1OKKD

Homo-heterodimeric complex of the srp gtpases
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
283
structure length
265
Chain Sequence
b'AIPWGGNLEEVLEELEMALLAADVGLSATEEILQEVRASGRKDLKEAVKEKLVGMLEPPVEPKGRVVLVVGVNGVGKTTTIAKLGRYYQNLGKKVMFCAGDTFRAAGGTQLSEWGKRLSIPVIQGPEGTDPAALAYDAVQAMKARGYDLLFVDTAGRLHTKHNLMEELKKVKRAIAKADPEEPKEVWLVLDAVTGQNGLEQAKKFHEAVGLTGVIVTKLDGTAKGGVLIPIVRTLKVPIKFVGVGEGPDDLQPFDPEAFVEALLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SIGNAL RECOGNITION PARTICLE PROTEIN
publication title Heterodimeric Gtpase Core of the Srp Targeting Complex
pubmed doi rcsb
source organism Thermus aquaticus
molecule tags Cell cycle
total genus 94
structure length 265
sequence length 283
ec nomenclature
pdb deposition date 2003-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00448 SRP54 SRP54-type protein, GTPase domain
D PF02881 SRP54_N SRP54-type protein, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 1okkD01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1okkD02
5FL7D 2ZRFA 3LY5A 2QL6A 3TKLA 1J90A 2J0UB 4Q9IA 4I1VA 2I1VB 1ZCAA 3GLFA 2WIBA 2O8CA 3QOFA 2ZM5A 5EP3A 2OZEA 1Q1ZA 5JBQA 3TJZA 3GLIB 1JJ7A 4GRAA 4LWZA 4OKSA 1CJTC 2ZE8A 1KI1A 3QVUA 5JEDA 1YRBA 2ZYWX 4FMDB 3I32A 1R0XA 4TYYA 4JLAA 4IFBA 1RJ9A 2F6RA 4ZCMA 3ZJYA 1KZGB 1WXQA 2JCSA 2Z0MA 1CR1A 2WSMA 4IHQA 1AGRA 4M9SA 4AWXA 3K70B 2IYYA 3ETLA 5TB5A 1E99A 1CP2A 3N2IA 3SU8A 1G3MA 1IAQA 5BW8A 4P32A 3WRYC 1CRQA 2KBFA 4E5UA 2BCJQ 2CE2X 4AK9A 2HT1A 4HAWA 1QHYA 3FPAA 4ZCLA 3DMNA 4EPVA 2XOKA 1KI9A 1QHNA 1TF7A 3EWAA 3GEHA 2Q21A 1AN0A 1G3IA 1QHIA 1DAMA 1L4YA 3FKSD 3NBZC 4LPSA 3EX7C 5IF9A 1E96A 3DL0A 3LRPA 3KFXA 3SJAA 4QBGB 1FPMA 1G8GA 2BMJA 2ZJ2A 2ZS7A 4JLVA 3H1TA 4CEHB 1KAGA 3O8DA 2NTYC 3X1XA 1M6NA 4MRRA 3ZQJA 1U8AA 3SFVA 1AJEA 1DBSA 1ESMA 2O0HA 3DKVA 1DTSA 5FR2A 2EU8A 3EPJA 2ZI4A 3IIJA 4UNQA 1GL7A 2NZJA 2GNOA 2GEVA 3FFAA 3BS4A 2AX4A 3ZDQA 1S3SA 3QG5A 3FHCB 4DDTA 4LV5B 3AGPA 1XD8A 4BEJA 2RGEA 2F1HA 3WY9A 3A1UA 4RY2A 4CIDA 2UKDA 4BFSA 2ZSBA 4OHZA 3SR0A 2HF9A 4DDUA 1EFHA 3C41J 121PA 1UEJA 3LQQA 3V4FA 2OCAA 1S8FA 1OF1A 2ZSDA 5FTKA 3ZZTA 3VTKA 4M4SA 1LF5A 1ZIOA 1VCNA 1EGAA 2H7VA 4A8JA 4A1FA 3SYKA 4Q5IA 4PAQA 4EAQA 2HT6A 2PZEA 2EVWX 3B78A 3A8TA 4LHZA 3BFKA 3RS4A 1Q20A 5P21A 2AFHE 2N46A 3EW9A 2YC4C 1VDZA 5C2JB 2B7CA 5TMPA 1ODFA 2J7KA 2PX3A 1AM4D 2ZRPA 3R7WB 3B9QA 5J5CA 2VSXA 2D2FA 4HDOB 3H4MA 4LJYA 5ANRB 4WZBE 4Q1CA 1L7VC 1Q12A 5JI3E 1G5PA 2REOA 5EP1A 5SZJA 3MMPA 2ERYA 3LXRA 2A9KA 1T0HB 3OAAA 5CK4A 4QGHA 4DWJA 5BYKA 2ZRDA 4KFSA 2FSGA 4ARZB 1FP6A 5JSZA 2XZLA 4MGYR 5EP4A 1WA5A 4D2IA 4MGKR 2HF8A 4B73A 1IN6A 4LYJA 1Z07A 2ZRJA 3W6NA 4A6PA 4PQRA 3PUVA 1NN1A 4MUBA 3CRQA 3U44B 5JJIA 4QFMA 1WRBA 2Z43A 5KOYA 5A5GA 4Q4AB 3TGPA 1SHZA 1KK0A 1G17A 2J0SA 1TTTA 4V0ME 2NO0A 1D9XA 1AK2A 3VNVA 3C8UA 2VP2A 2C04A 2LCFA 1W0JD 2FFAA 1Z0KA 4DEXA 2ZRAA 1E1RA 5EE5B 2JLRA 4PHGA 3WMFA 1NL3A 3PITA 3PR1A 1G8PA 2A5FA 2G83A 5CDFE 4X8MA 5FL7A 4LJ6A 3VR1A 1W2HA 2CXXA 3FKQA 4NCJA 3SS8A 5DO9A 5FL3A 1LVGA 2ZQ5A 3TMKA 3C14C 1II0A 2BEJA 4GNKA 4P33A 5C4MA 3BH6A 2FH5B 1E6CA 3DO6A 4XVUA 2ZXUA 1W2GA 4JLNA 3BERA 1YZKA 3K09C 1G291 3SOPA 2ZUDA 4RFSA 3ASYA 5JLJA 1W36D 1QHXA 2VP0A 3KTAA 4O3MA 3HYTA 2UVQA 1H8ED 1M1YE 3AEZA 2NGRA 4IDHA 3CRRA 1J7KA 2WKPA 1G7TA 3M4YA 1UDXA 4QGAA 3FFBA 1XD2B 4XSHA 1T5IA 3LQRA 4LC0A 4FN5A 4V0OA 2REXB 3U3OA 1U0LA 3U3KA 4IVPA 3GMTA 2GEDA 4A9AA 1P7CA 4PANA 3QKRA 1YVDA 5CDFA 4BFWA 3HJNA 2FGJA 3UXMA 4ESHA 3KKQA 2DPXA 5DSZA 1OIXA 4LYAA 1OXVA 4NHOA 1OH8A 5CB6A 2IYUA 4C0SA 3CWZA 3LO5A 3X1ZA 4MGZR 4IXMA 2QMUA 3WMEA 1E2NA 3SQWA 4Q03A 2QT1A 2BOVA 4R71A 4XIGS 1M7BA 2WJGA 5EP2A 3FKSA 4B6FA 2QGZA 3M1IA 3UWKA 1W48A 3V9PA 2ODBA 3W6OA 1VCOA 3MG9A 3VR4A 2HUPA 3S1AA 4IRUB 4PSAA 5JJKA 1ZC3A 2ASEA 2J0VA 1Q21A 1HY3A 4Q1DA 4F4IA 1X86B 1DEKA 3U61B 1DELA 3M0EA 2W6ID 3GPLA 4Q01A 4YMUA 4TL8A 3IUYA 1CU1A 3L82B 5J4LA 3HPRA 3BFVA 3BGWA 1DAHA 3THOA 4F4JA 4UXJA 5AJYA 2PH1A 3NC0C 2A3RA 1FQKA 2QPTA 4TQUS 4D4JA 2OV2A 2ATVA 2YOGA 1ZUNB 4EJSA 5LDDC 3ADBA 2ZJAA 1AS0A 2GJ8A 1BOFA 1TNDA 2GK6A 1T4GA 4HUQA 4YMSA 3UWOA 2XTNA 4Y0VA 5CM9C 5JRJA 2ZRMA 1TF2A 2O0KA 3DM5A 3TQCA 1SKYB 1SXJC 1KI8A 4KFRA 1KO4A 4OYHA 3QKSA 1TEXA 1RVDA 1H8HD 4JKIA 1U8ZA 3TAHA 3VU9B 5H1YA 3ADCA 3IEUA 1TQ6A 2FDCA 1P61B 1YZUA 4A0GA 4KU4A 5G40A 2A7QA 2CCJA 1N6IA 4JLPA 5CK5A 1ZNZA 1G6HA 2FPMA 3SHFA 1DG1G 1AKYA 4AG5A 2D7DA 3QI2A 4G5GA 4CEJA 4H1UA 1OFTA 1XMVA 1CBUA 4MRVA 4D81A 4DB2A 4GOKA 5JWOA 2QAGC 4TT3D 5F9FA 1P2SA 3KQNA 1YJ5A 1ZNYA 2PJZA 4EUNA 1T5LA 5IHPA 1GKYA 1YR8A 4RZ3A 5KNBA 4YDHB 4QHYA 3RWMB 3O47A 3QBVA 2P2LA 5HPYB 3QEJA 1KYIA 1E69A 4AYTA 2GCOA 3JVVA 2PZFA 4AURA 1AS2A 2ORWA 3SI7A 1OHHD 3K0FB 1LY1A 3I62A 3H2YA 5TVKA 3FGNA 4QRHA 3W90A 3E5HA 1NIPA 5AJZA 3MWLA 2KB0A 1AS3A 2FX3A 4JSYA 3RVBA 3QY0A 3IHWA 3LBIA 1E2PA 2WJVA 2HCJB 1TAGA 2J3EA 5E3HA 2GJSA 2WOJA 1QRAA 2BBWA 3EIEA 1AQYA 4G01B 4LSGA 5EE1A 4F38A 1S0UA 3FOZA 3QSYA 4C0QC 1Z6GA 3DDCA 4LHXA 1Z06A 4W5JA 3SYLA 3OIVA 2BHRA 1Z63A 1GFIA 1SVSA 1G4AE 1LB1B 2X2FA 4WXPA 1ZJ6A 4FCWA 1W0JA 2QE7D 4PZYA 1IN5A 3TH5A 1IN4A 4RD3A 2HV8A 2JEOA 5B57C 2G1JA 1R0YA 1MH1A 1XEXB 2V7QD 