFKB 3OEOA 2ZXWC 2OG2A 4C3EA 2B0JA 2LD6A 3IHUA 4EIYA 5KYWB 1LI7A 1G4US 1WOLA 3HLZA 1O3UA 5FZTA 3QW1A 4BG0A 5KYYB 3NDBB 3U2MA 3M4BA 2CNWD 1MMAA 2KQ9A 2C04A 1A0BA 3S27A 3ZTMA 4FAPB 1UFBA 3K66A 3T6BA 1S7ZA 3A11A 1RXQA 1CPQA 3V5ZA 4JCHA 1KTMA 3EFOA 1SMYF 3G4XA 3U0CA 3NYLA 1PV3A 4K7BA 3F46A 3M79A 2XS1A 2VH3A 2JX0A 2H7OA 4YT8A 1FAPB 1HW1A 2R03A 3NMIA 1SF8A 2VC9A 1LI5A 3DM5A 4FX5A 2R7TA 4IAOA 3DAFA 3S28A 4ONSA 2KK1A 2D5RB 1QLEC 2E87A 3AQCA 4U5GA 3A9CA 3UMHA 5L0FA 3E70C 1YYXA 1L3PA 3O10A 4JE9A 3U5SA 4E18A 4YWQA 1EA8A 2Q9AA 2XLEA 2L6HA 3EFOB 2ASRA 3O6XA 1LM3B 2GAQA 3LEVA 3RF3A 1YAUO 1SZIA 2QNLA 4IARA 4XEFA 3DE9A 5KYUA 4JKVA 3KH2A 5DLJA 1Q0DA 1Q0FA 3LESA 3ZQVA 3PDMP 2R7VA 1OW6A 5DQTA 3RQEA 2J45A 2LFFA 3SXZA 4ANJA 3AG2C 4E0IA 1R4TA 3DI5A 4J32B 1J8YF 1TWGA 4O6NA 3C63A 2Q9BA 1NLXA 2P61A 4CIHA 4H54A 2XM4A 5L0DA 3Q7GA 2R7UA 1IW7F 1ZHXA 2AWCA 3X2QC 1ZVZA 3I5QA 4D4XA 1MNDA 2YEVA 3MLGA 3RVYA 1EKYA 2J46A 2NSFA 5FCLA 3FXHA 4YT4A 5JVEA 2HMZA 4GQHA 3RQGA 3IQ5A 1WASA 1YYJA 4AL1A 2PBEA 4CS7A 2Q3TA 4EHPA 3EGXA 3QMKA 1OW7A 4PR9A 3ZVRA 1JPJA 3L8IA 4KNVA 1Z7Qc 2JD3A 3SYNA 1LE4A 2M4EA 1K05A 2OKUA 3VAYA 1Z5ZA 1BBHA 3HNKA 4AE4B 3AG4C 2R02A 5CI9A 3MFNA 2WZLA 4PK4A 4ER9A 3GWLA 3H2UA 1OKKA 2H8AA 2HSQA 1ZYRF 3JZ0A 4LLEA 4DXWA 3AQBA 2OJQA 3B29A 2Y3DA 3GEIA 3RIPA 4A4AA 1TWCA 4EKWA 4I3MA 2DGJA 2L6FA 3UGOA 3UGPA 4X0RA 2Y3BA 3K7DA 1QKRA 2FFHA 3F47A 1YA7O 5JUAA 4CS8A 1C17M 3K33A 4N4WA 4CJOA 1A7VA 2A69F 3HJCA 3UR3C 1V54C 4DVZA 4MTFA 3W2WA 1H7IA 1LKXA 4KBLA 3BEHA 1T9KA 3K6BA 1E83A 1O87A 3O55A 4DOZA 1RCPA 5L0GA 2IYLD 3EGXB 4G7ZF 1ORJA 1U0BB 4OIRF 2OQMA 4Z9IA 2A1DD 3ZC4A 4OD5A 2R7WA 3NRHA 4DRJB 3VYWA 2P6VA 2QY9A 5JSLA 3TK0A 1VOMA 4AL0A 1Y6DA 1YZAA 1OXBA 3JSZA 4CSAC 3O39A 3KYJA 4QI0A 2Q7RA 2Q4FA 2W45A 4J7YA 4Z9JA 5F28E 3FDQA 4MS2A 3NKEA 4JEAA 2CW0F 3FHDA 4IJJA 3T4RA 2YL1A 2J9BA 3U3BA 4I44A 1OQCA 2DYRC 4MVQA 4EUKB 3DWWA 2A0UA 1U6HA 3J06A 3ZDLA 4HEAJ 4PFPA 4YL1A 2HMQA 4BPMA 5KYUB 2GA0A 1DOWA 3AGTA 1A41A 3S9OA 2DI3A 4IRUA 2J0WA 3CEXA 4DRHB 2PX3A 2XL8A 4NY3A 2HFIA 1ZW2A 1V4AA 2YRFA 5IY5C 3EQLF 3K1HA 2ICWG 2IXPA 3QZCA 1C02A 2XLVA 4P9TA 1DOVA 3KMIA 1JMWA 2J7PD 3IQCA 2RD9A 4NQFA 2WVNA 