3S90A

Human vinculin head domain vh1 (residues 1-252) in complex with murine talin (vbs33; residues 1512-1546)
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
248
structure length
248
Chain Sequence
VFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVEKMSAEINEIIRVLQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vinculin
publication title Intermolecular versus intramolecular interactions of the vinculin binding site 33 of talin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 109
structure length 248
sequence length 248
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-05-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 3s90A02
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 3s90A01
3H2UA 3S90A 1U89A 1RKCA 3TJ6A 2LQGA 2X0CA 3ZDLA 4PR9A 1T01A 5L0IA 3RF3A 1U6HA 5L0GA 5L0DA 5L0HA 4P9TA 5FZTA 5L0CA 2GWWA 1DOVA 4E18A 1ZVZA 1XWJA 5L0FA 2L7AA 1ZW2A 3T6GB 3H2VA 3VF0A 1RKEA 4E17A 1QKRA 2HSQA 1H6GA 3MYIA 1ZW3A 2B0HA 2IBFA 1SYQA 4EHPA 4K1OA 4IGGA 1RKEB 1ST6A 4W8PA 2GDCA 4DJ9A 1DOWA 3TJ5A 5L0JA 4ONSA 1YDIA 1L7CA 1TR2A
chains in the Genus database with same CATH superfamily
1CPQA 2QLAA 3X2QC 3ZQYA 1CGME 4P9FA 2X51A 3DZAA 4IWBA 3K6BA 2A0BA 3RIPA 4JJFA 4WGZA 3SXKA 2LQGA 3ZWIA 5DS6A 1OW7A 4R32A 1QQ3A 4XWJA 1YARO 3IHUA 2AVKA 3C8ZA 3G4XA 4A2NB 1H7IA 1GM5A 1D0XA 1NFNA 2YWAA 2LSEA 4E0HA 1ZVZA 3MLGA 4DBQA 2CCYA 3HJCA 4DXWA 1M2VA 2QE9A 2ZXPA 5HV9A 5JUAA 2XM0A 3PCVA 4YT8A 4JKVA 1D0YA 1Z63A 2TMVP 3FHDA 4Q4ZF 2HV7A 2NPUA 3NMJA 3TD7A 2VASA 2YL1A 2B0HA 3C8GA 1SYQA 3L8JA 3ZTZA 4MTOA 5DS4A 4DJ9A 3LLIA 3U9MA 1HY5A 3F47A 2PP4A 1LS1A 3B0PA 2LFFA 2AWYA 2WVQA 5DVWA 1OKKD 1S7ZA 4OD4A 2WB7A 3RQEA 1QPUA 1ZHTA 4ULVA 4KBLA 4EWCA 5TJ5E 3PHF2 4CJGA 2ICWG 2R7VA 3CQZA 4MVUA 2HMZA 4NCQA 1L3PA 5KYNA 3LESA 3EJNA 1U0BB 4HE8D 1MNEA 3ECSA 3QVYA 4MVOA 3EH1A 1E85A 2FFHA 2XS8A 1LM3B 1Z3IX 3C18A 1FTSA 1ZHWA 2D5RB 4PFOA 2J8WA 1VOMA 2HSQA 2RSEB 2RD9A 4YWQA 2DGJA 3NDBB 4ZLDA 4CS8A 4BJ6C 2YL0A 4J7TA 1HW1A 2G62A 4U5DE 4RBNA 5KYUB 2XLDA 1ZYRF 2AP3A 1VLTA 1O3UA 3LNRA 3LNMB 3LS0A 4BEMJ 4OIPF 4FAPB 5E33A 4JIOA 2QY9A 3B29A 5CIVA 4YL0A 1SMYF 2GA0A 3KMIA 4OIOF 1M6TA 3EFOB 4BJTA 4OIQF 2M4EA 1WGWA 3GORA 2HSBA 1NU7D 3DJNB 1A7EA 4IRUA 2ASRA 4MTFA 4YK5A 3B0VC 1Q0DA 1PD1A 1S05A 2YRFA 3S84A 2YLGA 3S27A 3JCUQ 5DS5A 1MMNA 2Y3DA 3SXMA 3ZIBA 3NYLA 3K1IA 2XL4A 1LI7A 3VF0A 5KYXA 1QKRA 3DKAA 3M79A 5JLIA 5EGYA 3RVZA 1C17M 4MVQA 4CX9A 1A41A 1G4WR 2XLOA 1MMAA 3SNHA 3SZRA 4CJOA 3NRHA 3U8PA 5IY5C 3A11A 2LIGA 2EPKX 2MYSA 4JTCB 1T6UA 3N0TA 4OD5A 1ZZPA 4LLEA 3DE8A 4J32B 5E3AA 4QI0A 3HTKC 