1OKKD

Homo-heterodimeric complex of the srp gtpases
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
283
structure length
265
Chain Sequence
AIPWGGNLEEVLEELEMALLAADVGLSATEEILQEVRASGRKDLKEAVKEKLVGMLEPPVEPKGRVVLVVGVNGVGKTTTIAKLGRYYQNLGKKVMFCAGDTFRAAGGTQLSEWGKRLSIPVIQGPEGTDPAALAYDAVQAMKARGYDLLFVDTAGRLHTKHNLMEELKKVKRAIAKADPEEPKEVWLVLDAVTGQNGLEQAKKFHEAVGLTGVIVTKLDGTAKGGVLIPIVRTLKVPIKFVGVGEGPDDLQPFDPEAFVEALLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SIGNAL RECOGNITION PARTICLE PROTEIN
publication title Heterodimeric Gtpase Core of the Srp Targeting Complex
pubmed doi rcsb
source organism Thermus aquaticus
molecule tags Cell cycle
total genus 94
structure length 265
sequence length 283
ec nomenclature
pdb deposition date 2003-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00448 SRP54 SRP54-type protein, GTPase domain
D PF02881 SRP54_N SRP54-type protein, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 1okkD01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1okkD02
4UXHA 2QTFA 4OI2A 4UXIA 3DVLA 2ZRMA 3B1YA 4UJ3A 3ZS8A 3AQ4A 3LD9A 5FL3A 1H8HD 1LF0A 1KDPA 3KX2A 2R6GA 4MKHA 2QGNA 3QF7A 3PITA 3FKQA 1IXSB 1WDTA 1Z6AA 3H0KA 4M2LA 5DE3A 4W5WA 2VIIA 3UXMA 1E2NA 1YVDA 2RGDA 5EXPA 5L3SA 2AN9A 3OFND 1SVSA 2W58A 2WOOA 5DISB 3PUVA 1ZM7A 4I81A 1ANKA 2JJ1A 2PLFA 5SZKB 1DG1G 4DSTA 3WBJA 2IYRA 2GDJA 1XCMA 2J9RA 2Q9BA 1JEEA 4JL6A 1VG8A 2R6FA 5HZHA 2QBYA 1COWD 1N6HA 1M6NA 3C5HA 1XCPA 1KI1A 4Q9KA 2F9MA 3IQXA 2J7PD 4AYWA 3HP1A 4PSVA 1KMHA 2FFQA 3R7WB 2QMUA 2QROA 3WP0A 1XTQA 1F6BA 3V9PA 4C0HA 1OFTA 2CHQA 3KKOA 1GITA 4Q4HA 4GI7A 2Q0HA 5DIFA 2V7QA 2DHRA 1YR7A 4PHGA 3KKMA 2VSXA 4OHVA 3K70D 1Z3IX 1GP2A 3HR7A 2F1HA 2VP0A 4IFBA 2WVJA 4E22A 1AK2A 2HYDA 4QGAA 3IUYA 2V6JA 1G20E 4C2UA 4B3CA 1EX7A 3KKQA 3P4XA 4NCKA 4KSCA 1QHIA 4AY2A 4KU4A 4MYTA 3LH5A 2IS4A 3GJ0A 1FX0A 3QG5A 3SNHA 4TL9A 1S2MA 3SR0A 1XXHE 1LF5A 1OKKA 2HJVA 4Q7KA 3FPAA 1IY2A 1D2NA 5JJLA 3A4LA 3CF0A 4TYNA 5FPSA 3O8DA 1G18A 2IA5A 4X8MA 4F4JA 1Z63A 4KODA 5F9HA 4AYXA 2F43B 3QPUA 3BB3A 2CCKA 3RRYA 4QHTA 3QBTA 4HUQB 2FFAA 3ASYA 1G21E 2H18A 1OHHA 1NBME 5HE9A 4HLCA 5FR2A 4A2PA 1DADA 2QMEA 1UM8A 1HT1E 2H92A 3B82A 1NBMA 2ZR7A 3W6OA 2QRZA 3QIAA 1LFDB 3B2EA 2QP4A 1NY6A 2ORWA 2L0XA 3KJIA 4JKIA 4PSAA 2ZM5A 3U44A 3X1XA 3G82C 1S3SA 4LYFA 4Q47A 2O8DA 5DGXA 1D9XA 1XU4A 3DZ8A 3RS7A 2ZRAA 1DBSA 2GK6A 3OEED 4B3GA 5JLJA 3KJHA 3CLVA 4DDWA 3QXCA 3LA6A 3K9HA 3IBYA 4DCSA 4A1FA 4TQUS 1NI3A 3T61A 3VU9B 2JLXA 3BC1A 1XEXA 4F93B 1AKEA 2ODWA 2EQBA 4XTCS 1OH7A 4EPXA 1U8ZA 4RKFA 1VKJA 3FDIA 1W0KD 221PA 3VTKA 3EARA 4ZDKA 2B21A 2XNDA 2CE2X 3RAPR 1YQTA 4Q1BA 4TTQA 4YONB 2ZRCA 4LC1A 4B73A 4CT4B 3C16C 3THWB 1NSTA 4US1R 3SYKA 4N0DA 4O2LA 4BRUA 2Z0MA 1KK2A 1ZRHA 5M04A 2O8CB 4TMXA 4DVGA 2IYXA 1E32A 4UNSA 1OH6A 4R7ZA 3T5GA 1EFCA 2B8TA 2FPLA 3P26A 3K9GA 4A0RA 1FTNA 4CDGA 4BFVA 2WJHA 2R6AA 3KKNA 5G3ZA 4PPNA 2H5EA 4RZXA 3DKVA 2AD5A 3R8CA 2ZI9A 4DT1A 3DHWC 2ZUCA 2WWWA 1W0JA 3KB1A 3CM0A 3CX7A 3DM9B 2IUSA 3K09A 5JCPA 1F2TB 3QPWA 1HA3A 1VG9B 1UJ2A 2JLRA 1G1MA 1G291 1GZSA 1JR3E 1XPRA 4LJ4A 1T91A 1H8HA 4C4PA 2OV2A 4CVNA 1B0UA 1OB2A 4G5SA 4DIEA 1EESA 2VF8A 1Z07A 4GSYA 4RD2A 4YMSA 1KO8A 3OFNA 2ZJYA 2ZRIA 1DAFA 3QEOA 5D3QA 3QVVA 4ZI2A 1H8ED 4G1UC 1ZMXA 4MRPA 1PUJA 4OYHA 4GDFA 1TQ6A 4WZ6A 3U6KA 4XH9B 3AKDA 5HTKA 1Z0AA 1WP9A 2XJ9A 3B85A 1COWA 1JALA 1G5RA 3QG1A 5EXXA 3SU8A 2Z4RA 5FOTA 1P9NA 2BKEA 4D0NA 2OO7A 2J7PA 3A36A 1US8A 4WXPA 1GFIA 4LBZA 3AUXA 3UANA 2QEQA 4XIGS 3DDCA 3I3SR 2OESA 1J70A 4G0NA 4HAYA 2VSFA 1N6OA 2NQ2C 4W7SA 5C4GB 3MCAA 3NVAA 4ARZA 1MT0A 4B3DA 2FX3A 2W2XA 2CE7A 1R8QA 2GHIA 2XSZD 2XTZA 3LQQA 3MG9A 4MYHA 3Q7QA 3X1YA 3Q5DA 1VIYA 1P73A 2OE2A 1E4YA 1GILA 4Q4AB 5JS7A 4C3ZA 2BBSA 1TAGA 3CX6A 3U3KA 2NMVA 3I92A 1QBKC 2ZYTX 4MKIA 2GXAA 2OCYC 3KXKA 3WRYC 2UKDA 5FH9A 3P20A 2ZUBA 3OHMA 4JS0A 5LD2C 1DE0A 1S9DA 2CVFA 3OIWA 2D4HA 4M9ZA 3TIFA 2W2VA 3WMFA 4NL4H 1DOAA 4Q19A 3FGNA 5E4FA 2VHJA 4IOKA 3B9QA 1N6IA 1R8SA 3SYLA 3WHKA 4JLDA 3TLXA 1P7CA 3FTQA 1YZLA 3A1WA 3FHCB 4DUGD 4DDVA 2P2LA 3ETLA 3ZIAD 2BHRA 5SZIA 4Z8XA 1OH5A 3MJRA 2WBLC 2BBTA 4LK2A 1KI7A 3GP8A 3W90A 3MMPA 1LY1A 3LBHA 2A7QA 5DI3B 4BZPA 2J46A 3I8XA 2FPMA 4MA4A 2ZE6A 2A5YB 2EVWX 1ZM4A 2QP9X 3NKVA 1WRBA 4BFXA 3KQLA 4DDUA 5JJKA 1HV8A 2YWFA 1Z5ZA 2GXSA 2FN4A 4M1SA 2B6HA 3OEEA 3MAAC 2BBWA 4XVQA 1MABB 2D2FA 1GRQA 1G3QA 2ZYVX 2WJGA 2O8BA 5CK4A 3BGWA 2XJ4A 1P9RA 2ZUDA 4FD2A 3RLFA 3DL0A 1RFLA 1VCIA 2DCUA 4ESHA 4ERNA 2YJTD 5G53C 3GJ7A 1S4QA 3QKSB 4B2LA 3C15C 1W0KA 1HQCA 1KDRA 1R4AA 1C9KA 1QDEA 1FUKA 1HY3A 1NLYA 4TT3D 4Q7MB 3AF1A 4WA7A 1KDTA 1OXUA 1KIMA 1L4UA 4IEIA 4L4UA 4BECA 1ZIPA 5DI9A 5EQTA 1GM5A 4IOMA 4V0LA 1RKBA 1E4VA 1OIWA 1EFRD 2PCJA 3ZQJA 4EPWA 1UBGA 3IIMA 2RGAA 4HAUA 1D2EA 4DRZA 1SVMA 4JYBA 4BEBA 4BASA 2AWOA 4MDEA 4L15A 2FG5A 1E2IA 4MKFA 2WWXA 2QG6A 2XB2A 3FHTA 3TVDA 4V0OA 3MD0A 2JJ2D 3SHFA 1V43A 1M1YE 1Q0UA 1E2QA 2GILA 2VO1A 3E5HA 3VHXA 1CXZA 2CNWD 1NLFA 2A5JA 1I4DD 2J0VA 5JECA 3LWNA 4NH0A 2AXNA 1UKVY 1VG1A 2G6BA 4MGKR 2REXB 1U2RA 1QF9A 5CK5A 1SVOA 2ZR0A 5JMTA 3LLUA 1W46A 4OQNA 1F48A 1U8YA 3LAWA 3OF5A 5JRZA 1W36C 4CEIB 3IPXA 