2YZSA 4PJNA 5E3AA 3U9JA 2A6HF 1ZHWA 4FESA 3V7OA 3K1IC 4XPWA 2DB4A 3IQTA 2FAPB 3GEEA 3W8IA 2J9WA 3S29A 3ZIBA 3SXKA 3CZ6A 3SZRA 2XXAA 4I1MA 4NTFA 4GEHA 5L3VA 2W9YA 1GM5A 5KYXB 4JJGA 3ITFA 3MBGA 5F5HA 4LERA 1OCZC 2O9XA 3X1OA 3JSEO 4K1OA 2P0NA 1OXKA 4MW3A 4BJ1A 4EBBA 4E7ZA 2EIMC 5L3QA 2QE9A 2PFDA 3ASNC 2QTVA 3HTKC 3LLIA 3L8JA 5B1AC 3WG7C 3JT1A 3JTLO 4DJ9A 5E33A 3LNMB 3N24A 1ZW3A 1WN0A 3DMDA 2WVOA 4L6RA 5L0CA 1FTSA 5DS4A 1PD0A 1RKCA 3Q6NA 4U5CE 3Q6MA 4A2NB 2Y3GA 1LVKA 1R5ID 2YVKA 2ZD9A 3LJBA 4BEJA 1ZHZA 256BA 2VCAA 1SYQA 2JPUA 2FGYA 2LCHA 4DRIB 3S90A 4LACB 1MMNA 3LUTB 4Z9HA 3ABKC 4XLNF 4KNWA 1HW2A 1OCCC 3DAGA 3I4UA 5A6AA 3ECSA 4U5HA 3RKOF 3T9OA 4MTGA 4YK5A 2UUIA 4BJ6A 4EBKA 4LDQA 2XM0A 4Q7CA 4ZLDA 1BDJB 2BE5F 1E2XA 5AGFA 4G78A 3U8VA 3POVA 1U89A 4O6MA 1M56C 1ZZPA 2EPMX 1I4YA 2LP4A 4DBQA 2YLGA 5L0IA 3EH1A 5CI8A 4NTBA 3U3FA 4Q4ZF 2XLHA 1LPEA 4K0DA 2MWQA 3EGDA 1T6QA 4OIOF 1A7EA 2XSEA 3KPHA 2AWYA 1TFOB 3W8HA 3RH3A 4N6CA 4B6IA 2R7XA 5L0JA 2R9RB 2IBFA 3EGDB 1O5HA 2Z15A 3GWNA 2LK4A 5COGA 4JJFA 3Q7LA 2XXAB 1VMAA 3EPVA 4CSAA 2NG1A 2VCBA 1OKKD 1VYKA 1FFHA 2YLDA 4MTOA 2V3CC 1GQAA 1H9GA 3I5PA 2V26A 4H4KC 2PNOA 3DD7A 3M4CA 3SXMA 3HNJA 1D1BA 1NG1A 1Q0GA 3MX3A 2G3VA 3R7CA 5DQZA 1XWJA 1G8XA 4GYTA 4MW8A 3ZG1A 1D1CA 3OWTA 3NMKA 4MVRA 2HUJA 3KL4A 2CDQA 4O7GA 1D1AA 2IOQA 4XPXA 4OIQF 2IXOA 4JRZA 3IEEA 2LIGA 2R05A 3W4YA 1OR3A 1M2OA 5JP7A 3US6A 2AVKA 3KYIA 2R7QA 3NMJA 4PACA 3S0XA 3JYHA 5B1BC 4Q5SF 1VYIA 2LFDA 2KC3A 3HNLA 4YL3A 4YT2A 3G50A 1PCXA 1NU9C 4YL0A 4U5FE 1EQ1A 1OR2A 5A6KA 4XWJA 1F1MA 3WAQA 5B3IA 2OJED 4D4NA 3FMSA 2TMVP 3K1IA 1T6UA 3EH2A 4U5DE 4CS9A 1D0YA 1G5ZA 1TWHA 5JRAA 1H9TA 2GWWA 3B0UX 3CSKA 3HKKA 1Z63A 2EIJC 5KYXA 1NZEA 2XL6A 1TKNA 2AU5A 4DBRA 1BZ4A 2X51A 5EGYA 1HY5A 3FAPB 1FNTc 1L7CA 1ZHTA 4G0HA 4LDRA 1PD1A 3DJNB 3N2ZB 4JW1A 3DE8A 2KGOA 4PFOA 4BJ5C 4C3DA 2Y69C 3LEOA 4CS8C 5JLIA 2WL8A 4MVUA 4XPYA 5T1DB 2EPKX 4MNDA 4MVSA 3ZQYA 3E9VA 4U5EE 5K0IA 1KU2A 4AX2A 2PP4A 3GM1A 4MQ9F 3TQOA 2NSGA 1Z6AA 1AUEA 3B71A 2Q9CA 4NCQA 5COFA 1WWPA 2HJMA 4E0HA 1TWAA 1NFNA 3LLKA 3LS0A 4RBNA 5HV9A 3B0VC 4O79A 1QSPA 3EJNA 2XLDA 3C62A 4W8KA 2HSBA 2R25A 3JCUQ 1CGME 1C03A 2RSEB 