4CBEA 2Q3TA 2EIKC 4YT2A 1HW2A 5E3CA 1TFKB 1U89A 3ZVRA 4JZAA 1AEPA 3W8IA 3A9CA 4CS9A 5T3WA 4FESA 4LACB 3TULA 2LP4A 5DQTA 1NSGB 3JSZA 4U5FE 2J7PD 2FAPB 1O87A 1JPNA 1NG1A 2GWWA 2J9WA 3GWLA 1VLSA 3EG9A 3O55A 2OQMA 4MW8A 2L7AA 5F5HA 1UG7A 1ZW2A 1ZHZA 2L6GA 5COFA 1RJ9B 4E17A 2R7SA 3OEOA 3QMKA 2XLMA 4I3MA 3IQ6A 3LEOA 4Z9JA 2J0XA 4J7YA 1V4AA 3AG3C 4M63A 2M64A 2FGYA 3ABLC 2H7VC 1VTMP 2IXMA 1KU2A 4IAQA 4AE4B 3HLZA 1UFBA 1M56C 2HV6A 3POVA 3IQTA 3AG4C 2J0WA 2IXPA 4N06A 4O7GA 1ORJA 1WATA 4DBRA 2R7RA 2DYRC 1YA9A 2OEVA 2L81A 2ZXWC 2WVOA 3GM3A 1D0ZA 3LLKA 5JSLA 3RF3A 4N6HA 3V7OA 3T6JA 3SXYA 3VRCA 5B3SC 1T9KA 1DOVA 5CI8A 2P6VA 3EGDA 2OJQA 2NUTA 4CS8C 4JTAB 3IQCA 1HE1A 3AQCA 3ASOC 4NQFA 4JEAA 3E70C 3T9OA 4OIRF 2BC5A 2GFHA 2VCBA 3T6BA 2IBFA 1JPJA 4A4AA 1ST6A 1H9GA 1ZU4A 2HJMA 3GEIA 2A68F 4O79A 4PFPA 5L0JA 4BG0A 2IOQA 2MHRA 1YZCA 3ATPA 1YA7O 3GANA 3GEHA 2H8AA 3S28A 2PBEA 3BEHA 4Q5SF 2LCHA 1LI5A 4MQ9F 5T3TA 3MBGA 1T6IA 4XTKA 4LDKA 2XM4A 2X0CA 5JP7A 1A7VA 1A7DA 1G5ZA 1JAFA 3DAGA 1T5OA 3K1HA 2P1AA 3L8IA 4I1MA 2YVKA 4MTGA 4P9TA 1TKNA 1K40A 3ZSUA 2YEVA 5EK0A 4IB4A 2J45A 4NTAA 2KNHA 3WODF 2IXNA 3N24A 3DM5A 4IAOA 3SEOA 2KC3A 1EA8A 2EIMC 3NKDA 1TFOB 3R7CA 3DI5A 5A6BD 4RDAA 2Q7RA 1M2VB 1N1CA 4IGGA 4GEHA 4BEJA 1OW6A 2VCCA 4GYTA 4G7HF 3B0UX 2XXAA 1CPRA 3IPMO 4U5BE 3C8GB 3LS1A 3U9JA 3JRMO 3AGTA 4ER9A 4CS9C 1YZAA 3M15A 3JTLO 1QLEC 3TK0A 3DMDA 1QZXA 4G0HA 1RXQA 4ZLCA 3DAFA 4MS2A 3TOLA 3O39A 1U6HA 2IYLD 1R4TA 4GQHA 1C02A 1XZPA 5L0CA 2E87A 1XWJA 4P6IC 1OW8A 2Y3HA 2GAQA 5K0IA 3EPVA 4K7BA 1RKEA 2I15A 2XLEA 3CSKA 1IZMA 3K7DA 2R7UA 3R2PA 2EPLX 3I5PA 3QVZA 2KQ9A 2W45A 5KYYA 3EHNA 4C7OA 4OINF 4Z9IA 1GQAA 2ZPAA 1C03A 5COMA 2CNWA 4HEAJ 1WTYA 5F5FA 3AOUA 3UGPA 2KJGA 3WAQA 5L3VA 3RVYA 2PFDA 3C8GD 5FCLA 3V5XA 2KK1A 4U5EE 1Z6AA 3QW0A 5A6JA 3L34A 3GM1A 3U8VA 3DJUB 5L0GA 2YL3A 1PCXA 4XLNF 2V26A 3B9QA 1BDJB 4NY3A 4D4NA 4WGYA 5L0FA 3W4YA 1FR0A 4EKWA 1VMAA 5KYWA 1YYXA 3EQLF 2Z15A 2XLWA 4I1OB 4PK4A 1FMVA 3MFNA 3ZTMA 1E86A 2NSFA 3QTHA 1YYJA 3AG1C 2Q9AA 4WABA 5KYXB 3G4ZA 2Y69C 3NYMA 4E7ZA 1HMDA 1YDIA 2R7OA 4IJJA 4KI2A 2H7BA 1AUEA 1V55C 1MMDA 3U2MA 2ZD9A 1OR3A 4AL1A 4JEBA 4MVSA 3FMSA 1B68A 3U2LA 4MVZA 4EBBA 2ZXOA 3FAJA 1TWGA 2PNOA 1NFOA 1QSPA 2J9BA 4XLPF 1E84A 1OCRC 1ZHXA 2PX0A 4X0RA 1LE4A 3FXHA 3JSEO 1T6QA 4KC9A 4DVYP 4E18A 3UR3C 1YJGA 1GS9A 2DYSC 2KSFA 3HNJA 1BBHA 4F4BA 1SR2A 3I4UA 4UDVA 4EBKA 3W2WA 1M57C 3EG9B 4U5CE 5A6AA 2H7OA 3RH3A 2XLVA 1RMVA 2W9YA 4RD9A 1E83A 3WG7C 2A69F 1HE9A 1OCZC 4ULWA 1I4YA 1SF8A 3ABKC 1L7CA 2UUIA 2L9JA 4EBJA 1TWAA 3EH2A 4KNVA 1I5NA 3LJBA 2BL2A 2YLDA 2EIJC 3Q7GA 3UNGC 