1OKKD

Homo-heterodimeric complex of the srp gtpases
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
283
structure length
265
Chain Sequence
AIPWGGNLEEVLEELEMALLAADVGLSATEEILQEVRASGRKDLKEAVKEKLVGMLEPPVEPKGRVVLVVGVNGVGKTTTIAKLGRYYQNLGKKVMFCAGDTFRAAGGTQLSEWGKRLSIPVIQGPEGTDPAALAYDAVQAMKARGYDLLFVDTAGRLHTKHNLMEELKKVKRAIAKADPEEPKEVWLVLDAVTGQNGLEQAKKFHEAVGLTGVIVTKLDGTAKGGVLIPIVRTLKVPIKFVGVGEGPDDLQPFDPEAFVEALLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords SIGNAL RECOGNITION PARTICLE PROTEIN
publication title Heterodimeric Gtpase Core of the Srp Targeting Complex
pubmed doi rcsb
source organism Thermus aquaticus
total genus 94
structure length 265
sequence length 283
ec nomenclature
pdb deposition date 2003-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00448 SRP54 SRP54-type protein, GTPase domain
D PF02881 SRP54_N SRP54-type protein, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 1okkD01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1okkD02
1A4RA 5JLJA 4QHTA 2RGBA 2R62A 4D0LB 2RGNC 3RC3A 3BWDD 3KTAB 3GP8A 3FMPB 1FQJA 1XD2B 3OIYA 2WJYA 1RE0A 5E7IA 4LRWA 2BKEA 3X1WA 3PG5A 1DG1G 2MMGA 5AUNB 1NI3A 1N6RA 1E96A 5FL7A 5UKDA 3RYTC 2C77A 2BBSA 1SZPA 3SEAA 1UEIA 2R9VA 3LNCA 4LPSA 3GPLA 4XVUA 2EU8A 4M1MA 3OEHA 3QKRB 5H68A 1UFQA 4UJ5A 1FTNA 4F4CA 2IYVA 2HYIC 5CIQA 3AB3A 5J40A 5D3MA 2REOA 2VHQA 3QJYA 3RRZA 2WPDD 2OV2A 3O8BA 5LB2A 3QXXA 4D4KA 3DM9B 4DCVA 1AGPA 5KSYA 4A36A 1HYQA 2YYZA 5A4JA 1YHNA 1JJVA 3LVQE 4ZI2A 5CLLA 3QXJA 3PEWA 2Q9BA 2VSXA 1JXMA 2BKUA 2AR7A 1W36D 1JQJC 1UJ2A 3IIMA 2YWHA 4RZ3A 5KPDA 1HE8B 1OKKD 4QGGA 2IS4A 1Q12A 2O8FA 5DHAA 4Q4AB 3OAAD 5KNCA 4JVLA 4OK3A 3CF2A 3ASZA 5JI3E 2QNRA 3RS3A 1MO5A 4M4SA 2D06A 4FMCF 4TYWA 1M6NA 2XOKA 1P6XA 2O8EB 5JSZB 2VTKA 1AM4D 2ZI5A 1G21E 2R2AA 3WHKA 1ZAKA 3HU2A 4TTQA 2ZI9A 4PPGA 4DCNA 5EE3A 1YRBA 4Q9JA 4B6EA 4OQMA 3K0FA 3SHWA 3ZQ6A 1FQKA 2PZEA 3PUYA 4TLBA 2QP4A 2XXAB 2IW3A 1JR3E 2EFDB 5J5CA 2W0MA 2DPXA 2X77A 3MJRA 2IS6A 1E9DA 3CWQA 4TYPA 4Q9LA 2YOHA 2ZXUA 3GLGB 4S2EA 4DT1A 2AFIE 2C2HA 4HAWA 4NU0A 1K5DA 1QF9A 4O2LA 1VHLA 1D2EA 3CRVA 1YZLA 5BN3A 1RRPA 4RZUA 1ZMXA 4QHYA 3CB4A 5LDDC 2XZOA 3EIQA 4TWZA 5FPHA 2P65A 3ZVRA 3NEJA 4KAXA 4Q1EA 3W6PA 4EKDA 4MYTA 1YVDA 5KDLA 4URUR 3K8YA 1E98A 3PFIA 1JBKA 3I3SR 3MWYW 5AUQA 3B1ZA 3FHOA 4OYHA 2GAOA 3WY9A 1E32A 2BC9A 3DHWC 3THOA 2NTYC 3ADKA 3RS7A 3ECCA 1SVIA 4HB3A 3I32A 3T61A 3D3QA 3FDIA 3BFKA 4A0FA 2ZREA 2IS2A 4DLZA 3OFND 2QMHA 3L0OA 4UKDA 3B5JA 4TZ0A 5E7JA 2QZ4A 4B73A 2ZSDA 4OBEA 1Z63A 3K9HA 1E0KA 2YV5A 4E5UA 721PA 4J0QA 1IXSB 2ODWA 5TB5A 2WKRA 3TUJC 2BEJA 3VHLB 4I81A 4OHVA 4YMUA 2ERXA 4TLAA 4DDTA 4YMSA 3TUIC 2WVJA 4DLYA 5EE9A 1FX0A 3T34A 1NL3A 3OEED 4DLVA 2F6RA 5HE9A 4RFSA 3KTAA 3RRYA 1E69A 1FMLA 3SHFA 1KZ7B 2A5JA 2C8VA 3B85A 2FSHA 3QE0A 1UM8A 1OLOA 2QENA 2Z5FA 1FFHA 3ICQB 4D80A 3BGWA 4EPRA 4Y0AA 2AFHE 1TNDA 2QU8A 1Z6TA 3VR5A 1F48A 1QG4A 4Q19A 4LBWA 2LCFA 3W90A 1YR9A 2Z0MA 1GFIA 3CX8A 1CS4C 1OYYA 1MABB 2E87A 3PEVA 1KGDA 3QKRA 2IS1A 2VIIA 2G88A 3MWLA 4PC3A 3UXMA 1VG0B 2GNOA 2CDNA 2IYLD 4I1UA 4QKQA 3KB2A 2HJVA 5JECA 4F4IA 5CDFE 3NHAA 2D74A 1XMVA 1F5NA 4US0R 4DRZA 4Q21A 1VIAA 2NGRA 2V54A 2VHTA 5GJVC 2JLXA 4PHHA 4MUAA 4I1SA 3QEJA 1BH2A 2ODBA 4IHQA 3IILA 3CPHA 1OH5A 1NRJB 4L16A 4C9BA 2FFBA 5CM8B 4PQRA 1W4BA 2F1HA 4ARZA 2XX3A 1QHIA 5CIWA 2IYSA 2ZETA 2XJ9A 3AVVA 4K46A 4CW7A 3CKLA 1ZJ6A 1QRAA 1EFTA 3BK7A 3L82B 2O8EA 2Q3HA 2WHXA 5JSZA 2GCOB 2RMKA 2IF2A 2FFQA 1CU1A 5EE1A 3A1VA 4QBGB 4Q1AA 4NL4H 3WNDA 4A9AA 3RANA 3DKPA 4TYQA 1G8GA 4PC7A 5K8UA 1R6BX 3LX5A 2XXAA 4G5RA 3BJIC 3NBZC 4G5GA 2FH5B 1KMHB 1E4VA 1E79A 2G6BA 1JI0A 4LYHA 3TH5A 1KDPA 4BUJA 5FL7D 4DUGA 3K70B 3EZ6A 3TAHA 1S8FA 3GLGA 4LK2A 1X3SA 3UMFA 1E2IA 4PXAA 4KXFB 4KYIB 4NYIQ 2IK8A 4IDQA 3OZXA 2ZRBA 3A58B 5CK4A 5L3RA 4DXAA 2FDCA 4AKHA 2JLUA 1L4UA 2FEMA 3E5HA 4JLDA 4JJZA 2F9MA 4B3GA 1CR4A 3LV8A 1RIFA 3NDBB 4JVMA 1ZNYA 2ZVQX 4NYJR 4BEJA 2GZHA 2PJZA 3HYRA 4N3NA 5H8WA 2CK3D 2F1IA 2QEQA 4YLGA 3HWSA 4RD0A 4PQFA 3TMKA 3CRRA 3IPXA 3FKSD 3AVQA 3JZAA 4TMWA 1R7RA 3F3YA 2TMKA 5EQTA 2XNDA 1KAOA 2W6ID 1T3SA 2R6CA 2HV8A 4LUCA 1Z0JA 3A4LA 2ZI6A 2EFHB 4ZDIA 4V0LA 4F4JA 2IYYA 3GFPA 1QHNA 4QM6A 1R0ZA 5FBRB 1U8ZA 2OO7A 5BXQC 3UWOA 5JS8A 4B76A 1U9IC 2WMOB 2OBMA 1S4QA 1WP9A 1YZGA 3Q7PA 4OL0A 1QVRA 2ERYA 1KK1A 1CRQA 1F6BA 4RFVA 1D5CA 1N6PA 1Z0KA 2A5FA 4I1VA 1FUKA 4JSYA 4KFTA 4N1AA 2QE7A 5FPKA 3AVUA 1CJMA 2Z43A 3VX3A 4NCJA 5JFGA 3FGNA 5HE8A 4IOMA 2EYQA 2CL0X 2OXCA 4OQLA 5JWHA 3RVBA 2IHYA 2VRWA 2OILA 3KQLA 1A1VA 2WOJA 2WWGA 1Z22A 1AK2A 3IQXA 1MABA 5G41A 2JIZA 1S3GA 3M4YA 5AWFC 4HATA 4DBLC 1Z0AA 3LXRA 3BBPA 2FMXA 2R6GA 1IQPA 1SXJB 2BV3A 2W6JA 1R8QA 2JLSA 1X1SA 5G40A 2OXRA 3GEIA 3SJAA 2LKCA 3BH6A 4OHYA 3B1VA 2FF7A 2BOVA 5L3QB 1Q22A 5J4HA 4CGZA 5BWMA 1T8UA 1DAMA 4GT1A 4C0QC 3VNUA 1KKMA 1LW7A 4UNQA 3N70A 3OE7A 1LTQA 3ASYA 4PX9A 3U3RA 3GLHB 2GAAA 2J1LA 4HLUC 2J7PA 4FXPA 3QXSA 3UWKA 2AD1A 1YKSA 2WIAA 1E2MA 2WMNB 5HZKA 2FN4A 2GVDC 2D7CA 5K8IA 2JJ1D 4DIEA 4RJLA 2QL6A 4EIWA 1G8HA 3BXZA 4W5WA 2PZGA 5K8LA 3ZD6A 1GRRA 4FMDB 3F5FA 2GCOA 4YC7A 3GJ5A 1A2BA 2QPTA 3EARA 4JIMA 4NKRA 