4DJ9A

Human vinculin head domain vh1 (residues 1-258) in complex with the talin vinculin binding site 50 (vbs50, residues 2078-2099)
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
251
structure length
242
Chain Sequence
b'VFHTRTIESILEPVAQQISHLVIMHEEGKAIPDLTAPVAAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTQGIEEALKNRNFTVEKMSAEINEIIRVLQLTSW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vinculin
publication title Crystal structure of vinculin in complex with vinculin binding site 50 (VBS50), the integrin binding site 2 (IBS2) of talin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 103
structure length 242
sequence length 251
ec nomenclature
pdb deposition date 2012-02-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 4dj9A02
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 4dj9A01
1RKEA 1RKEB 1ZW3A 2B0HA 2X0CA 4PR9A 4DJ9A 3RF3A 4E17A 1H6GA 1DOWA 3VF0A 5L0HA 2GDCA 1T01A 2LQGA 1U89A 3S90A 2L7AA 5L0FA 4W8PA 4EHPA 1YDIA 2IBFA 1ZW2A 1ZVZA 1U6HA 3T6GB 3ZDLA 4ONSA 3TJ6A 5L0JA 3TJ5A 5L0CA 1SYQA 1TR2A 5L0GA 1QKRA 5L0DA 2GWWA 1L7CA 2HSQA 3H2UA 4K1OA 1RKCA 3H2VA 4IGGA 1DOVA 5L0IA 5FZTA 4P9TA 3MYIA 1ST6A 4E18A 1XWJA
chains in the Genus database with same CATH superfamily
2NSGA 2YWAA 4OD4A 1JAFA 1UG7A 2PX3A 2RD9A 2OCCC 2YLGA 2ZXOA 5A6AA 2LQGA 3JT1A 1BZ4A 5L0FA 3F46A 2Q7RA 4PFPA 3T6JA 3OA1A 3DI5A 3G4XA 3JRTA 3C18A 1Y6DA 1YARO 1TR2A 2FGYA 3LLKA 4J32B 3TOLA 5JS5A 1M2VA 1M2VB 1ZHYA 4CJOA 1YYJA 3V5XA 1WTYA 4YT2A 2DI3A 4KBLA 4EBBA 3C7JA 4JCHA 4AE4B 2L81A 4FX5A 4AE4A 1ZHTA 2CDQA 4MTFA 1WWPA 4WGZA 4JC7A 2J9VA 4CSAA 1GGQA 2CNWA 3DKAA 4Q7CA 3SNHA 2E87A 3K6BA 4U5GA 4E0IA 1BR4A 1LI7A 2NSFA 2HS5A 2X0CA 1FNTc 1RCPA 3BRJA 2ZXPA 2R05A 3Q7GA 4MTOA 3NDBB 1R5ID 3QVZA 2QUPA 4LLEA 3UNGC 5L0HA 4BJ1A 1G5ZA 1U6HA 3LAYA 3POVA 3TJ5A 5DQZA 3GODA 1SYQA 2HJMA 3NMIA 3ZQVA 3SXYA 4IB4A 3A9CA 3UGOA 1OW8A 3LUTB 4NTFA 2EIKC 2KYHA 3ATPA 2XM0A 3RW0A 5L0IA 4IGGA 