1MQVA 1YVIA 4MVMA 1O5HA 1OCOC 3EGXA 4XEVA 4JURI 4DVZA 1WASA 4MVRA 3FDQA 4PJNA 1EI7A 2NUPA 3FVYA 4O6MA 2BE5F 5D92A 3VYWA 3PDMP 1FFTC 1NZEA 4WJ0A 5HSWA 3UMKA 3S29A 2YL7A 3C7JA 3MYIA 3UMIA 3EGDB 3M1CB 5DQZA 3DD7A 2NUTB 4G78A 4HFFB 4JTDB 256BA 4EHPA 3NG1A 1J8YF 1SZIA 3Q6MA 3Q6NA 4O6YA 4Z9HA 4E7SA 2KGOA 4JRZA 1TR2A 3W2VA 3PMRA 1Q0KA 1Z7Qc 4MW3A 3US6A 4CSAA 4C3BA 5D91A 4BJ5A 3LUTB 4L6RA 2CGEA 2LK4A 2MWQA 2AU5A 2LD6A 2R25A 2QUPA 1KTMA 2QTVA 3S0XA 2UUHA 3K1IC 4C3EA 5FZTA 2R7XA 3AG2C 5EHHA 2F22A 3O10A 1PV3A 2ETSA 2R03A 3BRJA 1ZU5A 2C03A 3ZG1A 1Z5ZA 1H6GA 1V54C 3ABMC 1ZW3A 1OKKA 1LKXA 1WOLA 1OQCA 2DI3A 2EPMX 2YHSA 1Q0MA 1BR1A 2EILC 3W8HA 2NSGA 2PX3A 4CIHA 3FOOA 4G7ZF 3GM2A 3QW1A 2A1DD 1GGQA 2I8BA 4JVSA 5GPGB 4K0DA 2R7QA 1G8XA 2CW0F 2R9RB 1F1MA 3UMHA 3V5ZA 3UGOA 1H9TA 2XXAB 2PF4E 3C63A 2IM8A 4U5HA 4DRIB 4PR9A 4U9DA 1VYKA 3JZ0A 1TWCA 3IQ5A 2YZSA 4XPWA 5L0HA 2WZLA 4MNDA 1ORYA 2B0JA 2KYHA 4YT5A 1NU9C 1XZQA 1VB5A 3T4RA 3ITFA 2C04A 4QI2A 4IARA 3TOMA 3MYFA 2IXOA 4HFKB 2R7WA 3L0IA 4K1OA 1RKEB 4W8PA 2A6HF 3KYJA 5JS5A 1LPEA 3NMKA 5BQIA 3AJMA 3JRTA 5F28E 3JT1A 1D1CA 2Y39A 3OWTA 4JC7A 4JW1A 1LIHA 1K05A 4KNWA 4N4WA 4O6NA 5L0DA 5KYYB 4C7OB 1LVKA 2D4UA 3FOPA 3S90A 4JCZA 4DRHB 3CZ6A 4AX2A 2XSEA 2WZFA 2HS5A 2XL6A 5L0IA 2G3VA 2L6HA 3V5YA 4CIPA 4EUKB 1QVXA 2V3CC 2XS1A 4G7OF 1Y4CA 3GWNA 2OEXA 5BUOA 2LFDA 5BQHA 2R05A 3GEEA 2OJED 3QZCA 4PACA 4YL3A 2JD3A 1FFHA 3JYHA 3N2ZB 5KYUA 3T6GB 3U5SA 4ANJA 2Q9CA 4JJGA 5DLJA 3EZIA 1HMOA 2HZ8A 2J9VA 3NMIA 4CDVA 3U0CA 3J06A 1K04A 1M2OA 3RKOF 1JR8A 3RYLA 3Q7LA 4AL0A 2WL8A 1V74B 2J9UA 5KYWB 2GDCA 4XPXA 4I44A 1Q0FA 3CAXA 3EZHA 4YJWA 3LEVA 4QDLA 3TJ5A 1BZ4A 3EFOA 1J8MF 1VYIA 4Q7CA 3VM6A 5JVEA 2A6EF 5JT4A 2OU6A 4CSAC 3LAYA 2Q9BA 2J7PA 2P61A 1CGOA 2QNLA 4YT4A 3AGUA 1FNTc 4C3DA 4FWVA 5T1DB 3KH2A 1JRAA 2R02A 1JOGA 2DB4A 3KPHA 4H4KC 2CNWD 1FMWA 1R5ID 3I5QA 3KL4A 1BR4A 4NTFA 3NYJA 1ORSC 3L1MA 4J30B 1TQGA 4BJ1A 2G3KA 4N6CA 1Q0GA 3GODA 5COGA 5A69A 1IW7F 1JMWA 4XQ1A 3O6XA 4CDAA 3HNKA 2HKVA 3HKKA 1D1AA 3K66A 2OOCA 1PD0A 4DOZA 3NKEA 2Y3BA 1Z23A 1KNYA 1TWHA 2A0UA 2JX0A 2VC9A 3FAPB 3M4CA 5B1AC 4EIYA 1RCPA 5A6KA 1DOWA 5B1BC 5BQGA 1D1BA 2L6FA 3HNLA 3G50A 4ONSA 2HMQA 1MMGA 2OG2A 4BPMA 3JYYA 3RQFA 3F46A 2VCAA 3DM9B 3MX3A 1ZHYA 1VK5A 2CDQA 4LLCA 4XPYA 4AK9A 4E0IA 3B71A 2HFIA 2WVNA 2ZXRA 1RKCA 2NG1A 3TQOA 1W2WA 1Y6DA 3DXJF 3RQGA 3TJ6A 4LDQA 1G4US 3ASNC 4LDRA 1WWPA 3ZC4A 3ZDLA 1LS4A 1OR2A 2Q4FA 4NTBA 3AQBA 1RJ9A 3SXZA 4JCHA 1E2XA 3SP1A 2J46A 2WZGA 2W4MA 2Q00A 3EGXB 4U5GA 5L3QA 5AC5A 3H2VA 2EINC 2XLHA 3WHNA 1AVOB 2NUPB 1EKYA 2HUJA 1WN0A 4AE4A 4LERA 2EPNA 3RW0A 