1NMZA 1VPLA 5G41A 2ZREA 3SDZA 3UIEA 4ABYA 3WYFA 3K8YA 2MSCB 1YE8A 4MH0R 3QE0A 4A15A 2VSOA 4UXHA 3N2EA 1HT2E 3P27A 3BJIC 5G53C 2CBZA 1C4OA 2ZANA 4BFVA 2W0MA 3NBYC 1EXMA 4YLGA 4LX0A 4KITB 1NJGA 1E94E 2RGGA 4ZKDA 3GD7A 3KX2A 3K0EA 1H8EA 3EA5A 2WKRA 1KSJA 4TSFD 1RYFA 3OHMA 5SZIA 3ZLJA 1Y3AA 1N5KA 4LBVA 1K5DA 2F1JA 4A2PA 2JLZA 3RWOA 1ESNA 5JWHA 2OCYC 1E4VA 3HP1A 2QP4A 2OEPA 1RRFA 4JMPA 5EZ5A 1UF9A 4DT1B 3QXSA 4HZUA 4OHYA 3C5HA 4UNNA 2KBEA 1QDEA 4KHZA 5TARA 5G3YA 2EYUA 4CGZA 5B2ZA 2RGNA 2VP6A 2XXAB 3I73A 1QHHA 2OE2A 4UNPA 2KI5A 1ZUHA 2GDJA 1OPXA 4NU0A 3EG5A 4MYUA 3L0SA 3T61A 1KO5A 1T0JB 2PMDA 1UBFA 1W4BA 1YR9A 1EFTA 2GXQA 3VKGA 3VR3A 1OJLA 4ZIRB 2KE5A 1FNNA 2P6NA 1E9EA 4JVLA 2ZE5A 4OK3A 1W44A 2P67A 2LWIA 4DLYA 2EWVA 4FXPA 1A7JA 1XNJA 2ZRKA 5SZHB 2VL7A 2ZRHA 2DHRA 3IBGA 1Z0IA 1KSGA 1XCMA 1N5LA 4HLUA 4B2PA 4C2TA 2AWOA 3FWYA 2GAOA 2W6IA 1P75A 5A4JA 5E7JA 2ZEJA 4DSNA 4GP7A 4RZXA 4HLQB 1N25A 2H8KA 1OSNA 4QNMA 5DI3A 2V9PA 3QPUA 3HWSA 3ZGXA 1U0HC 2G9NA 1US8A 4IDNA 4M0LA 5EE9A 4DCTA 1WB9A 1NG9A 3THWA 3TUZC 4J0QA 2J59A 3IIMA 4TTPA 4Q1AA 2ZU0C 1JEDA 4KFUA 1E2FA 1LF0A 2ERXA 3A1VA 2WTUA 3T1TA 5L3SA 4OQMA 1H8HA 2IF0A 3FE2A 1CJVC 3IO3A 4L9WA 5H70A 4LV8B 1TX4B 3TSWA 2EFCB 3EAQA 1BYIA 1VYUA 3CB4A 1DVRA 2AK2A 2L0XA 2RCNA 4JSTA 4NTZA 1Z47A 1JEEA 4UXIA 2GESA 4JLDA 3WYAA 1Z5ZA 1KDPA 1M34E 1MO6A 1XXHB 4A0RA 4DBLC 1J2JA 4TYNA 2A5GA 5DISB 3AQ4A 4TTRA 4TT3A 5GVRA 4QG7A 4B35A 2JLYA 3X2SA 2MSDB 3VHXA 1NLZA 3PENA 4Q4JB 1FUKA 4POAA 4F92B 3K0CA 5DN6D 1PLJA 1EFRD 3OFND 4YMTA 1WF3A 4TLBA 4NCHA 3IGFA 4TMXA 3I1FA 5DHFA 4LJ9A 3EIQA 4GSYA 5JJLA 4TL7A 4URWR 4RD2A 3ZD6A 1VMAA 1YZTA 1OHHA 2MSEB 4RCZA 3GJ3A 4BLRA 4ZI3A 3U4QB 4OQNA 3MCAA 2ECKA 2ZJ5A 4HB3A 1E98A 3THYB 1NY5A 5AJXA 1RRCA 4B74A 4L8GA 4LCBA 2PBRA 2ZI9A 1MABB 1VKJA 2ZAMA 1QF9A 3CRW1 2ZJZA 2OAP1 1B23P 5KDOA 3ZD7A 2J9RA 5FBRB 3N5CA 3QVVA 3WBJA 3TK1A 1XMIA 2N42A 3GJ4A 2C78A 4D0LB 5AUOB 2NPIA 2OESA 5HE8A 3RNLA 3A1WA 1G8HA 2QE7A 3X1DA 5GADl 3HU1A 4OHVA 1V5WA 1NLYA 4TLDA 3O8RA 2V7QA 2C9OA 4NDZA 1JB1A 4FMDF 5J40A 2QORA 4O0MA 1II9A 2REBA 3GEIA 4BLTA 2ZI7A 1GP2A 4UNSA 1I2MA 4NCIA 2K5UA 5CITA 2ZRGA 1CLUA 4C7OA 4JT2A 1GNPA 3U3RA 2GBLC 3PUYA 4LY6A 4JLKA 4KCGA 1R5BA 1FX0B 1KMHA 4CEIA 3AVTA 4WA7A 3LLMA 1W4CA 3BRWD 3UG6A 3CM0A 5AUNB 3W3AA 1OYYA 1VYTA 2CCKA 2QPAA 4TSFA 2BJVA 1CF4A 2ZPTX 4C30A 4HAXA 3RS2A 2QQ0A 5J4YA 2AWNA 2DWPA 4BZPA 2O8EA 3BH7A 3LVRE 3ZVNA 4JVNA 1S96A 4QBHA 1QZXA 4JVMA 2F55A 1RPZA 1XDBA 2I4IA 4PC3A 3REFA 3U3JA 2PL3A 1NN3A 2QENA 4AYWA 3AP2A 5FTJA 3THXA 3QXCA 3TNFA 3CZQA 2WJYA 2QBYB 1G3RA 2JIZD 2X2EA 4JYCA 1XEWX 3F8TA 3FDIA 4HEJA 1CRPA 3FYHA 1S1MA 4OK6A 4JVSB 4HI0E 3N70A 4PZZA 2TMKA 2YHSA 2FV8A 2ZI5A 4M1KA 3RSLA 1X6VA 1OXUA 1SXJB 4LK2A 1IY2A 3WRXC 5BQ5A 1OT3A 3A4LA 4MKHA 1II8B 1RRGA 4TYQA 4JIMA 4V0NA 2CJWB 2WHXA 2B8TA 4K46A 2W2TA 1P9RA 3SFZA 3UMFA 3GLFE 3T35A 2HJVA 2KJQA 1FMLA 4GOJA 1N6LA 3GLHB 1JXMA 4NYJQ 1GUAA 3ICQB 4PR0A 4C2UA 4B3CA 4R2IA 1MRSA 3T15A 4A2QA 4XTRA 3GLGE 3KZ1E 3GFTA 3KKMA 1UEIA 4WW0A 2QAGB 2IXFA 2VHQA 2C9CA 5FUVA 3K70D 3AVOA 4LBYA 4I4LA 2ZVQX 3QF4B 2ODEA 4HYYA 2OM2A 5TXGA 4XWOA 4AD8A 1QBKC 1XTJA 3T1OA 3E1SA 4CZ2A 5G3ZA 1M2OB 1DG3A 4MKFA 3KXIA 3MAAC 2X8AA 2PLRA 3A37A 4OQXA 1P2VA 2IA5A 5D3MB 5KNDA 1KGDA 1R6BX 2BJWA 2YWHA 2ZIAA 4I1SA 4G3XA 4X8OA 4B3FX 4EIWA 1T91A 1HQCA 2W58A 3I92A 3IO5A 3KKOA 4QKQA 1CULC 1MABA 1NN5A 2RB4A 3VMFA 1E2LA 4Z1MD 5LD2C 1UAAA 1X1SA 2O8BB 5KSPA 5KDDA 5EXTA 2EFGA 3C7KA 4XD7A 3GLGA 4O2LA 2QMEA 4NYIQ 4B3BA 1TU3A 4Q4HB 4KODA 1XB2A 3U5ZB 4P31A 1ZMXA 2PJRA 2YVUA 2PX0A 1E2HA 3Q7QA 3LDAA 1KIMA 5TY0A 2IS2A 2FFBA 4C0HA 2R6AA 3L0IB 2WM9B 4P4TA 2VYFA 2A78A 2P0EA 2WMNB 2ONJA 3GJ0A 1G7CA 1XMSA 2YWEA 3CR8A 1WDTA 5DN6A 2OLJA 1EFRA 3OFNA 3KB2A 3VR5A 1UJ2A 2R6CA 2SHKA 4FMCB 4B44A 3RANA 2CDNA 1FL9A 2ZR7A 5IT5A 1TL7C 1NSTA 3P32A 3ZZ0A 4LI0A 2Z83A 4RJLA 1XZQA 3IEVA 4IFEA 4TL6A 3SYNA 4DLZA 4PO1A 1G7SA 1LNZA 2VPPA 3D31A 1KKMA 3PFIA 1G8YA 2OO7A 5AJVB 3SBEA 1JI0A 2IXGA 2GF9A 4XTCS 4M1TA 1E9AA 4NONA 8OHMA 2OBLA 1GL6A 1S9HA 621PA 2O8FA 2D62A 3K0CC 1IXSB 1XWIA 2NG1A 5GJCA 5KUTA 5CB8A 1XCGB 5FTLA 4RD6A 1ELOA 1G21E 2CMKA 4B75A 4A36A 1D2NA 2X19A 3G5UA 3AKEA 4LV6A 1XZPA 4TQ9A 2V55B 3AVPA 2QMHA 4FWTA 2OUKA 1ZD8A 1UKZA 3TW8B 4Q00A 4B3XA 4DEYA 1UDWA 5FBQB 2FNAA 1ZVQA 3GP8A 3O8BA 2RHDA 5KSYA 3WP0A 1L8QA 2FU5C 3BD9A 3GJXC 3KQUA 3UPUA 1O87A 4BGDA 2OCPA 4KXFB 1ZNWA 5DGXA 1Z2CA 1HE8B 3SE0A 3DMDA 4BFYA 1A5TA 4LJ8A 4LZZA 3X1WA 3QIAA 3GLIE 2R6FA 4E03A 3CNNA 3SQXA 3C5CA 2WJIA 2FZ4A 4C9BA 2H92A 3DZ8A 4PFSA 3ND9A 1TQ4A 4TMVA 4EKDA 3QKTA 3LA6A 5FPKA 5LB4A 4KBGA 4CT4B 3KFVA 4II7A 3MLEA 1TPZA 2GWHA 4DCSA 1ZUIA 1RFLA 2ZR0A 1ZM4A 4RKFA 1ZYUA 2WSSD 3CNLA 2G0TA 1G20E 2JIZA 1TUEA 3NDBB 3MRSA 4BUJA 3UMSA 1IN8A 4D80A 1WP9A 3QUSA 1JXOA 5HCNA 2Q6TA 2J0UA 2ZYUX 1NVXQ 4ON9A 4AKIA 3ZVRA 3L43A 3LW8A 4HDQB 2OFXA 521PA 1DS6A 4XWAA 3GFPA 4A2WA 2XTMA 3AVUA 2QUZA 3GLIA 2FSFA 2D4HA 5FPSA 1XPOA 5EXSA 5DNYB 5K8IA 1FFHA 3D3QA 4N0EA 1MO4A 4FI3C 3R9XA 3B1WA 4N0DA 4LRWA 3TRFA 2ZJOA 3Q3JB 2J41A 4BWYA 2OBMA 4DB4A 2QAJA 2WWWA 1NKTA 1W4AA 1U9IC 2P3SA 1KY3A 4M1MA 2NIPA 3B1YA 3EZ9A 1PUIA 3DPUA 3TSZA 1IJFA 