5HZKA 3WNCA 2FSGA 1SXJD 1KAGA 3GJXC 3RNLA 2BJWA 3W6NA 4IVPA 4C0QC 1L4YA 1JR6A 3KTAA 2JGNA 2AWNA 3QXJA 3PIRA 1RRGA 3SBEA 3VNVA 1ZW6A 1H8EA 3EPKA 1ZAKA 1Z06A 4I4LA 3THXA 4POAA 2TMKA 2YINC 3LDAA 1HE1C 1UEIA 4LPSA 1AM4D 3BK7A 3TKLA 5FOWA 4JLJA 4DB4A 1DAKA 1K8RA 2C8VA 3NTUA 2HUPA 3A1TA 2AKAB 5TMPA 3VKGA 3LY5A 3QKRA 2FEOA 3LX5A 3UMSA 2JIZD 4DLXA 2CJWA 2IEYA 3OEHD 4A82A 2A78A 4OK6A 3CZPA 4WAUA 1Z0KA 3QBVA 4PO8A 4CEJA 3IDQA 1G16A 1YR9A 5HCNA 2GBLA 1N25A 2GK7A 1XTJA 3IGFA 3AF2A 2IYZA 3EW9A 1P75A 3FWYA 3K09C 2XSZA 4TMWA 3K9LA 4Q5IA 1CJUC 3NEJA 3FMOB 4XWKA 3RSLA 4LYAA 4EAQA 2JEOA 1E3MA 3VR2A 3DZDA 4D81A 4IHQA 4BEJA 4CF7A 1PVOA 5K8UA 121PA 1MO3A 1NVXQ 3FMPB 2Z43A 3TVTA 2W0MA 5KDDA 3RSOA 1N2CE 2UZ3A 5FR1A 1VECA 3ZH9B 4Q1DA 2H16A 4TLDA 1RRFA 2OM2A 2YOFA 5CLQA 3I72A 4A2WA 1DEKA 1HT2E 1P6XA 3KJEA 3U6BA 2GA8A 2QM7A 4US0R 2FOLA 5J4VA 4NE2A 4E5UA 1KY2A 3A8TA 3GQBA 4YMWA 4HB4A 1K5DA 1Z08A 1P61B 3FB4A 4OHYA 2QENA 1A5TA 2CLDX 1KNQA 4JVMA 4Q00A 4C0LA 4PZYA 1G8FA 1L2TA 2NO6A 4XWOA 2GF9A 4DUGA 3ZIAA 2OFXA 4ZIRA 4D26A 3ZVNA 2IYUA 3J81k 4BFUA 2BJVA 1XD2B 4ZCLA 4HZUB 1CRPA 3ICEA 3L0IB 2QMHA 1SVIA 3TNFA 4JZKA 2FV8A 4B2IA 3EZ9A 3LFUA 3K70C 4TLAA 1ZCAA 2P67A 2V3CC 3QENA 4DEYA 2BV3A 2PMKA 1ZNZA 2OUKA 5J47A 3GJ4A 1X1SA 1DELA 2GZAA 4QL3A 1OIXA 3ZDQA 1R0YA 2ANBA 3LX8A 5DNYB 3EX7C 3C41J 3TR0A 1G7RA 1GRRA 2F1RA 5P21A 4A4DA 4B3BA 1XMJA 4PANA 2YHSA 5TY0A 1M7BA 4C7OB 1KGDA 2NO7A 4XVUA 2JATA 4L5BA 4R71A 1NG1A 1SKQA 4LJYA 2BMDA 5KNCA 2FWRA 2ASEA 1A1VA 3SN6A 1YE8A 1M2OB 5EP2A 5FUVA 4O3MA 4TT3A 2CEAA 4HSEA 1J7KA 1NRJB 1GKYA 5KDLA 4EQ6A 1SGWA 4LJ7A 4UNPA 1I4LD 4V02A 3OIUA 4Q1AA 5TXGA 5F2EA 4A0HA 3AP3A 1ODFA 1OPXA 3OZXA 2R6DA 3HU1A 2GZDA 4HYYA 4TYYA 2DWOA 1QG4A 1X8LA 4O25A 3UWKA 1NN1A 1CP2A 3LVQE 1GTVA 2RCNA 3EC1A 2NTYC 2V55B 5L3SB 4PAQA 4EPRA 2Q3MA 5AJZA 1AS3A 1XD8A 3FVQA 5LD2B 1XNJA 1VMAA 1E2PA 4FW9A 2G88A 3AVOA 1XTSA 2UVQA 2JDID 4KAXA 3K0FA 4FCVA 4DIDA 2JJ2A 1LW7A 3CPHA 3K0CA 3NH9A 2QBYB 4C0BA 1G64A 3EPHA 1GSIA 2VBCA 3DM5A 2J3EA 1J2JA 4NP6A 4LWZA 3TH5A 3TQCA 3AP2A 1KMHB 2YC4C 5KU1A 4RD6A 2EFDB 3QKUA 3U3MA 4DCTA 2AK2A 1IQPA 4EJSA 1MH1A 2QQEA 4NDZA 4RJLA 2V4ZA 4Q4HB 1SXJA 4BLPA 3D31A 3EA5A 2QMOA 4C9BA 3Q3JB 1CIPA 1AQYA 2ZRJA 3A4MA 3B1WA 4FMDF 1II9A 3TBKA 2O5VA 1HYQA 1XEWY 3B7GA 3C5CA 4LC0A 3CF6R 3RANA 4WZAE 4ACAA 1WQ1R 1FQJA 5FPYA 1ZP6A 2ZI7A 1FX0B 3RS0A 5L3VA 2FSIA 2KE5A 4RD4A 4S35A 3W3AA 4UKDA 3G0HA 2JIZA 5DYIA 3THYA 3NIBA 5JJIA 2QGZA 1TEXA 3C4JA 4DLWA 3GPLA 1UDWA 3OEHA 4GNKA 1XXHB 2HYIC 1MR3F 4PZZA 3PEUA 3FOZA 4D6PA 3JZMA 3ZZUA 1G6OA 4PC6A 3B8HA 3AUYA 3GLIE 1NKTA 3CRW1 1G3IA 4LGMA 4LV6A 4Q9HA 4ZDJA 5GJVC 1O87A 4XSHA 3GLIA 1YRBA 1XZQA 5B30A 3CWZA 3R9WA 2OBLA 4DJTA 5KSYA 2WV9A 3DO6A 4B76A 4ZCIA 2WMOB 2ZR9A 5B2ZA 3L0PA 1E99A 2CHGA 4JLPA 4A36A 3P1JA 2PL3A 2C9CA 5EJEA 2QTVB 1M34E 4LYJA 1SVLA 1NLZA 5TB5A 4ZI3A 5AWFC 5FBLB 3KKPA 3W3ZB 1NJGA 1R0XA 3CWQA 3U44B 4M0LA 4URXR 5G3YA 2O8DB 1I2DA 3BH7A 5K8IA 3FE2A 3WYAA 1FNMA 4HB0A 1GIAA 1CJMA 1CJKC 1N5IA 3ZD7A 1Z6GA 3AVUA 2AXPA 4B2PA 2FSHA 3NBXX 1OH8A 4XSGA 1XEXB 2GBLC 4BZXA 2R44A 4TN1A 1J8YF 2HJGA 3KQHA 4TYWA 1MRNA 4QJ5A 2JAQA 2YZ2A 3BIFA 5E7IA 2AR7A 1OFHA 2QP3A 4DZZA 1W36B 2QAJA 2Z83A 5J4YA 2KB0A 1XEFA 1AA9A 1E0KA 3Q72A 2QQ0A 2J45A 4BRWA 2XTNA 4LUCA 5DHAA 5B58C 1W7AA 4AKIA 3AP1A 1JQJC 4DLSA 1KJZA 5CYPA 2AK3A 2QRNA 4QXAA 3IPYA 3HDTA 2ZJ2A 4KVGA 2NGRA 2QTHA 4KSBA 1NIPA 2Q6TA 4GOJA 1Q3TA 3CRRA 2NPFA 4H1VA 1NF3A 4JMPA 5LBIA 4F4IA 4MGYR 1D6JA 2DFLA 4A6XA 5CM9C 4DEXA 1KZGB 4BPBA 2JASA 1DAGA 4DT1B 1YHNA 3P4YA 3T12A 3B60A 3AVYA 2VH5R 2ORIA 4Q66C 2J0UA 3MSXA 4D82A 4OQXA 5E7MA 3A4NA 1GVNB 2RGNA 4QM7A 1XF9A 1Z28A 4B43A 5H70A 4RZ3A 3GLHA 3ADCA 3QSYA 3AVVA 3E2IA 2RGGA 3NDBB 1KI3A 2AX4A 1E9FA 2BVNA 3VX3A 2IF0A 5KHOC 4QC2A 3EWAA 2WWFA 1A7JA 4QFMA 1KDOA 2W0SA 4URYR 1T0JB 4ABYA 5JEDA 1GG2A 2NO9A 5AJVB 4JLOA 2ZITA 1E9AA 2EU8A 2PCLA 1RRCA 2JDIA 3QF4A 1AN0A 3QQ5A 4LV8B 4PC1A 3ZGXA 1Z6YA 2ZS7A 4Q01A 3JVUA 5KSPA 1E2FA 3TRFA 2A30A 3RWOA 2JLWA 3KZ1E 2HEIA 1RYFA 3TSOA 5JS8A 2ZSDA 1MOZA 1N0UA 1US8B 1BMFD 2HT6A 2MSCB 2BDTA 4TYPA 4X8HA 3IILA 3VHLB 4OHXA 1VTKA 1T3SA 4Q7LA 1CBUA 4B48A 1TF5A 5K8TA 3IEVA 2XTMA 4ARZB 4JT4A 4BLOA 1XP8A 2XZPA 1Y63A 4MQBA 1LB1B 4GMDA 3K9NA 1AGRA 2DFKB 4LV5B 1II8A 4URWR 3K70B 1S9HA 5D3MA 4YQFA 1FNNA 5FBRB 2QN6A 4QM6A 4MYUA 5TDHA 4GPTA 1G3MA 3IHWA 2VSOA 4HI0E 3CNNA 1SVKA 4BGDA 3H86A 2RB4A 4TZ0A 2DY1A 1T0HB 1EFHA 1WBBA 2GCOA 2GJKA 4PC2A 3I73A 1R5BA 4D4JA 2UZIR 2IT1A 2IUUA 4C0SA 3ND9A 4JVNA 1Z0FA 5SZHB 4EPYA 3PV0A 3K0CC 2WKPA 4FMBB 4QBIA 4RCZA 2PMDA 2KJQA 1NVVR 1NVVQ 1M7GA 4KBFA 4AKGA 2HLDD 4LBYA 4M1OA 3U7GA 1Q57A 3PR1A 2OILA 1TTTA 4PPGA 5J4HA 3BWDD 1JPNA 1UF9A 3K53A 4EJSC 3K0SA 4M8NE 4C0AC 2PJZA 2ZIAA 4KYIB 4Q03A 4ZDIA 2KWIA 4DLZA 1FZQA 1XD9A 2P6NA 1Q1BA 4LJ5A 2RGEA 2RKOA 2GF0A 3MJHA 5JI3E 4KFTA 4ASUD 3AVXA 2V6IA 1E2HA 1C4OA 4NBSA 4NZYA 1SHKA 2GEDA 2ZXUA 1QVAA 3ZS9A 2XX3A 3NEYA 2CXXA 1M7HA 2F1IA 2IYLD 1TUEA 4LBWA 3KQNA 4BFTA 4F92B 2WICA 4QNMA 1OXTA 2O8BB 5IK2D 3ADKA 1Z2CA 3QPVA 3KDSE 1GDDA 3CH4B 4NMMA 4YC7A 3T06B 2DPXA 5CDFA 2OAP1 2KI5A 1TU4A 1JPJA 3QNUA 1HTWA 3OESA 3RS5A 4NCJA 4JL5A 2FZ4A 