1HQYE 4V0KA 4BRUA 4X8HA 1KK2A 5KDOA 4NPHA 5HKKD 2CL7X 1ZD8A 4TL8A 4XTRA 3C41J 3EPJA 1KMHA 2CCJA 1T3HA 2DFTA 3V4FA 1K5GA 5JS7A 3MD0A 1ZM4A 2QP3A 4ASUD 1W4AA 3EZ9A 3TW8B 3RRMA 3PXGA 2J0QA 2VP0A 2QAGB 1NVVR 3AP2A 3FKQA 3TQFA 5JHHB 2P5SA 5L3VA 3K9NA 2XSZA 3ZD7A 1G7RA 5EE5B 1GNRA 4JT2A 1XWIA 4M1SA 4A8JC 1SKYB 3AEZA 1SKQA 2ZSEA 3SDZA 5FTKA 2C5LA 4MDFA 1OXVA 3ND9A 4M21A 4JT4A 1R5OA 2IXFA 1ETUA 1W4RA 3EZ2A 4A92A 2RGXA 3G0HA 3DVLA 2BCJQ 1A82A 3DKVA 1Z6GA 4JLBA 5EXTA 4GSYA 3WMFA 1HY3A 2VL7A 3CONA 2YC4C 4DHEA 2ZRGA 2NO9A 3ZIAD 1KNQA 2A9KA 1DVRA 2ZI4A 3BERA 2B21A 2QMOA 1DAEA 1IAQA 2FEOA 4G0NA 2OG2A 1S96A 4JL6A 1ZP6A 2EWVA 2F1JA 3V4RA 2HLDD 3TGPA 2F9LA 1I4TD 1XXHE 4HAYA 3THXB 1SVOA 4JL8A 2OESA 3O47A 1N5LA 4KSCA 4F91B 1CBUA 3WNCA 3NC0C 3CWZA 2V6IA 1X8LA 2CE7A 3N2IA 4WIAA 1W0JA 2EQBA 4AYTA 5DE3A 2NOAA 3G82C 4Z1MA 2D3WA 2NG1A 1QHYA 1KDTA 3NBYC 1NLFA 4HB4A 3A6PC 4PHGA 2GF0A 4MYUA 1OIVA 1MO3A 3C7KA 3DO6A 4W5JA 4G01B 5FR2A 1ZYUA 1A5TA 3JZMA 4JLAA 3FFBA 1SXJA 4LBVA 2JLWA 3BFVA 3AM1A 3AKYA 2A7QA 4IDHA 1SVWA 4D26A 1NBMA 3IDQA 1WXQA 2AWOA 3E70C 5L3QA 2PCJA 2A78A 3PITA 4II7A 1D9XA 1IOZA 3H2YA 4LBZA 3GLHA 3MCAA 4DDVA 3ZS8A 4XWOA 3RS5A 2VO1A 1Q1BA 2AXPA 1GKIA 4XSGA 1EFCA 1E2FA 1PJRA 2FPLA 2OLJA 5DLQC 3KJIA 2YC2C 4MKHA 4NCKA 2ANCA 3EIHA 4CT5A 4DCTA 2G83A 3ZVNA 1ZM7A 3HR8A 2QROA 2N1BA 3P27A 3RWOA 3HU1A 3WYGA 4CVNA 4URXR 3H84A 2Z4SA 1E9BA 2ZITA 4IVPA 1UPTA 5CJPA 2L0XA 4KFUA 4LGMA 1W4CA 1HUQA 4AYWA 5AK0A 1R0YA 2J9RA 1E2LA 1KDOA 1VCMA 2WPDA 1LV7A 2CEAA 2WJIA 4OI1A 2W00A 2J7KA 4OQFA 3SOPA 1TPZA 2R8RA 2D7DA 4LCBA 4NONA 5FOSA 1IXRC 3B82A 1IN6A 4H1VA 5F98A 2ONKA 1Z6YA 1GP2A 3LLUA 5KO2A 4YQFA 2XGJA 2I4IA 4QJ5A 1RZ3A 2QAGA 3WYAA 1XEWY 4OHZA 1OKKA 5F9HA 3VX4A 3AP1A 3RC8A 4IFBA 1GKUB 3SN6A 4LHYA 5KPJA 3OAAA 3CO5A 1WQ1R 2JA1A 4TL6A 4MUBA 3TR0A 3AKCA 2QT0A 3U5ZB 1NLZA 3SQXA 2REXB 3HPQA 4L9WA 2WSMA 1U81A 1ESMA 5AJXA 2XJ4A 1YZTA 3ZQJA 2H7VA 4C0KA 1D2NA 4B32A 4D4LA 3GJ4A 2RH5A 3P20A 1NF3A 1W48A 2QG6A 1CKEA 1YE8A 2ZSAA 1E6CA 3F0TA 3LDAA 4OK5A 4TQUS 4B3DA 4F7WA 4RD2A 1OFHA 1C9KA 5LPNA 1NSTA 1LS1A 1S3SA 4WVFA 3K0SA 1JPNA 2AXNA 5EE0A 3CW2A 1GNQA 2BMFA 1EG7A 2PCLA 2ZRKA 4LV6A 3ADBA 4I4LA 4LC1A 1W47A 4QJ4A 2KE5A 3T1OA 2YWFA 4FW9A 2ZJYA 2H17A 1QDEA 1AGRA 1B23P 1KO8A 4Q7MB 1TUIA 2VSOA 4YDHB 3THXA 5FFMA 4ACAA 1S2MA 4PAMA 3X1XA 2WWXA 4EUNA 1NJFA 2YHSA 1YZNA 4WZBE 1B0UA 5G3YA 2HT1A 1QHGA 3P26A 4Q4HB 5GJWC 3K70D 3VKHA 2GA8A 2CHQA 1E2GA 3ZJYA 2J0SA 3A37A 2FSGA 2V8OA 3HPRA 4BFVA 4XSHA 3A1TA 5AUPB 2ZSFA 1PUIA 1QZXA 1XX6A 821PA 4B3XA 3LFUA 1AS3A 1H8HD 2A3RA 4RCYA 1Z5ZA 5A5GA 2RHMA 1E9FA 3OFNA 1NY6A 3A4NA 1ZINA 5JJIA 3CX6A 3B9QA 2BIFA 3FMIA 3LW7A 1ZM2A 4LPKA 2VP5A 2IYTA 2ZRNA 3GLIE 2B8TA 1NY5A 3AF3A 4LSGA 2QMEA 4R7ZA 1KK3A 4ZDKA 1DOAA 2ODEA 1XPOA 3OEEA 4DLRA 2ZSBA 4JLJA 3LO5A 4MGYR 5B57C 3QG1A 5FOXA 2FU5C 3Q85A 3CIOA 4YDSA 3W3ZB 1P73A 3I61A 3W5JA 1OFTA 2PZFA 4EPYA 1II0A 2IUSA 2ZRLA 4GFDA 5LBIA 3D7MA 2J46A 2Q3FA 4WXRA 2HXYA 1CEEA 2PT7A 1G3IA 2GXAA 1HTWA 2NQ2C 1GKYA 1UKYA 3GJ6A 1IN8A 3LBNA 2A5YB 2IEZA 3DL0A 2ZAOA 2ZROA 1VMAA 4B48A 4WZ6A 3ICEA 4B3BA 3QENA 5B2ZA 2JJ8A 3PCRB 4PC1A 4B2IA 4M0LA 4PZYA 2P2LA 3LLMA 2WSSD 3CNOA 1FTSA 3GMTA 3D6TB 2UKDA 1ODFA 5KNBA 1KYIA 1II8B 1FUUA 4Q7JB 1KI8A 4ZV4A 2VYFA 1W5TA 1GOTA 1Z06A 1WF3A 5BW8A 3KFVA 1Q1QA 1N6HA 2ZUCA 3IKJA 3X1YA 3PEYA 4EJSB 2OLKA 4BFYA 2WM9B 4CEHB 1U94A 1FNNA 4A2WA 5TY0A 4AG5A 1BYUA 2WOOA 5C18A 3FPAA 3PR1A 4MGZR 3SQWA 3CBQA 1TF5A 4M53A 1II9A 1U0JA 1UEJA 1O3YA 2AD5A 3I4LA 4QJ3A 8OHMA 2ORWA 3QKUA 3BAFA 1TX4B 3R8FA 4DZZA 3KJEA 4UNNA 1GILA 3LW8A 3P32A 3IGFA 4NDZA 3GFOA 2CCKA 2KBEA 1JEEA 4FCWA 4JZKA 2DR3A 4QOSA 3K0CA 4QBFA 1WA5A 4OHWA 2YNMA 4TYYA 1T0JB 2VP2A 2G3YA 3FYHA 4ZPXA 2KB0A 2O8DB 2REBA 4CEJB 1KO4A 3ZDQA 3VHXA 4B43A 1VG1A 1TTTA 3JVUA 4GMXA 4DB4A 1J90A 3A36A 4GRAA 4KJZA 4MRVA 1CIPA 1PLKA 2W58A 4BLQA 2AX4A 5FTLA 2OFOA 4LC0A 2XB2A 1GITA 3VU9A 1W46A 4DDUA 1U0HC 5KOYA 3ND8A 1KO5A 1P75A 2GJKA 1OB2A 1E3MA 1GL6A 3LX8A 1NJGA 4PHFA 1FL9A 1HQCA 2CK3A 2X1VA 3B1WA 4JS0A 4NYJQ 5GJBA 1UBFA 2OUKA 3FKSA 1AKYA 2Z4RA 1W2GA 3EWAA 1J8YF 3C5CA 3Q72A 1AJEA 4G5SA 4TN1A 1G8PA 1E2JA 2W6IA 4M22A 2ZRDA 1G5PA 4E22A 2ZS8A 4US2R 2FPMA 3HDTA 5KTYA 2F55A 4BLPA 2BCGY 4JVSB 3LBIA 5DYIA 1NVWQ 1E0SA 3BORA 1UDWA 3NHBA 3SS8A 4Q48A 3FTQA 3NH9A 4DSOA 1WB9A 4XJXA 1N2CE 1XZPA 3NDPA 1G6HA 4B47A 3MGCA 3NEYA 4US1R 4F93B 1IHUA 4BFZA 3L0IB 2VP4A 4M1OA 5J4LA 4F38A 1XMIA 1XJQA 4B3FX 5L3SA 4GP6A 1EFHA 4Q02A 4NCNA 2FX3A 1UKEA 1KJWA 2G0TA 1P2VA 2FWRA 2FA9A 4MKGA 1UBGA 4TMVA 5BQ5A 4YMTA 1BS1A 3PUVA 4UQOA 1DADA 3U3OA 5G3ZA 3OF5A 1EESA 3C5HA 4PSVA 2XITA 2IXGA 3GJ7A 2Q21A 4ZIRA 2GJSA 3B8HA 5JCPA 3N5CA 1R5BA 4CDGA 2EFGA 4URVR 2KI5A 3LY5A 2CVHA 4HLQB 2Z6VA 2QBYB 3REFA 3VR6A 1NIJA 2ZE6A 4LBYA 4EJSA 4MH0R 2ZE7A 1G3RA 4ON9A 1OSNA 4CEHA 2FFAA 4L4UA 3TJZA 5EXPA 1MV5A 3CX7A 4G1UC 3DM5A 3OIUA 2BHRA 5SZIA 3ZH9B 4EFMA 3SFZA 4BFWA 1YR6A 2JJ1A 2CNWD 2FV8A 2QPAA 4TQAA 4A15A 1IY0A 3CRW1 2DHRA 1OH7A 621PA 1OH6A 3EG5A 4LJ9A 3UG6A 1E1RD 1TL7C 4BGDA 4NYMR 2ONJA 4Q7KA 2EFCB 2HF9A 4LJ6A 1SVKA 3VAAA 1ZVQA 1VCIA 3BE4A 5HKKA 1ZD1A 1XD2A 1N6IA 1XJCA 1E2NA 4CEJA 5FTNA 1G3QA 