1BR2A 4G7HF 2WVQA 1EI7A 2ZPAA 4J7TA 1YVIA 5B3SC 2OEVA 3TULA 2NUTB 5BQHA 1APCA 3SXYA 4QDLA 5KYNA 5E2QA 3UMIA 3BRJA 2WZGA 2W4MA 3L0IA 3TOLA 5HSWA 4YN0B 4KI2A 3RVZA 2VCCA 1Z23A 2IXNA 3L34A 5A6BD 5D91A 5KYWA 3WODF 4HFFB 2ZXPA 3GODA 4JVSA 4E17A 4U9EA 2F22A 3C8GD 4KC9A 2B0HA 4IAQA 1Q0MA 1E85A 4E7SA 2YL0A 1M57C 3EG9B 2WB7A 3KKBA 2HS5A 4JC7A 1T01A 3QVZA 1VTMP 1VK5A 1CPRA 3QVYA 1QPUA 1W2WA 4UDVA 3OA1A 1AVOB 2KNHA 2VASA 3RYLA 1IZMA 2XL4A 1QZXA 3VM6A 2R7OA 2AP3A 3NKDA 3N0TA 2KJGA 2L7AA 2NUPB 4XLPF 1OW8A 4FWVA 2J0XA 5T3TA 3UMKA 3DZAA 3NYMA 2WZFA
chains in the Genus database with same CATH topology
4DJ9A 1ZW3A 4P9TA 1DOVA 3TJ6A 1H6GA 1RKEA 3H2UA 1YDIA 1ST6A 4IGGA 5L0CA 1RKCA 2HSQA 2GDCA 5L0JA 2IBFA 4E17A 5L0DA 3VF0A 2B0HA 5L0HA 1SYQA 1ZVZA 4W8PA 3S90A 3T6GB 1QKRA 1T01A 3TJ5A 1U6HA 1RKEB 3MYIA 3ZDLA 3H2VA 5L0IA 2LQGA 2GWWA 4ONSA 1TR2A 1DOWA 4EHPA 1XWJA 5FZTA 5L0FA 4E18A 1U89A 4K1OA 2L7AA 4PR9A 2X0CA 1L7CA 1ZW2A 5L0GA 3RF3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DJ9 A;  1ZW3 A;  4P9T A;  1DOV A;  3TJ6 A;  1H6G A;  1RKE A;  3H2U A;  1YDI A;  1ST6 A;  4IGG A;  5L0C A;  1RKC A;  2HSQ A;  2GDC A;  5L0J A;  2IBF A;  4E17 A;  5L0D A;  3VF0 A;  2B0H A;  5L0H A;  1SYQ A;  1ZVZ A;  4W8P A;  3S90 A;  3T6G B;  1QKR A;  1T01 A;  3TJ5 A;  1U6H A;  1RKE B;  3MYI A;  3ZDL A;  3H2V A;  5L0I A;  2LQG A;  2GWW A;  4ONS A;  1TR2 A;  1DOW A;  4EHP A;  1XWJ A;  5FZT A;  5L0F A;  4E18 A;  1U89 A;  4K1O A;  2L7A A;  4PR9 A;  2X0C A;  1L7C A;  1ZW2 A;  5L0G A;  3RF3 A; 
#chains in the Genus database with same CATH topology
 3B0P A;  1TQG A;  2P7V A;  1M2V A;  2A6E F;  3U2L A;  4DVY P;  4O6Y A;  1HMO A;  1H6G A;  1RKE A;  2KSF A;  1NSG B;  1NFO A;  1YAR O;  5E3C A;  2GDC A;  1FMV A;  4U9D A;  1S05 A;  1OCO C;  3EHN A;  3T6J A;  1ZHY A;  1NBB A;  4WJ0 A;  5EHH A;  4EBJ A;  4JZA A;  1MMG A;  3DJU B;  5F5F A;  2YWA A;  3GEH A;  3LNR A;  3T6G B;  4R32 A;  5AC5 A;  2R7R A;  4JTC B;  2IM8 A;  4WAB A;  3ZSU A;  1RKE B;  2CGE A;  2EIL C;  3MYI A;  5COM A;  1E86 A;  3ZWI A;  4CS9 C;  5BUO A;  1FFT C;  1N1C A;  3HNI A;  1V74 B;  1WAT A;  3C18 A;  2R7S A;  2J9U A;  1Y4C A;  