4N06A 3U0CA 2A6EF 2CYDA 4JCZA 3SXKA 2A68F 2A6HF 4KNWA 2P0NA 1UFBA 1HW2A 3MYIA 1PD1A 3GORA 5FCLA 3EH2A 3Q6NA 4I3MA 2JD3A 3FHDA 3LLIA 5KYXA 4MW3A 5KYXB 1LVKA 4AK9A 3NG1A 4RDAA 2KW3C 3HNLA 4EBJA 5CIVA 4DJ9A 1J8MF 3AG3C 1C17M 1M56C 4O6NA 4MVZA 3E70C 3U2LA 1TFOB 3S28A 3X1OA 2VCAA 1LE2A 2P6VA 3HNJA 4D4NA 5KYYA 5KYYB 1CGME 2OEXA 1VK5A 4G7OF 1S05A 3FMSA 5L0JA 2HMZA 2L9JA 4JIOA 3F47A 2XXAA 2WL8A 3T6GB 4KC9A 4O7GA 3U9JA 3HTKC 1WN0A 3M1CB 2XLOA 4OIRF 4JTDB 5L0DA 1ZU5A 2WB7A 3AOUA 3DJNB 3H2UA 3LS1A 5JP7A 1RKCA 1JR8A 1D0XA 1PCXA 1RXQA 3L0IA 3ABKC 4YT5A 2HSBA 3EZIA 1I5NA 1AUEA 3IHUA 5T1DB 3US6A 1APCA 3LS0A 4C3BA 5A6BD 3FVYA 1FMVA 2HV6A 4NQFA 1VOMA 4O6MA 2A0UA 4E18A 3CQZA 3R7CA 2IOQA 2G62A 3SXZA 2AU5A 3NKDA 3K7DA 1ZW3A 2NUTB 2NUTA 3SEOA 3TQOA 3UMIA 3S0XA 3AJMA 3H65A 3JYHA 4J30B 2HJ3A 3B29A 3JCUQ 2Q9CA 1OR2A 2W45A 3CSKA 4N6HA 5AGFA 1FMWA 1OKKA 1FAPB 1TWHA 3EFOA 3EFOB 4XQ1A 3NRHA 4AL1A 5B3IA 1OR3A 3ABMC 2MHRA 3C63A 3ZDLA 1WATA 4P9FA 2PBEA 1A7DA 2LIGA 3SXMA 3S27A 5L0GA 1FFHA 1OCOC 2GWWA 2A69F 3PCVA 3V5ZA 5A6KA 5K0IA 2KC3A 1VTMP 1VLSA 2J9WA 2GAQA 4MVRA 5IY5C 1MQVA 5BQGA 1NU7D 3EH1A 3WG7C 1EQ1A 3IQ6A 4BJ5C 4CSAC 2CNWD 5AC5A 2RSEB 2XM4A 4XLNF 2LD6A 3U3BA 4LERA 3UGPA 5JLIA 5D91A 3NYMA 3S9OA 2LFFA 3JYYA 5JSLA 4BJ6A 5EHHA 4LDQA 4RBNA 3M79A 4HEAJ 3QZCA 4NC3A 1LS1A 5DQTA 1HMDA 1CPQA 1NLXA 2XLEA 4QI0A 4YJWA 3V7OA 2GFHA 5T3WA 4OIPF 1RMVA 1GS9A 1Q0GA 2BC5A 2EIJC 3NMKA 3HKKA 1YJGA 4GEHA 1NSGB 5EGYA 1GQAA 2ASRA 1YA9A 2WVOA 3MLGA 2R7SA 1D0YA 1MNEA 3QTHA 4DRHB 2VB6A 3AG1C 3B0UX 3DE8A 2HZ8A 3ECSA 2H8AA 1FTSA 2VCCA 3RQFA 5HSWA 5E2QA 4AX2A 3AQCA 1LE4A 1BBHA 3O6XA 2D5RB 2EPMX 4CS8C 4E0HA 1NFNA 2R7QA 4XWJA 2PFDA 5DVWA 3LNMB 4CS9C 4H54A 4E7ZA 5COGA 1O5HA 2QLAA 3KYJA 4G7ZF 1ORJA 2YKZA 2EILC 2Q9AA 1E2XA 1MMDA 2ZXWC 4XPXA 3RQGA 4JEBA 5AC4A 2XSEA 1VLTA 3U9MA 3EGDB 3EGDA 4U5BE 4EUKB 1QKRA 2XL8A 4WABA 3N2ZB 1VMAA 2F22A 4BG0A 2J8WA 1AEPA 3U3FA 3LEVA 3PHF2 2YRFA 3LEOA 4YL0A 4BEJA 4JZAA 2IXMA 2KQ9A 