3KJHA 1FMJA 1GSIA 3QPUA 1DAHA 4Q03A 4ASUA 3C14C 2N42A 4Q9KA 1UBCA 3WP0A 4A2PA 4JL5A 4D0GA 3WMGA 2WIBA 4ABYA 1SXJC 4MRNA 3TSOA 2FE4A 1NVVQ 4PQYA 4P3YA 1ZCAA 4H9GA 4KBFA 4CRWB 3U7FB 5B30A 3GLGE 2P6RA 2OZEA 5FOTA 3Q5EA 3A1SA 2ZQ5A 1XBTA 2V7QD 2BM0A 4NZYA 2LKDA 1VG9B 2C9OA 3QSYA 2ZYUX 4JBYA 5JI2E 1KJZA 1Z83A 1T9HA 3B7GA 2I1QA 2ZEJA 4Q4AA 2ZTSA 1T6NA 2JAQA 4TL7A 4URYR 1CJUC 2D2FA 1W0KD 1Z07A 3AVWA 1M74A 3ZIAA 4MYCA 1P62B 3W5IA 1CR0A 4IEEA 2WJHA 2G77B 5DYGA 4FWIB 4MA4A 4OKSA 1QHHB 2OSBA 4NH0A 5DI9A 4FCTA 2B8WA 3W9YA 1Q20A 3VKWA 2PLRA 1E99A 2HLDA 4DLSA 1IBRA 2P6NA 3A1WA 1KSHA 2HEIA 4IOKA 4BFUA 4FMDF 1G16A 3WP1B 2X2FA 1UADA 5C1BA 2OHFA 2PEYA 2CJWB 4IEIA 4KBGA 5FI1B 3CLVA 4Z54A 1H8ED 3MG9A 4C2UA 3EZ7A 1YQTA 2RCNA 1NMZA 4UXIA 4QXAA 1ZM3A 3MJHA 1XTSA 4V03A 4WZAE 2HF8A 1QG2A 3ZZTA 1EFRD 2FZ4A 3SBEA 2NMVA 3IIKA 3PENA 1W36C 3B60A 3CM0A 2QAGC 4Q4LA 3WRYC 3U44B 4V02A 3KUDA 5ELXA 1AZSC 4IXMA 3I62A 2O0HA 4C30A 3QQ5A 4MRPA 5K8TA 2VLIA 3I5YA 2J45A 1KSJA 1VIYA 3N2EA 1XEWX 4PANA 3R8CA 3ADCA 3IEVA 3DMNA 1SVLA 1EXMA 2CMKA 1JPJA 1MRNA 1YR8A 2NO7A 4Q1CA 3AUYA 3IBGA 1DG3A 3M6AA 4QG7A 2QBYA 4P4TA 1OFUX 2IWRA 2X19A 5JWRA 3KKPA 3TK1A 5E4FA 4W7SA 5JHGB 5TMPA 2IT1A 3VR3A 4IVQA 1TF7A 1R2QA 1US8B 2NPIA 4TQ9A 4RD6A 1EGAA 2OM2A 3OIVA 3TW4A 5SZKB 1DO2A 2QPOA 3H1TA 4ZCIA 2C9YA 1E9CA 1WCV1 3TE6A 2VA8A 3ADDA 4TMXA 4BLTA 4QNRA 3MUFA 4Z8YA 2UZ3A 1OXTA 2IHBA 1XF9A 4WA7A 2JLYA 2JDID 4LHZA 5JJKA 3PVSA 1XJ0A 1GAJA 1LVGA 1YU9A 2JASA 1FP7A 4GDFA 2PEZA 5FBWB 1IJFA 3UATA 4Q7LA 5FR1A 3TLXA 2W0SA 5AUOB 4HSEA 4QGHA 1TQDA 3W6OA 4ZCMA 5KDDA 2V6JA 2ZRHA 5FOWA 1GG2A 3I5XA 1ONBA 4HUTA 4D25A 2RGEA 4CT4B 4BLSA 4DVGA 4URWR 1I4DD 3CNLA 1X8KA 1PVOA 5EP2A 3BD9A 3TNFA 1Z8FA 2FPKA 4FWTA 3U60B 3R9IA 1GL7A 2OBLA 1G1MA 2IYZA 421PA 1KSGA 1R10A 1N5JA 3PJRA 2F43B 3NBFA 2MSCB 4I1OA 2O8BB 1DAGA 2WICA 1N6NA 4Q4JB 3B78A 2E1RA 3LH5A 3NWJA 3T12A 3WXMA 2J0VA 3KKQA 1FNMA 2QQEA 3MWJA 1K6MA 1NN1A 5ANRB 5BYJA 3RSOA 1RPZA 3J81k 4B35A 1ZUNB 3BRWD 1XCMA 1ZU5A 3NTUA 3CPEA 2IXEA 3KKNA 1OV4A 1AA9A 1QHHA 1G8YA 1Z2AA 2BBOA 4FMBB 1I2DA 1P2SA 2V1UA 3UKDA 1WGWA 2GBLA 1ZIPA 5JZVA 5CM9C 1G7CA 2PX3A 3KQHA 1GL9B 1XXHB 2CJWA 2O0JA 1AS0A 1KI9A 4L8GA 1F2UB 2CHGA 1EX6A 2FFHA 4M9ZA 3RS2A 2ASEA 3SU8A 1YR7A 1JR3D 2WWFA 1G3UA 1KI6B 1TQ6A 1XTRA 5FBLB 3GLFB 1H8HA 1GVNB 4TMTA 2FZLA 1T91A 1ZBDA 4DB2A 4D82A 2J41A 3CPJB 2DFLA 4D81A 1TADA 2VF7A 2C99A 4TYNA 1AS2A 2C03A 1WDTA 1X8JA 2GJ9A 4ZKDA 2VH5R 2DCUA 3H86A 5E7MA 2MSDB 2AKAB 1KO1A 4KYUA 2WJVA 4JVNA 4LJ7A 4D2IA 2EW1A 4JLKA 1XMSA 1W44A 2NZJA 5CITA 1BKDR 2JEOA 4PSAA 1SXJE 3QOFA 2YOFA 3K0CC 4KODA 3SYLA 1G17A 1CTQA 2O5VA 3LBHA 1NBME 3QBTA 1R4AA 2J59A 2BMJA 1NN0A 1RVDA 3FFAA 5F2EA 2EWWA 1UKVY 3Q8XB 1ZM9A 4GOJA 1P60A 2ZRJA 3V00A 3L0SA 3GLHE 2XNSA 1G5RA 2ZM5A 1IN5A 5TV2A 2RHDA 2FG5A 4MGKR 4P32A 1P9WA 4C3ZA 2VHCA 3BS4A 3KXIA 4Q1DA 3SZRA 2WSSA 4KFRA 1G291 1T4GA 2QTFA 1KY3A 4OJQA 4C0HA 1ZUHA 4U00A 4M9SA 1BIFA 2ZPTX 4BASA 2JJ2D 3QG5A 3ZS9A 3AVXA 4GP7A 3IO3A 4GI7A 1R0XA 2NO1A 3NBXX 4PR0A 2WJJA 1HT2E 3KXLA 4YONB 4Q1BA 1GRNA 1ANKA 4BLRA 2JLRA 1X86B 1P9NA 4XTCS 4ACBA 4JLMA 2O8CB 3MAAC 3X1ZA 3IIJA 1AQUA 2AN9A 2BBWA 4KLZA 1JALA 3BH7A 2OE2A 5JEDA 1NVXQ 2RKOA 4RSGA 4R2IA 3T1VA 2VSFA 1P2TA 4EDHA 1D6JA 2BEKA 4KSBA 4DLTA 2OAP1 521PA 4HAUA 1JNYA 3AF4A 4RKEA 3S1AB 3EA5A 4IJMA 3RRNA 4NBSA 2GWHA 2Q0HA 2E9SA 4HUQB 1TUEA 3QXHA 2F43A 4LJ8A 2IX3A 2O8BA 3QVVA 4Q4JA 5FUXA 1PLJA 2IBMA 121PA 4QHSA 3PUWA 3CRMA 2R44A 4PO9A 3W34A 3TSWA 4L15A 3W8NA 5HR5A 1JJ7A 2H57A 3LA6A 2GDJA 1KOFA 4LYAA 4OJKA 1XMJA 2W83A 4EPVA 3M0EA 2EYUA 4A2QA 3AGQA 1M1YE 4C0BA 4HZUB 3SBDA 4E03A 1LF0A 1R5NA 3CRQA 4LJ5A 5IK2D 3LRPA 1OB5A 5C4GB 1P5ZB 4PPQA 5FUWA 4F92B 3AVYA 4OHXA 5L8VA 3EC2A 3U3JA 4C0SA 1OHHD 4MQBA 3SJBA 3U3MA 4B2PA 2QGZA 3AF0A 3L43A 5CJ2A 2ZI7A 4B75A 4EJSC 2C95A 3NVAA 1GUAA 3UG7A 1KI6A 2XTZA 4U7DA 4I99A 3UPUA 1TQ4A 3GLFA 2GJAA 4TLEA 4X8MA 4DKXA 4GMDA 1VDZA 2RGGA 1AQYA 1A2KC 2GF9A 3HU3A 4PHTA 3K0AB 3B13B 4OI4A 2NZ8A 4HDCA 1HT1E 1F60A 2AHOA 3K09A 3REGA 1YJ5A 5JRJA 1OH8A 2PT5A 1HV8A 4QGAA 1R0WA 3FE2A 1LNZA 3LD9A 4K81B 4A4DA 4CYMA 1MKYA 3ETLA 1DE0A 1XD8A 3KXKA 1NG9A 1CJKC 4LV8B 1KZGB 2A2ZA 4ZCLA 1TAGA 1U90A 3PUZA 1KO7A 3R7WB 1COWD 1ZD9A 3AF1A 2ZI3A 4FD2A 4KFSA 4JLVA 5HCIA 3VTKA 2UVQA 4B44A 5DH9A 2BWJA 2QSYA 3TUZC 1T8TA 2ATXA 2DFNA 4QGFA 4A6XA 2IYUA 3Q9LA 2I1VB 1QBKC 1G18A 2I3BA 4LYJA 3MRSA 4TTRA 1NN5A 1P61B 1Q21A 2RGAA 3Q3JB 4LJ4A 1FW6A 1J99A 3B9PA 2R6FA 3L8ZA 1KHTA 4D4JA 3MWKA 1E9SA 2YOGA 1TQ2A 1Q57A 3F8TA 1S1MA 3T1QA 2A30A 3THWB 4QL3A 3IPYA 4BFXA 2OAQ1 4NCHA 1TF2A 3IEUA 4C7OB 4Q9HA 2QTHA 4BE7B 1F3OA 3MFYA 3RSLA 1W7AA 2VP6A 3I8XA 1GDDA 1Z6AA 1IONA 2GHIA 4NP6A 4AY2A 2C98A 5KHOC 2DBYA 4KV9A 3RDPA 2R6AA 4XWAA 3P4YA 1LB1B 5H70A 3GQBA 1SHZA 4MYHA 2CNWA 4BLOA 1XPRA 2WWWA 2ZJOA 2H1LA 1D2MA 1NMXA 2IYQA 3AV0B 3R20A 2GJ8A 2OEPA 4M8NE 4BZXA 1OW3B 2GKSA 1SVSA 2IYXA 3TR5A 5C46F 1E1RA 5BN4A 4MDEA 1VHTA 3LWNA 4H1UA 4O0MA 4JLNA 1S9HA 4G5QA 2GESA 3C15C 5CYOA 2OT3B 2VQSA 5JEEA 2IC5A 2HCJB 4NYMQ 3IHWA 2CLDX 5CLQA 3UK6A 4M9XA 3DEFA 2ZAMA 4FCVA 4LV5B 4OQXA 3GJXC 3DOEA 1MOZA 3CF6R 2QAJA 4PO1A 4BZQA 2ECKA 4CIDA 