1NLXA 3HNIA 3E9VA 1A0BA 3U3BA 1NBBA 2VB6A 4NC3A 1LE2A 1OXBA 3SYNA 4BJ6A 2R7TA 1CGNA 3KKBA 2YQYA 4D4XA 2VH3A 3DWWA 1APCA 1YAUO 4YN0B 3H2UA 4PJJA 1OXKA 2YKZA 4U9EA 4XEFA 5B3IA 2XL8A 3ZQVA 1OCCC 3H65A 2JPUA 3K33A 2YLIA 1T01A 2Y3GA 2EPOA 1MNDA 3S9OA 5A6BA 2OKUA 3U3FA 2XRHA 2HJ3A 3X1OA 5E2QA 2CYDA 4H54A 2P0NA 2P7VA 3VAYA 3RFYA 4PJLA 4FX5A 4PJMA 3CEXA 4B6IA 4JE9A 4DRJB 3EHMA 2O9XA 4BJ5C 2KW3C 5CI9A 3DE9A 4CS7A 4W8KA 5JRAA 2OCCC 2W4BA 1I4ZA 4CDYA 3IEEA 3C62A 4YL1A 4XEKA 2AWCA 3M4BA 5AGFA 1BR2A 1YLMA 5AC4A 3KYIA 3OA1A 1EQ1A 1FAPB
chains in the Genus database with same CATH topology
3H2UA 3S90A 1U89A 1RKCA 3TJ6A 2LQGA 2X0CA 3ZDLA 4PR9A 1T01A 5L0IA 3RF3A 1U6HA 5L0GA 5L0DA 5L0HA 4P9TA 5FZTA 5L0CA 2GWWA 1DOVA 4E18A 1ZVZA 1XWJA 5L0FA 2L7AA 1ZW2A 3T6GB 3H2VA 3VF0A 1RKEA 4E17A 1QKRA 2HSQA 1H6GA 3MYIA 1ZW3A 2B0HA 2IBFA 1SYQA 4EHPA 4K1OA 4IGGA 1RKEB 1ST6A 4W8PA 2GDCA 4DJ9A 1DOWA 3TJ5A 5L0JA 4ONSA 1YDIA 1L7CA 1TR2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H2U A;  3S90 A;  1U89 A;  1RKC A;  3TJ6 A;  2LQG A;  2X0C A;  3ZDL A;  4PR9 A;  1T01 A;  5L0I A;  3RF3 A;  1U6H A;  5L0G A;  5L0D A;  5L0H A;  4P9T A;  5FZT A;  5L0C A;  2GWW A;  1DOV A;  4E18 A;  1ZVZ A;  1XWJ A;  5L0F A;  2L7A A;  1ZW2 A;  3T6G B;  3H2V A;  3VF0 A;  1RKE A;  4E17 A;  1QKR A;  2HSQ A;  1H6G A;  3MYI A;  1ZW3 A;  2B0H A;  2IBF A;  1SYQ A;  4EHP A;  4K1O A;  4IGG A;  1RKE B;  1ST6 A;  4W8P A;  2GDC A;  4DJ9 A;  1DOW A;  3TJ5 A;  5L0J A;  4ONS A;  1YDI A;  1L7C A;  1TR2 A; 
#chains in the Genus database with same CATH topology
 1CPQ A;  2QLA A;  3X2Q C;  3ZQY A;  1CGM E;  4P9F A;  2X51 A;  3DZA A;  4IWB A;  3K6B A;  2A0B A;  3RIP A;  4JJF A;  4WGZ A;  3SXK A;  2LQG A;  3ZWI A;  5DS6 A;  1OW7 A;  4R32 A;  1QQ3 A;  4XWJ A;  1YAR O;  3IHU A;  2AVK A;  3C8Z A;  3G4X A;  4A2N B;  1H7I A;  1GM5 A;  1D0X A;  1NFN A;  2YWA A;  2LSE A;  4E0H A;  1ZVZ A;  3MLG A;  4DBQ A;  2CCY A;  3HJC A;  4DXW A;  1M2V A;  2QE9 A;  2ZXP A;  5HV9 A;  5JUA A;  2XM0 A;  3PCV A;  4YT8 A;  4JKV A;  1D0Y A;  1Z63 A;  2TMV P;  3FHD A;  4Q4Z F;  2HV7 A;  2NPU A;  3NMJ A;  3TD7 A;  2VAS A;  2YL1 A;  2B0H A;  3C8G A;  1SYQ A;  3L8J A;  3ZTZ A;  4MTO A;  5DS4 A;  4DJ9 A;  3LLI A;  3U9M A;  1HY5 A;  3F47 A;  2PP4 A;  1LS1 A;  3B0P A;  2LFF A;  2AWY A;  2WVQ A;  5DVW A;  1OKK D;  1S7Z A;  4OD4 A;  2WB7 A;  3RQE A;  1QPU A;  1ZHT A;  4ULV A;  4KBL A;  4EWC A;  5TJ5 E;  3PHF 2;  4CJG A;  2ICW G;  2R7V A;  3CQZ A;  4MVU A;  2HMZ A;  4NCQ A;  1L3P A;  5KYN A;  3LES A;  3EJN A;  1U0B B;  4HE8 D;  1MNE A;  3ECS A;  3QVY