2IXGA 3BD9A 1RIFA 2VF7A 1P2SA 4NONA 4U7DA 1XTRA 2VHUA 2F3RA 1EFTA 1T8TA 1U0HC 4QG7A 1YJ5A 4A8JC 3GJ3A 2WIAA 3QUSA 4YMTA 1CKEA 2WKQA 3FKSD 4RFSA 4IW3B 4OQFA 4YLGA 4DHEA 3NHBA 4OQLA 3HYRA 4LJ6A 5EE0A 1YZNA 3EWSA 2CCJA 1DS6A 3HYTA 4JLKA 2FF7A 3WYGA 4XJXA 3R20A 1QHXA 4RD3A 5GVRA 1Q21A 2ZE7A 1FFHA 1E0AA 2RH5A 3X1WA 5TV2A 2X19A 3D3QA 3VAAA 4XD7D 3VKWA 1WXQA 2XB4A 1N5LA 4KV9A 2O8EA 1VPLA 1YZTA 2QT1A 3CPJB 4M1YA 4RY2A 1K6MA 1ETUA 3GJ6A 2OCPA 1QHSA 4LCBA 4M9SA 4P3YA 2EW1A 2ONJA 1G7TA 2BIFA 3TUJC 1CJVC 1SZPA 1ZM9A 4LYHA 4TWZA 1S0UA 3SJZA 4RVCA 1DAHA 2ZRDA 1MO4A 2X2EA 2F3TA 1ZJ6A 3Q7PA 2A5GA 4IDOA 1OXVA 3KTAB 2IS6A 1Q44A 4DLYA 5EUQB 1P2TA 2C98A 2PT7A 1DAMA 1E96A 3SJCA 2N1BA 4HZIA 3THXB 4B44A 1G5TA 1YU9A 1RYHA 4MRRA 4NCIA 3GFPA 4NYMR 4NYMQ 3TMKA 4Q21A 3VR6A 4BLRA 4B6EA 1XX6A 4GMXA 3QKRB 1SHZA 4JLNA 3MWKA 2GEVA 4Q1FA 1E2JA 3AEZA 3SJAA 4I1SA 2CJWB 2ANCA 5CYOA 1BMFA 3B13B 1XJQA 2D74A 2QZ4A 1NN5A 4IOLA 4CEJB 3EPLA 1Q3HA 4IJMA 1IY0A 2DWPA 4B71A 1N6KA 2FDCA 3QY0A 1W4AA 2D3WA 2OLKA 2P3SA 1EG7A 4CEHA 2JCSA 1WA5A 2ZRNA 1YKSA 2C78A 2KBEA 2PX3A 4G5OA 4IXNA 4EPVA 3L43A 1W4RA 1KSJA 4FWTA 3B1ZA 4QGFA 4YXWD 1Q1ZA 1X8JA 4IDHA 1XMVA 4AC9A 3BRWD 1CU1A 4KVAA 3VNUA 2FGJA 1GUAA 3CRVA 1UAAA 1JB1A 1FUUA 1KJYA 3QXSA 3D8BA 1FOEB 3GJ5A 2VPPA 2G1JA 5C1BA 3HWSA 3RABA 3AKYA 1IOZA 2N42A 3N2EA 4GZLA 1KI8A 1VYTA 1UKZA 2ECKA 2C99A 1TX4B 2DBYA 4QNRA 2RHDA 2ZAOA 3THOA 3U7EB 2WJJA 4CZ2A 5K8LA 3W34A 3GLGA 2D06A 4D4LA 2HLDA 3MLEA 1N6RA 4JLAA 2HCJB 2ZRLA 4FN5A 2IYTA 3HPQA 4MGIR 4ZIRB 3CR7A 4XVRA 4FWIB 2ZI4A 3L8ZA 4A15A 2X1VA 3EIHA 5DH9A 2C95A 1TMKA 4II7A 5KOYA 3UPUA 1N0WA 5KSOA 5AUNB 3A6PC 5CLLA 3X1ZA 4EDHA 3BFKA 4ASUA 2BMJA 2B92A 3TAHA 5H8WA 2GESA 4I1VA 4L9SA 4N0EA 1EFUA 4TMTA 1PLJA 2ZEJA 5JBQA 2ZYUX 3F5FA 2RHMA 4B3XA 4HLUA 2E9SA 1TUIA 2ZSFA 4KI0A 2F1JA 2YVUA 2YWHA 1AZSC 3EA0A 4PPFA 5IK2A 3L82B 4M1MA 1AS0A 2P6RA 4NCNA 1ZD8A 1RE0A 4V0KA 1QHHA 1T3LA 1K5GA 3RDPA 3ZVLA 2VP5A 1B23P 4LZZA 2HCBA 1KK3A 421PA 1E2LA 3ZZ0A 5BN5A 4N1AA 3EZ7A 4RFVA 4MRVA 3W8NA 3PCRB 4QRHA 1P72A 4EQ6B 4Z54A 1CULC 1R5NA 4FMCB 4HB2A 3ICQB 2ZSAA 3PVSA 4BLTA 2J5XA 5EE9A 5EUMA 1Z0JA 4WVFA 1RZ3A 3FKSA 4FI3C 4RCYA 5EP1A 1O3YA 1OT3A 1UADA 1IONA 1XWIA 3L8YA 2IXFA 4QBGB 4TTRA 2O52A 2I1QA 4AKEA 1W5SA 4LHZA 4P4TA 4IOJA 821PA 4NYJQ 1HQYE 5AJYA 1PV4A 3WNDA 5JHHB 3WXMA 2FEMA 1NP6A 3FHOA 3TUZC 1NNEA 4KHZA 2VQSA 4XD7A 3CPEA 2BEJA 4YDHB 2QA5A 2GETA 4Z1MD 2B7BA 3R8FA 5A0FA 1S1CA 2R65A 4LBVA 3P27A 3PUYA 1U0JA 1T9HA 3CONA 2HF8A 4P4SA 2D2EA 1YZUA 2ZJZA 2G77B 3CX8A 4EJSB 2Q3FA 1JJVA 1OW3B 1XMIA 1YZGA 2BWJA 4URVR 5AK0A 3RYTC 3EASA 4G3XA 2PZFA 5HKKD 3SJBA 1DAIA 2PH1A 1AS2A 1TF7A 2IHYA 3U3OA 1TNDA 4Q9IA 4QOSA 2CLSA 4BFYA 1JAHA 1OLOA 2YOHA 1G8GA 3B6EA 5LB2A 4JSTA 1I4TD 2IHBA 2VP4A 4AYTA 5A5GA 2OXCA 4PAOA 2GCNA 4ESVA 3IBGA 5FBVB 1VHLA 4NTZA 3THYB 4TMKA 1E94E 1E9SA 3CB4A 1IHUA 1ZM2A 4PHTA 1G5PA 4PC3A 4Q48A 5CJPA 5BXQC 5AUQA 3ASZA 1A2KC 1G19A 3BS4A 5FOVA 4F7WA 2QSYA 4WBSA 2DFNA 2P6UA 1AGPA 1KO7A 4NYIQ 4NYIR 4Q4JA 5FPKA 1AKYA 5AUPB 1BIFA 4R2HA 3EZ2A 4OL0A 4XWAA 3GLIB 1LNZA 1QHGA 1W44A 2XXAA 3HU3A 5HPYB 5F9FA 3JVVA 4V0NA 4YXWA 1E0JA 3S1AA 5E3HA 1Q12A 3FYHA 2R9VA 3CRQA 4ZDWA 5A4JA 4DCNA 1BOFA 2JA1A 5FI0B 5JSZA 2WIBA 2WM9B 4LX0A 4OK5A 3TUIC 4A8JB 4GOXA 4AWXA 2WHXA 1QG2A 4F4CA 3VR5A 3CF2A 4AKHA 3BFXA 2CMKA 4NPHA 4Q9LA 1DARA 1HURA 4U02A 3RRMA 1P4SA 4B6FA 4TMZA 2O8FA 4QBHA 1FTSA 1IAQA 1T4GA 1SVWA 4JJZA 5FTMA 2GZHA 1UBEA 1G7CA 4A6PA 4TL7A 1RJ9B 4HAXA 1UBFA 2NO1A 4W9MC 1KI6A 5FPHA 2IBMA 2H17A 2VL7A 1Z47A 2XOKD 2HDNB 4AURA 5IF9A 2Z5FA 3EXAA 2Q9CA 4TL6A 4PQFA 1E9DA 3TR5A 1OFIA 1NJFA 2A5DA 2PZEA 2PJRA 2ATXA 4Q1EA 3BAFA 4M4SA 2FE4A 3W5JA 4MUBA 4Y0VA 3TSWA 2Q9AA 2ZS9A 3TGPA 3GEIA 3HR8A 5DSZA 3KQKA 2X77A 3ZVRA 4JIMA 1GL9B 1NVWQ 2G1KA 2J7KA 4M1TA 6Q21A 4MDFA 2W83A 3NDPA 1JBKA 3PG5A 3AF0A 1PUIA 2VP2A 4LHVA 1EFRA 1VDZA 3M4YA 4WW0A 1ZC4A 4ACBA 4L9WA 4QHSA 4HEJA 2Q21A 1A4RA 2VP6A 4LHXA 3U4QA 1N5KA 3CW2A 1OF1A 1KNXA 3VQTA 5JWHA 3E1SA 3T34A 1D5CA 1E2MA 2AFIE 1GNQA 1KO5A 2H8KA 4TLBA 4RSGA 1PJRA 3W9YA 4Q18A 1BO6A 2J0UB 2I3BA 4TTPA 4P33A 1NN3A 2AL7A 3KB2A 4MITA 2CNWA 1T5IA 2BCJQ 2PT5A 3PEYA 2V54A 1MRSA 2ZJ5A 4EIWA 3GLHB 1ZUIA 2AHOA 1WB9A 1SXJE 1I2MA 2C96A 4D4MA 4DLRA 3K0AA 1JECA 2E1RA 4PPQA 3UWOA 2IS2A 2WPDD 3KJGA 1S8FA 3N2IA 1KAOA 3CR8A 3IO3A 4GT1A 4OQMA 3ZLJA 1IXRC 1ZM3A 4HLUC 1NMZA 5FL7D 1XZPA 3QF4B 1TADA 1L8QA 2GCPA 2NO0A 1G8HA 4C0JA 2C03A 3MFYA 2FH5B 3W8RA 3ZQ6A 4QJ3A 4CT5A 4Z1MA 1VCMA 2C5LA 1SULA 1ZINA 1MO5A 4BFWA 2BKUA 3C7KA 1GNRA 5JWOA 4HATA 1ZBDA 4PQYA 4KJZA 1JEDA 2WMNB 2XITA 3RS3A 3LBIA 1G4UR 8OHMA 3ZD6A 5BN4A 1KSFX 2ZRFA 1ESMA 2N46A 4ZV4A 5FUYA 4P32A 1N6PA 5JI2E 2YKGA 4S2EA 2C9YA 1II8B 1QZXA 2ZRHA 5HKKA 5D3MB 1NMYA 1DO2A 4ZKDA 3SBDA 3SDZA 4C2TA 2ZPTX 3A1VA 4R2IA 3VFDA 3QOFA 2E87A 2CDNA 1E9RA 1G4AE 2XZOA 4DLTA 4FCWA 5BQ5A 2IUTA 5KUTA 2Q3HA 1AIPA 4HDCA 1EX6A 1KI2A 2GCOB 2WSSD 3H1TA 3M0EA 4B47A 4G01B 4M22A 1DO0A 3RHFA 2QNRA 4KFRA 4XOIA 4LRWA 1E9EA 1F60A 3IEUA 3KFVA 4H1UA 2FFHA 1JJ7A 4PSKA 1NVUQ 2MSDB 5EZ6B 2PEYA 4CYMA 4LY6A 5J4KA 5L3QA 2IXEA 1KOFA 3LXXA 3Q9LA 4YMVA 4F91B 3I32A 4HAWA 5AJWA 1FPMA 4HZUA 1IM2A 