2D2EA 2QMUA 3KKOA 5DSZA 2ZS7A 2HCBA 3WBJA 4JMPA 3IHLA 1S0UA 1VCNA 3UMRA 1N0VC 4MRSA 1HEIA 3EAQA 5DGXA 2HUPA 4HB0A 3U61B 4W5HA 4PC2A 4EFLA 3AVPA 3GEEA 4OI2A 4RD4A 4WBSA 5D3QA 1RW4A 1N5KA 3EPLA 2V7QA 4M1TA 2WZQA 5B58C 2FNAA 2V1XA 5DI3B 1IY1A 4DT1B 1FPMA 3K9LA 4AC9A 2H18A 1E0AA 2QM8A 1XTKA 2ANBA 2ZIAA 1ZNZA 2ZYWX 2WV9A 3KL4A 2ZANA 4B33A 2XAUA 6Q21A 1XP8A 1GWNA 3K0AA 2W2VA 3AQ4A 4C0AC 2QQ0A 4LI0A 1EX7A 1W0KA 5AJYA 4AYXA 4CEIB 3W3AA 4FIDA 1PUJA 1NKTA 4V0MA 2FGJA 1L7VC 2PH1A 1OPXA 2F3RA 1OJLA 5E3HA 4KLNA 2JLZA 1TMKA 2LWIA 3SYKA 1GRQA 4O2RA 4WOPA 3R7WA 2ZRMA 2V4ZA 4JJKA 4BFTA 4E09A 2AK3A 3RHFA 4ZO4A 1CP2A 4WXPA 4KCGA 1H8EA 2IWHA 3FHTA 5EP4A 3RS0A 4P33A 1RRCA 5EXSA 5DN6D 2VBCA 4IDOA 4NTZA 4HB2A 1VYTA 1EFRA 3JVVA 3HYTA 2HXSA 3RNLA 3VR4A 3X1DA 4YMVA 2GZAA 1FX0B 5P21A 2OFXA 5HTKA 1FZQA 2QP9X 1XU4A 2JATA 4RFSB 2HDNB 3DZ8A 3EC1A 4A0GA 1DS6A 1E0JA 4RY2A 3TSZA 1OYWA 3EPHA 3THWA 3PIRA 1GNPA 4Q4HA 2ZR0A 5DISB 5DNYB 3W8RA 4GPTA 4PO8A 4AURA 4P0TA 4C7OA 1P7CA 3KKMA 4R9UC 4DJTA 2CLCX 3CH5A 2QORA 3CH4B 2YWGA 1TU3A 4HDOB 2IA5A 3K53A 1P9RA 3Q7QA 1BO6A 2P6UA 3MSXA 2R6DA 5LD2B 1KJYA 1XTIA 4IOJA 5KU1A 4AD8A 4LHVA 5F9FA 3I92A 1JXOA 5JMTA 4P31A 4XH9B 4LJYA 3RAPR 1UKZA 1W2HA 1UAAA 1G64A 1IY2A 1CLUA 2W2TA 1E1QD 2ZRCA 5FTMA 3T5GA 4MITA 1RFLA 4DLXA 5HPYB 1M7GA 1QHXA 4YXWD 3T06B 4NE2A 5HZHA 3BFXA 4AKEA 3U7GA 2QI9C 1AKEA 1KI4A 2XZLA 2A5GA 1G6OA 1G9XA 2GBLC 2JDIA 2WKQA 3CR8A 3OESA 2MMCA 2VF8A 3IUYA 4ARZB 4ZDJA 1S9DA 5FOUA 3AVOA 3W6NA 5TARA 4TTPA 1UF9A 3K70C 4M1KA 3AKDA 2ZRIA 1W5SA 4ITRC 1ZW6A 4B34A 1OXSC 3E1SA 1WBDA 4V0NA 3T15A 3ZVLA 3U4QB 1CULC 2P67A 3HJNA 4X8OA 1GZSA 2PX0A 4DEXA 1ZNXA 4TT3D 1II8A 5HCNA 2IYWA 3BB3A 1YZQA 4BEBA 1N6OA 3UMSA 1OT3A 2GEUA 4QBHA 4LY6A 3RWMB 2KBFA 3A8TA 5DI3A 3CNNA 2GETA 5EUMA 2ZE8A 4R71A 2VPPA 3LQRA 3QXCA 4RVCA 1R8SA 2OCAA 1BMFD 1M2OB 4UNSA 4LOAA 1DAKA 1E2QA 5FBQB 4CEIA 4OK6A 1IM2A 1IN4A 1Z0DA 3QUSA 4FINA 1TEXA 1N0WA 4LJAA 1Z0IA 5A0FA 2GXUA 3B1XA 1SULA 4XVRA 1VYUA 1OXUA 2QSZA 5FH9A 1KI1A 4V0OA 1XTJA 1T5IA 1U8YA 4HAVA 5KSPA 4AKGA 3IQWA 2WAYA 4DSTA 3KDSE 3VNVA 1GM5A 1HH4A 2UZIR 1OIXA 3AKEA 4QNMA 3DOFA 1V5WA 2O8DA 1KI3A 5C2JB 1XB2A 2RB4A 5AR1A 4GZMA 4DLUA 5DO9A 4HYYA 1G41A 1JR3A 2QUZA 3L0PA 2P0EA 4PC6A 3SJCA 1XNJA 3WBKA 1RYHA 3U6BA 2WKPA 3NH6A 5TXGA 2ZU6A 4BECA 2PJRA 1N3BA 4XD7D 2ZRAA 4JLOA 3RS4A 4Q9IA 5JRZA 4JSTA 1E2DA 3GJ8A 2ZVPX 3I73A 4PTLA 1VCOA 5JBQA 5IF9A 4ILEA 4G5OA 2HJGA 2G9NA 4GOKA 3ZZ0A 4GZLA 2QGNA 4W9MC 1RRGA 3ONWA 3O8RA 1BOFA 1E4YA 2DB3A 1G4AE 1KI2A 2EFEB 1JAHA 2X2EA 3DDCA 4E07A 4Q47A 2OCYC 3QBVA 1ELOA 3O8DA 4BZPA 4MKFA 3U3KA 4UNRA 4TSFD 2J5XA 3X2SA 3KJGA 2C04A 2IYRA 4JKIA 4P4SB 3BIFA 4HI0E 3QVUA 3G5UA 3CR7A 3C4JA 2XZPA 2VHJA 5J4VA 3H4MA 4UJ3A 3T35A 4FMCB 2ZE5A 3B6EA 4KI0A 5F3WB 2JJ2A 2F3TA 3L8YA 2GRJA 3B1YA 1ZU4A 1D8TA 1DELA 4OI0A 1X1RA 2WTUA 2YVUA 2ZYTX 4EPXA 5FUYA 2ORIA 3A1UA 4JKYA 3KQNA 1NLYA 2VP9A 1GTVA 1XDBA 3NC1C 2H16A 1D9ZA 1G7SA 1P4SA 4MGIR 4LHXA 3QY0A 4EAQA 3U4QA 4TMKA 2W2XA 4PZZA 4LDJA 1JEDA 3RLFA 2XB4A 3K09C 2H8KA 3EPKA 2Q9AA 3GCGA 4IFEA 4JYCA 2J3EA 3NKVA 1N0UA 5CDFA 1GIAA 2DY1A 4BQSA 4Z51A 4KO8A 4M2LA 1NSFA 2AWNA 5EP1A 2SHKA 3U7EB 1N5IA 2H92A 5J47A 4KITB 3VR2A 1DAIA 4RKFA 1M34E 1NN3A 3OEHD 4GOXA 1IJEA 2ZJ2A 4HEJA 4A6PA 2CHVA 1CXZA 4PZLA 5H1YA 5DHFA 3ZYCA 2P3SA 4EFNA 2BJVA 3KZ1E 1Y3AA 1NG1A 3EX7C 1CF4A 5BYKA 3IO5A 1XTQA 5IRCD 1Z2CA 1NKSA 2CVFA 1JB1A 3OIWA 2Q3MA 2GXQA 4MRRA 4O25A 3C8UA 5GJCA 2FSFA 4IW3B 2WJGA 3TAUA 2B7CA 3TRFA 2DFKB 3CUEF 1JECA 5KYKA 5IK2A 3QNUA 1KI7A 4DC9A 5CB8A 4PSKA 4A1FA 1CJVC 2BJWA 3GD7A 2GZDA 2V3CC 1OHHA 4D4MA 2GILA 1C1YA 4HAZA 4CF7A 1MRSA 1XEXB 4Q1FA 4LZZA 2XOKD 1G19A 5TVKA 4BPBA 3A4MA 3MMPA 2BVNA 1ZC4A 3AGPA 3WYFA 4GBMA 3D8BA 2KJQA 2RGNA 1PLLA 2WBLC 1G20E 3I8SA 2KWIA 1Q3HA 3LVRE 1G5TA 2Z83A 3U2QA 2C78A 4QRHA 4LX0A 3TKLA 3K9GA 2JGNA 1Q3TA 1UBEA 1MO6A 1CJTC 3NIBA 4B2LA 2RAPA 1N25A 5J4KA 2BMEA 2ORVA 3QF4B 4Z8XA 1Q1ZA 3I1FA 3SYNA 3EW9A 1E2KA 1COWA 1LF5A 4B3CA 1PZNA 1NNEA 3FVQA 3ZZUA 1EK0A 2IF0A 4UNPA 4ZDWA 2YKGA 4Y0VA 3C16C 5AJZA 3EIEA 2D4HA 1OXXK 4R2HA 1A7JA 3SE0A 3KQUA 5DIFA 1RRFA 3VKGA 4P4SA 3Q5DA 4AIIA 3DMDA 1KKLA 4DWJA 1E9EA 1G4UR 3QKSB 4IRUB 2KSQA 4TLDA 2QRNA 4LHWA 4ESHA 1Z29A 3QPWA 4AG6A 1YZKA 4A0RA 5JCZA 2QY9A 5SZJA 1Q0UA 4A82A 1YRAA 2AL7A 4JBWA 4DLWA 3U44A 4XOIA 4OQNA 4TZ6A 1DARA 2QN6A 4O3MA 3AF2A 1AN0A 2FOLA 4ESVA 1KSFX 4RZXA 1JQLB 1N6LA 2ODNA 1J2JA 1P72A 2BMDA 4DCSA 3FMOB 1XCPA 4URZR 5FOVA 2NPFA 3TQCA 1SGWA 1J7KA 3SFVA 2OFWA 4HDQB 4DDWA 1JR6A 3BOSA 5CB6A 3GEHA 5FPYA 3QF7A 3BB1A 1W36B 1E94E 1HA3A 2O0KA 2WWYA 2ZJBA 2G1JA 5E95A 3BC1A 3WHLA 1US8A 1G8FA 2QT1A 5FBVB 2B6HA 1Z08A 5KNDA 2OCPA 2OCBA 2GCNA 3UIEA 5BN5A 2P5TB 2ATVA 1E2EA 3SC3A 2GTPA 1P2UA 2Y8EA 4C4PA 2JCSA 3E2IA 4XVQA 1OIWA 3D31A 4PAQA 2XEXA 2B7BA 2D62A 1Z6XA 2WAXA 3GJ3A 5KSZA 4JLPA 1LY1A 4XWKA 4WW0A 2QM7A 4QC2A 1M7HA 1KIMA 3GJ0A 4L5BA 1M7BA 1ZNWA 2IUTA 1U99A 4CZ2A 3QPVA 1ZRHA 1XEXA 2ZR9A 3PEUA 2DWPA 1RJ9B 4N0DA 5FI0B 3LAWA 1NP6A 1N6KA 4AWXA 1FOEB 3WNBA 1Z47A 2J87A 1XEFA 2K5UA 1VPLA 3P4XA 1I4LD 1T0HB 4DIDA 3QI2A 1RYFA 3KFXA 1PV4A 1H65A 1IXZA 3CZQA 3VR1A 4DEYA 4IOLA 1L2TA 2Q9CA 4IKEA 