3AG4C 3EGXB 4IRUA 1PD0A 2VASA 2AVKA 2YL7A 1T6UA 5DLJA 5JRAA 2R7RA 1Z63A 3O55A 3NYLA 5E3AA 4PJLA 3NMJA 1BR2A 2YLDA 2NPUA 1A0BA 4KNVA 4PR9A 2L6FA 1OW7A 1DOWA 2DYSC 4MTGA 1G8XA 1Q0MA 3M4BA 2L7AA 1VYIA 3ZSUA 4C3DA 1A7EA 1YDIA 4R32A 3FDQA 4DBRA 2EPLX 3W2WA 4JKVA 4QDLA 1E84A 1V4AA 3W8HA 4J7TA 1M2OA 256BA 2WZFA 3RKOF 3TD7A 1K05A 1O87A 2J0XA 4PJMA 1L7CA 5T3TA 3RFYA 2YQYA 2Y39A 3DE9A 5JUAA 3DAGA 2Q00A 4M63A 3CEXA 1Y4CA 2J0WA 1Z3IX 3KYIA 5FZTA 3T9OA 3GEHA 2IYLD 4XPWA 3UMHA 3O10A 3KMIA 4HFFB 2QNLA 3FOPA 1ST6A 1OXBA 1MMAA 5TJ5E 2UUHA 4JEAA 5L0CA 1RKEA 1RKEB 2Y3HA 3ZTZA 2B0HA 3L1MA 1HMOA 4BJ6C 3C8ZA 2Y69C 4XTKA 3V5YA 4JJFA 4OINF 1CPRA 3PMRA 3IQTA 4PFOA 2R25A 4XPYA 2J9UA 1NBBA 1YVIA 1U0BB 1OCCC 3C8GA 1ZVZA 2OJQA 3C8GB 2WZLA 1LKXA 3GM2A 2ZD9A 1CGNA 3OWTA 4N6CA 3UR3C 5L3QA 1Q0FA 4PJJA 1IZMA 5DS5A 3HNIA 3QW1A 2XLWA 3DAFA 3A11A 3G50A 4GQHA 3RQEA 1HE1A 2KNHA 5KYUA 3AGUA 2PF4E 5KYUB 2W4MA 3DJUB 2C04A 3E9VA 3UMKA 3RH3A 3EHMA 4JTCB 4K0DA 2FAPB 3U5SA 4CX9A 3L8JA 1JOGA 1XZQA 1E83A 2HV7A 3FXHA 3X2QC 2XLVA 4ANJA 2YLIA 3VM6A 1KU2A 1A7VA 1R4TA 4WGYA 4GYTA 4WJ0A 1CGOA 5A6JA 1JPJA 4HFKB 4EWCA 5BQHA 5F5FA 4U5EE 2VC9A 1Z7Qc 3WAQA 2KJGA 3DZAA 2HFIA 1FFTC 3ITFA 2G3VA 4CIPA 1NU9C 2R03A 4EBKA 2XS1A 3RIPA 1S7ZA 1V55C 1LPEA 1ZHZA 3GWLA 2X51A 1EI7A 3GWNA 4CDYA 2UUIA 1YYXA 3N24A 2MYSA 1LI5A 2XRHA 1M57C 3AGTA 5GPGB 4IAQA 4OD5A 5HV9A 2JX0A 4XEFA 4JVSA 1V74B 2XLDA 4K7BA 3G4ZA 1QLEC 5EK0A 3TK0A 1WASA 4YWQA 4Z9JA 5E33A 1AVOB 1TKNA 1ZHXA 2QTVA 1OCZC 2BE5F 2IXPA 2O9XA 2P61A 2P7VA 2Q9BA 3GEEA 3KH2A 1ZZPA 2ICWG 4J7YA 3WODF 2TMVP 4OIQF 1FR0A 3VRCA 4K1OA 4JJGA 2H7OA 2LCHA 3L8IA 2W4BA 4DBQA 3VAYA 2KSFA 2ETSA 2KGOA 1RJ9B 1RJ9A 4U9EA 2QE9A 4ULVA 2Q3TA 1V54C 2YL0A 3K1IA 4MNDA 2YL3A 1TWCA 1Z23A 4MVMA 5B1AC 1YAUO 4I1OB 5COMA 1A41A 2FFHA 3JSZA 4JTAB 4O79A 4Z9HA 4BEMJ 4YT4A 3DM5A 3DWWA 1SZIA 1D1BA 4W8KA 4CIHA 3ZG1A 4E17A 3GM1A 1IW7F 2Y3DA 4RD9A 4CBEA 4NTBA 1U89A 3S90A 1W2WA 1YZCA 1XZPA 1H7IA 4YN0B 1ZW2A 