4MGIR 2C2HA 2W6JD 3B9PA 1NSFA 1N5IA 3U7EB 4DXAA 4D4KA 3FHTA 1F2TB 2CHVA 3UG7A 2BM0A 3A4MA 1UBEA 3RAPR 2CLDX 2Q3MA 1MOZA 1OIVA 3NC1C 4NCKA 3CF0A 2IT1A 3QG1A 5HCIA 2KSQA 4AIIA 5L3QB 1T8TA 3CPHA 3TR0A 1R5OA 5F3WB 4IOKA 2AD1A 2QMOA 4M9ZA 2A2ZA 3PV0A 2JDID 5HKKA 4Z1MA 3RRNA 1JR6A 4K81B 2ZJBA 2AN9A 4F93B 3PEUA 1Z83A 2IK8A 1G18A 3CH5A 2D7CA 3PVSA 4CEHA 3G82C 1S3GA 5J4HA 4Q7LA 5DE3A 3J81k 4MKGA 4QM6A 3KJIA 2DFTA 2G1KA 3B7GA 1FUUA 4KVGA 4V02A 4UJ3A 2J45A 2XITA 1E4YA 2Q9CA 3HR7A 3PQCA 2CNWD 3UANA 2F9MA 1PV4A 2JA1A 2JLSA 3KQHA 2BIFA 5EZ6B 2ZRIA 3T1QA 2V1UA 3MJHA 2FWRA 3FHOA 2NO9A 1W5TA 4MYCA 4PC7A 1Z0DA 1K6MA 2BMEA 4XOIA 5K8TA 5KPJA 4OI1A 2C9YA 1T8UA 2VQSA 3TIFA 1ZRHA 1UPTA 3W5IA 4NPHA 4QHTA 4NMMA 2YZ2A 3NBXX 2XJ9A 4GOXA 5B64A 2R44A 1KDTA 2EW1A 1WE2A 2IHBA 5F98A 1A2BA 1JQLB 3LW7A 5BYJA 2WJJA 4RZUA 1YU9A 4ITRC 4PQFA 3KKPA 4MKIA 3I5XA 3SJCA 1GKUB 4US2R 2O52A 4CVNA 3CNOA 5FTNA 4D0GA 4WBSA 4HB2A 4BFUA 1OB2A 1UKYA 4AYXA 2QSZA 3ZZUA 4B48A 1Z6AA 4PAMA 1YHNA 1E2EA 3R8FA 5JCPA 5C46F 4X8HA 3DKPA 1Q1BA 1G8FA 3B60A 5TDHA 3ECCA 5C18A 1NN0A 2J87A 3BIFA 3R7WA 4QC2A 4DLXA 4C0KA 1LS6A 2B7BA 3FMIA 3KJEA 2FJUA 2ZUCA 5KHOC 2AKAB 1XJQA 4PTLA 4M9QA 5B58C 3CRVA 4QJ4A 2AR7A 2IYVA 3B1ZA 4IJMA 2JJ2D 3ICEA 4GP6A 4ARZA 1DAEA 1GVNB 2Q0HA 2Y8EA 1JECA 3CH4B 4BZXA 4LBWA 1N6OA 4QNRA 1U2RA 4FCVA 4I1OA 1EX7A 4PO9A 1I4DD 3ADKA 2ZS8A 2W0SA 1WQ1R 1ZP6A 5EXPA 4PPFA 3QXHA 1E9FA 5KTYA 1Q1QA 3U44A 1X8KA 4TMWA 4ZCIA 3GCGA 3BH0A 3GJ5A 4Q1BA 4GMXA 3CIOA 1UBCA 4Q4AA 4DKXA 1MR3F 5FBWB 3P1JA 1R4AA 4ZDWA 2IYLD 4CW7A 2IXEA 2QP3A 5KPDA 1G3UA 3IQWA 1DPFA 2ORIA 5BXQC 2WSSA 3RHFA 3B8HA 3WNCA 4U7DA 2JAQA 2PZGA 2BBTA 2W83A 1N5JA 5K8LA 4YMWA 1E2KA 2HCBA 4C3ZA 5DI9A 3WNDA 4B2IA 1X3SA 2GHIA 4TQAA 5LBIA 4M22A 3Q72A 3OEED 1D9ZA 1UADA 3QNUA 1LFDB 2IL1A 2ZSFA 1ZCBA 2NO7A 4JLJA 1ZC4A 3TE6A 2R9VA 2F1IA 3ZIAD 1AQUA 3NHBA 1OXTA 2QTVB 2ZTSA 4A8JC 4UNRA 5LD2B 4GL2A 2NMVA 2BVNA 1OXXK 2HJGA 3CWQA 1KJYA 2DFKB 4AY2A 5FTMA 3IDQA 1CJUC 2WJHA 1ZBDA 4GPTA 3EWSA 2XB2A 1UKEA 2ONKA 4BASA 1XD2A 6Q21A 1CTQA 5GJBA 4QBFA 2C5LA 4URXR 2V1XA 4OI2A 2BMFA 1KDOA 1Q3HA 3DHWC 4DC9A 1GM5A 1QVRA 5E95A 2Q9BA 1NNEA 1Z0FA 2AXPA 5AUPB 2QQEA 5H68A 1DE0A 2W6JA 4D4LA 1I4LD 1GIAA 1XBTA 2WWGA 2D3WA 2GXSA 1XX6A 4GI7A 4PX9A 4HUTA 3AP3A 1SHKA 5KSZA 2CK3D 3CZPA 3A6PC 3F0TA 4BLPA 3K9GA 2QP9X 2ZVPX 4C0LA 4A4DA 4DLVA 1F2UB 2P5TB 1R5NA 4AG6A 2VP9A 2DFNA 2QSYA 1Z6TA 2DYKA 3LAWA 4BFZA 5BN3A 1SVWA 2JDIA 1SKYE 2CCGA 4I99A 1G3QA 1VG0B 3SEAA 1KI6B 4QBIA 1C1YA 1JALA 2GK7A 3RC8A 2H5EA 3NH9A 3W9YA 1SVMA 1VHTA 3MFYA 4OL0A 2FMXA 1QG4A 2OLKA 4DUGD 1EX6A 2QTFA 4H9GA 1QHSA 2GETA 5FPYA 2NOAA 4JLMA 4M53A 1XTIA 2AK3A 2A30A 3O8CA 4P0TA 3PG5A 3OF5A 1SVIA 1WBBA 1KK2A 2WWIA 4R98A 4GDFA 1N6KA 4MYHA 4U02A 721PA 5F9HA 1ANKA 2CNWA 1CXZA 1E9DA 2IC5A 2GAAA 3VX4A 4TLAA 2VBCA 4FW9A 1AZSC 3UMRA 3KQKA 2IYZA 2YNMA 4WAUA 3JZAA 2VHTA 1HTWA 1T3SA 3KJGA 2BMDA 4LJAA 2OG2A 1NMYA 5E7MA 1AZTA 3RLFA 3JVUA 2DWOA 1XTRA 1Z6YA 4LBZA 4KVAA 4IEEA 3TLXA 2PEZA 3JZMA 1T9HA 2AL7A 1KO7A 4X8LA 2BM1A 4L15A 3BK7A 3NDPA 1E9RA 3VU9A 4EPTA 4IVQA 3LX5A 2G0NA 4WZAE 3NIBA 4PHHA 1OB5A 2AD5A 2J46A 2FSIA 1E0JA 4DJTA 5JRZA 2GVZC 5KO2A 4MUAA 1J8YF 1F60A 2ATXA 3CONA 3Q8XB 2E9SA 1GDDA 4NYJR 3ZH9B 3NG1A 3BAFA 4KV9A 1P9NA 1YZGA 2WVJA 1E9CA 4ESVA 4OI0A 2QU8A 3ZS9A 2QZ4A 4PC2A 1HUQA 5IK2D 1OFIA 5HR5A 2B6HA 4N3NA 2O8DB 1P2TA 3P26A 3UKDA 1JPJA 1L2TA 2ZROA 2GXAA 3BB3A 1U81A 2VSFA 3PIRA 3AVXA 1IJEA 3VKHA 2F3TA 1Z6XA 2BBOA 4TLCA 1EWRA 1G1MA 3CBQA 4XJXA 4QOSA 3K0FA 2JJ2A 3CPJB 3QQ5A 4Q9HA 1J99A 1KMQA 3L2OB 5FOSA 2H17A 3TAUA 1ONBA 4EQ6B 4ILEA 2ZETA 1D6JA 3KUDA 3AM1A 5HE9A 2ZYTX 1IN7A 4NE2A 3I5YA 3SJZA 1Z22A 1K5GA 5DLQC 1E9BA 2IHYA 2H16A 2Q3FA 4DSTA 5AWFC 4XD7D 2GZDA 4NYIR 2WAXA 1JR3D 1KY2A 2HYDA 2VTKA 4B43A 5JEEA 1CR2A 2YOHA 2QRNA 1KSFX 4IDPA 4QXAA 4ZKEA 4EJSC 1XTQA 1UBGA 1AGPA 2LKCA 1E2GA 4M1WA 4TMTA 5CYPA 1OYWA 1RKBA 1IY0A 4BLOA 5KYKA 2CL6X 2ODNA 1W5SA 3WYGA 3TR5A 1NG1A 1WCV1 2V4ZA 1KI2A 1UFQA 1XEXA 4FINA 4P4SB 1XMJA 2CL0X 1XP8A 2ZRBA 3H86A 5J4VA 2DR3A 3I3SR 2JATA 2YV5A 4KJZA 2ORVA 4JZKA 4DSOA 1QHGA 3OEEA 2RAPA 4FIDA 4KAXA 3CX7A 4RZ2A 2V3CC 2F3RA 1TEVA 1NVWQ 3LVQE 4EPWA 1DO0A 1L4UA 1ZD9A 2ZS9A 3ZIAA 4OQFA 1U8YA 3K9LA 1B0UA 1R2QA 5FOUA 2QT0A 3H84A 1FP7A 1YR7A 5BN5A 1NMXA 4GBMA 5A0FA 2IF2A 4JBYA 4RSGA 2FE4A 2IYWA 4LJ5A 1CS4C 4PAOA 4BFXA 4LJ7A 2FEOA 4PC1A 4KBFA 3U6KA 4WOPA 1GZSA 1I4TD 4DT1A 2ZRNA 2V6IA 3KL4A 3U7FB 2IS4A 2DCUA 3ZS8A 3G0HA 2RGCA 3P20A 5L3RA 1E1QD 3SBDA 4MA4A 3B6EA 2XXAA 3GLFB 2O8CB 2C77A 2CK3A 3ZVLA 3AF1A 4JLBA 5CLQA 4V0LA 1SXJD 4BECA 5JFGA 1BKDR 4WIAA 3SHWA 2V8OA 1ZIPA 3EIHA 3K0AB 4D6PA 1OKKD 2FFQA 4JL5A 4QGFA 3NHAA 1IBRA 4ZIRA 2JLUA 2RMKA 4Q19A 4Q4LA 5CIWA 2BCGY 2CVFA 1RJ9B 2PLFA 3RDPA 3VFDA 4HDCA 2VHCA 3AH8A 3FB4A 2CL7X 5FOVA 1EESA 1P5ZB 1QG2A 4DUGA 5KU1A 3WMGA 2ZE6A 3MWJA 1NVUQ 3GJ6A 2A5JA 1IONA 2JGNA 3BXZA 4XWKA 4ZV4A 5JECA 1HV8A 1XFAA 1KK1A 2F43B 1C9KA 5FOWA 5L8VA 1XXHE 4EPRA 1R0WA 4URUR 4DCNA 1D8TA 2IS1A 5C4GB 4TWZA 4ZDKA 4PPQA 2FN4A 1G19A 4G5RA 4DDVA 3NXSA 5FFMA 2C98A 1E0SA 4MQBA 5AR1A 1MRNA 1EFCA 4HB4A 5EE3A 2W2VA 3A36A 2XB4A 1E79D 3HU3A 4LDJA 3K1JA 2IYTA 