2PLFA 5JJLA 4AKIA 1E79D 4GNKA 4QBIA 1CR1A 3NG1A 4DUGD 4L9SA 1DTSA 4NYIR 3GLFE 4KVGA 3QF4A 4C0LA 5GADl 1XRJA 1XPUA 1AIPA 1RC8A 4HAXA 3EWSA 2YWEA 3LXXA 3U6KA 1AZTA 1LFDB 1ZCBA 1SKYE 1CRPA 2ZUDA 3SR0A 1Q1EA 1EFUA 2GK7A 4A0HA 1LS6A 4MKIA 1WMSA 3K0EA 5DN6A 1MT0A 4B71A 4AK9A 4D6PA 5FUVA 1KAGA 2V55B 1Q44A 3GFTA 4IDNA 1T5LA 3LQQA 4RZ2A 1J8MF 4BWYA 2ZR7A 1P3JA 4POAA 3FHCB 4RD1A 3FB4A 2J0UB 3DPUA 3CF0A 2AK2A 1I2MA 4X8LA 2B92A 4HLDA 5EXXA 1DEKA 2NO0A 2C9CA 3WRXC 4HLCA 1XXHA 2CLSA 3QKSA 2QRZA 5EUQB 4DSNA 3KB1A 4D0NA 2PMDA 2XNDD 4DCUA 1F2UA 3VFDA 2FGKA 1YZUA 1F2TB 2G0NA 1TU4A 3PV0A 1ZIOA 5M04A 1WE2A 1E2HA 5FL3A 1SQ5A 2ZU0C 4C0JA 1L8QA 4UXJA 1DPFA 4G3XA 1E2PA 1K8RA 3ZVMA 4Q5IA 2ZJ5A 2ZUBA 1TEVA 2CXXA 1J70A 3ZGXA 2EVWX 1M8PA 2NO6A 1NIPA 2QE7D 4QM7A 2RGCA 4TLCA 5EZ6B 1MO4A 2CE2X 2DWQA 4EPTA 4K8OA 4PAOA 1VTKA 1E1QA 3FMFA 1W1WA 2O52A 4YXWA 4WAUA 1VG8A 3AP3A 3GLIB 1VKJA 2JIZD 4TL9A 3FOZA 4U02A 5LB4A 3THYB 1ZC3A 2R65A 2GEVA 4YMWA 1L4YA 2V9PA 2F7SA 2GVZC 2JLQA 2W6JD 4C2TA 5CYPA 4LWZA 2CCGA 4S35A 1MH1A 4NCIA 2ZRPA 4Q66C 4RCZA 4A8JB 1G7TA 2ZJZA 3PUXA 1Z3IX 1Y63A 4EQ6B 2BM1A 4Q01A 4KU4A 5FPTA 4N0EA 4AI6A 5EP3A 1XD9A 5CK5A 2BBTA 3OE7D 2ZJAA 4PPFA 3IBYA 5KSOA 4ZKEA 3TVDA 3AH8A 1X6VA 3U7HB 4QFMA 1KY2A 4IXNA 1SHKA 2DYKA 5IT5A 2J7PD 3AVTA 4TT3A 4GL2A 1EWQA 3FWYA 2IL1A 2VEDA 2ZJ8A 3VMFA 4KVAA 2PL3A 2ZS9A 3UANA 4B6FA 2GCPA 4FI3C 1XCGB 1CR2A 2XTNA 4JYBA 1RJ9A 3RABA 2ZYVX 5J4YA 3M1IA 3T1TA 1W49A 3O8CA 4LYFA 3B2EA 1U9IA 4TMZA 5FTJA 4Q18A 5LD2C 3OHMA 1MR3F 3TIFA 1U8AA 3VU9B 2HYDA 5D3MB 2O8CA 1BMFA 5TDHA 1RKBA 3AUXA 5SZHB 1JAIA 2MSEB 1OFIA 4BRWA 4EPWA 4M1YA 1KK0A 1WBBA 1BYIA 2YJTD 3HP1A 2RGDA 3QEOA 1FP6A 4M1WA 1ZUIA 3TVTA 2F1RA 3S1AA 1UDXA 2YZ2A 3KX2A 3VQTA 2BDTA 2GK6A 3EA0A 1NVUQ 4IDPA 4HUQA 4XIGS 1E9RA 1XZQA 5G53C 4U5XA 1XFAA 2Q6TA 3EXAA 3WMEA 3NXSA 1ESNA 1U98A 1S1CA 2OBNA 1Z0FA 3DZDA 4V0ME 2XSZD 4ERNA 3R9XA 2O8FB 5JWOA 4IVRA 3KUCA 3L2OB 3V9PA 1KMQA 1KNXA 2HT6A 4FN5A 3PQCA 2G1KA 3MLEA 1WRBA 1DBSA 3I72A 2CBZA 1T3LA 2A5DA 4Q00A 2AKYA 2NIPA 5B64A 4XD7A 1HE1C 3K1JA 5GVSA 2J0UA 4HZUA 5EZ5A 5C4MA 2XTMA 5IHPA 3BH0A 1OE0A 4HLUA 3K0FB 4DSUA 2QA5A 5KUTA 4B74A 1OF1A 4NMMA 2WWHA 4KHZA 5L3SB 1V43A 1F2TA 4RD3A 1DAFA 3P1JA 3HR7A 3ZLJA 3QKTA 5AJVB 3KQKA 1IN7A 1EWRA 3SI7A 3CZPA 1O87A 5IDVA 3H0KA 4M9QA 1SVMA 2N46A 2WWIA 2VHUA 1QHSA 4PFSA 2DWOA 1C4OA 3R9WA 5FPSA 2PBRA 2FSIA 1Z28A 3SNHA 3QIAA 4JBXA 1G3MA 4ZIRB 2C96A 4TSFA 1W0JD 1QVAA 1DO0A 1VECA 1VYVA 3TBKA 4Z1MD 4R98A 2H5EA 2IEYA 3GLIA 3EASA 4HZIA 3THYA 1KTVA 4UXHA 2IUUA 2JLVA 4P4UA 1U0LA 3SJZA 4BFSA 5EJEA 2FJUA 1E9AA 2YINC 2ZRFA 5GVRA 1SXJD 1HURA 1U2RA 4PPNA 4ZI3A 1KDRA 2X8AA 2QTVB 1NBMD 221PA 4NHOA 5AJWA 3EZFA 4A8JA 4EQ6A 1NMYA 3T5DA 2GEDA 2GXSA 2CL6X 2PMKA 3BB4A
chains in the Genus database with same CATH superfamily
2D6FA 4F06A 3IVMA 5F35A 3H4TA 1DG1G 1BDHA 3KLBA 3R5XA 3TL3A 1LPEA 1B2RA 3I9V1 3REOA 1DSSG 5H4GA 4QD3A 2OZLB 1EUCA 1Y7IA 2OV2A 1J33A 5KSYA 2HLNA 2HNBA 2JGIA 5ALDA 4KX5A 1EHYA 3V8PA 4MQ5A 2Q9BA 2NTJA 2DPMA 1UJ2A 2YWHA 2D59A 2NYAA 3K6SB 4Q4AB 2B4YA 3F6YA 5EGYA 4JGGA 4L0MA 4M0PA 3H05A 3QBEA 4YY3B 3WHKA 4LHSA 3AI7A 1S7CA 5IFLA 1GPNA 2EFDB 3RTAA 2EGGA 3OO1A 1J8FA 5D86A 4PZAA 5BN3A 2I80A 2IYNA 5CT5A 4MV4A 1F38A 1WEKA 1U80A 5EWLA 3SC4A 1Q74A 3KK0A 1J1UA 1PG2A 1EQ2A 2E21A 4HH0A 5AW1A 4L3OA 3EZXA 3FYTA 4R1QA 4RUKA 3RHZA 3MLBA 3SP1A 1TUBA 1E6LA 3PJGA 2OWDA 3KD3A 5B6PA 1BVHA 3ERCA 3TUIC 5T4EA 1K2WA 2N0SA 4F1WA 5CPBA 2Y6UA 4OLHA 4DNFA 1I1QB 3D6HA 3L46A 1YA6A 1JHPA 1TNDA 1Z6TA 3VR5A 2ZULA 2BFFB 1TYAE 3W90A 1MABB 4FP9A 3ZW9A 3H1GA 2GNOA 3IHKA 4X44A 1LZKA 4DRZA 3B7PA 2CFIA 4MWSA 1X7YB 4PHHA 2FPOA 5TQVA 2QVGA 1EXWA 1U7HA 3GODA 3K8OE 5F9MA 3I5AA 3UAXA 3V1NA 4INAA 4NL4H 3TMAA 4IKPA 4PC7A 1E79A 5DTRA 1EKXA 1DUVG 3PQEA 3QLEA 2IQ5A 3NKFA 5F73A 4EP1A 1M2OA 4YCSA 4JLDA 4E11A 3NDBB 2F1IA 3HP7A 4KQKA 1RAGA 3AVQA 2R7VA 4IH1A 1DPGA 1TRKA 2YV2A 1UWVA 6CHYA 1Z0KA 1ZISA 3ETNA 3MS7A 1U2ZA 1NX9A 3GRAA 3JYNA 1IPFA 1WXWA 3G17A 1Y1KE 2G5GX 4DBLC 1ECPA 2UZ0A 2OGZA 1SC3A 3FZYA 2C4WA 3H8VA 3KHKA 4X1IA 1HKHA 4DR2B 2AP3A 2G06A 1LDEA 2VAWA 4CDRA 3LGAA 2VKTA 1MAWA 3NT5A 2WMNB 1SHTX 2ZWIA 2QAIA 1RHJA 2WHQA 4J0FA 2A14A 2KQ9A 2PGJA 4J3NA 5JS7A 3AEQB 1Y81A 4BCDA 3FKQA 3AP2A 3U3FA 4WY5A 3VZRA 3NWPA 2ZBRA 1QG0A 1PJTA 3U2LA 2NU9B 4JT4A 5DCLA 3T52A 1QGOA 3WLTA 4JLBA 4UTVA 2VL7A 3WGKA 4EIYA 1QGED 1Y5IA 1DAEA 5CFMA 5LFAA 2X23A 3HKDA 2AYXA 4O8CA 3O47A 1EFLA 5K0BA 5M34A 4HFJA 3RUDA 3QLUA 3M4CA 2Q07A 5K9ZA 4ZJYA 4EY7A 2F8MA 2VDLB 3TCKA 3DO6A 1WOYA 1OBFO 3BZWA 4LBVA 4CR7A 1SXJA 3RRFA 4D26A 1D04A 1DFHA 1HGXA 1MZPA 1L7PA 3AR2A 3I5PA 3CWCA 4Y6PA 1P19A 5A05A 1Q1BA 1EFCA 4C20A 2FPLA 1YHYA 3Q7EA 4H1TA 1V37A 1B68A 4IS2A 1LBQA 5EPUA 1AEPA 5TGDA 3I9JA 4LGMA 1V74B 3WAKA 4DDVA 2HWUA 2R6JA 4Y18A 1D7OA 5KNBH 2VNSA 4U8GA 3G4XA 3RYLA 1GZ4A 3FNEA 3U5ZB 1XLVA 2REXB 2AI1A 4ID9A 5AYVA 6NULA 4K8RB 1NXOA 4UMFA 5CDHA 5D1NA 1VL2A 2QG6A 1CKEA 4F8JA 1EYZA 2EKLA 4M36A 1AGRA 1S7GA 1MVLA 4EUNA 1NJFA 1YLMA 1QHGA 3EDMA 1K8XB 2P4EA 1CHNA 3ER9A 2RGYA 4CIVA 1RAIA 2ACEA 4JDPA 2IE8A 3CLSC 3UQYS 3CX6A 3KOZA 5ERYA 1XPOA 4WLOA 1UKBA 1HQKA 4S1WA 3W9SA 4JP2A 3TLEA 