4ZLC A;  1GGQ A;  2X0C A;  4P6I C;  3SNH A;  4WGZ A;  1KNY A;  2OU6 A;  4WGY A;  4PJL A;  5DS6 A;  1BR4 A;  2KYH A;  1YLM A;  5JT4 A;  2P1A A;  4N6H A;  4MVZ A;  1HMD A;  1MQV A;  4HE8 D;  5KYY A;  4CDY A;  1YDI A;  1ST6 A;  2VB6 A;  4I1O B;  2EIN C;  2YL3 A;  3ZTZ A;  4BJ6 C;  3ASO C;  4RDA A;  4XTK A;  2BL2 A;  3DXJ F;  4OD4 A;  1GS9 A;  1CGN A;  1I5N A;  3VF0 A;  4CDV A;  1VLS A;  5JS5 A;  3PMR A;  4MVM A;  3LAY A;  2J7P A;  2QLA A;  4BJT A;  4IB4 A;  1K40 A;  1A7D A;  2IXM A;  3SEO A;  2XLO A;  3V5X A;  2GFH A;  4ULV A;  3M1C B;  1BR1 A;  2D4U A;  4JTA B;  4CBE A;  2YL7 A;  1ZU4 A;  5A69 A;  2NUT A;  4LDK A;  3IPM O;  2G3K A;  2L81 A;  2HJ3 A;  2HZ8 A;  2YLI A;  4CDA A;  2HV6 A;  5BQG A;  1RJ9 A;  2XRH A;  2BC5 A;  1B68 A;  3QW0 A;  1E84 A;  4J30 B;  3TJ6 A;  1V55 C;  2H7B A;  1HE9 A;  4YJW A;  3CQZ A;  1VLT A;  4JIO A;  3NYJ A;  2YHS A;  2HKV A;  3AJM A;  3JYY A;  1LS4 A;  1UG7 A;  4W8P A;  2A68 F;  3B9Q A;  3GM3 A;  2HV7 A;  3AOU A;  2LQG A;  2M64 A;  4OIP F;  4BEM J;  3TOM A;  3G4Z A;  4G7O F;  4C7O B;  4XEV A;  3TD7 A;  4RD9 A;  1VB5 A;  4XQ1 A;  3FVY A;  2Y39 A;  1LIH A;  3C8G A;  4JCZ A;  3SP1 A;  3EZH A;  5DS5 A;  4NTA A;  1M2V B;  3L1M A;  2CYD A;  3DKA A;  1CGO A;  3M15 A;  3S84 A;  5L0H A;  3ABL C;  4JTD B;  4N06 A;  3MYF A;  1YJG A;  1NU7 D;  2NUP A;  4NC3 A;  2Y3H A;  3LS1 A;  1Z3I X;  1AEP A;  4JEB A;  4MVO A;  5EK0 A;  1YA9 A;  3H2V A;  3NG1 A;  3PCV A;  1TR2 A;  3DM9 B;  3JRM O;  4OIN F;  1ORS C;  1T6I A;  5T3W A;  4C3B A;  1J8M F;  1OCR C;  1JPN A;  3AG3 C;  4XEK A;  4BJ5 A;  5A6J A;  3EG9 A;  1K04 A;  1QVX A;  2OCC C;  2XS8 A;  2YKZ A;  4PJJ A;  1D0Z A;  2YQY A;  4M63 A;  4AK9 A;  5GPG B;  3R2P A;  4C7O A;  1G4W R;  4YT5 A;  2C03 A;  3FOP A;  1MNE A;  3QTH A;  3C7J A;  4IGG A;  4EWC A;  3C8Z A;  2PX0 A;  4CX9 A;  1HE1 A;  3FOO A;  5A6B A;  1WTY A;  4F4B A;  3GOR A;  1LE2 A;  4HFK B;  2PF4 E;  2QUP A;  2MHR A;  2H7V C;  4JUR I;  4ULW A;  3VRC A;  1Q0K A;  5BQI A;  2NPU A;  3UNG C;  3U9M A;  1MMD A;  3PHF 2;  4CJG A;  1SR2 A;  3IQ6 A;  2OEX A;  1XZQ A;  3FAJ A;  3RW0 A;  1FMW A;  3U8P A;  1QQ3 A;  5AC4 A;  1RMV A;  