4CYMA 1W36C 2BWJA 5LB2A 4DLRA 2KWIA 2G6BA 3D8BA 1GL9B 4R2HA 4DIDA 4OI4A 5CLLA 1SVLA 5IDVA 3KUCA 1BMFD 4Z8YA 1KNXA 1PVOA 2XAUA 3KKNA 1S9DA 5DHAA 4PXAA 4ZO4A 1W4RA 2QGNA 1K8RA 3F3YA 2R8RA 1D5CA 3U3MA 5CJ2A 5BN4A 2RGAA 2ZRCA 4ZPXA 1XXHA 4BE7B 4UJ5A 2ZUBA 3IPXA 4EFNA 3B2EA 3BFXA 1GRQA 4GZMA 4WVFA 2HLDD 2RGNC 3C15C 2FSHA 4PC6A 2QNRA 5IK2A 3A58B 2WPDA 4HAUA 4H1VA 5D3QA 5HZHA 1Y63A 1HH4A 1XTSA 1ZW6A 3GFOA 1JBKA 4TN1A 4Q7JB 1IOZA 4LJ4A 4Q4JA 1OIWA 4W5WA 4PHTA 1HURA 3HR8A 2O0JA 2ZITA 4HZIA 1HQYE 4GZLA 1NF3A 4MYTA 1VG9B 2C95A 4B32A 4BFTA 4BEBA 3VQTA 2EQBA 4AI6A 3OEHD 2VP5A 5FR1A 3LFUA 4A0HA 3RS5A 5EXXA 5JZVA 1BS1A 3K09A 4A8JB 3U4QA 3DOEA 1M8PA 5HTKA 1RC8A 2RH5A 3LLUA 4IDOA 4KI0A 2R6DA 5EJEA 3THYA 3K53A 3LX8A 1W46A 1NBMD 5HKKD 1P2UA 3TBKA 4HLUC 3BOSA 4NYMQ 4JBXA 4GT1A 1VCIA 2IX3A 4UQOA 3T5DA 4FWIB 2GJAA 1GNQA 2OAQ1 1Z8FA 1IXRC 4Q7KA 4DDWA 1JR3A 2MMGA 4WXRA 1KJZA 2I3BA 3RYTC 1GG2A 5CM8B 2GF0A 1PUJA 4MITA 5KSOA 2J5XA 4TTQA 3Q9LA 4ASUD 1LW7A 2VF8A 1NLFA 3A1TA 3H0KA 4AKHA 2BC9A 3R8CA 3PUXA 3V00A 1FMJA 3FMFA 3ONWA 4V03A 1IY1A 4XVRA 4ERNA 4OQLA 2IYXA 3RRMA 1RE0A 2I1QA 4YXWD 3CF6R 5JSZB 3OESA 4DLSA 5UKDA 1SULA 4LPKA 1EWQA 4HAZA 1DOAA 1R0ZA 3VR2A 2IUUA 1LS1A 3L8YA 3K0AA 2OCBA 2FF7A 1NI3A 5FI1B 3ZQ6A 3TVTA 4YQFA 1EK0A 1SXJE 2B21A 3FMOB 1AIPA 1VIAA 4G0NA 3Q85A 2GRJA 4B6EA 4MDEA 1E9SA 2GCPA 1KKLA 3AKCA 3EZ7A 3MUFA 1FX0A 3MGCA 3UATA 5JI2E 2FEMA 2YWFA 1M74A 3HDTA 3MSXA 1RRPA 3NEYA 3PCRB 5FI0B 4YC7A 5FUWA 1KTVA 1UKVY 2ANCA 3IIKA 4QGGA 1YZQA 1G64A 3B5JA 3GLHE 4CT5A 1FOEB 2F43A 4JBWA 3P4XA 3Q7PA 1XPUA 3I8XA 2GJ9A 4QL3A 2WAYA 3CR7A 2QBYA 3EC1A 1JAHA 2FOLA 2XX3A 3KXLA 4Q1FA 1E1QA 2QY9A 4DCUA 2QTHA 2B92A 4Q47A 3W8RA 2Z4SA 4TZ6A 1S2MA 2YOFA 1D2MA 3I4LA 1SXJA 1TMKA 2G77B 4RFSB 3W5JA 1V43A 3NKVA 3PUZA 1JQJC 3KTAB 3LV8A 1DAKA 3B1VA 1XPRA 1OKKA 2GEUA 1II8A 2J7PD 1P3JA 3B85A 3EXAA 4FD2A 1G9XA 1YR6A 3OIYA 4M1SA 1PZNA 2CJWA 4Z51A 2ZAOA 2F1RA 4IOMA 1XJCA 5GVSA 4KSCA 1KJWA 3GLHA 2P6UA 2Q3HA 3QKRB 1CKEA 1UM8A 3R9IA 2A5YB 3A1SA 3WNBA 1GKIA 3RRZA 1T3HA 2QAGA 3PUWA 3WBKA 5J47A 1GWNA 3WHKA 2XSZD 1ZM7A 4NZYA 3QF4A 3D6TB 1W7AA 2D74A 3M6AA 2P65A 2QI9C 2C03A 1G6OA 1W1WA 2WOOA 3IPYA 4Z54A 1TADA 4RD0A 4S35A 5AJWA 1RIFA 3EPHA 3OZXA 2IEZA 2XJ4A 3AVWA 4Y0AA 5D3MA 2VHUA 1KI7A 2VLIA 4DHEA 1E79A 2D2EA 2YWGA 3S1AB 4P4UA 2PT5A 1BH2A 3E2IA 2OT3B 4PZLA 5L3VA 3NH6A 1M7HA 2HXSA 1BMFA 3CPEA 1OH7A 2Q9AA 3AB3A 5FPHA 2O8BA 4Q48A 2XTZA 3W3ZB 2E87A 4B2LA 1F48A 5DYGA 5FUYA 4IKEA 1ETUA 1NBME 4Q4HA 2IUSA 3L8ZA 2JJ8A 2WV9A 5GJVC 2W00A 3NBFA 1CR0A 4E22A 4EJSB 3B1XA 1KSHA 3T06B 1E2MA 3CLVA 4D26A 3REGA 1O3YA 3ND8A 1GNRA 2HLDA 4LHVA 4HUQB 4IXNA 4A82A 4DLWA 5JS7A 4DVGA 1SKQA 3I61A 1VHLA 5DH9A 1N3BA 1AA9A 4PO8A 4KO8A 4TLEA 5C1BA 2ZSAA 5M04A 2EWWA 2RGXA 3EASA 1M7GA 3QKSB 1YRAA 1DARA 4XSGA 1U90A 3GQBA 3NWJA 3OEHA 2NO6A 2GTPA 4IVRA 2WICA 4Q9KA 3MJRA 3UK6A 1YZNA 5FBVB 4TL9A 4JJKA 4L5BA 1GAJA 1EFUA 1XRJA 2AXNA 1LV7A 2F7SA 1G41A 2G88A 4IOLA 2OFOA 3GJ7A 3AVYA 1NBMA 1NVVQ 3VAAA 2D06A 2JLQA 1N0UA 3LBHA 1ZM2A 2YJTD 3RS0A 4E07A 4BLQA 2NZ8A 3CO5A 2OFWA 5ELXA 4CEJB 3BB1A 3AF2A 2OXRA 5JHHB 1KOFA 3KQLA 4C0BA 1SVOA 1G4UR 4JLOA 2QG6A 5TV2A 4EFMA 1Q44A 3QPWA 2P6RA 3DZDA 4Q1EA 4EPXA 5FBLB 3P4YA 1GRNA 1AKEA 1ZM9A 2OHFA 2WWHA 2GCOB 2WIAA 3KXKA 4ASUA 3C4JA 2E1RA 4BZQA 3PJRA 2QM8A 2Z6VA 1PJRA 3LXXA 4B33A 2ANBA 3T12A 4OBEA 4IDQA 3U7GA 1E3MA 1N0VC 4YXWA 2NQ2C 2OILA 1JAIA 3L0PA 1NIJA 1BYUA 2UZ3A 5JWRA 3F5FA 4URYR 1FZQA 4L4UA 2DFLA 1RZ3A 3TVDA 2OBNA 3CRMA 4V0MA 4ZI2A 4HAVA 1N6HA 3I72A 3VR6A 1F6BA 4JS0A 4LHYA 2YKGA 3BB4A 2F9LA 2RKOA 4AKEA 5E7IA 4DZZA 2CLCX 5JCZA 4M2LA 1Q22A 4A0FA 4OHWA 5CIQA 4G5SA 1SZPA 3QEOA 1MO3A 1YZLA 1R7RA 5F2EA 1WMSA 1N6NA 1TQ2A 2GVDC 2NO1A 3CX6A 2J0QA 2QA5A 1VTKA 1IXZA 3RS3A 2FZLA 5FPTA 1H65A 4TYPA 1E2JA 2BKEA 2YYZA 3EZFA 1A82A 1HT1E 2ZI3A 4L16A 4W5HA 3VHLB 2DBYA 4D0NA 2WWXA 1P62B 1W36B 4NP6A 2DWQA 2GCNA 2RHMA 4D82A 1VECA 3BE4A 4URVR 2DB3A 4B76A 2J7PA 3EZ2A 1FTSA 3SNHA 5CYOA 4GMDA 2XZPA 2H57A 1G5RA 1X8JA 1KO1A 2CVHA 1X8LA 3FMPB 4U5XA 3EA0A 4ACAA 4L9SA 3TQFA 5EE0A 5H8WA 4EFLA 5JHGB 2IS6A 2PMKA 3QBTA 4HZUB 2V6JA 3CUEF 3B13B 4CDGA 3TUIC 3T34A 4KSBA 2VIIA 1XEFA 4DCVA 4B71A 4KFTA 2VRWA 3QJYA 1G7RA 4LUCA 1QHHB 4B47A 2XNDD 1Z28A 2VA8A 1HA3A 2XSZA 421PA 5KNCA 2X1VA 2QN6A 1F2TA 1RYHA 4M1YA 4OJKA 1FQJA 1OFHA 2JJ1D 3IKJA 1GILA 3HPQA 4UKDA 3PEWA 1Z2AA 1NJFA 5L3QA 1XTKA 3Q5EA 1DAIA 4ZDJA 1G16A 2W2XA 2RGBA 2XEXA 2BDTA 3SC3A 4LGMA 2ZR9A 4HLCA 2CE7A 4MRSA 2FGKA 2ZI6A 2BV3A 1G5TA 4A92A 2ZRLA 1N2CE 1HE1C 3R20A 2CHGA 4DIEA 2PCJA 5DI3B 1MO5A 2HDNB 3PXGA 4Q21A 3EARA 1XJ0A 3K9HA 2UZIR 2IYSA 1US8B 3GJ8A 4DLUA 5AK0A 1LTQA 4KYIB 3THWB 1TU4A 2ZSEA 3AGQA 1HEIA 5E4FA 2AFIE 2XNSA 2Z5FA 1Q57A 1PLKA 4W7SA 1Z08A 5BWMA 2AHOA 4CF7A 5K8UA 5L3SB 3W6PA 3RRYA 4URZR 3OIWA 1MT0A 2GZHA 4KYUA 1U99A 2EYQA 3WP1B 2GBLA 1P72A 3OE7D 5JMTA 4Q9LA 4DLTA 2EFHB 1W0KD 2VP4A 2AKYA 1VG1A 1OE0A 1VG8A 2GKSA 5EQTA 1DAFA 4JL6A 4JT4A 4BQSA 4DSUA 5FOTA 3LNCA 4HAYA 3LWNA 2QEQA 2ZJ8A 1Z0JA 3QXJA 1P73A 4B3DA 1NP6A 2IW3A 3K70C 1FTNA 4O25A 3WHLA 4GFDA 1GITA 5DIFA 3NVAA 4WZ6A 3T5GA 1A1VA 2V54A 2IWRA 1OH5A 4D25A 3QF7A 3SN6A 2C8VA 