4IDQA 4PAMA 5BYKA 2G3YA 2W00A 1VG0B 2BOVA 3O8RA 2RGCA 4JSYA 1TF2A 2XAUA 4AD8A 5F3WB 5G40A 2Y8EA 4NCHA 3LBNA 1YR8A 3Q5EA 1EK0A 2CL6X 5E95A 1Z83A 3QVUA 4PX9A 2GAAA 1P2UA 4ITRC 2WWGA 2SHKA 4OK3A 2WWHA 3LQRA 4IDNA 5B64A 4LJ8A 4MRNA 1OXSC 4BZQA 1X86B 1M74A 1GNPA 2GAOA 2O0HA 2OCBA 2CLCX 4Q02A 4RKEA 4W5JA 4D25A 3LV8A 1G8PA 2YOGA 3WNBA 2GJ9A 3CRMA 2XOKA 3WRXC 4BFSA 5CITA 2GVDC 2FFBA 4QJ4A 2ZVQX 3W5IA 5CB8A 1W0JD 4GP7A 1S1MA 2REOA 2VYFA 5BWMA 3U5ZB 1R0ZA 3PUZA 2FU5C 1P2VA 3CUEF 4D4KA 3KUCA 5KDOA 4B35A 4TZ6A 1BYUA 3U3RA 2MMGA 5FTNA 2NZJA 3GLHE 3RWMB 1KI9A 4W5HA 1JR3D 1Z6TA 3LW7A 4A2QA 4NU0A 4DBLC 2GVZC 4ILEA 5FBWB 1QHYA 1Z29A 4RFSB 3U61B 2DB3A 3GD7A 1KO4A 3C8UA 4WOPA 3I61A 3D7MA 2RMKA 2RGXA 4D80A 1PZNA 2ZI5A 3JZAA 4FINA 4LI0A 4HUTA 5BW8A 2WJIA 3DMDA 3W6PA 2QM8A 2ZS8A 3AVWA 1XJ0A 2F9LA 4DB2A 3EG5A 3TQFA 2O8EB 2JLSA 2WZQA 3NBYC 5J40A 2V1UA 2J1LA 1IN4A 3MWJA 3UMFA 1KK0A 2NG1A 1UPTA 1CF4A 1T8UA 2ZU6A 1XPUA 3SE0A 1WGWA 1U0LA 5FTJA 5KO2A 3LNCA 1ZVQA 4KYUA 5KNDA 3PEWA 2IL1A 4PTLA 1KYIA 1BYIA 4PZLA 4RD1A 3IKJA 3TJZA 4EKDA 1LV7A 2WPDA 4KITB 5HCIA 1J99A 1U94A 3EZ6A 2ZI6A 1BH2A 3V4RA 5E7JA 1ZUHA 2JLVA 3WBKA 2VA8A 3BORA 5CM8B 3VKHA 4TLEA 4DCUA 2P5TB 3DOFA 4JBXA 4Q7JB 4TQ9A 5FL7A 1G6HA 3QKTA 2QY9A 4UNNA 1WE2A 4LHWA 1LVGA 5EP3A 1UKEA 3BB1A 3VMFA 3GLFE 1FQKA 1IBRA 2EFGA 4WXRA 1CRQA 2CCGA 1XXHA 5EE3A 3AF3A 3GLFA 1GL6A 1Q22A 2VHTA 2WSMA 4MGZR 3T5DA 3NBZC 2J0SA 3PXGA 4ZPXA 3T1OA 1NMXA 1QRAA 4HLDA 4IRUB 1ZUNB 2QPAA 2WJVA 3F0TA 4OI4A 4JJKA 1KK1A 3BH0A 1G17A 3UIEA 3OIVA 1R0WA 1E2KA 4CEHB 3OE7D 2F7SA 3RS4A 1UKYA 4KCGA 3VR1A 2IS1A 2QAGA 3GEHA 3BOSA 2CL7X 5DN6D 1XCGB 1ZNWA 2YC2C 1ZC3A 1E9CA 1IN6A 4U00A 2Z4SA 2IF2A 2EYQA 4JLBA 1R10A 3AKEA 1SXJC 3T1QA 1NSFA 4NHOA 3I5YA 1Q1QA 4OHWA 5EXTA 4LDJA 2WSSA 4M1KA 4Y0AA 3VR3A 5KSZA 2W6JD 2X8AA 4EUNA 3L0OA 3SZRA 2ZETA 1OSNA 1Q20A 2I4IA 1Q1EA 3EIEA 3BJIC 1N5JA 3GLGB 4M1WA 2V8OA 4P31A 2VHCA 1JXMA 3LRPA 4JYCA 3KL4A 5CDFE 4F38A 4JKYA 2IYVA 2AKYA 3LXRA 1XJCA 5GJBA 2CK3D 1F2UA 1RW4A 2BC9A 2XNSA 4JVLA 5GVSA 1CLUA 1XEWX 3P32A 2GEUA 1UBCA 1U98A 3KFXA 1E2GA 2F55A 1T6NA 1KI4A 5ELXA 3OAAD 5FTLA 3U60B 2OAQ1 4GOKA 4EPTA 4K81B 1XTKA 2ONKA 3U7HB 4JLMA 4DXAA 4D0LB 2QT0A 4B74A 4US2R 2KSQA 4KO8A 1TPZA 4NKRA 1OIVA 3MWYW 4HAZA 4P4UA 2LCFA 2YYZA 3DEFA 3ADDA 2FMXA 3MRSA 3Q8XB 4KLNA 3VR4A 2FGKA 3BBPA 3I1FA 4C0KA 1FL9A 2ZRPA 2ZJ8A 5J4LA 5DLQC 2ZTSA 1QHHB 1VCNA 1W4BA 621PA 2QPOA 1JQLB 1C1YA 1H65A 3O47A 3AVPA 3NBFA 2BMEA 2CBZA 4M9XA 3RRZA 1XBTA 2BM1A 3CZQA 4LPKA 4L8GA 2YWEA 2J59A 2CL0X 1JNYA 2QE7D 1YR6A 1RC8A 2QORA 4UNRA 5C4MA 1IN8A 4URUR 3R7WA 3T35A 1F3OA 4TSFD 1P5ZB 1XDBA 2YWGA 2BM0A 5FFMA 1JR3A 1HE8B 1MV5A 2XGJA 1N3BA 4D2IA 2ZE8A 1X8KA 4RD0A 3TAUA 5DO9A 1G7SA 2D62A 1J90A 4ON9A 4BLQA 4G5RA 1CEEA 2ZANA 1AJEA 2R8RA 3HPRA 2G0NA 2LKCA 3CO5A 4Q4LA 4QHYA 1S3GA 2W6ID 5UKDA 4K46A 1ZIOA 5TVKA 1DG3A 2OBMA 3FFAA 1BKDR 2H7VA 2GWHA 3IIJA 3UG6A 4O2RA 1GAJA 4TL8A 1W2GA 1F5NA 5JZVA 3ADBA 1CR2A 3KXIA 4QBFA 1ESNA 5JWRA 1G9XA 3I8SA 3L0SA 3N70A 4TQAA 3FMFA 4P4SB 4LJ9A 2A3RA 3K1JA 4HDQB 2DR3A 3CNOA 1N0VC 4AIIA 2FZLA 4ZO4A 3U3JA 2OZEA 4DLUA 2REBA 2F43A 4BWYA 2HV8A 2F6RA 1ONBA 4IVRA 3SS8A 1IN5A 4HUQA 3LVRE 1XPOA 1U90A 2RGNC 4Z8YA 2WAXA 4B33A 1CR4A 2ERYA 5FTKA 4JBWA 4OBEA 1HEIA 1U99A 5C2JB 1ZU5A 2VEDA 4JBYA 4YMUA 4P0TA 1VYVA 2ZRGA 4PHHA 2QU8A 4I99A 1OE0A 1P9WA 1XTIA 3PUWA 4L16A 4LJAA 4MH0R 5HE8A 5H68A 4FCTA 5SZJA 2P65A 3V4FA 2A9KA 1OXXK 1KZ7B 5ANRB 5FBQB 5C46F 5KTYA 2OHFA 2MMCA 1KO1A 5TARA 3REFA 4Q4JB 4DKXA 2GXUA 3SFZA 4LHYA 2NIPA 5CIQA 5GJCA 3GLGE 3SFVA 5DHFA 4B32A 1SKYB 1GKIA 3OE7A 2JLQA 2XXAB 1GL7A 3VU9A 3O8CA 3GCGA 4J0QA 1DVRA 3PEVA 2AFHE 4FMDB 1UFQA 1R2QA 3DMNA 5DN6A 1GRNA 3S1AB 3CIOA 1E98A 2G83A 1KTVA 3QEJA 5AR1A 5JSZB 3CH5A 1RVDA 5EE1A 1FMJA 4OKSA 2NZ8A 2VLIA 2WAYA 4KBGA 3N5CA 4OJKA 3EIQA 1D8TA 3ZJYA 1W48A 4QKQA 4UJ5A 1TEVA 4D0GA 5FI1B 2W6JA 3THWA 3LW8A 2B7CA 2GKSA 3PENA 4CGZA 1E1QD 2WWIA 3PUXA 2O8FB 3K8YA 3IQWA 3SQWA 1VYUA 2OEPA 2ATVA 2QSZA 3NWJA 4I1UA 5AUOB 2O8CA 4LSGA 1WMSA 5KYKA 3HJNA 3AH8A 5C18A 2J0QA 4QGGA 1ZYUA 1PLKA 2C2HA 1D9ZA 1KI6B 3NHAA 3WYFA 2DFTA 3B1VA 4JT2A 2PEZA 5EP4A 2WKRA 1M8PA 3M1IA 1FW6A 1Z22A 3T15A 1S96A 2CK3A 1W47A 2C04A 2O0KA 4GRAA 1NIJA 3NC0C 4A0GA 4AI6A 1G3UA 2ZU0C 3SC3A 2IYSA 2QAGC 1IJFA 1F2TA 2GNOA 3QXXA 1E1RD 1GWNA 3X2SA 5JFGA 3AV0B 5IRCD 1CJTC 5F98A 2H1LA 3OAAA 3SYNA 1W5TA 1OJLA 3PQCA 2IWHA 1KY3A 3UATA 1NN0A 2A2ZA 1N6NA 2D7CA 5FPTA 1G3RA 2FA9A 521PA 2LWIA 3TSZA 3AM1A 3ECCA 2IC5A 5KPDA 2X2FA 1EXMA 1U9IA 2GTPA 3U4QB 4IFEA 2IYQA 2OXRA 2G0TA 4NYJR 1XRJA 4B34A 3I4LA 1JI0A 1Z8FA 2ZI3A 3A58B 5BYJA 4A92A 2PBRA 3QXHA 3K0FB 3A1SA 5JCZA 3AKCA 2WTUA 3SOPA 5FUWA 2JJ8A 4N3NA 3DPUA 5CB6A 2QE7A 2WWYA 1E79D 4XTRA 5HR5A 1JXOA 4FIDA 2ZROA 1EWRA 2FJUA 4TSFA 2IYWA 4URZR 1QVRA 2ZSEA 5G41A 4G5QA 5BN3A 3WMEA 1E2EA 2ORVA 4PQRA 1ZU4A 3F3YA 3A1UA 3TE6A 4FXPA 3K0AB 2JLYA 2PX0A 2XZLA 2OT3B 5DYGA 2JLUA 3BFVA 3GFTA 5JHGB 2PLRA 4Q4AA 1ZD1A 1SXJB 5J5CA 1ZD9A 4UNQA 5EZ5A 2GJ8A 2BCGY 2JLZA 2IK8A 1KMQA 1FMLA 2W6IA 4PO9A 2CVHA 3PFIA 1W1WA 2BBOA 1FP6A 3BXZA 1CR1A 3FFBA 4U5XA 4UQOA 5LB4A 1G8YA 4DWJA 4DSNA 4V03A 1IY1A 2IYYA 2G9NA 