1YZC A;  3TJ5 A;  2CCY A;  3AGU A;  3EHM A;  3GAN A;  4QI2 A;  3AG1 C;  4PJM A;  2I15 A;  3ATP A;  2ZXR A;  2A0B A;  2I8B A;  2EPO A;  1JRA A;  2MYS A;  2L9J A;  2LSE A;  4U5B E;  3W2V A;  3JRT A;  4LLC A;  1RJ9 B;  3ABM C;  2EIK C;  2ETS A;  2Q00 A;  4P9F A;  3RQF A;  1ORY A;  2DYS C;  2EPN A;  1D0X A;  2G62 A;  2J8W A;  1I4Z A;  3H65 A;  3WHN A;  4CIP A;  1WGW A;  2W4B A;  3RFY A;  1FR0 A;  4AE4 A;  2KW3 C;  1ZU5 A;  2CNW A;  1T5O A;  2ZXO A;  1LS1 A;  3V5Y A;  4IWB A;  2L6G A;  2OOC A;  1M6T A;  2J9V A;  2XLW A;  5D92 A;  1JOG A;  3C8G B;  3GM2 A;  3EZI A;  2EPL X;  2XLM A;  5TJ5 E;  3CAX A;  1JR8 A;  5DVW A;  5CIV A;  1JAF A;  2UUH A;  1XZP A;  1TFK B;  3OEO A;  2ZXW C;  2OG2 A;  4C3E A;  2B0J A;  2LD6 A;  3IHU A;  4EIY A;  5KYW B;  1LI7 A;  1G4U S;  1WOL A;  3HLZ A;  1O3U A;  5FZT A;  3QW1 A;  4BG0 A;  5KYY B;  3NDB B;  3U2M A;  3M4B A;  2CNW D;  1MMA A;  2KQ9 A;  2C04 A;  1A0B A;  3S27 A;  3ZTM A;  4FAP B;  1UFB A;  3K66 A;  3T6B A;  1S7Z A;  3A11 A;  1RXQ A;  1CPQ A;  3V5Z A;  4JCH A;  1KTM A;  3EFO A;  1SMY F;  3G4X A;  3U0C A;  3NYL A;  1PV3 A;  4K7B A;  3F46 A;  3M79 A;  2XS1 A;  2VH3 A;  2JX0 A;  2H7O A;  4YT8 A;  1FAP B;  1HW1 A;  2R03 A;  3NMI A;  1SF8 A;  2VC9 A;  1LI5 A;  3DM5 A;  4FX5 A;  2R7T A;  4IAO A;  3DAF A;  3S28 A;  4ONS A;  2KK1 A;  2D5R B;  1QLE C;  2E87 A;  3AQC A;  4U5G A;  3A9C A;  3UMH A;  5L0F A;  3E70 C;  1YYX A;  1L3P A;  3O10 A;  4JE9 A;  3U5S A;  4E18 A;  4YWQ A;  1EA8 A;  2Q9A A;  2XLE A;  2L6H A;  3EFO B;  2ASR A;  3O6X A;  1LM3 B;  2GAQ A;  3LEV A;  3RF3 A;  1YAU O;  1SZI A;  2QNL A;  4IAR A;  4XEF A;  3DE9 A;  5KYU A;  4JKV A;  3KH2 A;  5DLJ A;  1Q0D A;  1Q0F A;  3LES A;  3ZQV A;  3PDM P;  2R7V A;  1OW6 A;  5DQT A;  3RQE A;  2J45 A;  2LFF A;  3SXZ A;  4ANJ A;  3AG2 C;  4E0I A;  1R4T A;  3DI5 A;  4J32 B;  1J8Y F;  1TWG A;  4O6N A;  3C63 A;  2Q9B A;  1NLX A;  2P61 A;  4CIH A;  4H54 A;  2XM4 A;  5L0D A;  3Q7G A;  2R7U A;  1IW7 F;  1ZHX A;  2AWC A;  3X2Q C;  1ZVZ A;  3I5Q A;  4D4X A;  1MND A;  2YEV A;  3MLG A;  3RVY A;  1EKY A;  2J46 A;  2NSF A;  5FCL A;  3FXH A;  4YT4 A;  5JVE A;  2HMZ A;  4GQH A;  