3LD9A 1KI3A 4G1UC 2FA9A 2VHJA 4LYHA 221PA 1CJKC 3W8NA 1XU4A 1TQDA 3AV0B 4HLDA 3PEYA 3ADDA 1ZU5A 3IHLA 2WKQA 1SVKA 2FPKA 1S4QA 3B82A 4RVCA 4ZDIA 3DVLA 4QJ3A 1CJMA 3MWKA 3QKUA 4W9MC 2VH5R 3D7MA 4MRPA 1OW3B 1COWD 4Q7MB 3U60B 1FNMA 1T3LA 4NL4H 3AVVA 821PA 3AVQA 1E0KA 1EG7A 3ASZA 2G3YA 5HZKA 1I2DA 2R6GA 3K0SA 3E70C 1XCPA 3AKYA 1MKYA 3SZRA 1E0AA 3KB1A 1F3OA 2GA8A 4KLZA 1KZ7B 2R62A 4HB0A 4RKEA 3W34A 2WPDD 4AKGA 1KI4A 2EFDB 4PPNA 2GXUA 2VO1A 1P9WA 4M9XA 3QXXA 4QM7A 3CF2A 4PPGA 4Q02A 4PHFA 3MD0A 4C7OB 4C0JA 1ZD1A 1ZAKA 1HYQA 4C4PA 3L0OA 4MDFA 3V4RA 3ZYCA 1N0WA 2WWFA 1KMHB 4CEIB 3AP1A 1R10A 1KO8A 4E09A 1ZINA 1N6PA 4QHSA 2FPLA 2ZU6A 1CIPA 2O8EB 2GZAA 5J4KA 4NYMR 1MV5A 4G5QA 2N1BA 2YINC 1W47A 1S1CA 1TUIA 4US0R 3THXB 2JLXA 4F91B 5LPNA 5KDLA 2CLSA 2R2AA 4I1UA 2ZYVX 5GJWC 4U00A 4TMZA 4Q9JA 2P5SA 2XNDA 2GJKA 4B3GA 3DM9B 3AUXA 1Z3IX 3IILA 4C0AC 3CKLA 1ZM3A 2BBSA 1FW6A 2GILA 4Z8XA 1E2DA 4S2EA 4CRWB 1W49A 4RD4A 2JJ1A 1F5NA 3OIUA 2H18A 4RD1A 2C96A 3A4NA 1JJVA 1F2UA 4Q18A 1YQTA 4EPYA 4TYWA 4A6XA 1A2KC 3U6BA 3CX8A 4XH9B 2JLWA 3DEFA 5EUQB 1U0JA 1OFUX 4US1R 3LBNA 2DY1A 2XZOA 1KI6A 4FCTA 4IEIA 3ZVMA 4BPBA 1NRJB 2HXYA 2BEKA 4NCNA 1KNQA 4NKRA 4R9UC 4JKYA 1GOTA 2BKUA 2C99A 1P4SA 3IBYA 4IW3B 2OXCA 2IEYA 2WWYA 1SQ5A 1JPNA 4AC9A 2LKDA 4M21A 1D2EA 3LH5A 3BBPA 2XGJA 1WGWA 3VNUA 4BRUA 3AF0A 3HYRA 3I8SA 2XOKD 4I81A 3T1VA 2IBMA 4RFVA 2H1LA 2R65A 1NKSA 1VIYA 5AUQA 5SZKB 4F4CA 3BORA 2HEIA 3U2QA 1IM2A 4TMKA 3GEEA 1P60A 5FH9A 3RC3A 4V0KA 2QROA 1DADA 3FVQA 4G5OA 1DO2A 5CJPA 3GLGB 4NH0A 2ZJYA 3OE7A 1N6RA 4D4MA 4QJ5A 3AUYA 1KDRA 1GTVA 1W0KA 1XEWY 4BRWA 1VCMA 1TF5A 1J8MF 1Q3TA 4XVQA 2FG5A 2VEDA 3QPVA 3EPLA 1A4RA 1GSIA 3TUJC 4LYFA 1SGWA 4HSEA 3CW2A 3KJHA 4JJZA 2WZQA 2VF7A 4YMVA 2X77A 2JLVA 4FMCF 3C16C 3VKWA 3AF3A 3FTQA 3KDSE 3EZ6A 1WBDA 1VYVA 3PEVA 2CEAA 3Q5DA 2O8DA 1DAGA 2WMOB 4YDSA 2QM7A 2PCLA 1R8QA 3R9WA 2NPFA 1IHUA 4P3YA 1RW4A 1U98A 2B8WA 2IYQA 1E2IA 3AKDA 1BO6A 1Z0AA 2MMCA 4KLNA 4LOAA 1OV4A 4PSKA 1OH6A 2EFEB 3RSOA 2QPOA 1BIFA 1OLOA 4OK5A 4MRNA 3TW4A 4FMBB 1NY6A 1Z29A 3WXMA 4O2RA 4BLSA 1PLLA 4YONB 2OSBA 1ZU4A 3AF4A 4EQ6A 5IRCD 3IQXA 5DYIA 3X1YA 2J1LA 4NBSA 4LC1A 1COWA 1E2QA 1KK3A 2O8FB 2A5DA 3VX3A 4EDHA 1U9IA 5FUXA 1GRRA 4ACBA 2PEYA 1QVAA 4TZ0A 3SJBA 3K9NA 1P6XA 1ZNXA 4IOJA 4JL8A 2IYRA 1OXSC 3DOFA 4OHXA 4PQYA 2HYIC 1J70A 4RCYA 3MWYW 4Q66C 1JR3E 4DRZA 2IUTA 3QENA 1T6NA 1JNYA 3OAAD 4LHWA 2O5VA 2CHQA 1XF9A 3TSOA 4P4SA 4N1AA 4PSVA 3RABA 3RS7A 3NEJA 2JASA 3NTUA 2FFHA 4JYBA 4K8OA 3U7HB 2YC2C 3EC2A 5FOXA 2PT7A 3HU2A 4F7WA 5EUMA 3BWDD 2ODWA 4M1OA 5JS8A 1YKSA 3BC1A 1CR4A 1XD9A 5B30A 2RGDA 1U94A 1Q1EA 2Z4RA 1Q0UA 1NVVR 1R8SA 1X1RA 4M8NE 1CEEA 4B34A 4HATA 2IWHA 1KAOA 2ZE7A 4OJQA 3EPKA 1IQPA 1KHTA 1E1RD 2WBLC 2QRZA 4R7ZA 1E32A
chains in the Genus database with same CATH superfamily
5ELLA 5TT1A 2QTAA 3M6XA 3D4NA 4WFJA 1F1JA 4C3BA 4RHYA 1AHPA 3HJCA 1JJ7A 1GSOA 3TLEA 2ZE8A 3HN6A 1KI1A 3M4CA 3N86A 3ZWIA 2V7GA 3WWZA 4M8SA 4FKZA 4Q9DA 2ZULA 3K70B 2IYYA 2JFHA 3OOJA 5CEJA 1E99A 3LECA 1KP3A 2CE2X 4HAWA 4F3YA 3ZQKA 4EG0A 1JWBB 4NR0A 2JHFA 4YDQA 3OE5A 4ZT2A 3FKSD 2IXAA 1M6TA 1EB9A 3LRPA 2AF3C 2OHIA 2WFLB 2V0GA 4RTLA 5EWMA 2VJPA 4G0ZA 2NTYC 1M6NA 3F9IA 5CX4A 3T7DA 1WV1A 2ZI4A 3IIJA 1GL7A 1H2XA 3C85A 3UMCA 4ZVQA 5HS6A 4ND2A 1E2XA 2NAPA 4FDTA 1XRMA 5KC8A 2W93A 2HD4A 1O96B 3GGSA 3BRWA 3WICA 5CVVA 2K7FA 3PBKA 2I80A 3BFKA 3PFBA 3B0VC 1DTWA 3LVFO 3CLTC 2VSQA 2ZRPA 5A04A 1T1EA 4YPOA 1GGMA 4CM4B 4FT4A 2AWYA 5CK4A 1FE8A 2RHHA 2PANA 5CNIA 3K31A 3R74A 1BXKA 4XOUA 3CLSC 3VU1A 4B79A 1XNQB 5IM4A 4MGYR 3IH5A 3NUZA 3HI4A 3QHPA 2ORED 4PSCA 2Q1TA 3AI7A 3RFYA 1BX1A 4BO6A 1ABEA 4N40A 1XZNA 3GMSA 1TTTA 3N5KA 1NW8A 4NY1A 2L17A 2BUBA 5CDFE 4X8MA 1GZHB 3A2LA 5JD6A 3F98A 1ST3A 2JHPA 1ZVMA 5JLJA 1JMWA 1JN0A 3OCZA 3HYTA 1UDCA 3A9VA 3HR4A 3N2KB 1IZMA 2REXB 3W9UA 1PFKA 1TK2A 3KNZA 4QU8A 2FDXA 4GG1A 3KKQA 1QLJA 2NT4A 1FPQA 4H1HA 2C0QA 3FDJA 1W19A 3GJTA 4U1RA 5EP2A 1RABA 3CSDA 3MG9A 3VR4A 4PSAA 1EX1A 1HY3A 1X86B 1XPJA 5JAQA 5HIMA 4B83A 4QD3A 4EA9A 3R5XA 3RVRA 1AS0A 5DVZA 1QGZA 1C4WA 4HUQA 4Y0VA 1KF0A 1JB9A 4KFRA 2UVDA 2W70A 2ZIVB 3Q98A 3V55A 2VT3A 1RVDA 3R7AA 3VU9B 1C03A 3KSMA 3ZC4A 1TQ6A 4IUDS 6REQA 4D9JA 4A0GA 2VHXA 2JI8A 1C7RA 1G6HA 1IEXA 3NMIA 4BP9A 3NMJA 1SCQA 1XMVA 4DB2A 3AHIA 5B4TA 4YDHB 4QHYA 4EHIA 2IE8A 4PNHA 2PZFA 4J3NA 4KQGA 3FGNA 3DAFA 2P35A 1DJNA 3KQVA 4HQOA 2BGGA 4IJQA 1THTA 3OOHA 1PEYA 4XGIA 4O2AB 1CERA 1U3FA 5E3HA 2J5BA 4HQFA 2RAFA 3OLZA 5KWJA 3ZZ1A 1E4EA 4TUYB 1VBMA 3EDCA 1EK6A 2O2JA 3RRFA 2CCYA 1IN4A 3BMOB 4YV2A 2P1AA 3SYTA 2V7QD 2C57A 4UEJA 1V8BA 5IG2A 1P7PA 3OKFA 4DBQA 1UMKA 1ZK2A 1CQWA 1W73A 4J3JA 4PAGA 3HYLA 4QOIA 2AQ8A 3PDHA 4GGPA 4O59O 4UOZA 4LBVA 1PDOA 4GDMA 4Y6RA 4GPIB 4NZOA 1C8BA 1JH8A 2CLFB 5TARA 3O3NB 5HP4A 3ROPA 3LCMA 4ER9A 3CZAA 1HMYA 6LDHA 2I6GA 3W5VA 3HHEA 2KE5A 2NNWB 1E8MA 2ZRKA 4GVLA 3I0NA 3T5MA 1X7HA 3GRRA 5LOVA 5A1JA 1F17A 3L7JA 4CETA 4BEMJ 4FGKA 1QV7A 1XN4A 5JV5A 3C3CA 1K4MA 3VTAA 4EZBA 4F6LA 4YP0A 3SXJA 3M15A 3T1TA 3N59A 2WVNA 1GFZA 4CIAA 2XUJA 1VYUA 1BJTA 1RMQA 1NLXA 5C31A 1EUCA 1O6GA 1WUJS 5GVRA 3BRSA 4HGPA 2MSDB 4EGFA 5E1DA 3WLKX 3UT6A 