2WFMA 1BU5A 5AW0A 1UKYA 3FJ1A 4KOEC 3TTYA 4U3JA 3ZDYB 3GLVA 5HRUA 3TKAA 3PWZA 5A4AA 3NYLA 1YKFA 3WIBA 3IEIA 4EJSB 4H6XA 4CEHB 2Q6VA 3DUWA 3PYXA 2WOOA 4DR1B 2C07A 3C3AA 2QN1A 3BAFA 2WYIA 4D9MA 1KRWA 2EG5A 1V3QE 1S2LA 4KR0A 1CYDA 2HWWA 3Q3EA 2QLNA 4F97A 3E2PA 3PDHA 1PZGA 4JYAB 2CD9A 2ZW9A 5KU7A 1W59A 2JANA 4LZOA 3LK6A 3SEQA 4HG2A 2YLDA 1SIOA 2YDXA 2HL6A 4NH4A 1UBFA 4QICA 5DLPA 1G8PA 4YRNA 4FS8A 2ZRDA 1M72A 1IW7F 3HZRA 2DMRA 2YVAA 1W85A 4Q48A 4Z4FA 2XIJA 1L4NA 4MV5A 3I42A 2VP4A 4I5FA 4HNVA 1V1RB 2P9HA 1XZMA 3D3JA 5DCWA 1DXYA 2X8JA 4HPWA 4B7XA 4M1QA 4MKGA 4HE8D 4UQOA 3LQ2A 2BTOA 3B3AA 2WMDA 4OKNA 3QV2A 2CVHA 2OHXA 4PRZA 1HM5A 4CM5A 5EGSA 4H35A 3DV0B 3TF5A 5TIIA 4NENB 1X80B 3SFZA 1MC1A 2VTBA 1E6EA 2QPAA 4J0JA 2PP4A 621PA 1NFFA 5U9CA 1BW9A 3U7QB 1GZ6A 1I14A 4WOKA 2G36A 1WKBA 4MVOA 4MRNA 2G71A 1MV8A 2DUJA 1NVVQ 1TK9A 1JHYA 1P33A 3V48A 3UYLA 2WHRA 1KJZA 4FB4A 4CV2A 3R3VA 4ZTBA 3P9SA 2JAQA 4F2DA 2WJHA 4PRLA 4MA4A 3M2PA 4BZZA 4UZFA 4RCVA 1KSHA 3L0IA 5CDTA 1Q7GA 4CV3A 2NMVA 3SBEA 1E1CA 3KEFA 5CLHA 3I62A 4HNUA 4F2HA 2YV1A 4AMUA 1UWKA 1WR8A 1V16B 4Q1CA 4MB6A 5D7NA 2IWRA 4YNBA 4WEOA 3GDOA 5TJ5E 4RD6A 1DO2A 2QPOA 4ZC8A 3TE6A 1DKUA 4K6GA 1FXWA 4TMXA 4YQEA 1Z5NA 2DI3A 2JLYA 4DG9A 1RZVA 1QFMA 4JQOA 4XB1A 1WUTA 4W8GA 3NAMA 2VXOA 3AFNA 1Q0QA 5KDDA 4CM9D 2G08A 4A23A 3ICOA 2JHFA 4PAGA 1XU7A 4AS3A 1Z8FA 5FB3A 2FPKA 4UQPA 3RVDA 3WIEA 3C6BA 1N5JA 4U0JA 3PJRA 3C8ZA 1AT1A 3DQPA 1FNMA 3ZPXA 1X0VA 5ICMA 4RWZA 1AA9A 4RTRA 1GA4A 1OAOA 5CVJA 3BE6A 2YJGA 2CXRA 2CJWA 2F2TA 1KI9A 1VYHA 2YQ4A 2HMAA 3E5RA 5A9TA 4WJKB 3U31A 1A7EA 2PUJA 4QUBA 2Q2NA 2WW8A 1OBOA 3HBMA 2PGAA 1PR6A 1NVAA 1X2BA 4EKWA 3BF8A 4GOJA 1J24A 3EUWA 4JEUA 4RLHA 2JHGA 3SZRA 1FJGB 3FRIA 4FZVA 1IDN1 2X0RA 4UOQA 3QWAA 2ZBUA 5L0IA 4J9VA 4JLMA 1SQFA 4GMFA 1EGVB 4JCHA 3PTAA 3IIJA 1I3KA 2AN9A 3I5MA 5CIYA 3NJ4A 2VSNA 521PA 5HM6A 4INOA 2HFJA 2YEVA 1JDTA 1QV9A 1QKRA 1IEQA 3SHTA 3T1YB 2A59A 4MROA 1KOFA 1Y1LA 3JAKB 4H60A 3JQAD 2WAAA 5FUWA 1B0PA 4B75A 3MF4A 1DTWB 3M6VA 5E2IA 3TW8A 4YL0A 2YIDA 1TJPB 4TXMA 4Q1VA 3NI2A 4YHHB 3UMIA 3U9JA 2FLWA 1CJKC 4LYYA 2JW5A 2G28A 4EK9A 4FD2A 1JMKC 5HCIA 2BWJA 1SR8A 1T8TA 2UZ4A 2I1VB 5DM0A 3DF9A 4PZUA 3VVLA 2JFXA 3RSSA 3FDZA 1D2HA 3DCNA 4QL3A 2I62A 3WX0A 1O4VA 4EYSA 4QEKA 1Z6AA 5L4LA 3HBFA 3UWMA 4BVAA 3SQMA 4MYHA 4BLOA 2ZJOA 4HGRA 1OW3B 4RH1A 3UMJA 1VHTA 4MEBA 3UA4A 2OKCA 1ZL2A 1SZIA 1SC4A 2JZCA 1P6UA 3H1AA 1HEYA 1JSXA 2HIGA 3U61B 4KNWA 3ZWPA 2QMQA 4M7PA 5CAEA 1GTSA 3PTZA 5DULA 4C0AC 1BFKA 3ROEA 3DONA 2O05A 5MFZA 1UJNA 4KKXB 3LYHA 1YNSA 1R3DA 3TEJA 4JJKA 3GXOA 1R5ID 4ROSA 1YGPA 3RSGA 3EEYA 3PQFA 5EP4A 2QJRA 4IDOA 4PYNA 4D3YA 2GZAA 1KQ3A 1QO9A 2KGOA 3E03A 1GNPA 1IB6A 4IILA 3C5WP 3NDIA 2VF5X 3KOXA 3R9KA 3QEMB 3EQ2A 5TQ0B 4PYMA 3MT0A 1IY2A 3NHPA 1XZIA 4ZZ2A 1G9XA 3E1KA 3VSBA 3TWOA 1IUNA 1QPGA 3IBFA 1FBNA 3RRJA 3GELA 1KR2A 3B9BA 4CM9A 4K2AA 1Z15A 2GLUA 3EZGA 2HHJA 3I2JA 2M6LA 3V2HA 3CNNA 4X9XA 3ZWIA 4YASA 4ZRNA 3IRUA 3G0GA 5SYAA 1QRTA 4N8EA 2IY9A 2ATCA 1ZS9A 4Z99A 1N0WA 3ODGA 3SIWA 3B1XA 4I1RA 4W63A 3RADC 4FR0A 4KQ9A 5KSPA 1GA1A 1RWWA 3IQWA 2R79A 2UVPB 4IIHA 1VL0A 2G9ZA 2FRDA 1W5BA 2EBWA 3L0PA 1DWPA 3SCZA 2JI9A 1H22A 3ZN2A 4XD7D 3V7YA 4MV7A 3I73A 2CHEA 4TZTA 5DNEA 2WT8A 3OTIA 4G5OA 1RAAA 1IJBA 4KB5A 4AU1A 4EEKA 1E4YA 4J4BA 4AO6A 4OYYA 4REQB 2J31A 4TTIA 1E7MA 2EZ9A 3D8SA 5DHSA 4C4TA 4GU5A 2HA0A 3RFXA 2XZPA 4XJSA 5J4VA 2VZEA 1DWQA 3HVKA 4JENA 4O4LF 4OI0A 3LC0A 4ECAA 3DTYA 2BGUA 3O4IA 4FYXA 4YS6A 1POWA 4X20A 2H8KA 2HDOA 2LD6A 4JYCA 3NKVA 1N0UA 5CDFA 1GIAA 4B6OA 3AHJA 1RNLA 4L8FA 1N5IA 4RKFA 1M34E 2ZJ2A 1IOWA 1SR2A 2IP2A 3GFBA 3TW0A 3QNUA 3JQAA 1KI7A 2BTEA 2HBRA 5KNCD 4UUAA 2EKDA 4IAOA 2SBTA 3ZZ1A 5DYTA 1OXKB 1U2GA 3LTEA 4RVSA 1D2GA 3W5BA 5CR9A 2QRUA 4DGSA 3KQYA 5K0JA 3GYBA 1CJTC 5DPMA 3K2QA 4CPDA 3SYNA 1PZNA 4UNPA 3RVPA 4ZDWA 1GKKA 1ADFA 1E84A 2IOFK 3BIJA 1U28A 5IN4A 3KQUA 1NUHA 1GV1A 1T1SA 1BRTA 2WM8A 2KSQA 5KSWB 3GGDA 4B3JA 5AICA 1GQ2A 4ZEXA 4JBWA 2FZWA 1PJ4A 3QV1A 2DBVO 4OQNA 3S70A 4R0MA 6ABPA 3O3OB 2WIGA 1UJ6A 2OC4A 1MGOA 5K4GA 3H5TA 1OLXA 3RKOF 2CFOA 2W9XA 1E94E 3BC1A 5DM2A 4DQXA 1SCUB 3JV7A 3K2BA 3ZCPA 1C9NA 4M8LA 3Q2KA 5DMHA 3LHKA 1ESZA 2GCNA 5BN5A 4KN6A 1E6UA 3A6LA 3C0KA 3I2IA 4XLTA 3GUVA 3U4DA 1PGJA 1R6AA 2QVZX 4ZT2A 4RJTA 5FI0B 4PZPA 5C8YF 1NP6A 5KQMA 4CG2A 1K6EA 2BGJA 3P4XA 2FN8A 4GM4A 3KFXA 4Q9NA 3WYCA 4DEYA 2FN3A 3SYMA 4LX8A 1ZD5A 3BFPA 2ENUA 2WHPB 1VJ1A 4P2BA 4QOGA 2UXDB 1F2VA 4QFDA 1WUHS 3K0EA 4D6PA 5FUVA 3JALB 4IQ0A 4P9FA 3VBEA 1ADCA 1DMRA 4CNQA 4BJ6A 4HLCA 3LKBA 2G1UA 4MVRA 1F2UA 1GRVA 1P0FA 1E2HA 2UYGA 1L8QA 4FYYA 2NZWA 4KE7A 1NUQA 4HTFA 1AHPA 3LS1A 1V35A 4GQHA 1P0MA 2Y1GA 5LB4A 2QZ9A 2GVZC 2W2KB 1QX3A 2GBIA 5HXAA 5LJIA 2JK1A 5FPTA 1QPZA 1E89A 1OZFA 2O5CA 4C89A 5IT5A 2K2WA 1EWQA 1H2WA 4FI3C 4V1CI 4RLSA 3ZR4B 4PAWA 2XTNA 1RJ9A 2ZYVX 3JZIA 1MW9X 5JY1A 2WFZA 3IUNA 3N74A 3P9QA 3UO8B 5AKGA 4M1YA 2QWXA 4KC0A 1ZUIA 2I4TA 1EVLA 1UDXA 2BDTA 1XZQA 1XFAA 2GEJA 3NXSA 4A8PA 1YE5A 2BMAA 5B2EA 2O8FB 1K8YB 3SKXA 3ZNNA 1GUZA 1M3SA 2QE6A 3IYLW 3RS9A 2I99A 4XD7A 2JHAA 4HN9A 1PR3A 4EVQA 3GPIA 4NMMA 1C8VB 4DR7B 2PMEA 4A26A 4AJ2A 3UUWA 