A;  4MVO A;  3EH1 A;  1E85 A;  2FFH A;  2XS8 A;  1LM3 B;  1Z3I X;  3C18 A;  1FTS A;  1ZHW A;  2D5R B;  4PFO A;  2J8W A;  1VOM A;  2HSQ A;  2RSE B;  2RD9 A;  4YWQ A;  2DGJ A;  3NDB B;  4ZLD A;  4CS8 A;  4BJ6 C;  2YL0 A;  4J7T A;  1HW1 A;  2G62 A;  4U5D E;  4RBN A;  5KYU B;  2XLD A;  1ZYR F;  2AP3 A;  1VLT A;  1O3U A;  3LNR A;  3LNM B;  3LS0 A;  4BEM J;  4OIP F;  4FAP B;  5E33 A;  4JIO A;  2QY9 A;  3B29 A;  5CIV A;  4YL0 A;  1SMY F;  2GA0 A;  3KMI A;  4OIO F;  1M6T A;  3EFO B;  4BJT A;  4OIQ F;  2M4E A;  1WGW A;  3GOR A;  2HSB A;  1NU7 D;  3DJN B;  1A7E A;  4IRU A;  2ASR A;  4MTF A;  4YK5 A;  3B0V C;  1Q0D A;  1PD1 A;  1S05 A;  2YRF A;  3S84 A;  2YLG A;  3S27 A;  3JCU Q;  5DS5 A;  1MMN A;  2Y3D A;  3SXM A;  3ZIB A;  3NYL A;  3K1I A;  2XL4 A;  1LI7 A;  3VF0 A;  5KYX A;  1QKR A;  3DKA A;  3M79 A;  5JLI A;  5EGY A;  3RVZ A;  1C17 M;  4MVQ A;  4CX9 A;  1A41 A;  1G4W R;  2XLO A;  1MMA A;  3SNH A;  3SZR A;  4CJO A;  3NRH A;  3U8P A;  5IY5 C;  3A11 A;  2LIG A;  2EPK X;  2MYS A;  4JTC B;  1T6U A;  3N0T A;  4OD5 A;  1ZZP A;  4LLE A;  3DE8 A;  4J32 B;  5E3A A;  4QI0 A;  3HTK C;  4CBE A;  2Q3T A;  2EIK C;  4YT2 A;  1HW2 A;  5E3C A;  1TFK B;  1U89 A;  3ZVR A;  4JZA A;  1AEP A;  3W8I A;  3A9C A;  4CS9 A;  5T3W A;  4FES A;  4LAC B;  3TUL A;  2LP4 A;  5DQT A;  1NSG B;  3JSZ A;  4U5F E;  2J7P D;  2FAP B;  1O87 A;  1JPN A;  1NG1 A;  2GWW A;  2J9W A;  3GWL A;  1VLS A;  3EG9 A;  3O55 A;  2OQM A;  4MW8 A;  2L7A A;  5F5H A;  1UG7 A;  1ZW2 A;  1ZHZ A;  2L6G A;  5COF A;  1RJ9 B;  4E17 A;  2R7S A;  3OEO A;  3QMK A;  2XLM A;  4I3M A;  3IQ6 A;  3LEO A;  4Z9J A;  2J0X A;  4J7Y A;  1V4A A;  3AG3 C;  4M63 A;  2M64 A;  2FGY A;  3ABL C;  2H7V C;  1VTM P;  2IXM A;  1KU2 A;  4IAQ A;  4AE4 B;  3HLZ A;  1UFB A;  1M56 C;  2HV6 A;  3POV A;  3IQT A;  3AG4 C;  2J0W A;  2IXP A;  4N06 A;  4O7G A;  1ORJ A;  1WAT A;  4DBR A;  2R7R A;  2DYR C;  1YA9 A;  2OEV A;  2L81 A;  2ZXW C;  2WVO A;  3GM3 A;  1D0Z A;  3LLK A;  5JSL A;  3RF3 A;  4N6H A;  3V7O A;  3T6J A;  3SXY A;  3VRC A;  5B3S C;  1T9K A;  1DOV A;  5CI8 A;  2P6V A;  3EGD A;  2OJQ A;  2NUT A;  4CS8 C;  4JTA B;  3IQC A;  1HE1 A;  3AQC A;  3ASO C;  4NQF A;  4JEA A;  3E70 C;  3T9O A;  4OIR F;  2BC5 A;  2GFH A;  2VCB A;  3T6B A;  2IBF A;  1JPJ A;  4A4A A;  1ST6 A;  1H9G A;  1ZU4 A;  2HJM A;  3GEI A;  2A68 F;  4O79 A;  4PFP A;  5L0J A;  4BG0 A;  2IOQ A;  2MHR A;  1YZC A;  3ATP A;  1YA7 O;  3GAN A;  3GEH A;  2H8A A;  3S28 A;  2PBE A;  3BEH A;  4Q5S F;  2LCH A;  1LI5 A;  4MQ9 F;  5T3T A;  3MBG A;  1T6I A;  4XTK A;  4LDK A;  2XM4 A;  2X0C