1TFKB 3C8GD 1SF8A 3IEEA 3LNRA 4B6IA 2XXAB 4NCQA 1PV3A 4NY3A 2R02A 3ASOC 4DRIB 4CJGA 2VH3A 4BPMA 1JMWA 4IAOA 3ZIBA 4PACA 2OU6A 1Q0KA 3HNKA 2V26A 4QI2A 2EPKX 3M4CA 1J8YF 2B0JA 2PP4A 2XLMA 3AQBA 1SMYF 2LFDA 1QQ3A 3EPVA 1N1CA 1D0ZA 3EJNA 3NYJA 3TOMA 1SR2A 4D4XA 4G7HF 1LM3B 2OJED 1ORYA 1MNDA 2LK4A 1QPUA 3M15A 2W9YA 3ZWIA 4N4WA 4A4AA 1JPNA 4NTAA 1BDJB 4AL0A 3IPMO 4IJJA 3RVZA 3VF0A 3BEHA 2R7OA 1QSPA 4LLCA 5JT4A 1OKKD 1T6IA 1WOLA 3Q7LA 2H7VC 2L6HA 3IQ5A 1TWGA 4X0RA 2YZSA 4Q4ZF 3MYFA 1Z5ZA 2A0BA 2DB4A 2NUPB 2NUPA 3EHNA 3CZ6A 2OQMA 3ZC4A 3GM3A 1E85A 1YZAA 3KKBA 4L6RA 3SYNA 2EPNA 4U9DA 3H2VA 1DOVA 1H9GA 2J9BA 4YT8A 3JSEO 4CDAA 1HE9A 4BJ5A 4C3EA 3RVYA 2C03A 4XEKA 3DMDA 3O39A 5E3CA 4O6YA 3SZRA 5L3VA 2EINC 1OQCA 1D1AA 2OG2A 3I5PA 3GEIA 2V3CC 2OKUA 3KPHA 2Q4FA 4H4KC 1G4US 2WVNA 4DXWA 3LJBA 2LP4A 2XLHA 4G0HA 2JPUA 4CDVA 1H6GA 3I5QA 3B0VC 3WHNA 3T6BA 4IWBA 3U2MA 3QVYA 2GA0A 1GM5A 4FAPB 3FAJA 1G4WR 2J45A 4U5HA 4W8PA 2IBFA 3SP1A 4P6IC 2Y3BA 2EPOA 4I44A 2HUJA 1KNYA 1EA8A 4CS7A 1HW1A 4LACB 1MMGA 1OXKA 2IXNA 2D4UA 2R7TA 2YVKA 3JTLO 5KYWA 5KYWB 5DS4A 4FESA 5BUOA 2VCBA 4DRJB 2J7PA 4E7SA 1ZU4A 1ORSC 4YL1A 3R2PA 4YL3A 2AWYA 4Z9IA 3CAXA 2CGEA 2DYRC 4OIOF 4ZLDA 2XL4A 3ZVRA 3FAPB 3AG2C 3K1IC 4MS2A 3NKEA 1Z6AA 2AWCA 4CS8A 5JVEA 3DD7A 1EKYA 3W2VA 2I8BA 3L34A 4PK4A 2XL6A 4CS9A 2PX0A 3QMKA 1T9KA 2IXOA 1BR1A 2BL2A 3DM9B 3LESA 4EIYA 4C7OA 1NZEA 3T4RA 4C7OB 1T01A 3RYLA 4KI2A 4IARA 4EHPA 1O3UA 1C03A 1HY5A 3HLZA 4JRZA 3VYWA 3TJ6A 4EKWA 2H7BA 2G3KA 3C62A 2WVQA 3FOOA 4MVQA 4XEVA 5B1BC 1Q0DA 3GANA 5F5HA 3B9QA 1M6TA 3HJCA 1I4ZA 4P9TA 1QZXA 2I15A 2OOCA 1LS4A 4I1MA 3TULA 2HKVA 2HMQA 2PNOA 3EGXA 1T6QA 5CI8A 2OEVA 2ZPAA 4PJNA 1D1CA 3KL4A 1VYKA 1OW6A 4UDVA 3EG9B 3EG9A 2R7UA 2R9RB 2NG1A 4HE8D 1TQGA 1QVXA 4ULWA 3W8IA 2R7WA 1NFOA 3W4YA 3ZTMA 3Q6MA 2CW0F 3MFNA 3N0TA 5DS6A 2LSEA 2YHSA 3K1HA 1NG1A 3JZ0A 3B71A 4MW8A 3S29A 1I4YA 2A1DD 2CCYA 1K40A 2M4EA 4U5CE 2M64A 4DVZA 4LDKA 1F1MA 4U5FE 1B68A 1L3PA 3OEOA 