3R9IA 3X1DA 1X6VA 2MSEB 3ND8A 5GJWC 4PC7A 2YNMA 3D6TB 4MUAA 1YZKA 2ZJAA 4KFSA 2D7DA 3TW4A 1YRAA 4BFZA 2O0JA 2A5FA 1QHNA 4E09A 1SKYE 3BH6A 3RVBA 4HDOB 2OBNA 3MUFA 4G5GA 2GJSA 3EAQA 5FOUA 1D2MA 2B8WA 2OLJA 1DTSA 4BLSA 1X3SA 2Z6VA 3LO5A 3ONWA 1IN7A 3DOEA 4HB3A 2VP9A 1Z0DA 2QPTA 1NKSA 4A9AA 4AG5A 4DCVA 3AVTA 5DI3A 2HXSA 4BE7B 1VCOA 2ODEA 3O8BA 4WIAA 2ZREA 1OYWA 1N6LA 4R9UC 3ZVMA 3M6AA 2ZYWX 721PA 1MKYA 1P3JA 4C30A 4CRWB 4DLVA 1TU3A 4EFNA 3KXLA 1XB2A 3IO5A 2DYKA 1VHTA 4IEEA 4GZMA 3FMIA 2BEKA 5JEEA 4LOAA 3PJRA 3EZFA 2CHVA 2H57A 3CKLA 3BB4A 1MABA 5L3QB 3VX4A 1NG9A 2VTKA 4TMVA 3T1TA 1IJEA 2V9PA 2FPKA 2OFOA 4GL2A 1WBDA 4A0FA 4DSOA 4WZBE 1Y3AA 3CNLA 2PZGA 3R9XA 2I1VB 3UKDA 3QKSA 4B3FX 2J41A 1KKLA 2ODBA 4KXFB 4X8OA 5FUXA 5AJXA 4QGHA 4ZCMA 2EWVA 3U7FB 1FP7A 3KQUA 2RGBA 5EE5B 3UK6A 1E2DA 1WF3A 1XMSA 3I5XA 1OYYA 2NPIA 4DDTA 4MYCA 2QL6A 1E1QA 4JLVA 3QE0A 3SQXA 3MGCA 3SHWA 4DC9A 4PXAA 4E07A 1P62B 3NH6A 2EFCB 3SEAA 4Z51A 3UMRA 4EFLA 3GEEA 5JRJA 1XFAA 1AZTA 2R6CA 4MKGA 4GP6A 2C9OA 2ERXA 4Q9JA 2JJ1D 3NXSA 3U2QA 4M9QA 1CTQA 3AVQA 1KHTA 2ZAMA 3DKPA 3L2OB 4BUJA 1RRPA 1LS6A 3AB3A 4JVSB 2OG2A 2P0EA 3CBQA 4I1OA 4RZ2A 2IW3A 1MO6A 4HAVA 1W49A 1R6BX 4OI0A 5CIWA 5EXSA 1OFUX 3ZYCA 1G41A 1E1RA 2R2AA 1VIAA 2DWQA 3WHLA 4B75A 5KPJA 1E0SA 1YZQA 4TYQA 2VRWA 1EWQA 1ELOA 1KKMA 1OV4A 4K8OA 2KBFA 5H1YA 4X8LA 4OI1A 4M53A 4CEIA 4JL8A 2V7QD 2OFWA 2QUZA 2W2TA 2XEXA 2RAPA 3GFOA 4CIDA 3G5UA 2IEZA 1OB5A 2C77A 1RPZA 4M21A 2OSBA 4CW7A 1T5LA 2ZVPX 1U8AA 2HXYA 4YDSA 5IHPA 4E03A 5IDVA 5LDDC 3B78A 1OKKD 5L3RA 1E79A 3BE4A 4OJQA 4PR0A 3K0EA 4IXMA 1E6CA 2ZE5A 1DPFA 1UDXA 1V5WA 5GADl 1HUQA 1HH4A 1EGAA 1P60A 3KUDA 1IXZA 1PLLA 2YV5A 3RC3A 3TW8B 2EFEB 2OCAA 3RRNA 3LLMA 4TLCA 3HU2A 3C14C 3EC2A 2ODNA 1R7RA 3QJYA 3B9PA 4MRSA 2IWRA 1SQ5A 1GKUB 1OHHD 3AGPA 4PHFA 5FOSA 1JAIA 3T1VA 3ZZTA 4PFSA 1T3HA 4IVQA 4AK9A 2K5UA 1R5OA 2ZRKA 4KFUA 1NBMD 1TL7C 1II0A 3UG7A 1LTQA 3RC8A 2VHQA 3H84A 2ZSBA 3H2YA 1AQUA 1U9IC 2NOAA 2ZJOA 1CS4C 1GOTA 2GJAA 1CR0A 4UXJA 2EYUA 4IDPA 3GLFB 2ZRBA 2ZQ5A 4ZKEA 4AG6A 2BMFA 1NY5A 2HT1A 1W2HA 1WCV1 2FNAA 1KSGA 3WY9A 1Z2AA 1Z0IA 1Z6XA 2HF9A 1X1RA 4H9GA 2WOJA 1NL3A 2ZJBA 3QI2A 4KLZA 1BS1A 3WP1B 1A82A 3MWLA 5FOXA 3I62A 3GMTA 5L8VA 1DAEA 2WJYA 1TQ2A 2P5SA 1J8MF 2QAGB 4GBMA 4V0ME 1KSHA 1XD2A 2QI9C 4A8JA 2GRJA 4EFMA 5B57C 1W4CA 4V0MA 3B1XA 1E69A 1TQDA 1ZCBA 1A2BA 4OHZA 2EWWA 4RZUA 1W36D 2XNDD 1L7VC 4BQSA 4FMCF 3F8TA 3IHLA 4O0MA 1ZNXA 3SI7A 3TK1A 4HLQB 2EFHB 3BERA 4Q1CA 3REGA 4IKEA 2FSFA 2LKDA 3GJ8A 1UEJA 3NG1A 1E9BA 2IX3A 3V00A 4R98A 2V1XA 3H4MA 1RJ9A 3EPJA 5LPNA 1KJWA 3IIKA 3E70C 4GFDA 3NC1C 4C7OA 1ZNYA 5CJ2A 1TQ4A 2J87A 3OIYA 5IT5A 3AF4A 3A37A 3AGQA 1U81A 2GXQA 3B5JA 2AD1A 4PO1A 5KNBA 2R62A 3WMGA 4DSUA 3Q85A 3RS2A 1F2UB 1LS1A
chains in the Genus database with same CATH superfamily
4OI2A 2IW1A 4QYWA 3B1YA 4JK3A 3AQ4A 4GIBA 3LD9A 5A6VA 4FONA 4ZV7A 3HXPA 2I6FA 1Z8NA 3L9WA 2QMYA 1D2CA 2OEVA 3GL9A 2JJ1A 1HRKA 5SZKB 1ZA1A 1RWKA 1H2AS 1N6HA 8MHTA 2IYNA 1DIGA 3DCIA 2PWYA 3MJFA 3IQXA 1Z5VA 2H08A 3T7TA 3T3IA 2RHJA 1CUUA 3Q9SA 3RRBA 1YSCA 1U31A 1TCCA 2ZVDA 4P34A 4RPHA 5GV7A 3EXHA 1KEVA 3NTQA 3IEMA 4K6MA 3MVEA 4YECA 3H1AA 3F8WA 1G18A 3W2WA 3VI3B 1G21E 1D1TA 1USGA 3FZEA 5DTQA 1JMWA 3KZCA 2Y99A 1GYQA 1WMAA 4NY3A 1RYNA 5EUBA 5AM1A 1QPBA 1RYZA 3F7MA 3T54A 4U1RA 1D9XA 1Q2UA 2H06A 1X1EA 3OU7A 1YMVA 1ODJA 3H42B 3PYXA 4ZHQA 2JLXA 1NHWA 2G0AA 4UATA 4RKFA 4UMDA 5JNUA 4NZ9A 1NXQA 3V8PA 4C07A 3FOAA 2I4TA 1FP4B 1UZLA 3E6AA 3QWHA 3CYFA 4AROA 2PVSA 3RKOF 1M6YA 4TMXA 1Q19A 4CWAA 1JDBB 4KMRA 3K9GA 2XB8A 3WK6A 3KKNA 3F6CA 1M2JA 4ZTZB 1Z3CA 4ARCA 3HI6A 1OCOC 4BQQA 1G1MA 2RKWA 4CLOB 4LJ4A 3ZD8A 4HGRA 4DIEA 2Z2KA 2XMBA 4YMSA 4MW4A 3WIDA 3U6KA 4J1QA 2AR9A 1VZ2A 1YR1A 3W9UA 1G5RA 4N01A 4UOEA 2XYGA 1GFIA 2AYYA 4LBZA 2ZZKA 1ACMA 2VSFA 3MT9A 3V6MA 3RBVA 5BN3B 1Q0KA 3V7WA 1R8QA 3MG9A 3ONVA 3Q5DA 5C7YA 1C7IA 1YZ3A 1SB8A 4J1TA 2KLHA 2OK7A 2XLMA 4LTDA 3FRJA 3T0IA 3OIWA 4QQFA 1A1SA 3AIKA 1E2UA 2UYYA 5B1AC 4L6CA 2ZXFA 3U26A 2LNDA 3DP7A 2E21A 4ZICA 3L4SO 4Z3KA 2PUAA 2WTNA 3I2IA 3VPBA 2A7QA 4BZPA 4FFBA 4N8EA 4TKLA 1LIHA 2A5YB 5ENVA 3EK2A 2VK8A 2JBHA 3L5KA 1I3MA 4XVQA 2R84A 4UEOA 1NBAA 3IAM1 2YJTD 2AHRA 4R40A 3H75A 1A0BA 3MBGA 2QX9A 2B8NA 1U7PA 3TLAA 3BD6A 2A9PA 2FG5A 3GNTA 2FP4A 2XB2A 4RXUA 3WRWA 1ZG3A 1V43A 3DEYX 1WAMA 1PNOA 1Y1KE 2HHJA 3VO1A 2BR5A 2IHVA 4JJ4A 1TJPB 5JRZA 5JISA 1YCDA 1SXJD 3GJXC 3O31A 4ND8B 1X7YA 3QXJA 3KOOA 2LV8A 5BNFA 1YE5A 5AKEA 3ZN2A 1E6WA 4YRQA 2XYVA 5BURA 4FBLA 2WU1A 3Q4GA 4RIGA 3HA3A 1P0QA 1GAXA 2FEOA 3DXZA 3UMSA 3H5NA 4O2BA 3HTXA 4CQLA 1VKHA 5KJFA 1QYDA 1LCIA 3EUEA 4RK5A 5T67A 4V0RA 3NEJA 3JQEA 1QWOA 4EVQA 1NVXQ 5JH7F 2Z43A 1ZLXA 4LSMA 2Y05A 2PG3A 1RRFA 3S9OA 4LZAA 1ZW1A 5JW6A 2QM7A 4FKZA 4ME6A 4Z4IA 1DOHA 1GRVA 2AMFA 2NO6A 2KHZA 1CY1A 4ZAZA 4XWOA 1AU9A 2AI3A 1H2FA 1PG2A 1SVIA 4RJIA 5BSMA 3I30X 1TJ5A 2PMKA 3GJ4A 4LZOA 1PSWA 1A5BB 1WXHA 4BTVA 3FETA 1AA6A 4R9RA 1C8BA 1XMJA 4KE8A 3JCZA 3RU3A 1KGDA 5BMVA 3I39X 1M2OB 4J91A 5U4XA 1OAKA 1XWJA 2O3UA 4V02A 4MUJA 4JGIA 2CF5A 2WG1A 3I6YA 3TEMA 4Y2VA 5JS5A 3HU1A 3I9V1 2V65A 1R0BA 3K8QA 4QICA 5AJZA 2BAGA 5AFSA 5J59A 