A;  5JP7 A;  1A7V A;  1A7D A;  1G5Z A;  1JAF A;  3DAG A;  1T5O A;  3K1H A;  2P1A A;  3L8I A;  4I1M A;  2YVK A;  4MTG A;  4P9T A;  1TKN A;  1K40 A;  3ZSU A;  2YEV A;  5EK0 A;  4IB4 A;  2J45 A;  4NTA A;  2KNH A;  3WOD F;  2IXN A;  3N24 A;  3DM5 A;  4IAO A;  3SEO A;  2KC3 A;  1EA8 A;  2EIM C;  3NKD A;  1TFO B;  3R7C A;  3DI5 A;  5A6B D;  4RDA A;  2Q7R A;  1M2V B;  1N1C A;  4IGG A;  4GEH A;  4BEJ A;  1OW6 A;  2VCC A;  4GYT A;  4G7H F;  3B0U X;  2XXA A;  1CPR A;  3IPM O;  4U5B E;  3C8G B;  3LS1 A;  3U9J A;  3JRM O;  3AGT A;  4ER9 A;  4CS9 C;  1YZA A;  3M15 A;  3JTL O;  1QLE C;  3TK0 A;  3DMD A;  1QZX A;  4G0H A;  1RXQ A;  4ZLC A;  3DAF A;  4MS2 A;  3TOL A;  3O39 A;  1U6H A;  2IYL D;  1R4T A;  4GQH A;  1C02 A;  1XZP A;  5L0C A;  2E87 A;  1XWJ A;  4P6I C;  1OW8 A;  2Y3H A;  2GAQ A;  5K0I A;  3EPV A;  4K7B A;  1RKE A;  2I15 A;  2XLE A;  3CSK A;  1IZM A;  3K7D A;  2R7U A;  3R2P A;  2EPL X;  3I5P A;  3QVZ A;  2KQ9 A;  2W45 A;  5KYY A;  3EHN A;  4C7O A;  4OIN F;  4Z9I A;  1GQA A;  2ZPA A;  1C03 A;  5COM A;  2CNW A;  4HEA J;  1WTY A;  5F5F A;  3AOU A;  3UGP A;  2KJG A;  3WAQ A;  5L3V A;  3RVY A;  2PFD A;  3C8G D;  5FCL A;  3V5X A;  2KK1 A;  4U5E E;  1Z6A A;  3QW0 A;  5A6J A;  3L34 A;  3GM1 A;  3U8V A;  3DJU B;  5L0G A;  2YL3 A;  1PCX A;  4XLN F;  2V26 A;  3B9Q A;  1BDJ B;  4NY3 A;  4D4N A;  4WGY A;  5L0F A;  3W4Y A;  1FR0 A;  4EKW A;  1VMA A;  5KYW A;  1YYX A;  3EQL F;  2Z15 A;  2XLW A;  4I1O B;  4PK4 A;  1FMV A;  3MFN A;  3ZTM A;  1E86 A;  2NSF A;  3QTH A;  1YYJ A;  3AG1 C;  2Q9A A;  4WAB A;  5KYX B;  3G4Z A;  2Y69 C;  3NYM A;  4E7Z A;  1HMD A;  1YDI A;  2R7O A;  4IJJ A;  4KI2 A;  2H7B A;  1AUE A;  1V55 C;  1MMD A;  3U2M A;  2ZD9 A;  1OR3 A;  4AL1 A;  4JEB A;  4MVS A;  3FMS A;  1B68 A;  3U2L A;  4MVZ A;  4EBB A;  2ZXO A;  3FAJ A;  1TWG A;  2PNO A;  1NFO A;  1QSP A;  2J9B A;  4XLP F;  1E84 A;  1OCR C;  1ZHX A;  2PX0 A;  4X0R A;  1LE4 A;  3FXH A;  3JSE O;  1T6Q A;  4KC9 A;  4DVY P;  4E18 A;  3UR3 C;  1YJG A;  1GS9 A;  2DYS C;  2KSF A;  3HNJ A;  1BBH A;  4F4B A;  1SR2 A;  3I4U A;  4UDV A;  4EBK A;  3W2W A;  1M57 C;  3EG9 B;  4U5C E;  5A6A A;  2H7O A;  3RH3 A;  2XLV A;  1RMV A;  2W9Y A;  4RD9 A;  1E83 A;  3WG7 C;  2A69 F;  1HE9 A;  1OCZ C;  4ULW A;  1I4Y A;  1SF8 A;  3ABK C;  1L7C A;  2UUI A;  2L9J A;  4EBJ A;  1TWA A;  3EH2 A;  4KNV A;  1I5N A;  3LJB A;  2BL2 A;  2YLD A;  2EIJ C;  3Q7G A;  3UNG C;  1MQV A;  1YVI A;  4MVM A;  1O5H A;  1OCO C;  3EGX A;  4XEV A;  4JUR I;  4DVZ A;  1WAS A;  4MVR A;  3FDQ A;  4PJN A;  1EI7 A;  2NUP A;  3FVY A;  4O6M A;  