3RQG A;  3IQ5 A;  1WAS A;  1YYJ A;  4AL1 A;  2PBE A;  4CS7 A;  2Q3T A;  4EHP A;  3EGX A;  3QMK A;  1OW7 A;  4PR9 A;  3ZVR A;  1JPJ A;  3L8I A;  4KNV A;  1Z7Q c;  2JD3 A;  3SYN A;  1LE4 A;  2M4E A;  1K05 A;  2OKU A;  3VAY A;  1Z5Z A;  1BBH A;  3HNK A;  4AE4 B;  3AG4 C;  2R02 A;  5CI9 A;  3MFN A;  2WZL A;  4PK4 A;  4ER9 A;  3GWL A;  3H2U A;  1OKK A;  2H8A A;  2HSQ A;  1ZYR F;  3JZ0 A;  4LLE A;  4DXW A;  3AQB A;  2OJQ A;  3B29 A;  2Y3D A;  3GEI A;  3RIP A;  4A4A A;  1TWC A;  4EKW A;  4I3M A;  2DGJ A;  2L6F A;  3UGO A;  3UGP A;  4X0R A;  2Y3B A;  3K7D A;  1QKR A;  2FFH A;  3F47 A;  1YA7 O;  5JUA A;  4CS8 A;  1C17 M;  3K33 A;  4N4W A;  4CJO A;  1A7V A;  2A69 F;  3HJC A;  3UR3 C;  1V54 C;  4DVZ A;  4MTF A;  3W2W A;  1H7I A;  1LKX A;  4KBL A;  3BEH A;  1T9K A;  3K6B A;  1E83 A;  1O87 A;  3O55 A;  4DOZ A;  1RCP A;  5L0G A;  2IYL D;  3EGX B;  4G7Z F;  1ORJ A;  1U0B B;  4OIR F;  2OQM A;  4Z9I A;  2A1D D;  3ZC4 A;  4OD5 A;  2R7W A;  3NRH A;  4DRJ B;  3VYW A;  2P6V A;  2QY9 A;  5JSL A;  3TK0 A;  1VOM A;  4AL0 A;  1Y6D A;  1YZA A;  1OXB A;  3JSZ A;  4CSA C;  3O39 A;  3KYJ A;  4QI0 A;  2Q7R A;  2Q4F A;  2W45 A;  4J7Y A;  4Z9J A;  5F28 E;  3FDQ A;  4MS2 A;  3NKE A;  4JEA A;  2CW0 F;  3FHD A;  4IJJ A;  3T4R A;  2YL1 A;  2J9B A;  3U3B A;  4I44 A;  1OQC A;  2DYR C;  4MVQ A;  4EUK B;  3DWW A;  2A0U A;  1U6H A;  3J06 A;  3ZDL A;  4HEA J;  4PFP A;  4YL1 A;  2HMQ A;  4BPM A;  5KYU B;  2GA0 A;  1DOW A;  3AGT A;  1A41 A;  3S9O A;  2DI3 A;  4IRU A;  2J0W A;  3CEX A;  4DRH B;  2PX3 A;  2XL8 A;  4NY3 A;  2HFI A;  1ZW2 A;  1V4A A;  2YRF A;  5IY5 C;  3EQL F;  3K1H A;  2ICW G;  2IXP A;  3QZC A;  1C02 A;  2XLV A;  4P9T A;  1DOV A;  3KMI A;  1JMW A;  2J7P D;  3IQC A;  2RD9 A;  4NQF A;  2WVN A;  2YZS A;  4PJN A;  5E3A A;  3U9J A;  2A6H F;  1ZHW A;  4FES A;  3V7O A;  3K1I C;  4XPW A;  2DB4 A;  3IQT A;  2FAP B;  3GEE A;  3W8I A;  2J9W A;  3S29 A;  3ZIB A;  3SXK A;  3CZ6 A;  3SZR A;  2XXA A;  4I1M A;  4NTF A;  4GEH A;  5L3V A;  2W9Y A;  1GM5 A;  5KYX B;  4JJG A;  3ITF A;  3MBG A;  5F5H A;  4LER A;  1OCZ C;  2O9X A;  3X1O A;  3JSE O;  4K1O A;  2P0N A;  1OXK A;  4MW3 A;  