5A69A 1YA7O 1ZYRF 2Z15A 1KTMA 4DOZA 2YEVA 1YLMA 2P1AA 1C02A 4JURI 2Y3GA 3I4UA 5D92A 2R7XA 3U8VA 4MVUA 4ER9A 3DXJF 3K33A 5B3SC 5F28E 2EIMC 2ZXRA 5CI9A 4YK5A 1K04A 3RF3A 4ZLCA 1MMNA 3QW0A 3PDMP 3S84A 4MVOA 1TWAA 2GDCA 1VB5A 1OCRC 4JW1A 2R7VA 1E86A 2IM8A 2J46A 4DVYP 3K66A 3ABLC 4A2NB 3MBGA 4FWVA 4ONSA 3MX3A 1T5OA 1LIHA 3ASNC 2DGJA 4LDRA 4F4BA 2YL1A 2KK1A 3U8PA 4Q5SF 3JRMO 2L6GA 2HSQA 1ZHWA 2MWQA 3ZQYA 2QY9A 2WZGA 3EZHA 3J06A 4U5DE 4BJTA 1JRAA 4G78A 2AP3A 2J7PD 4JE9A 5COFA 4MVSA 5BQIA 4XLPF 1H9TA 4MQ9F 5KYNA 3IQCA 5A6BA 1WGWA 3EQLF 3B0PA 2XS8A 1XWJA
chains in the Genus database with same CATH topology
1RKEA 1RKEB 1ZW3A 2B0HA 2X0CA 4PR9A 4DJ9A 3RF3A 4E17A 1H6GA 1DOWA 3VF0A 5L0HA 2GDCA 1T01A 2LQGA 1U89A 3S90A 2L7AA 5L0FA 4W8PA 4EHPA 1YDIA 2IBFA 1ZW2A 1ZVZA 1U6HA 3T6GB 3ZDLA 4ONSA 3TJ6A 5L0JA 3TJ5A 5L0CA 1SYQA 1TR2A 5L0GA 1QKRA 5L0DA 2GWWA 1L7CA 2HSQA 3H2UA 4K1OA 1RKCA 3H2VA 4IGGA 1DOVA 5L0IA 5FZTA 4P9TA 3MYIA 1ST6A 4E18A 1XWJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RKE A;  1RKE B;  1ZW3 A;  2B0H A;  2X0C A;  4PR9 A;  4DJ9 A;  3RF3 A;  4E17 A;  1H6G A;  1DOW A;  3VF0 A;  5L0H A;  2GDC A;  1T01 A;  2LQG A;  1U89 A;  3S90 A;  2L7A A;  5L0F A;  4W8P A;  4EHP A;  1YDI A;  2IBF A;  1ZW2 A;  1ZVZ A;  1U6H A;  3T6G B;  3ZDL A;  4ONS A;  3TJ6 A;  5L0J A;  3TJ5 A;  5L0C A;  1SYQ A;  1TR2 A;  5L0G A;  1QKR A;  5L0D A;  2GWW A;  1L7C A;  2HSQ A;  3H2U A;  4K1O A;  1RKC A;  3H2V A;  4IGG A;  1DOV A;  5L0I A;  5FZT A;  4P9T A;  3MYI A;  1ST6 A;  4E18 A;  1XWJ A; 
#chains in the Genus database with same CATH topology
 2NSG A;  2YWA A;  4OD4 A;  1JAF A;  1UG7 A;  2PX3 A;  2RD9 A;  2OCC C;  2YLG A;  2ZXO A;  5A6A A;  2LQG A;  3JT1 A;  1BZ4 A;  5L0F A;  3F46 A;  2Q7R A;  4PFP A;  3T6J A;  3OA1 A;  3DI5 A;  3G4X A;  3JRT A;  3C18 A;  1Y6D A;  1YAR O;  1TR2 A;  2FGY A;  3LLK A;  4J32 B;  3TOL A;  5JS5 A;  1M2V A;  1M2V B;  1ZHY A;  4CJO A;  1YYJ A;  3V5X A;  