1A9YA 2YYSA 1XTSA 3KAJA 4I5IA 4MTLA 4CR6A 3ESDA 2YC4C 2FUNB 2WHPB 3PUHA 4RHCA 4ZVQA 3BWBA 4EF6A 4FMDF 4WKPA 1HYQA 4RY0A 3UJ7A 1GVHA 4EB3A 3GLIE 5LZ8A 1M73E 3E5RA 1T2CA 5LZ5A 4IQ0A 5IUJC 5CURA 2GWWA 2EBHX 3QU5A 2WUWE 1QQTA 1M34E 4F5WA 3OPXA 2WE8A 3K6BA 1NPDA 3ELYA 3JX9A 3WG7C 3D4IA 4LX8A 3AFMA 3TMAA 5FWDA 4B82A 1CY6A 4RYLA 3CF4A 5KVCA 2MT9A 3CW8X 5AI9A 1YJXA 3KQHA 3NT5A 2AR7A 2O19A 1W36B 2Z83A 2BF7A 5AJTA 1M1XB 1AA9A 1E0KA 3HN2A 2Y1OA 2R6ZA 5CYPA 2FN3A 2QTHA 4ZQFA 3CRRA 3INGA 1ATZA 1C03A 1RHRA 4ZCTA 5BYAA 5HQTA 2J0UA 5A62A 3EE6A 2QIOA 3RROA 2BYTA 5BP7A 2AX4A 1F17A 2DUJA 2IPNA 3H5RA 3ACBA 4UHDA 4NBLA 3QYJA 3QQ5A 3VR6D 3BVPA 1RXIA 5LXTA 3HP7A 1AK1A 3QMWA 3GJZA 4YRBA 1CBUA 3JYLA 4V38A 1EXDA 4PJLA 4RACA 3ZXYA 2O7VA 3I01M 3IHWA 4O8ZA 2CJXA 4DR5B 4JI2B 1YOVB 4QDJA 5KYUB 1KXZA 1X70A 5EUCA 2WKPA 4AMVA 1SOAA 1HQKA 2AOUA 2HN9A 2DT5A 3L8GA 1Q57A 2WSIA 1JPNA 3K53A 2I0FA 3BILA 4HWGA 1Q1BA 3NUGA 3VH4A 4ER9A 1BDMA 1C4OA 1SHKA 3R6LA 4YGXB 3ZS9A 4XQGA 1WIWA 3BICA 4EMTA 5TPZA 5JOQA 5BSRA 1N57A 3T06B 4KWTA 2VUTA 1ZGJA 4XGIA 5EEGA 1K04A 3A26A 2BM8A 5EE0A 4G81A 1XKXA 3WYGA 5TX7A 1Q21A 2VSYA 1FFHA 2EL9A 1WXQA 3LBAA 4KQ6A 4ISCA 3VHXB 1DEOA 2PR2A 1QS0A 4KX3A 3WMRA 2BSAA 3BIWA 4KXVA 5COBA 3TUJC 1HYHA 2Q5JA 3T95A 5LP6A 1ZJ6A 1U5AA 2PT7A 2ZAYA 2P8SA 1JDSA 4NYMR 3VRHA 3G0OA 2DSNA 5JCOC 5TGTA 3EXFB 2PL1A 4ZVMA 5ALHA 1BMFA 1NN5A 4IOLA 3EPLA 1WCYA 2DWPA 4U5BE 2GSDA 1W6RA 3DOOA 1RRMA 5GONB 2NN3C 3BRWD 1P81A 3SY8A 2BFMA 4QDKA 3UCFA 4IR7A 3HWSA 4NABA 2OC9A 1R4NA 4GZLA 1WABA 2C99A 4KQWA 3JAMA 1YH3A 2ZRLA 5IW8A 4X00A 3SS7X 3FPSA 3N0WA 3DZKA 4II7A 2FUKA 3L8EA 3UB3A 5ICCA 4E18A 1BN6A 1JX6A 3M6LA 4FS8A 1AG9A 3WGHA 1BSVA 2YWHA 2YVUA 4DG9A 1K2WA 4PIVA 3FPHA 3PUIA 3S29A 4DF3A 3TQSA 4JGGA 2AA3A 1QO0D 4GSLA 2HCBA 2JPUA 2GHRA 3LK7A 4EQ6B 1P72A 3W1WA 2PFGA 2WP8J 1ESDA 3LBFA 4D45A 4WVFA 3L8YA 4S2UA 2I1QA 4AKEA 1FXSA 2GGSA 4LHZA 3W78A 4NYJQ 1BQEA 3KKKA 1HL7A 1NNEA 3AHJA 3GZJA 4PX3A 1O54A 2BEJA 4L8WB 2LDXA 1TU0A 1U0FA 4DRYA 3P27A 2DKOA 1W5EA 4RZIA 4U0KA 2ILVA 4XJVA 3RQEA 4DR2B 1P6QA 4AL0A 4UCWA 2IHYA 2W48A 2VHEA 3A6EA 1L7MA 3LPNA 2GCNA 3S2FA 3IBGA 1VRCA 1UFOA 3CB4A 2CY0A 3DD7A 4Q4JA 2QVXX 2WYVA 2HWYA 1QCCA 1NBOA 5E3HA 5A4JA 3ICOA 3VNBA 2J08A 4YRZA 1V3UA 5T3YA 3GH1A 4OO3A 3SX0A 1PZXA 1IAQA 1SBHA 1LDEA 2QZSA 2X41A 5FPHA 3PHHA 4KG7A 2H17A 5MGBA 1J21A 3ZDRA 1CDZA 5TPWA 2ZIWB 4Q1EA 2OXTA 2AE1A 3N8NA 3ILVA 3GVIA 1TMYA 4FFSA 3EVEA 3NDPA 2R1UA 9LDTA 3ABZA 1SVNA 4ACBA 3CR3C 3TD2A 5JZSA 2Q21A 1XLTC 4KOEC 1OF1A 3PQ5A 3MWGA 2KSFA 4IZ6A 1E2MA 3M9WA 3KEMA 1FRZA 2I3BA 4MLDA 4XVCA 2BCJQ 3N6XA 4H15A 4F72A 2ZJ5A 2PXAA 2AHOA 4GR9A 2IS2A 3K0AA 3UWOA 1ARZA 1E20A 4KQJA 2A9QA 3KZMA 4QJ3A 1WPRA 1OXBA 1ONSA 4GI2A 3QMKA 1L5OA 1A69A 1YUNA 1EVYA 1N6PA 5JYDA 4OB7A 2NUPA 4DCMA 3OJCA 3OLCX 2JZOA 5T64A 1X87A 2E87A 4NC3A 2XZOA 4QWWA 2IZ0A 4DLTA 3MOSA 1KI2A 4FYWA 1O8CA 3QE3A 1DO0A 1YNOA 2VJQA 3A4VA 2HJMA 2Q5OA 4KAAA 1YMQA 4CTNA 4IDQA 16PKA 3FOOA 1YGPA 2X8LA 4MCHA 1W2WB 2QWXA 4BKMA 4BMVA 2NSJA 3US6A 1JU4A 2OCBA 4RKEA 1E3IA 1O5IA 3TPCA 4KZPA 4Z4HA 5ERGB 2FU5C 2OBBA 3WLMA 1FVOA 1UJBA 4HUTA 4HADA 1HDZA 5AK5A 2XGSA 1I9CA 3RK0A 1XJ0A 2DZDA 4DB2A 3EG5A 3FCOA 3MWJA 2JFWA 1KK0A 2NG1A 4ZVLA 1UPTA 1QGAA 1VMDA 2ZKLA 1XPUA 2V74B 2H7OA 4PTLA 2PKYX 5HCIA 1U0OC 1RWBA 3B0PA 4TLEA 4S05A 3L8JA 1XRPA 3LPCA 4MP3A 1V74B 3HXQA 1Q22A 4NLLA 1NMXA 1T9DA 2Z8YA 4IRUB 1ZUNB 4JJKA 2EATA 5DULA 1NGSA 4P38A 4RMNA 3UJAA 3TGLA 1E9CA 3T9AA 4KPUB 2Q3TA 2PVPA 3I5YA 4BG0A 4JJGA 4L07A 3K71B 5JYBA 4JODA 4EUNA 1R27A 2P75A 4EZBA 1B14A 4EY5A 1Q20A 2FUCA 4DILA 2NYUA 4XEUA 2WYWA 3GYBA 2VHCA 1M8GA 4JYCA 1BW9A 1RW4A 3HUTA 5HKOA 1KBQA 2ZJFA 4RPLA 3AI7A 4ZZ0A 1UBSB 3KFXA 3A9RA 1EE2A 5ELXA 3OAAD 4XWGA 2D00A 2ATCA 1B3RA 1GKLA 3PXUA 4D0LB 4ENQA 1QORA 3GLRA 3GU3A 1OIVA 3D4LA 2OUIA 2PRKA 1T3TA 4YDRA 5G0VA 2BMEA 3TLYA 4ZYTA 5C32A 1AF7A 2XT9A 1CFJA 3PC4A 4PYRA 5DXAA 1CEEA 1RMTA 4KO3S 1U8FO 3UJDA 1Q2XA 1ZOIA 4O2RA 1I3OA 4JEMA 4ABTA 1T9BA 3LT4A 4YMHA 1G9XA 3N70A 2W6NA 3BL6A 4HDQB 1FCJA 1OLSA 2XE4A 2WUDA 3SS8A 2WUVA 4R2MA 5LA6B 2R5FA 2FAXA 2FR1A 1CR4A 2JIQA 3H2VA 2IPOA 3HCOA 5BSTA 4NZZA 3ENKA 4MV5A 5ITWA 4I99A 1EX1A 5H68A 4I3HA 3ZX5A 4YROA 2F1OA 1KO1A 3QE9Y 3WWOA 3WLTA 2XXAB 4EUFA 4X20A 2V7BA 4F2WA 2NZUG 5FCLA 3KG2A 3E5NA 5IZ4A 2WJPA 3UBMA 3STYA 1D8TA 1TEVA 4C4SA 5FJJA 3TGWA 4Y98A 3IVRA 5BWOA 2X51A 2O1WA 2VDQB 1ULHA 4TQGA 1E92A 1RXSA 4JUFA 3PFWO 4B2YA 2O0KA 5HRUA 1XQ9A 4GRAA 1FP1D 4A0GA 3Q2IA 1IJFA 1EQ1A 1P45A 4FYHA 5HFNA 3U7QB 5JZ9A 1E62A 4Z0HO 3GRAA 3EQ9A 5E3JA 4CCYB 3TLBA 1U9IA 4BCCA 4MPRA 4ZA2A 4PLTA 2PA3A 2AFIB 4ODIA 3MLBA 4RS4A 2ZROA 2I2XB 4FHFA 3ETCA 2QTNA 4PQRA 1FNCA 3BFVA 2CD9A 3HB9A 2O7NA 4RTMA 2QTBA 4JU8A 1W1WA 1PVDA 2QB5A 2Y68A 1OI7A 4J7CA 4D8YA 3D6TB 5ER9A 4WL0A 3TXXA 1QHNA 4L2IA 5KWIA 1IC6A 5H82A 3LO5A 4A9AA 1PVVA 1RWOA 4L9AA 3PJRA 3F1LA 2CHVA 3EJWA 3G02A 2KLBA 3IOBA 2DBVO 5KNBD 1U2DA 3K0BA 4W5OA 5ED0A 1N4DA 3TB4A 2GM9A 4KB5A 2P6OA 3SHWA 2FWPA 3CSSA 4O1MA 4MI3A 3MERA 4Q9JA 2FMUA 2JJ1D 2KJGA 3AVQA 3TK0A 1SU4A 4LK3A 3KYCB 3NKDA 4E5DA 4WK2B 1Z5UA 1JHUA 4M9CA 2ZFUA 3V7OA 2G28A 3NS7A 3QQPA 2V96A 1NM5C 2KQUA 3O0TA 