4BJ1 A;  4EBB A;  4E7Z A;  2EIM C;  5L3Q A;  2QE9 A;  2PFD A;  3ASN C;  2QTV A;  3HTK C;  3LLI A;  3L8J A;  5B1A C;  3WG7 C;  3JT1 A;  3JTL O;  4DJ9 A;  5E33 A;  3LNM B;  3N24 A;  1ZW3 A;  1WN0 A;  3DMD A;  2WVO A;  4L6R A;  5L0C A;  1FTS A;  5DS4 A;  1PD0 A;  1RKC A;  3Q6N A;  4U5C E;  3Q6M A;  4A2N B;  2Y3G A;  1LVK A;  1R5I D;  2YVK A;  2ZD9 A;  3LJB A;  4BEJ A;  1ZHZ A;  256B A;  2VCA A;  1SYQ A;  2JPU A;  2FGY A;  2LCH A;  4DRI B;  3S90 A;  4LAC B;  1MMN A;  3LUT B;  4Z9H A;  3ABK C;  4XLN F;  4KNW A;  1HW2 A;  1OCC C;  3DAG A;  3I4U A;  5A6A A;  3ECS A;  4U5H A;  3RKO F;  3T9O A;  4MTG A;  4YK5 A;  2UUI A;  4BJ6 A;  4EBK A;  4LDQ A;  2XM0 A;  4Q7C A;  4ZLD A;  1BDJ B;  2BE5 F;  1E2X A;  5AGF A;  4G78 A;  3U8V A;  3POV A;  1U89 A;  4O6M A;  1M56 C;  1ZZP A;  2EPM X;  1I4Y A;  2LP4 A;  4DBQ A;  2YLG A;  5L0I A;  3EH1 A;  5CI8 A;  4NTB A;  3U3F A;  4Q4Z F;  2XLH A;  1LPE A;  4K0D A;  2MWQ A;  3EGD A;  1T6Q A;  4OIO F;  1A7E A;  2XSE A;  3KPH A;  2AWY A;  1TFO B;  3W8H A;  3RH3 A;  4N6C A;  4B6I A;  2R7X A;  5L0J A;  2R9R B;  2IBF A;  3EGD B;  1O5H A;  2Z15 A;  3GWN A;  2LK4 A;  5COG A;  4JJF A;  3Q7L A;  2XXA B;  1VMA A;  3EPV A;  4CSA A;  2NG1 A;  2VCB A;  1OKK D;  1VYK A;  1FFH A;  2YLD A;  4MTO A;  2V3C C;  1GQA A;  1H9G A;  3I5P A;  2V26 A;  4H4K C;  2PNO A;  3DD7 A;  3M4C A;  3SXM A;  3HNJ A;  1D1B A;  1NG1 A;  1Q0G A;  3MX3 A;  2G3V A;  3R7C A;  5DQZ A;  1XWJ A;  1G8X A;  4GYT A;  4MW8 A;  3ZG1 A;  1D1C A;  3OWT A;  3NMK A;  4MVR A;  2HUJ A;  3KL4 A;  2CDQ A;  4O7G A;  1D1A A;  2IOQ A;  4XPX A;  4OIQ F;  2IXO A;  4JRZ A;  3IEE A;  2LIG A;  2R05 A;  3W4Y A;  1OR3 A;  1M2O A;  5JP7 A;  3US6 A;  2AVK A;  3KYI A;  2R7Q A;  3NMJ A;  4PAC A;  3S0X A;  3JYH A;  5B1B C;  4Q5S F;  1VYI A;  2LFD A;  2KC3 A;  3HNL A;  4YL3 A;  4YT2 A;  3G50 A;  1PCX A;  1NU9 C;  4YL0 A;  4U5F E;  1EQ1 A;  1OR2 A;  5A6K A;  4XWJ A;  1F1M A;  3WAQ A;  5B3I A;  2OJE D;  4D4N A;  3FMS A;  2TMV P;  3K1I A;  1T6U A;  3EH2 A;  4U5D E;  4CS9 A;  1D0Y A;  1G5Z A;  1TWH A;  5JRA A;  1H9T A;  2GWW A;  3B0U X;  3CSK A;  3HKK A;  1Z63 A;  2EIJ C;  5KYX A;  1NZE A;  