2IOYA 1C1XB 2FW7A 4GI3A 1A9QA 4Q7EA 5LWQA 1YZTA 4DLLA 3THYB 3U37A 1JLMA 2R1TA 3KOWA 3RFFA 2OAP1 1WU7A 2W8BB 4DNXA 4JMLA 1P7ZA 2X0EA 1RKXA 3OG9A 1PBNA 2ZI7A 3EXIA 5H5JA 3ONFA 3T9AA 3BUSA 4UBJA 2GUWA 1OYYA 2O0MA 2P6PA 1DKQA 3GLUA 2XCSB 3REFA 4PC3A 1GVHA 4U2EA 2JIZD 1LS4A 1XEWX 3FDIA 2W4BA 1GLVA 2A4MA 1PZGA 1SXJB 2Y27A 5ARDA 1B73A 5CVTA 5C9ZA 5JC1A 4EEZA 2KJQA 3GLHB 4NYJQ 3E9CA 4LTNA 3KZ1E 1UEIA 2Q4TA 1YT5A 2IXFA 5FUVA 4M1ZA 4LBYA 2JD0A 2OM2A 4IJKA 5F4BA 3H9JA 4ZFNA 2IXDA 1W5AA 1MA0A 4HGOA 5L45A 2BEUA 1C7QA 4AVYA 3Q15C 1X1SA 3O73A 1L8OA 3HJAA 3CLUC 1PQUA 3DCYA 5DX1A 1U0RA 1YOVB 4E32A 2VYFA 3TS1A 4C7KA 2VZ0A 3VR5A 2WU4A 1MC5A 4B3MB 4DW8A 5CFOA 2QE6A 3DXJF 2IXGA 4RVGA 3GGDA 3TZHA 1OWLA 3ELDA 4PRYA 4KNWA 1LLDA 4RD6A 2A9OA 1ELOA 4FFNA 2GNAA 1UCFA 2XLBA 1U2PA 2P11A 2NNLD 1KEVA 1L3CA 3RGWS 4ITVA 2QJTA 3GJXC 1CC1S 2OCPA 4LZZA 3PNLA 2W2PA 3C5CA 3DZIA 4GR9A 1JU4A 2ZVDA 3FUVA 4R1TA 2R02A 5JVDF 4IO1A 5LB4A 5ICFA 2C2GA 2DQ4A 1Z0SA 4CV1A 3EISA 1A04A 1QYVA 5AJHA 3OJ0A 3DUFA 3QLTA 1FS5A 3I9OA 4O8ZA 1I3NA 1V2HE 3PSHA 4MULA 2HKVA 1FFHA 3B1WA 3TRFA 5JPCA 2BPOA 5F35A 1NSFA 3CB2A 4N4WA 1C2TA 3CV3A 3U7QB 4HKTA 4U9IS 2Q3MA 3HNOA 1H0SA 1K86A 2OBBA 5EZYA 1LVUA 3MJSA 4M9ZA 1LU9A 1JR6A 4G9GA 5I9BA 3ASNC 4JDUA 3Q10A 2D7CA 3W3AH 3QTBA 4ZCTA 4ZCPA 1PGNA 1USGA 5J4HA 1FUUA 4KVGA 4UJ3A 4YT8A 2PKQP 1I4ZA 4HTAA 4PGHA 1OREA 2ZWOA 1YBMA 4NMMA 2YZ2A 3NBXX 4O2BB 1N2CB 4B1FA 1AHHA 5F98A 1OVMA 1U9CA 1PR4A 4PQFA 3S1SA 5IDWA 5K3AA 3U3BA 1JG1A 4YT4A 5D2CA 2C3YA 1Z7BA 1T2DA 2RJ3A 5FA5A 3WK4A 2EDAA 4PTLA 4EHFA 5EJAA 1O9HA 2JJQA 4IJMA 3ICEA 1KVUA 3BHJA 1U2RA 3K4QA 1B14A 4DLNA 4INJA 1E4OA 3ROEA 1X8KA 2B4YA 1EWYA 4XB1A 5FBWB 3BREA 4P08A 4EKYA 5KPDA 2JIMA 3IQWA 3EXHB 5LCXA 3KOXA 2XCRB 4G6ZA 5E6UB 4RV5A 1ADCA 4JLJA 4QLOA 4L08A 3F1LA 4G5YA 2K2WA 3W4KA 1ZBDA 1M6VA 3MYRA 4B87A 3EWSA 1JKJB 2CD9A 4BNDB 3JPWA 4TT8A 5JD4A 1JWLA 2R03A 1NNEA 5AUPB 1I4LD 3OJEA 4PEVA 4HWPA 5KTOA 1BSVA 2C2KA 2REQA 3TRIA 4POOA 4MQUA 4G0HA 4OHKA 3RQSA 4WGYA 1YQWA 4A2CA 3PHLA 4CKEA 3W9YA 4FYIA 4EYKA 1EX6A 4X0RA 4NPAA 3T7IA 1O54A 5E3CA 4ULVA 2G06A 3BRJA 2OUIA 3D7KA 3VHRA 3HV0A 3HLYA 3PQ2A 3LMKA 3VOAA 4LMBA 4QDKA 1DFHA 5JXGA 4EGJA 4F12A 3L7MA 5AW7A 3H2IA 5T3UA 2V7WA 1HE2A 2FEXA 2FMFA 3N8KA 3V80A 2MR6A 4DYVA 5GINE 3QFFA 3F78A 3JYNA 4OI0A 4R0NA 2IV7A 1HUQA 1F8GA 5JSKA 2B6HA 3UKDA 3LLKA 2D4AA 4M7RA 2INGX 2VSFA 1C5KA 4QAQA 3ANYB 4FOOA 4MHTA 2R85A 2BBOA 4GQAA 1Y4CA 4CM3A 3QQ5A 1NX9A 1CZLA 4KPFC 4JTAB 2R6JA 2KSFA 4PR3A 2XLEA 3OPXA 2FQQA 4Q12A 1JR3D 1E5LA 3U5SA 3AW9A 4P4NA 5J4VA 3H86A 1M2VA 2YV5A 4DSOA 3PA8A 3OEEA 4KAXA 3N7TA 1FNBA 4D5EA 1U1DA 3ZIAA 3Q3EA 5E1OA 1CUSA 1V35A 3C1UA 1CDZA 3A6EA 5GM2A 4MROA 3KOYA 2WHQA 5ENDA 4FDLA 4WLVA 3IUPA 2EJVA 5DU2A 1JRLA 2XLOA 1KFKB 1LA2A 4JUDX 3AJAA 3GLFB 1IXYA 4AJKA 2C77A 4JLBA 4O4JB 1YLMA 1P7VA 3IALA 1VDMA 1XDGA 2CDAA 4Q05A 3NU1A 1OAAA 2ZE6A 2TRSB 3HLKA 2A5JA 5IXYA 1WU8A 2GPSA 3PT9A 3BEHA 3WDSA 4TWIA 2BWJA 3KJZA 4W9NA 1TC2A 1BA3A 4TTAA 3NKEA 2ZUBA 2XEDA 4EFNA 2HLDD 5B58T 3N7AA 1UP7A 1AE1A 2C00A 3OZFA 1HURA 3HR8A 5C5IA 4MYTA 2DSTA 4L8WB 1BDMA 3WADA 3VQTA 1PFQA 3LFUA 3U4QA 4KIGA 3T99A 2R6DA 5HIAA 3LX8A 1J0DA 2Q5IA 3TB6A 4H08A 1TM3E 2C42A 2R8OA 3P52A 5FWDA 1H85A 1K88A 5CM8B 1A5AB 4ZI7A 2LTAA 4GPBA 1N2XA 2BC9A 2I8AA 5KTRA 1RCPA 4IZ6A 1JEQA 3RRMA 1RE0A 2I1QA 4YXWD 3EJNA 2X9GA 1WB6A 4LPKA 1GQ2A 5EYPA 3SVLA 4YQFA 1WTYA 1ECCA 3Q85A 3LSTA 3HE3A 1C50A 1FX0A 3MGCA 2YWFA 1SUDA 3NEYA 4WZBB 1UKVY 1V45E 3IIKA 3PRKE 4KPUA 4CT5A 3H5OA 1EVZA 1XPUA 4KH1A 2QRPA 2FOLA 2FLKA 4JB2A 5G1NA 4BKQA 2YHIA 4FZVA 1FCJA 1TMKA 2XUOA 4DRXB 4YI3A 2GEUA 1IEVA 5A71A 1QNLA 4QPJC 1JV2B 1HX7A 2DLCX 2P6UA 4CM9D 2WVOA 4UAJA 4BO8A 4RMHA 3ESAA 2ZB3A 2COEA 1LBEA 4ZZ2A 3WHKA 4R2LA 2Z2ZA 2IYNA 1Q7BA 5D3MA 1D4ZA 3F96A 5FHQA 3EIFA 4AICA 2NUBA 1UJ5A 2E87A 4DIFA 3IDZA 3ME5A 4BO4A 1CR0A 3PC4A 1XCJA 2B2XA 5JS7A 4IXNA 3C6MA 3HO8A 1LQ2A 4QWWA 2WJWA 2YYSA 3PRJA 3F71A 1K66A 2PRSA 2I15A 1QGOA 2M6KA 1DQNA 4OA8A 5EHZA 4RK4A 5KS2A 3PC8C 3J06A 2R1VB 1RXQA 3I2YX 4B81A 4E7OA 1Q17A 3JQ8A 4XX0B 2WIAA 4ASUA 3PJRA 3WHNA 3PDUA 5BPFA 2AG0A 4OBEA 2P2DA 4QARA 2AJBA 3ZUGA 3TW8A 4J9VA 4HAVA 3PXDA 3BG5A 3ZWVA 4FBLA 2W6OA 2B1QA 1BR4A 2IV3A 1NV9A 4BV3A 2AW3A 2QA5A 1RTKA 4WBNA 1E2JA 3HWX1 4XGNA 2RD9A 2R1UA 1E6MA 5JO9A 1KAMA 3VZSA 4BMDA 1TMGE 2XZPA 1LC0A 1OX4B 3V4LA 1FYFA 3KD3A 4MTCA 4HZUB 2WZGA 5AHKA 1ZK4A 3WLRA 2JJ1D 3IKJA 1MEJA 4HXGA 2OGUA 3ZDXB 3GA5A 2GYVA 4JBIA 1CPQA 2IQ5A 3TLMA 3IOMA 2VWPA 2ZRLA 3INNA 1N2SA 1HE1C 3RTAA 2WA2A 4RELA 2CMHA 3FM9A 4IV0A 2IYSA 1L7PA 1IBCA 5ALEA 4EY8A 3F47A 4U5DE 4OSEA 5BWMA 3QELA 2EGUA 1MT0A 3RIXA 3ZHXA 2I33A 1N1DA 3R5FA 4IUBS 1V11A 4B3DA 1WTAA 2Y0CA 4ENQA 3QF7A 2FA9A 3SICE 1G8JA 1TQDA 4IKPA 2ODQA 4IMJB 3DOOA 4NATA 1C0KA 5JOQA 3R7NA 2HJMA 4AMUA 3DGEC 4N7MA 3H18A 1H6CA 4KXNA 4YO7A 3E8SA 3CXUA 2FZCA 3MW8A 3OZUA 4RO0A 4RIIA 3FMGA 5FORA 4FFLA 4RKEA 1AF7A 2H1SA 1A8SA 3QK7A 4BNJA 1M54A 2WWFA 3H2GA 2HHAA 4QEZA 1X80B 3UJBA 1R10A 2Q5FA 3GFGA 4C6SA 4HDSB 4JENA 5DYYA 1F0YA 3MTJA 2JFPA 4BVKA 2OMKA 3THXB 5LQJA 4CKWB 1PO7A 3BSSA 5I8WA 5DTEA 2AOUA 5KVQA 2O50A 2I3ZA 2BBSA 4S2EA 4ZGBA 4Y98A 4YPVA 