1WTY A;  4YT2 A;  2DI3 A;  4KBL A;  4EBB A;  3C7J A;  4JCH A;  4AE4 B;  2L81 A;  4FX5 A;  4AE4 A;  1ZHT A;  2CDQ A;  4MTF A;  1WWP A;  4WGZ A;  4JC7 A;  2J9V A;  4CSA A;  1GGQ A;  2CNW A;  3DKA A;  4Q7C A;  3SNH A;  2E87 A;  3K6B A;  4U5G A;  4E0I A;  1BR4 A;  1LI7 A;  2NSF A;  2HS5 A;  2X0C A;  1FNT c;  1RCP A;  3BRJ A;  2ZXP A;  2R05 A;  3Q7G A;  4MTO A;  3NDB B;  1R5I D;  3QVZ A;  2QUP A;  4LLE A;  3UNG C;  5L0H A;  4BJ1 A;  1G5Z A;  1U6H A;  3LAY A;  3POV A;  3TJ5 A;  5DQZ A;  3GOD A;  1SYQ A;  2HJM A;  3NMI A;  3ZQV A;  3SXY A;  4IB4 A;  3A9C A;  3UGO A;  1OW8 A;  3LUT B;  4NTF A;  2EIK C;  2KYH A;  3ATP A;  2XM0 A;  3RW0 A;  5L0I A;  4IGG A;  4N06 A;  3U0C A;  2A6E F;  2CYD A;  4JCZ A;  3SXK A;  2A68 F;  2A6H F;  4KNW A;  2P0N A;  1UFB A;  1HW2 A;  3MYI A;  1PD1 A;  3GOR A;  5FCL A;  3EH2 A;  3Q6N A;  4I3M A;  2JD3 A;  3FHD A;  3LLI A;  5KYX A;  4MW3 A;  5KYX B;  1LVK A;  4AK9 A;  3NG1 A;  4RDA A;  2KW3 C;  3HNL A;  4EBJ A;  5CIV A;  4DJ9 A;  1J8M F;  3AG3 C;  1C17 M;  1M56 C;  4O6N A;  4MVZ A;  3E70 C;  3U2L A;  1TFO B;  3S28 A;  3X1O A;  2VCA A;  1LE2 A;  2P6V A;  3HNJ A;  4D4N A;  5KYY A;  5KYY B;  1CGM E;  2OEX A;  1VK5 A;  4G7O F;  1S05 A;  3FMS A;  5L0J A;  2HMZ A;  2L9J A;  4JIO A;  3F47 A;  2XXA A;  2WL8 A;  3T6G B;  4KC9 A;  4O7G A;  3U9J A;  3HTK C;  1WN0 A;  3M1C B;  2XLO A;  4OIR F;  4JTD B;  5L0D A;  1ZU5 A;  2WB7 A;  3AOU A;  3DJN B;  3H2U A;  3LS1 A;  5JP7 A;  1RKC A;  1JR8 A;  1D0X A;  1PCX A;  1RXQ A;  3L0I A;  3ABK C;  4YT5 A;  2HSB A;  3EZI A;  1I5N A;  1AUE A;  3IHU A;  5T1D B;  3US6 A;  1APC A;  3LS0 A;  4C3B A;  5A6B D;  3FVY A;  1FMV A;  2HV6 A;  4NQF A;  1VOM A;  4O6M A;  2A0U A;  4E18 A;  3CQZ A;  3R7C A;  2IOQ A;  2G62 A;  3SXZ A;  2AU5 A;  3NKD A;  3K7D A;  1ZW3 A;  2NUT B;  2NUT A;  3SEO A;  3TQO A;  3UMI A;  3S0X A;  3AJM A;  3H65 A;  3JYH A;  4J30 B;  2HJ3 A;  3B29 A;  3JCU Q;  2Q9C A;  1OR2 A;  2W45 A;  3CSK A;  