2BE5 F;  5D92 A;  3VYW A;  3PDM P;  1FFT C;  1NZE A;  4WJ0 A;  5HSW A;  3UMK A;  3S29 A;  2YL7 A;  3C7J A;  3MYI A;  3UMI A;  3EGD B;  3M1C B;  5DQZ A;  3DD7 A;  2NUT B;  4G78 A;  4HFF B;  4JTD B;  256B A;  4EHP A;  3NG1 A;  1J8Y F;  1SZI A;  3Q6M A;  3Q6N A;  4O6Y A;  4Z9H A;  4E7S A;  2KGO A;  4JRZ A;  1TR2 A;  3W2V A;  3PMR A;  1Q0K A;  1Z7Q c;  4MW3 A;  3US6 A;  4CSA A;  4C3B A;  5D91 A;  4BJ5 A;  3LUT B;  4L6R A;  2CGE A;  2LK4 A;  2MWQ A;  2AU5 A;  2LD6 A;  2R25 A;  2QUP A;  1KTM A;  2QTV A;  3S0X A;  2UUH A;  3K1I C;  4C3E A;  5FZT A;  2R7X A;  3AG2 C;  5EHH A;  2F22 A;  3O10 A;  1PV3 A;  2ETS A;  2R03 A;  3BRJ A;  1ZU5 A;  2C03 A;  3ZG1 A;  1Z5Z A;  1H6G A;  1V54 C;  3ABM C;  1ZW3 A;  1OKK A;  1LKX A;  1WOL A;  1OQC A;  2DI3 A;  2EPM X;  2YHS A;  1Q0M A;  1BR1 A;  2EIL C;  3W8H A;  2NSG A;  2PX3 A;  4CIH A;  3FOO A;  4G7Z F;  3GM2 A;  3QW1 A;  2A1D D;  1GGQ A;  2I8B A;  4JVS A;  5GPG B;  4K0D A;  2R7Q A;  1G8X A;  2CW0 F;  2R9R B;  1F1M A;  3UMH A;  3V5Z A;  3UGO A;  1H9T A;  2XXA B;  2PF4 E;  3C63 A;  2IM8 A;  4U5H A;  4DRI B;  4PR9 A;  4U9D A;  1VYK A;  3JZ0 A;  1TWC A;  3IQ5 A;  2YZS A;  4XPW A;  5L0H A;  2WZL A;  4MND A;  1ORY A;  2B0J A;  2KYH A;  4YT5 A;  1NU9 C;  1XZQ A;  1VB5 A;  3T4R A;  3ITF A;  2C04 A;  4QI2 A;  4IAR A;  3TOM A;  3MYF A;  2IXO A;  4HFK B;  2R7W A;  3L0I A;  4K1O A;  1RKE B;  4W8P A;  2A6H F;  3KYJ A;  5JS5 A;  1LPE A;  3NMK A;  5BQI A;  3AJM A;  3JRT A;  5F28 E;  3JT1 A;  1D1C A;  2Y39 A;  3OWT A;  4JC7 A;  4JW1 A;  1LIH A;  1K05 A;  4KNW A;  4N4W A;  4O6N A;  5L0D A;  5KYY B;  4C7O B;  1LVK A;  2D4U A;  3FOP A;  3S90 A;  4JCZ A;  4DRH B;  3CZ6 A;  4AX2 A;  2XSE A;  2WZF A;  2HS5 A;  2XL6 A;  5L0I A;  2G3V A;  2L6H A;  3V5Y A;  4CIP A;  4EUK B;  1QVX A;  2V3C C;  2XS1 A;  4G7O F;  1Y4C A;  3GWN A;  2OEX A;  5BUO A;  2LFD A;  5BQH A;  2R05 A;  3GEE A;  2OJE D;  3QZC A;  4PAC A;  4YL3 A;  2JD3 A;  1FFH A;  3JYH A;  3N2Z B;  5KYU A;  3T6G B;  3U5S A;  4ANJ A;  2Q9C A;  4JJG A;  5DLJ A;  3EZI A;  1HMO A;  2HZ8 A;  2J9V A;  3NMI A;  4CDV A;  3U0C A;  3J06 A;  1K04 A;  1M2O A;  3RKO F;  1JR8 A;  3RYL A;  3Q7L A;  4AL0 A;  2WL8 A;  1V74 B;  2J9U A;  5KYW B;  2GDC A;  4XPX A;  4I44 A;  1Q0F A;  3CAX A;  3EZH A;  4YJW A;  3LEV A;  4QDL A;  3TJ5 A;  1BZ4 A;  3EFO A;  1J8M F;  1VYI A;  4Q7C A;  3VM6 A;  5JVE A;  2A6E F;  5JT4 A;  2OU6 A;  4CSA C;  3LAY A;  2Q9B A;  2J7P A;  2P61 A;  1CGO A;  2QNL A;  4YT4 A;  3AGU A;  1FNT c;  4C3D A;  4FWV A;  5T1D B;  3KH2 A;  1JRA A;  2R02 A;  1JOG A;  2DB4 A;  3KPH A;  4H4K C;  