3WDLA 2BZSA 2C96A 2NZ2A 3E84A 3COJA 2BFAA 2FB9A 1G2QA 4UTOA 3Q7SA 2XMPA 1JSCA 4NCNA 2WKWA 4JKYA 3IRUA 2QM0A 4YUAA 2R751 1ZK1A 3P9RA 1KPIA 1LDEA 1YKGA 2WF8A 3L34A 5AUQA 5SZKB 4PY2A 3UICA 4EI8A 2Y1FA 2WHYA 2OJED 2QVLA 1R0BA 4QJ5A 2R7NA 4GU5A 1J8MF 4XM2A 2BDEA 1AQ6A 1JZQA 1EUDB 1FS6A 1Q0HA 3TGWA 2WZLA 1H94A 3U9TA 3AF5A 4JI7B 4MW9A 1Q7EA 1X1QA 3ZXSA 3DLIA 3EJ6A 4TM7A 1F6WA 1WM1A 4EQ6A 1ZPDA 2OBYA 2EFYA 1HLDA 3G5AA 1AVTA 4GM1A 4J6EA 1G59A 3K6RA 4UDXX 1X7ZB 5FP0A 3TIXB 3J80A 3MWYW 1H3FA 5C8DA 3CZ5A 2O5VA 5FWNA 1XF9A 4DGQA 4KXUA 3IE1A 5IJXA 2ODWA 4RJJA 4Q5SF 1U94A 3TMAA 1QFZA 1Q1EA 3C1TA 1FVHA 5EKDA 2W2OA 2Z30A 3CEAA 2WTMA 4LECA 2X0CA 2VLBA 3O7MA 5DM60 2DQSA 5DDIP 1F3LA 2GN6A 1ISGA 2QG4A 4HAIA 1ZCAA 2WIBA 5EP3A 3ZXYA 3ED1A 4HRYA 3GLIB 1HKHA 3RUIA 2GO1A 2O2CA 3OT1A 1KZGB 4IHQA 3STTA 1DCMA 4K6GA 1SPBS 1QHYA 4ZCLA 4RKWA 7REQA 3S90A 4BVAA 5IH3A 3R7BA 3NBZC 2X51A 3SJAA 5HFAA 3S2YA 4NOMA 1PJ4A 4ZA2A 3HA5A 2JHAA 3D3WA 2I6FA 4WZZA 1DBSA 4OXIA 1Y8QA 4LF5B 1F9AA 3HVKA 4BNNA 4AB1A 3ZDQA 2AX4A 4WESB 1S3SA 3Q0TA 4DDTA 2AYYA 1VPEA 1SEPA 5TJHA 4I8DA 3HADA 3C41J 5KYGA 1EIZA 3EBPA 4NBWA 1Y7PA 1SQFA 3RYHB 1SXHA 1GFWA 3TTWA 4PLFA 5NLLA 4IGIA 3RS4A 3SXYA 2CFCA 4QUKA 4D4NA 2VR1A 3L8DA 3W8EA 5SZJA 2FSGA 3ZH2A 1Y80A 4TWJA 5EP4A 4EM6A 1WDMA 1OC4A 3JQGB 4A6PA 5LA6F 3CVXA 2C3PA 4Q4AB 1KK0A 4B7AA 4WCFC 2VP3A 1E3SA 2IYAA 2V7VA 1B6SA 4PLHA 1I6KA 1PJTA 4J07A 3UC5A 1WMFA 2CXXA 5F9MA 1ORJA 4L8YA 3DVSX 3QMKA 4DR7B 3AEZA 4AU1A 2UXCB 2WKPA 5A4IS 1U0LA 3HBMA 3WK6A 5CDFA 1YVDA 4ENPA 3OURA 2DPXA 1KVRA 3OPNA 1TR2A 1VIVA 3RO7A 2ZB2A 1JHQA 2QMUA 3WMEA 1YU6A 3QLUA 3L6DA 1A7VA 1QX3A 4JBNA 1V6CA 4FCCA 4KAJA 3S7ZA 4EECA 3CCFA 4L9AA 4W82A 5L53A 1CUEA 5FV7A 3WK7A 2JCBA 2A14A 1DELA 2BMWA 4RHCA 4U8HA 1Z2EA 4TQUS 4EJSA 1WCIB 1KC1A 2GK6A 1MAUA 2XTNA 1Z6ZA 2P7IA 3R3WA 4OUKX 1O6BA 2ACVA 1M3SA 2CHFA 1YZUA 2C83A 4CE6A 2A7QA 2XE7A 3GPBA 4ZVVA 3L4BC 2HUNA 4L8VA 2OCGA 2QS9A 4GOKA 3CSKA 4LZPA 5KQMA 2AZTA 4IV5A 1KU6A 2BH2A 3IUQA 3USES 3FPHA 4RLQA 3TAXA 4DTCA 3O47A 4HSGA 1KYIA 4X7RA 3HUDA 4ZOAA 5LP6B 3SI7A 1BWPA 1PT8A 4P5PA 2P4QA 5T3WA 1XQ1A 1KIFA 4LSGA 3IJPA 3LVBA 2PYZA 4NV0A 4PYRA 2BHRA 2C1ZA 2P9TA 1AXEA 3QA9A 1AF4A 1O9BA 4Y1FA 5JXHA 1ZGGA 3F46A 1ULHA 1C7ZA 4YAIA 2VHVA 1KZ4A 1XVVA 2FPRA 2F2TA 1RXWA 1J20A 5G53C 1RNLA 5BR8B 5DX8A 2ZJ4A 3OHMA 4P36A 3FLBA 1Y3AA 4FXOA 3GIDA 3ENVA 3LS2A 4U9UA 4MARA 1YVPA 4QUIA 5AKZA 2GXQA 4EL0A 2MYNA 4WDRA 4JCOA 4MUGA 3SHFA 4JTDB 3MXOA 2VJNA 4P92A 3HKCB 5A2GA 3SIRA 4LRSB 5EIHA 1T9BA 5TIIA 5DI3A 3EJWA 4WK4B 4DCTA 2HU8A 1T4CA 3K9FC 1XZ8A 1PVVA 5C35A 2WUDA 4Z1OA 2IF0A 1U4SA 5E6SB 2OOCA 1HLGA 1DVRA 2AK2A 2V7EA 1Z0ZA 2I1LA 3HJRA 4MDHA 1ZOOA 4RK7A 1HY5A 4M0KA 3HBJA 1I1NA 4AUEA 3WLLA 2JFNA 3ANTA 2IPOA 4Q4JB 2CD7A 2PF4E 3GUZA 3RYLA 3EIQA 4BLRA 4TVSA 2PM8A 1UQRA 4OYLA 3PT5A 2SKCA 2JBHA 1U8FO 3LQ4A 3WK9A 1G0OA 4IMIB 1I10A 4NLLA 3DTNA 2Q3EA 4JC8A 3EGOA 4D0LB 4JDPA 4UFPA 2DI3A 1E3DA 1JKFA 3AHHA 4L7VA 1HE9A 3O2QB 3L6EA 4UQPA 3JASA 1S02A 5IABA 4GH5A 3TCXB 4Z2AA 1XLUA 1TDJA 2XTJA 3UG6A 3WS7A 1HE3A 2DWPA 4QO8A 5CBKA 4H7JA 2A0XA 1MAHA 2IUEA 2FPUA 3H0EA 3GX1A 2OK8A 4ZZ3A 1F6DA 1JTFA 1UOPA 1G60A 4HI0E 2TMKA 4K9OA 3H1BA 9GPBA 3IOCA 1XAJA 4MKHA 3UJAA 3NIWA 2J08A 3T35A 1OBVA 1A8UA 4F3RA 5B7PA 4PFJA 4PR0A 4AJ4A 4Q4DA 4GM0A 1JYSA 3N8GA 2ZVQX 1N7IA 3KOZA 4CZ2A 3E1SA 1SC6A 4K1OA 3NKLA 1TM7E 2ZR8A 2PLRA 1U1IA 2WUVA 2ZIAA 1B8PA 2HWUA 1BXRB 5AK3A 2O8BB 5KSPA 2NYVA 3C7KA 4O2LA 3U5ZB 1XB2A 1JMVA 1YHZA 3NV9A 4X6YA 3FF1A 1KNYA 3CCBA 4CKCB 3O7WA 5LQNA 2IS2A 3L0IB 1VE5A 1IQ0A 4M37A 4ISBA 1LE4A 2Z2IA 4LI0A 1L8AA 1Y5NA 4PO1A 1PT7A 2VPPA 2JI9A 4M0FA 2D5LA 1S8NA 5FT9A 3G1UA 2C7QA 1CZOA 3UFXA 2RD2A 2Q62A 1YHYA 1KE1A 3X1KA 1YKFA 5LQRA 2PWYA 4UU0A 1IEQA 3W8IA 4FFMA 2ZB7A 3RSCA 1ZVQA 2WIKA 3GP8A 4LFAB 3WIUA 4KP7A 3VPAA 5KJCA 4IRXA 2PUTA 1BHSA 3NO4A 1YDFA 4UZEA 4WBXC 3G2LA 4UULA 1ICEA 4KGVA 3K6JA 1TTPB 3VRHA 4RIHA 1ZM4A 1ZYUA 3FJ1A 2EZ8A 2G0TA 3FDZA 4MVJM 4JY7A 1CX9B 2H4WA 4ON9A 2B2NA 1UZAA 1F8UA 2O3QA 4WMLA 1BJKA 1DS6A 2IOHA 3H8SA 3U9MA 1M83A 3R2JA 1C17M 1BJRE 1GA4A 1MO4A 4OBWA 5ARCA 4N0DA 1L3PA 1MPTA 5SICE 5JZMA 2XUKA 5JG7A 2W6JD 4R32A 1N5IA 1EUYA 5CW2A 3FHTA 5E9JA 2AFVA 1DAOA 1G8KA 3S70A 5DPMA 3PEFA 4MIOA 4BNZA 2A2ZA 3PV0A 1OWNA 3RRNA 1TYAE 4PJJA 2IXMA 2Y1DA 3GOHA 5TLSA 5A2QA 3NTXA 4KYVA 2Q9CA 4V3CA 4F2HA 1JWAB 3KPVA 4L2IB 4BN5A 3ICOA 4NPHA 1EQ1A 1NFFA 2X0JA 2XJ9A 1IWPB 2VDLB 3CVYA 2YWDA 1QYRA 5JSYA 1RT9A 4HQLA 4Z2YA 1YJAA 4FDMA 1FK8A 1PX0A 1W52X 1UZUA 1Z6AA 3NP9A 3ZJ5A 1E2EA 3CRZA 1G8FA 2FFRA 2J87A 3DMPA 4IR7A 2WIFA 4UCXA 4BZXA 3R7SA 4PO9A 1VJ5A 4GOMD 5BNZA 2GYUA 3P1JA 4CW7A 3IERA 2F4NA 2PAAA 8MHTA 3IHTA 2WSSA 5DQZA 3TNDA 2JAQA 1E2KA 1N5DA 3UAWA 3HNLA 2B94A 5LBIA 3N76A 5TMEA 3V8RA 3NHBA 4GQBA 1JH9A 3F7TA 3ZHSA 2RBKA 1JQBA 1OC2A 1R27A 1JHMA 2ECOA 1XYYA 1L3IA 1CTQA 2V1XA 1RXVA 4X1YA 1QSGA 4L8LA 1REQA 3UB3A 1Y37A 3U1BA 3GT4A 5JASA 1RJEA 2ZQZA 1O6ZA 2I8LA 2WP0A 4MGHA 5SV2A 2FR8A 3NVMB 3MWDA 2JDIA 2JFQA 1WW3A 4RLHA 1HFEL 5F7ZA 2A68F 3EQ9A 3FN4A 4XEKA 3NB0A 1FYDA 1ZUNA 2VHTA 3P9QA 1HSOA 4MV5A 1KO7A 2BM1A 5JATA 4WZAE 4KN9S 2C7VA 1OR2A 1UK9A 1D1SA 3LQYA 5K0IA 1XNGA 4IZIA 