1EJ0A 4XA8A 3FUWA 1PHPA 4K6HA 4NJMB 4QTUB 5J2TA 2GKGA 2VHZA 1VLVA 1BMDA 3IDSA 3KOUA 3NRBA 5IM4A 4ZQHA 3KVYA 2YINC 3FOWA 3U0BA 2X9VA 5A4KA 1V8PA 1TJYA 3B2NA 4HGPA 1FQJA 3OWTA 2WJYA 1GPYA 1Z3CA 4IZ6A 5BVGB 3VSAA 3SEAA 1N7GA 3HB4X 4UJ5A 3CX4A 4F4CA 2H2WA 3TSYA 2Y69C 4ZZ0A 4ARBA 3HWWA 3O8BA 5LOVF 1HYQA 5JATA 3PEWA 4TTJA 1BA3A 2BKUA 1JQJC 1R6XA 2IS4A 2YJZA 3DEAA 2O1WA 5KNCA 1CDOA 1WPQA 5AVVA 1AQLA 3IAXA 3OH8A 3JWEA 1M6NA 4P3PA 1Z2NX 1P3DA 1G21E 1B6TA 3HU2A 1K08A 4PPGA 1ZJWA 2VRNA 1QB8A 2OZPA 1HRKA 5J5CA 3QMVA 3ETEA 4DT1A 5DRYA 5H02A 2E4XA 3EIOA 1C0IA 3CB4A 3DEZA 1HT0A 5C31A 4PGAA 2P65A 2C3YA 3MWYW 3FHOA 3FLBA 4EGSA 3ADKA 3V5YA 2IGBA 2ZQZA 3FDIA 4KP7A 2Y1WA 4WGFA 2ZXEA 4KDCA 3BIXA 2FVYA 4B73A 4YUYA 2FSUA 3EA4A 1T9DA 1ZHXA 2GYUA 3WJ7A 3W4JA 3F5QA 1FX0A 3BWBA 2J48A 1K05A 3PNOA 3B85A 1EP2B 3B6ZA 5DGTA 2AFHE 4UU0A 4HGOA 1IYZA 2A0BA 2Q4RA 1TM1E 1CS4C 1PJCA 4G0HA 5EFZA 5JECA 3DWWA 4GDMA 2AOUA 3M3PA 3WRVA 5IY5C 3BRSA 1LU9A 3ZLUA 1N7HA 4TMYA 2FFBA 3CLHA 1EZ1A 1SCIA 1OBCA 3HKEB 3FTFA 3L82B 4KQGA 3FAKA 5KQRA 1IHYA 4D5EA 2YNMD 1PQYA 4GYJA 3GGCA 5K8UA 1UDBA 3N6RA 3PXUA 2IHTA 3UMFA 1E2IA 1BXKA 2ZRBA 4J94A 2R1VA 1HDZA 2E37A 4JJZA 2CVQA 3V7UA 5KOHA 4B4VA 4AMYA 2CK3D 4PQFA 5LZ7A 3UXEA 2WSIA 5EQTA 3VYSB 2J85A 2NQ8A 1RM5A 1U8ZA 5I8WA 4Q3AA 5JAMA 1JH9A 3OU6A 4JSYA 3GVCA 4JFRA 4OIPF 2VRWA 1RXCA 3O38A 5BQOA 2WWGA 5AI8A 1DOWA 2EILC 3OP1A 3GRPA 2FWBA 5AWFC 5EJMA 2EPNA 2FMXA 3E9MA 1QIFA 1IUOA 2VC9A 4I8XA 3L07A 5G1OA 3RFUA 2JAWA 2Q5LA 1XN1A 2I7CA 1AY0A 4D9NA 2F59A 2P4UA 4EIWA 1ULBA 2GCOA 1RXWA 1KK2A 1QLJA 2G70A 4TL8A 5ICSA 1E83A 3L1IA 2H5IA 2WVAA 1RQNA 3TQFA 3RSHA 3DG9A 2QUIA 1XWIA 1ONPA 4X3PA 1GYQA 1SKQA 4K7BA 1VHWA 3KQMA 3HC7A 5CCEA 2DVMA 2NUAB 1W4RA 4FFBB 3GBVA 4RF5A 2PD4A 3DKVA 3WMFA 3SF8B 2JIOA 1I0ZA 3AX6A 5F76A 1H23A 3MOGA 1AQNA 2RARA 4HFNA 2B21A 3USZA 3QW0A 4G0NA 2OEXA 4UAVA 2WTBA 1NULA 3UVEA 2JAPA 3X43A 1E4EA 2QVXX 3BMNB 5A0VA 2HCTA 4YCJA 3O9MA 2JJQA 1OIVA 2W6NA 1MO3A 4G01B 2R6R1 2NM0A 1A50B 3H2YA 4MWEA 3IB6A 3BD7A 2J30A 3R0VA 3MCAA 5T6MA 3TLCA 5A9SA 3GGGA 3OLQA 4ANJA 1SUFA 5IZ4A 1V26A 5CFQA 3R76A 1LWOA 3SM3A 4DCMA 1Y3CE 2P4QA 4LCBA 1IXRC 3F7OA 3O0DA 4BO3A 3BE8A 4RK6A 4EENA 3NTOA 1IRIA 4MV1A 4JOCA 4YJFB 3FCOA 2LNDA 5DNWA 3LHDA 5F9HA 1RKVA 1UQUA 3VTZA 2BHSA 3AR9A 1UZNA 1QKKA 1U81A 1GNTA 2X41A 2BEUB 1RJWA 3AONB 5AJTA 1RYBA 2PV0A 3VHXB 1O6ZA 5EE0A 1AK1A 1BXRB 4QJ4A 4U9UA 1H69A 1YS7A 3I6BA 1P5JA 1B0UA 2CHQA 2WY2D 3ZCUA 4DADA 4GI3A 821PA 3AIOA 4B3XA 1Z5ZA 1K27A 4YPOA 5EKTA 2VWPA 3GLIE 1T10A 1VLQA 3GHHA 3HN6A 1BXGB 3QG1A 3ZY3A 3CIOA 4DIFA 5BP7A 2AZDA 3W5JA 1ARZA 4KDRA 3A70A 1TZKA 3GJ6A 5E2AA 5CG2A 3ICEA 2IH5A 1K6IA 3N2YA 3H5IA 1VQ1A 5KMGA 5KJCA 4Q7JB 2VASA 3I9FA 3V42A 5IG2A 1TU0A 2I7VA 4BFYA 3ZKWB 2H1CA 1U4SA 3UJ6A 8OHMA 2ORWA 2G72A 4MYDA 5GINE 3H18A 3PFBA 1RJFA 2NPOA 2YNMA 4ZPXA 4WKGA 2O8DB 5CG1A 4KYTA 3NTXA 4KWIA 3FGOA 3GZJA 1DINA 1OX5A 1HG0A 3T7DA 2OFOA 4A91A 2RI6A 1U0HC 1KO5A 4YP6A 4MVWA 1YT5A 2PTHA 4CFZA 3ZE1B 4FYMA 4TKMA 4W7HA 3Q7IA 2CK3A 2QW8A 1W2GA 2Y68A 1YRHA 3C5CA 1FS6A 3BG5A 4C29A 3ZGVA 1MQ8B 2HDWA 2ZS8A 3HDTA 2I54A 1F14A 2Z3VA 2FUG1 2P4HX 3OHSX 3NEYA 4US1R 2DKOA 2VYQA 2ZJ6A 4BFZA 4BNJA 2XLWA 3C1TA 2XGSA 1KARA 3IAM6 2G0TA 4L74A 1PV1A 4G0VA 4HNGA 4ROTA 4UZEA 1NXXA 3RAJA 4GUDA 5EHQA 5EIAA 3H17A 3KQOA 1G3RA 1Q7RA 4H4DA 1QGUB 3V32A 1MJ5A 4XB6B 1NBWB 2FV8A 1XMPA 3PQ3A 4TKUA 1OH6A 5M2QA 2P6MA 2Q2OA 1TL7C 3LZ6A 3ABIA 1N6IA 1XJCA 4OLJA 2WTEA 1UP6A 1HKUA 3O7MA 1MNQA 4D0GA 5EJ8A 4JMLA 4TUYA 3BMCA 3IQEA 2X2PA 3GFRA 1OAKA 1T36A 1ZIDA 3SIXA 2C9OA 2FPXA 4BO6A 4FZ3A 4JB2A 5IT9A 1XKQA 2VT6A 2P5UA 4MYCA 3KALA 4JXXA 2XBLA 4FCTA 3M82A 2RSEB 3PUJA 3DR3A 5LL6P 4Q9AA 4QXAA 3VZSA 3R3ZA 4MQEB 2EP7A 3T5CA 4PIPA 3FUVA 4IXMA 1YMUA 5BOSA 3FZEA 5JQGA 4G86A 3R8CA 2O6HA 1MRNA 3NZEA 4BO4A 3TEFA 2O7NA 3KKPA 3R3HA 3T7RA 4WBNB 3H1TA 4GPIB 2BP7B 1PV2A 3AOGA 1G4HA 2P6OA 1OXTA 4WA7A 1G8JA 2FWAA 2PUHA 1LRLA 4PLTA 3GORA 5FR1A 3EGDA 4MR8B 4MW0A 2WG2A 2BDEA 3W2TA 2O2GA 1GCOA 3GEGA 3GUYA 421PA 1G1MA 4CV0A 4PGHA 3H42B 4F9GA 4EMUA 2WKWA 4U5GA 3KKQA 1ZUNB 1XCMA 4KBYA 4J07A 4LGVA 4XIYA 2VFAA 3KEQA 1LLCA 2C7RA 3U9SA 2CHGA 1GN8A 5JD5A 1K3FA 1AV7A 5ALSA 1WY5A 2AUMA 5FBLB 2FZLA 3BRQA 1OW7A 4TX1A 4DC0A 3HFGA 1DC3A 1TADA 3LWBA 1JSLA 1AS2A 4C3UA 2DCUA 3CW8X 1KO1A 3ZXIA 1DKMA 2QTTA 4O4HA 1BKDR 2EW2A 4KWTA 3DGFC 3LBHA 2GT1A 4FYWA 1P60A 2RONA 3L0SA 3FY4A 1IN5A 1POXA 1OVMA 1E1KA 4H31A 1D8AA 3KXIA 2Q7DA 3QEKA 1WMAA 4C0HA 3FSJX 2JJ2D 1PCXA 2IYPA 3K6RA 4AICA 2ZJ4A 3DYIA 4NICA 2W6PA 4PR0A 1L5MA 4P7FA 3NU1A 3QVTA 4EVRA 1AQUA 2R6HA 5BSKA 1H1TA 2EW8A 3PEFA 1ULZA 2OAP1 1LGYA 3S1AB 2CLLB 4NBSA 2GWHA 3OUZA 2IX3A 1JHOA 4X61A 2FN7A 3PUWA 2R44A 3NORA 2JGRA 4LXIA 3W7AA 4O63O 4KXVA 4AP5A 4MV6A 3LA6A 4Z9BA 2XA9A 1LF0A 1NFOA 3CRQA 4JA0A 2F3QA 3GWLA 3EC2A 1LVUA 1NTOA 4GOLD 2IIPA 3GLFA 1C1DA 1SOMA 4FEAA 4AP6A 4KIUA 3K0AB 5F3DA 1A0BA 3SIRA 3RKUA 3GR6A 1YJ5A 1HV8A 1G55A 4CYMA 4QGSA 1G38A 3ETLA 1E4OA 3V4PB 4BHTA 2ZI3A 4ETMA 5CDGA 1TVKB 3GA7A 5AD1A 3LLIA 4QGFA 1BMQA 1JLLB 3LRXA 1NN5A 2NUPB 1TM4E 1E7SA 4QDOA 1A71A 4OX9Y 4WGZA 1TD9A 4HQOA 1FK8A 4J91A 1GL3A 5BMVA 2XVZA 3M1AA 1D2MA 