2CNW D;  1FMW A;  1R5I D;  3I5Q A;  3KL4 A;  1BR4 A;  4NTF A;  3NYJ A;  1ORS C;  3L1M A;  4J30 B;  1TQG A;  4BJ1 A;  2G3K A;  4N6C A;  1Q0G A;  3GOD A;  5COG A;  5A69 A;  1IW7 F;  1JMW A;  4XQ1 A;  3O6X A;  4CDA A;  3HNK A;  2HKV A;  3HKK A;  1D1A A;  3K66 A;  2OOC A;  1PD0 A;  4DOZ A;  3NKE A;  2Y3B A;  1Z23 A;  1KNY A;  1TWH A;  2A0U A;  2JX0 A;  2VC9 A;  3FAP B;  3M4C A;  5B1A C;  4EIY A;  1RCP A;  5A6K A;  1DOW A;  5B1B C;  5BQG A;  1D1B A;  2L6F A;  3HNL A;  3G50 A;  4ONS A;  2HMQ A;  1MMG A;  2OG2 A;  4BPM A;  3JYY A;  3RQF A;  3F46 A;  2VCA A;  3DM9 B;  3MX3 A;  1ZHY A;  1VK5 A;  2CDQ A;  4LLC A;  4XPY A;  4AK9 A;  4E0I A;  3B71 A;  2HFI A;  2WVN A;  2ZXR A;  1RKC A;  2NG1 A;  3TQO A;  1W2W A;  1Y6D A;  3DXJ F;  3RQG A;  3TJ6 A;  4LDQ A;  1G4U S;  3ASN C;  4LDR A;  1WWP A;  3ZC4 A;  3ZDL A;  1LS4 A;  1OR2 A;  2Q4F A;  4NTB A;  3AQB A;  1RJ9 A;  3SXZ A;  4JCH A;  1E2X A;  3SP1 A;  2J46 A;  2WZG A;  2W4M A;  2Q00 A;  3EGX B;  4U5G A;  5L3Q A;  5AC5 A;  3H2V A;  2EIN C;  2XLH A;  3WHN A;  1AVO B;  2NUP B;  1EKY A;  2HUJ A;  1WN0 A;  4AE4 A;  4LER A;  2EPN A;  3RW0 A;  1NLX A;  3HNI A;  3E9V A;  1A0B A;  3U3B A;  1NBB A;  2VB6 A;  4NC3 A;  1LE2 A;  1OXB A;  3SYN A;  4BJ6 A;  2R7T A;  1CGN A;  3KKB A;  2YQY A;  4D4X A;  2VH3 A;  3DWW A;  1APC A;  1YAU O;  4YN0 B;  3H2U A;  4PJJ A;  1OXK A;  2YKZ A;  4U9E A;  4XEF A;  5B3I A;  2XL8 A;  3ZQV A;  1OCC C;  3H65 A;  2JPU A;  3K33 A;  2YLI A;  1T01 A;  2Y3G A;  2EPO A;  1MND A;  3S9O A;  5A6B A;  2OKU A;  3U3F A;  2XRH A;  2HJ3 A;  3X1O A;  5E2Q A;  2CYD A;  4H54 A;  2P0N A;  2P7V A;  3VAY A;  3RFY A;  4PJL A;  4FX5 A;  4PJM A;  3CEX A;  4B6I A;  4JE9 A;  4DRJ B;  3EHM A;  2O9X A;  4BJ5 C;  2KW3 C;  5CI9 A;  3DE9 A;  4CS7 A;  4W8K A;  5JRA A;  2OCC C;  2W4B A;  1I4Z A;  4CDY A;  3IEE A;  3C62 A;  4YL1 A;  4XEK A;  2AWC A;  3M4B A;  5AGF A;  1BR2 A;  1YLM A;  5AC4 A;  3KYI A;  3OA1 A;  1EQ1 A;  1FAP B; 
#chains in the Genus database with same CATH homology
 3H2U A;  3S90 A;  1U89 A;  1RKC A;  3TJ6 A;  2LQG A;  2X0C A;  3ZDL A;  4PR9 A;  1T01 A;  5L0I A;  3RF3 A;  1U6H A;  5L0G A;  5L0D A;  5L0H A;  4P9T A;  5FZT A;  5L0C A;  2GWW A;  1DOV A;  4E18 A;  1ZVZ A;  1XWJ A;  5L0F A;  2L7A A;  1ZW2 A;  3T6G B;  3H2V A;  3VF0 A;  1RKE A;  4E17 A;  1QKR A;  2HSQ A;  1H6G A;  3MYI A;  1ZW3 A;  2B0H A;  2IBF A;  1SYQ A;  4EHP A;  4K1O A;  4IGG A;  1RKE B;  1ST6 A;  4W8P A;  2GDC A;  4DJ9 A;  1DOW A;  3TJ5 A;  5L0J A;  4ONS A;  1YDI A;  1L7C A;  1TR2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...