4K87A 4D98A 1JQDA 2HJWA 2OMKA 3U09A 1PLLA 1R7RA 4A8TA 1K8XB 3VYSB 2XOEA 5CGZA 2ZOSA 4Z4CA 4KFUA 3UG7A 5NLLA 2FPOA 2E7ZA 1E3WA 1ZBQA 3H2YA 1CS4C 5K03A 2R00A 2VK4A 4DR6B 4LF5B 4NV1A 3ZWDA 1NJ5A 3GRZA 2VNAA 3ANMA 2J9UA 4UFPA 1X1RA 2WEKA 1P1HA 3QFFA 4LFBB 4I36A 1MMAA 1WLSA 3QY9A 3K35A 5FBKA 1UXGA 3NOVA 2QR5A 4FMCF 5AKGA 4DGSA 1IWPB 2NP6A 3NG1A 2ZM6B 1XHFA 3CXRA 3GPCA 5CBPB 4U6NA 2I2WA 3B5JA 2AMLA 2AD1A 3IUPA 3DZAA 3KT6A 3K92A 3UAZA 2I6QA 3QYPA 2ZB8A 1L5HA 2EWMA 2YN0A 1C14A 1KDPA 1EI9A 1VJ1A 1WDTA 1YO6A 4M2LA 2O1SA 5EXPA 3ZY3A 1SVSA 1QRTA 2EZ8A 3PUVA 3B38A 4I81A 1KE1A 1YTLA 3WBJA 2F4VB 4B31A 1JEEA 2R6FA 4RNDB 2IIPA 2F9MA 4D8TA 1GFSA 3OPMA 3FCCA 1DT3A 4RPIA 1ZN9A 1DKLA 2CVPA 3UICA 1RRKA 3HR7A 3IUYA 2V6JA 3N9IA 4E0HA 4FSXA 3P4XA 4NCKA 2HHHB 2QVGA 2W4BA 3SC4A 5IY5C 1E5TA 4FT4A 1E5XA 4WRRA 3WQBA 1T01A 1NR5A 2QJFA 4HLCA 1OLUA 4HNSA 3BCHA 5E0KB 3HG7A 3FVYA 5JDCA 3MRTA 1MEOA 2ZM5A 3U44A 5IKMA 1EDZA 1GKKA 1DBSA 4DWOA 5KS2A 4HH1A 1FYWA 1EIZA 1VCHA 3LA6A 5T8KA 5KC9A 3A1CA 3T61A 3EFHA 3O8OB 1VFNA 3O3CA 3T9CA 3EIXA 4KUGA 2G71A 4OLFA 1UUFA 2J31A 4B73A 2FMTA 3THWB 4N0DA 5L0FA 5FLKA 3P52A 2Z0MA 4CLRA 4JJ8A 2W4MA 4H18A 4BKPA 4J16C 3D59A 4BFVA 3A1EA 1Q0HA 3VR0A 4BE4A 3ORYA 4DT1A 2WWWA 2MHRA 4YP9A 4GKAA 2A0UA 4NPCA 5YASA 3CLTC 5EIXA 1J33A 1JLSA 1NC1A 3OFNA 5KX5B 5BT8A 4UU7A 1ETHA 2H0AA 2KYHA 3OEWA 1ZMXA 4MRPA 1YYJA 4WZ6A 5AVTA 2XJ9A 4K9PA 3GELA 4ZGGA 5FOTA 3N2ZB 4NJEB 4D0NA 4AMUA 4MXDA 4WXPA 3UANA 6ABPA 1TKAA 4MYHA 5TT0A 4RELA 1E4YA 5HFAA 3U3KA 4JFRA 3FSEA 5BV7A 5HVNA 2QYOA 4BO1A 3SXUA 4PFPA 3KAKA 3C43A 3B20A 1YB5A 3B9QA 1UR5A 4RQBA 5K0CA 3DMTA 3R3VA 4ZOEA 5HF8A 3OCJA 2Z9CA 3KUXA 5CLHA 2J9GA 2FEPA 2DQKA 4JEHA 5B53A 1CFZA 1P4RA 3IRVA 1G5HA 2I76A 1Z5ZA 2GS9A 3MAAC 3SPXA 3WO1A 2Q41A 1GRQA 2ZYVX 3TJ6A 3ZU3A 2D8AA 1S4QA 1KMIY 4TS4A 3IALA 1QQ3A 2XL4A 2X5XA 1JIQA 5FNVA 4GPAA 5DGIA 1UBGA 4YGYA 2RGAA 2FEXA 3GJTA 4KE7A 4HRAA 3RH0A 4YP5A 4R51A 2QG6A 1T9GR 3P96A 4XKJA 1EKYA 4RM2A 3LWNA 1SVOA 3IPXA 3W8DA 3RVLA 2OV1A 4QWMA 1QIGA 3SDSA 2FRDA 4E3ZA 4DB4A 2HUPA 4EI9A 5K3AA 1N7HA 1DWUA 3HDVA 4OLJA 3EZGA 4P9FA 1C1DB 2QOEA 3VOBA 4AN1A 3JYOA 5B6IA 3UFBA 1N2CE 2O7QA 2F67A 2NLOA 3PQ7A 5D92A 3PNOA 4BVHA 4MAAA 5GGYA 4OHYA 5TLSA 3MTGA 4D26A 3DTTA 2WJAA 4B2IA 1SXGA 4IDGA 3QENA 3S68A 3WE7A 5JXWA 1A5SB 3ZIDA 1OIXA 1R0YA 3LX8A 5L0DA 3TR0A 2F1RA 5TT1A 1JKJA 2I6XA 1OX6A 4MAMA 1LPNA 1DQSA 2NO7A 4RSRA 4R71A 5KNCA 2FWRA 2PUVA 5B3KA 1X9GA 2H9YA 1DCMA 4YRSA 5IF3A 3FI9A 3GUUA 4UTNA 4KV7A 3AI2A 4FFPA 2DWOA 2HLNA 3UAOA 1CP2A 2WDZA 2H5JA 3DGEC 3BE5A 1XD8A 3FVQA 4C05A 1MZPA 4MUKA 1LW7A 3KU1A 1MQ9A 4ZAYA 1DBRA 3WOHA 5EFOA 1JA0A 5ALFA 2Z57A 2QMOA 1L5ZA 3A4MA 2PJUA 3T0GA 3CF6R 4ACAA 2J32A 4CR7A 2ZI7A 5DQTA 1I1OA 3O2QB 1ZPDA 1L1RA 4UKDA 4R2LA 3OEHA 4NICA 1MR3F 1G6OA 3T4XA 5CG2A 2PH7A 4EB6B 5JZOA 3CWZA 3I37X 3HBLA 4HNGA 2H63A 1U0EA 2PL3A 1ZH6A 3V32A 4EG8A 3FKJA 3BE8A 4QUEA 3E4CA 3UGKA 5TPZD 1HM5A 4HCJA 4RHXA 2C7PA 2GBLC 4QGBA 3WB0A 1GGMA 4DZZA 2QAJA 2P5UA 2E5WA 1I3KA 1A8HA 3SXKA 4MVJF 3ERCA 1T4CA 3A05A 3Q15C 1X15A 4MGYR 4P36A 4DBRA 4BV9A 2VG8A 2AMYA 2EGHA 3EULA 3B60A 1FYFA 1YJBA 1GVNB 4H7FA 4KJXA 2WJ6A 4NOLA 1GPKA 4CG3A 1A7JA 4QFMA 4ABYA 1Y5LA 6PFKA 3C8MA 3TPZA 2XLDA 3KZ1E 2HEIA 1H2WA 1BMFD 5I9LA 3ZWXA 4H4EA 5DCYA 1FNNA 4PTYA 4EUSA 1RZVA 1ICEA 4EZEA 3O8QA 2IZ7A 2PU5A 1QX3A 1JMVA 2IPMA 1TVCA 4KIJA 2UZIR 2RK6A 1P3Y1 4M8KA 1S7CA 3K0CC 3Q8LA 4KR7A 3SJ7A 5ISMA 4EJSC 1GGNA 2W6ZA 1T2EA 4A6EA 3CVUA 4OBXA 1QCYA 4U4AA 3H9BA 2HRBA 1ECGA 2CXXA 2IXPA 4OPMA 5AVVA 2I29A 4LBWA 3NYMA 1DTWB 4BFTA 1RQGA 1M2EA 2YASA 1Z2CA 4AJKA 3DBIA 1O95C 3EOZA 1SBCA 1GQRA 1CEYA 3L46A 2UYCA 5B1HA 5COMA 2CXPA 1PNRA 4HN2A 1CY2A 4A03A 5B3LA 1DCTA 2W6MA 4UDYX 2Z6UA 2Q3EA 5E33A 2C5AA 1JHAA 4O0LA 5I9MA 1VIVA 1D7AA 3R6GA 3C48A 5DKFA 5CYFA 3IBFA 2X2EA 3RT9A 1L4BA 5CB4F 4C0WA 4B44A 1G5TA 3SHOA 4ZAWA 1QV9A 3QKRB 5AVSA 1D1QA 4ONSA 1XJQA 2ZZNA 4CEJB 2Y39A 2B8EA 2WHRA 2OLKA 1UOOA 1FFXA 4EPVA 4K9NA 4FWTA 2GPYA 4WLVA 3OFVA 1L6RA 2D1FA 1PR3A 1RXCA 2HRQA 4CM9A 2N42A 1WPGA 5CA0A 4JI8B 3PS9A 1MTZA 4YAEA 2ZAOA 3LECA 3FTPA 1ZYRF 2YY6A 2HLDA 2TRSB 3HPQA 1RJFA 4A15A 3M1LA 2CMDA 3R9XB 1CT9A 5KSOA 3ZC4A 3BCRA 4DABA 4QLBA 1G2IA 4NFLA 4L75A 3ENZA 2XGGA 4RESA 4L3OA 1W9MA 2H1IA 1RJDA 1F2DA 1Z33A 2W43A 1NQ5A 5AW3A 4B7AA 3QHPA 1ISSA 3T9BA 1B23P 4K0RA 2HK6A 3RRJA 5HZMA 2ST1A 3TECE 4H0FA 3W77A 3OCXA 1YL5A 4ZWNA 2GKGA 5JHHB 4DMKA 2AWYA 1NVDA 1UP6A 4UPEA 4O4JF 3VBEA 5L4NA 4J0HA 4JI7B 3REQA 4FJ1A 3HFGA 1J2YA 2FY8A 1RBYA 4ZQHA 2R66A 3HO8A 4QOSA 4PLHA 3P2YA 3IQZA 3BTUA 1W85B 4P3KA 3FOCA 4CCAA 3RBAA 5A5GA 4ESVA 4DJDC 1ZHTA 4D99A 1S89A 2XWSA 4EVSA 5CFQA 3KEQA 4NENA 4R2HA 1VM6A 3EZ2A 2C4NA 3M4ZA 1TVEA 4XM2A 4PX5A 4A8JB 4MVJG 3NT4A 5JS6A 5EZYB 4U02A 2J9BA 1CQZA 2WT8A 1JIIA 1BCRA 1HI9A 3L4JA 1SCUA 1HNXB 2X0IA 3IUBA 5EK0A 1RJ9B 3COPA 1QE3A 2K2WA 5BOSB 5C35A 1WOMA 1EA5A 2Q9CA 1SMKA 4MI6A 1MPXA 4HNHA 1OFIA 1SUSA 2Q3BA 4HQ6A 1N5MA 1C50A 1MB2A 4P4NA 2APJA 4C4TA 4GLBA 4DVYP 1EP1B 3D5EA 2X58A 1HF3A 4C7JA 1ZRSA 5FBHA 3AFIA 3QE2A 1WDLA 3RVOA 1VSQA 2J9VA 1LRJA 3GRYA 3KWLA 2ZBPA 3T34A 2IJGX 1QC5B 2R96A 4QFBA 1FVXA 4QUKA 2QLAA 4NFYA 1T5IA 1TLTA 