2XL6 A;  1TKN A;  2AU5 A;  4DBR A;  1BZ4 A;  2X51 A;  5EGY A;  1HY5 A;  3FAP B;  1FNT c;  1L7C A;  1ZHT A;  4G0H A;  4LDR A;  1PD1 A;  3DJN B;  3N2Z B;  4JW1 A;  3DE8 A;  2KGO A;  4PFO A;  4BJ5 C;  4C3D A;  2Y69 C;  3LEO A;  4CS8 C;  5JLI A;  2WL8 A;  4MVU A;  4XPY A;  5T1D B;  2EPK X;  4MND A;  4MVS A;  3ZQY A;  3E9V A;  4U5E E;  5K0I A;  1KU2 A;  4AX2 A;  2PP4 A;  3GM1 A;  4MQ9 F;  3TQO A;  2NSG A;  1Z6A A;  1AUE A;  3B71 A;  2Q9C A;  4NCQ A;  5COF A;  1WWP A;  2HJM A;  4E0H A;  1TWA A;  1NFN A;  3LLK A;  3LS0 A;  4RBN A;  5HV9 A;  3B0V C;  4O79 A;  1QSP A;  3EJN A;  2XLD A;  3C62 A;  4W8K A;  2HSB A;  2R25 A;  3JCU Q;  1CGM E;  1C03 A;  2RSE B;  1BR2 A;  4G7H F;  2WVQ A;  1EI7 A;  2ZPA A;  4J7T A;  1YVI A;  5B3S C;  2OEV A;  3TUL A;  2NUT B;  5BQH A;  1APC A;  3SXY A;  4QDL A;  5KYN A;  5E2Q A;  3UMI A;  3BRJ A;  2WZG A;  2W4M A;  3L0I A;  3TOL A;  5HSW A;  4YN0 B;  4KI2 A;  3RVZ A;  2VCC A;  1Z23 A;  2IXN A;  3L34 A;  5A6B D;  5D91 A;  5KYW A;  3WOD F;  4HFF B;  2ZXP A;  3GOD A;  4JVS A;  4E17 A;  4U9E A;  2F22 A;  3C8G D;  4KC9 A;  2B0H A;  4IAQ A;  1Q0M A;  1E85 A;  4E7S A;  2YL0 A;  1M57 C;  3EG9 B;  2WB7 A;  3KKB A;  2HS5 A;  4JC7 A;  1T01 A;  3QVZ A;  1VTM P;  1VK5 A;  1CPR A;  3QVY A;  1QPU A;  1W2W A;  4UDV A;  3OA1 A;  1AVO B;  2KNH A;  2VAS A;  3RYL A;  1IZM A;  2XL4 A;  1QZX A;  3VM6 A;  2R7O A;  2AP3 A;  3NKD A;  3N0T A;  2KJG A;  2L7A A;  2NUP B;  4XLP F;  1OW8 A;  4FWV A;  2J0X A;  5T3T A;  3UMK A;  3DZA A;  3NYM A;  2WZF A; 
#chains in the Genus database with same CATH homology
 4DJ9 A;  1ZW3 A;  4P9T A;  1DOV A;  3TJ6 A;  1H6G A;  1RKE A;  3H2U A;  1YDI A;  1ST6 A;  4IGG A;  5L0C A;  1RKC A;  2HSQ A;  2GDC A;  5L0J A;  2IBF A;  4E17 A;  5L0D A;  3VF0 A;  2B0H A;  5L0H A;  1SYQ A;  1ZVZ A;  4W8P A;  3S90 A;  3T6G B;  1QKR A;  1T01 A;  3TJ5 A;  1U6H A;  1RKE B;  3MYI A;  3ZDL A;  3H2V A;  5L0I A;  2LQG A;  2GWW A;  4ONS A;  1TR2 A;  1DOW A;  4EHP A;  1XWJ A;  5FZT A;  5L0F A;  4E18 A;  1U89 A;  4K1O A;  2L7A A;  4PR9 A;  2X0C A;  1L7C A;  1ZW2 A;  5L0G A;  3RF3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...