2HC9A 4NZNA 2XBUA 1KEKA 2A92A 2QTGA 4AJNA 4DQDA 2XL6A 2WYVA 1JKFA 2KYHA 4CIDA 1NDHA 4LGYA 1J09A 5DSZA 4HQNA 3MWGA 5HIAA 5CT4A 2H1FA 1VYIA 1Z0UA 3IURA 3RBAA 3OEYA 1L1QA 5C7OO 3RYFA 2CXQA 5DI3B 1IY1A 2H18A 1ECJA 1XTVA 4N4WA 4J8PA 2XMPA 2DUWA 5JSFA 3ZWQA 4MI6A 2JGKA 3TPFA 2LWIA 2FEAA 2V4ZA 4HDNB 3LDHA 3SSAA 8AT1A 1J5PA 1RRCA 4P33A 1U04A 5GWXA 2HXSA 3FYUA 1BFDA 1FZQA 3Q9NA 3QFSA 1UC9A 4TKZA 2GJ4A 1P7CA 4R9UC 3K30A 1B3RA 3CH5A 1MB4A 4YGYA 3TLYA 4D99A 4LJYA 1SQ6A 1FJXA 1MW8X 1GNLA 5HZHA 4WZZA 5AT1A 2MMCA 1TKCA 1S9DA 4TTPA 1UF9A 4AJEA 1XQVA 1KVTA 4ITRC 1ADJA 1TKRA 3NOVA 1V39A 1B6RA 1WBDA 4QARA 4UCWA 2J0XA 3WL7A 2XUQA 2B30A 5BUZA 4MS3A 3ABZA 1AX9A 4WXEA 3JD4A 2KK1A 4ZK2A 1VK5A 3KLOA 4N12A 3SNKA 3R3UA 2LUOA 1ZI8A 1WCWA 4OK6A 4ZU6X 5ITVA 4QUEA 5A0FA 4UCFA 4H17A 4G0UA 1LI7A 1O95C 4MPJA 4DPLA 3X2QC 1IRXA 3MFQA 4JXZA 2VCBA 4AUMA 1XB2A 2RB4A 1VI2A 4LDNA 5AKJA 2LSEA 3A28A 1M2VB 1SIBE 5BV8A 2ZRAA 2FMKA 1W87A 2VJPA 4YQYA 4ZU3A 2Q7XA 1LDNA 2OKGA 3MA0A 5D84A 1LPMA 4Q7QA 3BRJA 1MQVA 5B36A 3BMQA 1M33A 3CB2A 4QPNA 4DBZA 1SUBA 2YXBA 3SVLA 2VNJA 4QI2A 3G5UA 5FP0A 1CNMA 4OB8A 3ITKA 5CXQA 3LY8A 4B7CA 4TM8A 1QIKA 2JJ2A 1ABBA 5K09A 4DNPA 2ZYTX 3UHOA 3KUUA 4G1MB 5EMJA 1JLMA 4EVSA 1JEDA 1LCIA 2J3EA 2BI4A 2Y3IA 3ORSA 3RS8A 2E4AA 2UU9B 2ZAYA 3G0DA 5HSWA 2ZBQA 3PXAA 4WJLA 4EO7A 1U2PA 2R4QA 3ZE9A 4O25A 1G2IA 4L07A 1TGYA 1BGVA 1JECA 4A1FA 2GZDA 2A57A 3NYQA 3TS1A 5TS3A 1YL5A 9ABPA 3WGGA 3PHCA 1V41E 3FOBA 2KJQA 2ID8A 4WK6A 3TKLA 1N25A 4PG5A 5EIBC 3U4HA 4K9QA 1FTWA 3FVQA 3UA3A 2YKGA 1T0UA 4HYTA 1K06A 4FLMA 4XAQA 2XVYA 3SXUA 4I5DA 1CUSA 1KKLA 4R3UC 1XZKA 5E3AA 4DJEC 4F85A 5CH8A 3N8IA 3OLVA 3PDJA 3FCYA 1VA5A 2XQIA 5I01A 1AN0A 5HDQA 4EEXA 4ESVA 4J7CA 2ODNA 5ALHA 4OXQA 1RQXA 1L5HA 2HA4A 1J7KA 1CS0A 3O10A 5BWNA 5HUJA 1W36B 5MGBA 3DR5A 1H9GA 2CLOB 5FBVB 2YZKA 3BHIA 5KTNA 3UIEA 2QV0A 2AOXA 3HFJA 4Z9AA 5FDFA 5JXWA 5A6SA 1Z6XA 1XYVA 3QPVA 3PEUA 3I1YA 4HYEA 4JVOA 3LFHA 1I4LD 1SA0A 1K63A 2H8AA 2OXIA 4RVFA 4ZVOA 5CT9A 1I32A 2CFRA 3QA3E 3AU8A 2PS3A 2C9MA 5AM3A 5K5EA 3HXMA 3PC8A 1CRPA 4W9NC 4CLRB 2EPLX 4E46A 2Q3BA 5HW0A 4HFFB 2QQFA 4RZ2A 1U0NA 3CF0A 4Q3CA 4I3MA 1O0CA 1XWWA 3P2OA 3PDCA 1C0EA 1SQ5A 4CV1A 1BS2A 2R4TA 4DL9A 2LK4A 1CY6A 4PCLA 3COWA 2IIVA 4HRAA 2X40A 1PJZA 3FOZA 2OEVA 2H2IA 2HGSA 2EBUA 2GEVA 5KAPA 5IZCC 1ENOA 4ND3A 1BNCA 2PSJA 4QOHA 2IXBA 4N0EA 4BAZA 1P7PA 1YCDA 2DHQA 3WWDA 5CEJA 1X6VA 5JCOC 1FFTC 2J7PD 2G80A 4GWLA 3UANA 4QG3A 2GCPA 2JVIA 4J1NA 3HACA 3RTCA 2SCUB 3GPDG 3HQ4O 4CU5A 3DDHA 2EEZA 4EHPA 3S6JA 1KEUA 1UM9B 3KX2A 3TZKA 1H94A 4U5XA 2OBNA 1TQ8A 3DKAA 2VUUA 4AY3A 5BMOA 2WDZA 4FONA 4ZRMA 4FDVA 2A5DA 2AKYA 5LXTB 1GV0A 3MLAA 1TJNA 3BH0A 5JNRA 1M6HA 2WWHA 5HFNA 3TRDA 1YL6A 4DLKA 2LP4A 2F8TA 1LC0A 3V7FA 1C4OA 2W98A 4M7OA 3QIAA 5TMDA 1M2JA 4YJ2F 2ZYAA 4P84A 3L92A 1WUKS 5GZ3A 4H7HA 3EASA 1RWOA 3OHPA 4Z2AA 5EJEA 3SJZA 2HH9A 2FJUA 3FOAA 3BSFA 2ZRFA 1KJJA 1HURA 3H3FA 3H65A 3V7OA 1XMXA 3PBKA 2R1TA 3D7KA 2GXSA 4DTCA 1A4RA 4CLEA 1G42A 2V6BA 2MMGA 1XLUA 1NI3A 3LVBA 4ZV7A 5H68A 4B4DA 2AHRA 3NIWA 3PC3A 4CTKA 2REOA 3QJYA 3DTVD 1NQXA 1PS8A 4KN8A 4F6CA 4BO7A 3K6KA 4DCVA 3C6XA 1KZ6A 1Q1GA 2QRKA 1JEQA 3EDRA 4JUBA 3QUQA 2V3VA 1VZ3A 3SG0A 5AM4A 1LXCA 5BSGA 3R7CA 2Y39A 2R2AA 4EHAA 3N0RA 2H0QA 3DJNB 2PUVA 3M81A 3TG8A 1E9DA 4ESOA 2YOHA 3N0VA 1Z56C 1TEHA 2Y93A 3WXBA 1XRLA 3P0EA 4RZUA 5HIKA 1ZVZA 5AVSA 1H93A 4KAXA 1B73A 4OYLA 3OA0A 2A0UA 3QWIA 1Z0ZA 1M8GA 1XXLA 3T61A 3ABLC 4RJJA 4WLVA 4V1CA 2P8SA 5E7JA 4QRDA 4Q4ZF 2QRLA 1SUPA 4DBRA 4RZSA 1XPJA 4Y6RA 1UBRS 2F6RA 2HJ9A 2A0KA 1FMLA 3WGZA 1EKYA 4R54A 1QFYA 1OLOA 3I34X 3HO8A 4JYZA 1YS9A 1YBMA 4HOYA 1NE7A 3MWLA 4PC3A 1QIEA 1PNOA 1PYOA 5CDSA 2ZIGA 1Y8ZA 5I7UA 5LP6C 1AURA 1JU9A 1XN4A 2Q4TA 2X13A 3CPHA 1OH5A 3FGPA 2JI4A 1N4AA 5HZGA 5JDIA 1CUZA 3IAEA 4MS4B 4N18A 5J23A 4NOMA 3QBJA 5HNKA 5JSZA 4G7ZF 4PINA 2P0AA 1E8DA 4KQ2A 3DKPA 2GS9A 4WKPA 5A7FA 3LX5A 2XXAA 1HE5A 1T4BA 1XQ9A 2D2IA 3TD6A 4XPXA 4NYIQ 3JD2A 3BGVA 3EQ7A 1L5VA 1GCAA 4DLBA 4LNUB 4B3GA 1N1CA 4R01A 2JEZA 3HYRA 4N3NA 2QEQA 4M0FA 5AW7A 2WNIA 4OEHA 3IPXA 4O1MA 3F3YA 3LRTA 2HV8A 2WYUA 7ADHA 4U5QA 1DCKA 1OLUA 2AR9A 4ZAXA 4WCFC 3LY9A 1TWCA 2R7TA 4JI6B 5ED4A 2ZJ3A 4E5MA 3WIVA 3ID6C 2NVOA 3KQLA 1A1VA 3IQXA 3QU4A 3MWDB 4MZDA 4O6YA 1TA0A 2CW5A 5E6UB 2BV3A 3T4EA 3HVUA 3SJAA 4OHYA 4CGZA 4UNQA 1GGKA 5B3JC 4XX1A 3TB4A 1LTQA 5K8CA 2F64A 2J1LA 2J7PA 2BH2A 4CKWA 3NHSA 3HLKA 1YFKA 4ZVSA 4FBMA 2V59A 3WLSA 1NMEA 4ZAWA 1X1QA 2A9QA 2GN0A 3DQZA 4UDYX 1Z38A 1YDGA 1NNSA 3MD0A 4OSEA 3SGLA 3QKIA 2RKWA 1W4AA 4Y98A 3EZ9A 3UMCA 4N8SA 2JAUA 2P5SA 1OMOA 2PX2A 1ZVKA 5EE5B 4Y9SA 1FFXB 1NV8A 2VK4A 4OPMA 2B5WA 1R5OA 5LQMA 2PU7A 5IVDA 1M54A 2DBQA 1LJUA 4DHEA 1FJ2A 1OU4A 4RMHA 1S02A 1SUEA 4QGBA 4I2VA 1UMBB 5ECYA 2J4DA 3V6MA 1RXEA 3S5UA 1PEAA 4IIJB 3IR6A 5HRCA 2NG1A 1A9YA 5L3ZA 4B6GA 4HB4A 3HZOA 2YJ4A 5FR2A 1P4GA 2H59A 2YHIA 4L50A 1NUAA 3HN2A 2II6A 4II7A 5J2UB 4LBZA 1C2TA 2OORC 4O59O 3K31A 4UBJA 1F5SA 3L49A 4XIFA 4WACA 1PJRA 3KJIA 1JB9A 1FFEA 4NCKA 1J56A 3D64A 2QROA 3TZCA 2JFHA 2QTRA 4ZO6A 3NHWA 2X5KO 2C8KA 1HZZA 1R0YA 3DTVA 1A76A 4OI1A 4DIOA 3SF0A 1U1CA 4ZMBA 3KVOA 3S55A 5E9JA 5KO2A