4IIJB 4GKBA 2WZBA 3IP9A 4FWBA 2C96A 4FGUA 1EZZA 3BTSA 4JC7A 4FYXA 3RIEA 4K9KA 3ZNNA 2XADA 2O5RA 1G8HA 1YGYA 5C7LO 1Z7GA 3QTHA 2VDWA 4OHCA 2BKUA 4RWZA 3DV9A 3RAJA 4DM7A 3ZD6A 1EVJA 3NRBA 4C2AA 2GZ2A 1SCBA 4KAJA 4ZKDA 1ZUD1 4M0FA 4R2IA 3BD8A 5DHRA 1QDLB 2VHXA 2HMYB 2KYRA 5CRIA 1NU8A 2BFAA 2R48A 1E85A 1EFVA 1FS5A 3HKBA 1TO6A 3DEKA 3TZQA 2BMVA 4CYMA 5J4KA 2G1AA 1Y9DA 3I32A 3NVKI 4IBOA 1IM2A 2JHCA 3PUJA 3O8RA 4RTRA 2EL7A 2C8JA 1C9MA 4AD8A 1V1MB 3M79A 1M33A 3VNQA 1G2QA 1OLXB 3HKCB 4D8XA 3N5KA 1VMIA 3L7YA 1H3FA 5JPIA 2WWHA 3LQRA 4QGSA 4ZU1X 1NI4B 2F00A 4X66B 5C9ZA 4LRQA 4Q3AA 4KE9A 4GP7A 3UHFA 1E7YA 1BR1A 3TYXA 3RWMB 5K3CA 1XRQA 2FJ0A 2OWEA 5ALLA 1PGQA 1PT6A 2GDCA 2P9QA 1IM5A 1KIFA 3DL2A 4DCOA 5EVJA 5ALPA 2FDXA 4CIBA 2XZTA 4JB8A 3FNIA 3PD1A 5E8RA 2MSWA 1JUDA 4X94A 5FTJA 4JV5B 2VTDA 1RCPA 5JSLA 1KYIA 1AT1A 3T3EA 3IQ5A 3IKJA 4MVJM 3A10A 4YUZA 2XRYA 4U2KA 1G59A 4YN3A 3L0CA 4LHWA 2GYWA 1KU6A 3S0JA 4CTJA 4MGZR 2CLMB 1H4TA 2JGJA 3BXXA 5CFLA 3CTMA 4RV5A 5I48A 1OXKB 3JT1A 3A6HA 1ZC3A 1EKXA 3U80A 3A6LA 1RKUA 3TNYA 1LK7A 2VTBB 2V7EA 3RIGA 3QJGA 2A1TR 2GQ0A 3L0OA 1BEEA 4P6IC 1P1BA 2ZYGA 1TK3A 2FEKA 5FO1A 4X3PA 1O0SA 4CMIB 1XMXA 3SXPA 5GJBA 5D1HA 2GEUA 1UBCA 2F55A 3ZHOA 2EP5A 2INGX 2H4XA 3N7AA 1ZXXA 4MV8A 1SYQA 3I1FA 1UXKA 2FEWB 5EPUA 3V2HA 1THMA 2HRCA 2CBZA 4GZ5A 1ES9A 2PMEA 1O6FA 3LVFO 1G7SA 4KXNA 4ON9A 2IYEA 1Z8HA 4BJ5A 1GGJA 5C8YF 4Y8VA 4R3NA 5CDHA 3TKYA 3IR6A 4OHUA 1ULZA 3L1HA 4QBFA 5CXXA 2AUNA 5KOJB 1YDEA 4KX5A 4BQEA 3PC6A 4Q1VA 3EMVA 4PE5B 1RD4A 2VEDA 2XWJI 2Q6KA 3M2TA 3PUWA 2DB4A 2RHLA 2XH8A 5PGMA 3V4FA 1NSGB 1OXXK 3D2LA 5B1BC 3WGZA 5LLDA 3LRXA 5JALA 3SFZA 1GUZA 2IEAA 3FTEA 4ZJYA 1VFPA 3L8FA 3S1AB 2G83A 5AR1A 2HNBA 2NZ8A 3EIQA 1W48A 1BHSA 2QD1A 3TDMA 2VDRB 1N2EA 3W3AH 1FP4A 3GEGA 3GQVA 3IQWA 3SQWA 4M63A 1Q83A 3EB9A 5FWAA 4BB0A 2PZKA 1XJWA 3E2PA 3H1PA 1KE2A 3G8DA 1ZVVA 4AI6A 2IYSA 1GWNA 1RWNA 1SRRA 2G5GX 5DK4A 3MJTA 2P6MA 4R31A 3BZBA 1L7NA 4XPYA 2IIVA 4TV8A 3D8RA 1ECPA 3ZI4A 4E5SA 3DPUA 2YWJA 4XRGA 2SCUB 1V71A 2BGUA 4PGAA 1QF7A 1QVRA 5BN3A 3F71A 3HSSA 1QIHA 1NBBA 3UMYA 1DO8A 1P39A 5CVEA 2C7VA 3EY9A 4BTLA 3DTNA 3OZGA 4BX8A 3X1DA 3DOCA 4WWHA 3EVAA 2ZJAA 3L7BA 3TW4A 3THRA 3RF6A 3VUFA 3ZDFA 3C5WP 4WN3A 1X3SA 2Z6VA 4LKRA 4RY9A 1J49A 1X38A 1L7OA 3NX4A 3MQ4A 3C4VA 1BROA 3QEAZ 4I9NA 1A7AA 5B1IA 4R9UC 2IVZA 3Q5GA 1MKYA 3N6VA 3ZLUA 3PQEA 1XZKA 4BNYA 3DOHA 2H7VC 2OYRA 2CNDA 3E1GA 1G5IA 3T1TA 3DE0X 1E5VA 3KOUA 2PA0A 1AQLA 3DQQA 1P31A 3AR8A 4UBIA 4OYRA 4IGAA 5DM0A 2P61A 4DC9A 2EFCB 2D2XA 3PXXA 2WU8A 3U4AA 1MDBA 2M6SA 3SLGA 1N9ZA 3WHLA 4J4TA 1QOZA 1OV4A 3LNRA 2X8BA 2J3IA 4ND8A 2RAPA 3D6VA 4E33A 4M21A 1T5LA 1FSGA 3LLSA 3D1LA 2XVYA 4L27A 3ZDLA 1XA0A 3WGUA 1N2OA 3IUSA 4ZHSA 3MELA 3RRXA 3K66A 3G23A 4D3DA 2AJDA 3LPDA 3T1VA 5EGYA 4LZLA 4R4JA 2DLDA 5JROA 1RADA 3C1AA 2WT9A 5AM4A 3U3FA 2Z2JA 2V6MA 4TSRA 2HHCA 1W2HA 1Z0IA 2HF9A 4OP3A 1CW2B 1NXPA 2BKAA 2CUNA 4NCXA 4XB1A 1ZDMA 2HK9A 3KB6A 4RZUA 3RBZA 4O0MA 5KVQA 1OASA 1K9VF 2LKDA 3TIXB 5FOQA 2XV1A 5EIOA 1U81A 2GXQA 3V6LA 1M2OA 3VPHA 4DLNA 2Y9PB 2Q4EA 1HYGA 1E8MA 2V0NA 3CUWA 5NULA 1O3UA 3MHPA 3H5OA 4TSKA 3OFND 1ZL0A 4HV4A 1WB5A 1DG1G 5FV7A 1C8LA 3AJRA 3MJVA 1JIVA 3LDHA 3PJEA 3C5HA 4L5CA 5IFKA 3GZNB 4YRPA 1Z4MA 4PSVA 5KU7A 2WHQA 3MTIA 1K98A 1F6BA 2WHPA 1GITA 3OX3A 1GNVA 3WWPA 1WV1A 2DERA 4UUOA 1GP2A 2C7QA 3OLYA 4BEVA 3WGJA 2WVJA 2QJOA 1Y7TA 4CNQA 4A6DA 2IZOA 1KFJB 4FFVA 1XXHE 1QE0A 3O8DA 2IA5A 4FPXA 4ND7A 3RUAA 4R8KA 3U4IA 3RRYA 4KPEC 2FFAA 1KWGA 3C7CB 1IK4A 1Z15A 5FT9A 3QX9A 3B82A 4Z49A 1XG5A 2XD4A 1TW2A 4X3CA 2LE0A 4JH0A 2ZRAA 4O4IF 4GOMD 1CG6A 2B36A 3F6EX 4J03A 3QXCA 2W2NA 3DE8A 2EQBA 2XCUA 2IXTA 1NDUA 1JZTA 4ILKA 1XI2A 4EG0A 2FMHA 4YONB 1EWYA 4GWGA 3P2JA 1HE1A 3A7DA 4P22A 4CV0A 4HJXA 2D5AA 4YHBA 1EFCA 2FPLA 5AKKA 1LI7A 4HNTA 2P2NA 1JB9A 2R7KA 1SCJA 4JLWA 2YL2A 4JCCA 3H2JA 1F2TB 1GPBA 1AQIA 5AI8A 4WA8A 3ZWWA 5A0TA 2W11A 2M98A 3A3KA 3LGSA 4GYKA 5FYDA 1EESA 3LQ1A 4EHHA 1Y5NA 2QAIA 1JSRA 4K88A 4EB8A 3B85A 2BKEA 3L3BA 2QEQA 1LJLA 3OUTA 4G0NA 4HWSA 3UF0A 1U11A 3EDRA 2V5UA 2XUOA 1K66A 1U8XX 4QUDA 3RKRA 5ECGC 3RW9A 1S2OA 3U0BA 5LVAA 2Q5LA 3H9GA 3LTEA 3ACDA 3KXKA 4FDMA 1YOVA 5KYUA 1R4MB 2VHJA 1CRLA 4CU2A 4EI8A 3NMKA 4EJ2A 5GM1A 1GT91 2WB4A 3OZSA 4LK2A 3PJGA 3K96A 2GCIA 2J46A 4RHUA 2H5LA 1NUTA 1KPIA 3D1VA 1OAOC 1G5FA 3WMWA 4CTKA 1Q0FA 2C4WA 3EODA 3IOEA 1D6NA 2LPMA 1FNSA 2HMZA 3VOTA 4R2WA 3DYIA 1PSDA 3R7NA 1T1JA 3WNQA 5KNCD 4J3NA 4BX0A 1HQCA 1KDRA 4QQ8A 1HY3A 4J8PA 1JVSA 5TE9A 4BECA 5DI9A 4IOMA 1RKBA 3H8WA 4HQRA 4RE6A 1R6DA 3CUTA 2IU6A 5LWHA 4JYBA 4M98A 2C00A 4MDEA 1E2IA 2W93A 1J5PA 4G5XA 3VHXA 1I4DD 4UVGA 1UKVY 2NX2A 1QF9A 4PCLA 1XZJA 5HZKA 1XZIA 2VBGA 3C6YA 3ZSUA 1G8KA 4DL9A 5F28E 1K8RA 1TMOA 5TMPA 3K1IC 4KRFA 2M64A 3OEHD 4F2PA 4A82A 1GA6A 5BNIA 3H9EO 3KWJA 4ZRMA 4P5DA 1P75A 4PTZA 4RK0A 3GGOA 3RSLA 4EAQA 4PVCA 5C31A 5K8UA 5GONA 1RPJA 2ASRA 2BR3A 5CNKA 1NNI1 2PYZA 1AMNA 2ADOA 3UM9A 2ADMA 1K5DA 1LC3A 4RF4A 4Z9BA 3S5JA 4JVMA 1L2TA 4DUGA 1G9SA 3TVYA 1FRNA 1NUAA 2GO1A 4IQ4A 4ZREA 2VK2A 2FZEA 3F3KA 3GOQA 3O9VA 1KHHA 3NIGB 5AESA 4FLMA 5DNYB 4PRZA 3MCVA 3O7WA 4PCAA 2MIIA 2I4LA 1RI2A