1J2UA 5TJ5E 2LVBA 3SBOA 1HNWB 1JPJA 4NCBA 4LXXA 3PIRA 5FAKA 2F3TA 2Q46A 1FRQA 4ZPJA 5COMA 4IB4A 3K0FA 3FR8A 1ONBA 1DQSA 4JJ7A 4V0RA 5BN1A 1IN7A 1E9BA 4KQWA 4IGGA 2R25B 2XMGA 3L1UA 4FWVA 4EBKA 4TMTA 1UFQA 4LYGA 4FINA 4P4SB 1M5UA 2DR3A 2EF0A 2JATA 3R7CA 5K0ZA 3GNLA 3GF4A 1L4UA 3GRKA 3SX0A 2QT0A 2C5BA 2ID8A 3RT1A 1VYKA 4EHPA 1Z5WA 4GYWA 1RQ7A 3E03A 4O8CA 3OCYA 1K75A 1XAIA 2NWQA 2NTEA 2V6IA 4ICIA 3KKZA 2DCUA 5L3RA 4ZO7A 3AYXB 2CK3A 2ETSA 3KYBA 4CIWA 1GL3A 2WWTA 4FNMA 5KYYB 3K20A 3Q2IA 2JIQA 1FTQA 1JU3A 2R7MA 3INGA 2EBUA 3PNSA 5JFOA 1D8TA 3OZAA 4AL0A 1DKUA 1OBCA 1T1IA 1MRNA 4CQMB 3OA2A 3V4ZA 2X8JB 3HU3A 3K1JA 4RF5A 3TBHA 1YL6A 1S9DA 4ZO4A 3CVWA 3O93A 2I6TA 3P2KA 4EF5A 5CJ2A 1FSGA 4G9EA 3A58B 3FDXA 4YEDA 1Y63A 2O0JA 3ZWNA 4AI6A 2QXUA 3UAGA 4LVNA 4O1IA 5EXXA 4MO9A 2AR0A 2RH5A 1JIXA 5HKKD 1P2UA 3EF0A 3TOCA 3BOSA 1GCGA 4GT1A 1QKJA 2R8YA 5C8YF 3ECSA 4B7UA 1GNQA 2OAQ1 3JPYA 1KJZA 2I3BA 4G0UA 4BMNA 5F12A 3A1TA 4AKHA 5DGHA 1GZUA 1JHPA 4ERNA 4Q9NA 3S9OA 2X0DA 4WN3A 3OESA 1N2BA 2M98A 5HHTA 3FAZA 4ZT5A 3AUUA 4IGKA 4AX8A 2BUCA 3O55A 4PZ0A 4B6EA 5KHLB 1KKLA 1R9GA 3U4AA 3C48A 2G36A 1TQ8A 3BEDA 1YZQA 5EFOA 3TTVA 4JBWA 3DMYA 2WAYA 2CBXA 2QBYA 2R96A 2UUHA 4TTTS 3IQEA 3LY8A 5IJ9B 4PZCA 3R76A 1R9MA 3B85A 4CMIB 1G9XA 2H9YA 4XE5A 2CJWA 3GRUA 3I01A 4IOMA 1F06A 3PDIA 3OSZA 1GKIA 1HNNA 2BGNA 5KJEA 2A9RA 5KNCD 1FFAA 1O9GA 3IPYA 4B2YA 2UYHA 3GPDG 5AJWA 4CGYA 1LDBA 2IEZA 2P4SA 4EI7A 3TTTA 5E9WA 5EQDA 3G1WA 3NHFA 1AT1A 1EQAA 2BGJA 5K4AA 3NH6A 1T10A 1A4UA 3Q3GE 3UW1A 3V4VB 4K26A 4YRGA 3B1XA 2HJSA 4WNAB 2QSUA 4D26A 1W1UA 3W5DA 3ND8A 4DVGA 1VHLA 1JMKC 4ZZ0A 1PJSA 1G2PA 3GDGA 2EWWA 4R1QA 3K35A 2WYHA 1DNPA 3MJRA 2XUIA 4TL9A 2IU0A 1ZJYA 5JTTA 1G41A 3NXKA 3U8PA 3KQYA 3U39A 1W75A 5BV0A 2YJTD 4E07A 5ELXA 3I6IA 4C0BA 4YPFA 4IEFB 1HMPA 1YMQA 2WT9A 3BKWA 3T9EA 4L78A 1BYUA 1X42A 3PNKA 4CIXA 3EIXA 5JNVA 3DTVA 3UAYA 3FSRA 3D2BA 1QBGA 2Q1SA 1SZPA 2QK4A 1U8EA 2G7MC 5JJBA 1DT5A 2H7CA 3FTEA 1UIRA 1HT1E 5CX1A 1W36B 1TUGA 1XSEA 1C3OB 5TF0A 1KO1A 3PX3A 4RIEA 1X8LA 1J97A 4U5XA 4WD3A 2PMKA 5A3JA 4MV0A 2DKOA 3NPMA 3PC3A 3OKPA 4U9EA 1O97D 4Y2JA 3AEKB 3PEWA 1V6AA 3PNOA 1MQAA 1ZWLA 3Q5EA 5BR7A 3ZUPA 1EDOA 2W2XA 1QVVA 5CFLA 2ZI6A 1C1HA 3LFTA 5IUJC 1X14A 2BTQA 4I5FA 5T64A 3T6KA 3EARA 3IEEA 2FZ5A 3A9WA 4H3HB 1TU4A 3H17A 2ETXA 2Z5FA 1Q57A 4CUZA 1PLKA 1T9AA 1P1IA 1BWRA 3WP1B 4MVXA 5J5AA 1UMDA 4HNAB 1DAFA 4JL6A 1WABA 3HO6A 2QRVA 1KU0A 2IY7A 1ZS9A 4DQUA 3V1LA 4BNFA 3C24A 4WZ6A 4FQ7A 3ZHVA 3H05A 3ADDA 3TEFA 1HOTA 3MWKA 4TWAA 3B6JA 4W9MC 5L0CA 1C2YA 1OW3B 2JH3A 1FNMA 1VKZA 4V24A 2P0NA 4TLMB 4RQUA 4Q16A 4Z9HA 3SZRA 4KIUA 2JKVA 5EKTA 1W87A 4AKGA 2E55A 2GCGA 1YJCA 3M9LA 1FFXA 4YP7A 2I87A 1S2IA 4ZLDA 4I3GA 1COZA 3NHWA 4KDEA 3O26A 4NYMR 1ZBQA 2AUTA 2YL2A 1W47A 1JIJA 3TPFA 2PZLA 4I1UA 3NCTA 4GGMX 3KEMA 2IE0A 4TROA 4LQLA 3GBPA 4PRLA 2P30A 1Y1PA 3OIUA 2RONA 1OVGA 4JUBA 2IPMA 4LWOA 3LZDA 1FSSA 4XH9B 1WP4A 3DEFA 5BT9A 5T8KC 1KIAA 3UYKA 2BEKA 1UM9B 4YIHA 2LCHA 1B6GA 3FZNA 2OOKA 3PQ5A 2BTEA 3PDMP 3D5TA 1XWJA 4EKWA 1AZWA 4FE4A 2XOKD 4MWEA 4RFVA 2IH5A 5BSGA 3UOGA 4BKRA 5FH9A 4J2TA 3OMXA 4PLYA 4NH0A 4U5BE 2IOQA 2OHXA 1I4WA 1VCMA 2GPAA 4K9NA 3CG0A 4MVWA 2PUEA 2G70A 3VKWA 3JSZA 3AF3A 3SCZA 3EZ6A 5J1TB 4DABA 3ZIDA 1CUVA 1NW6A 5D92A 2XW6A 2YIVX 1IN1A 3BWBA 1OLOA 3AOEA 3HJUA 4O2RA 5K45A 4TXLA 5HKBA 2O05A 5AC4A 3OKAA 2I66A 1PT6A 1I5EA 3D3JA 3E35A 5CFPA 4RANA 2WSIA 4W99A 4DWVA 4Z9FA 2J3QA 4BYMA 1T6UA 1L7CA 4PYLA 1JNYA 2QXTA 3MINB 1Q92A 4PZUA 5BVGB 1CR4A 2FPPA 2FWBA 4N9WA 3M7IA 2LV8A 2KYHA 3MD9A 2C88A 3V7FA 3A6FA 3LE8A 5JH7A 1VBNA 2ENWA 5CG2A 1C7IA 3P9PA 3FNIA 1TCVA 4BZWA 3AFIA 1Z35A 3RRXA 2AEMA 3CMCO 5BQ3A 4FMDB 4O33A 3SHQA 5ICGA 4IFBA 4R1UA 3MS2A 2IOFA 3C74A 3PP8A 3ZCQA 3OCUA 5IBCA 4UE2A 2PT9A 4KE8A 4GX1A 2BCJQ 4WNIA 4MR9A 2PT6A 1A71A 4V2UA 1AG9A 5JADA 1WPRA 1AN0A 3GZNB 4QBGB 3FOAA 4HY3A 1C02A 5CH3A 5LWHA 2ZS7A 1U8AA 1VE7A 4EY3A 1I0ZA 1KYTA 4BKMA 1BMQA 4RENA 4I7EA 2M6LA 1RQXA 2GNOA 1ATIA 3S3TA 2G6TA 4DMRA 3C1AA 1ISIA 3TFQA 4YYEA 1KZ1A 3SR0A 4GZ3A 1RIIA 2FPSA 3V4FA 3GRYA 3T3PB 5FTKA 4ZU3A 3U49A 3U4MA 4EAQA 3B78A 1J9GA 2EKPA 2FE1A 1VLZA 3R24A 4DA6A 2Y3BA 4RTMA 1VDZA 3T7CA 3R7WB 4CTOA 2H5IA 5H7XA 2RGWA 2A9PA 1Q12A 3LUFA 1FJHA 3OAAA 5BYKA 1J5XA 1FP6A 5FLYA 4EX7A 4JTCB 3PB3A 2OCCC 3CRQA 1KRWA 4KGXA 4A0SA 1XMPA 3MB8A 3N6VA 1E1RA 1NL3A 1ZN9A 4L4XA 4CWAA 1ZW3A 3ROFA 2WUFA 2GM9A 3C14C 1II0A 1C7EA 4QEKA 5A4AA 1YBAA 3KTAA 1M1YE 2NGRA 1OW8A 4QGAA 1PDVA 1ZICA 1CJCA 2E85A 2GEDA 4BLUA 4N8DA 2AV6A 3AIOA 1RWWA 1OXVA 4Z4IA 1EU1A 4M54A 2AJCA 2DVMA 2BGMA 4IIJF 3SQWA 1WULS 4JLSA 1M7BA 2FQXA 2C4VA 5BN3B 2CV2A 3VKVA 2JGFA 2ODBA 2QYHA 2G5GX 1Q21A 2PL9A 4HN4B 4F4IA 5C51B 1CWUA 2CXPA 3DHNA 1U9YA 1DAHA 4H54A 2BFEA 3VPXA 1TNDA 3IDFA 1F9EA 5CM9C 2QIOA 3IBCA 3MQFA 3FPLA 4MYSA 2AOXA 1TEXA 4L1KA 1G6Q1 3UWSA 2OV4A 1KYXA 5CB0A 3STUA 4FHCA 1HDCA 3UXEA 3OEOA 2NPOA 3TLCA 1P2SA 1T3TA 5IHPA 1GKYA 3M3PA 4RETA 3NT2A 5KYUB 3MWEA 1EFDN 1V71A 4QRHA 3W90A 3GIWA 3A3PA 4F1WA 1E2PA 4YT5A 3DR5A 4YFVA 1JI3A 4W9RA 3QLVC 3JQFC 3DDCA 3P4UA 1PHRA 4YMHA 4RF3A 5DXFA 3GV0A 4ZAVA 1JDSA 3ZKWB 2O9XA 5BQIA 3T4XA 4PRZA 2V7UA 1K92A