4N6H A;  5AGF A;  1FMW A;  1OKK A;  1FAP B;  1TWH A;  3EFO A;  3EFO B;  4XQ1 A;  3NRH A;  4AL1 A;  5B3I A;  1OR3 A;  3ABM C;  2MHR A;  3C63 A;  3ZDL A;  1WAT A;  4P9F A;  2PBE A;  1A7D A;  2LIG A;  3SXM A;  3S27 A;  5L0G A;  1FFH A;  1OCO C;  2GWW A;  2A69 F;  3PCV A;  3V5Z A;  5A6K A;  5K0I A;  2KC3 A;  1VTM P;  1VLS A;  2J9W A;  2GAQ A;  4MVR A;  5IY5 C;  1MQV A;  5BQG A;  1NU7 D;  3EH1 A;  3WG7 C;  1EQ1 A;  3IQ6 A;  4BJ5 C;  4CSA C;  2CNW D;  5AC5 A;  2RSE B;  2XM4 A;  4XLN F;  2LD6 A;  3U3B A;  4LER A;  3UGP A;  5JLI A;  5D91 A;  3NYM A;  3S9O A;  2LFF A;  3JYY A;  5JSL A;  4BJ6 A;  5EHH A;  4LDQ A;  4RBN A;  3M79 A;  4HEA J;  3QZC A;  4NC3 A;  1LS1 A;  5DQT A;  1HMD A;  1CPQ A;  1NLX A;  2XLE A;  4QI0 A;  4YJW A;  3V7O A;  2GFH A;  5T3W A;  4OIP F;  1RMV A;  1GS9 A;  1Q0G A;  2BC5 A;  2EIJ C;  3NMK A;  3HKK A;  1YJG A;  4GEH A;  1NSG B;  5EGY A;  1GQA A;  2ASR A;  1YA9 A;  2WVO A;  3MLG A;  2R7S A;  1D0Y A;  1MNE A;  3QTH A;  4DRH B;  2VB6 A;  3AG1 C;  3B0U X;  3DE8 A;  2HZ8 A;  3ECS A;  2H8A A;  1FTS A;  2VCC A;  3RQF A;  5HSW A;  5E2Q A;  4AX2 A;  3AQC A;  1LE4 A;  1BBH A;  3O6X A;  2D5R B;  2EPM X;  4CS8 C;  4E0H A;  1NFN A;  2R7Q A;  4XWJ A;  2PFD A;  5DVW A;  3LNM B;  4CS9 C;  4H54 A;  4E7Z A;  5COG A;  1O5H A;  2QLA A;  3KYJ A;  4G7Z F;  1ORJ A;  2YKZ A;  2EIL C;  2Q9A A;  1E2X A;  1MMD A;  2ZXW C;  4XPX A;  3RQG A;  4JEB A;  5AC4 A;  2XSE A;  1VLT A;  3U9M A;  3EGD B;  3EGD A;  4U5B E;  4EUK B;  1QKR A;  2XL8 A;  4WAB A;  3N2Z B;  1VMA A;  2F22 A;  4BG0 A;  2J8W A;  1AEP A;  3U3F A;  3LEV A;  3PHF 2;  2YRF A;  3LEO A;  4YL0 A;  4BEJ A;  4JZA A;  2IXM A;  2KQ9 A;  3AG4 C;  3EGX B;  4IRU A;  1PD0 A;  2VAS A;  2AVK A;  2YL7 A;  1T6U A;  5DLJ A;  5JRA A;  2R7R A;  1Z63 A;  3O55 A;  3NYL A;  5E3A A;  4PJL A;  3NMJ A;  1BR2 A;  2YLD A;  2NPU A;  1A0B A;  4KNV A;  4PR9 A;  2L6F A;  1OW7 A;  1DOW A;  2DYS C;  4MTG A;  1G8X A;  1Q0M A;  3M4B A;  2L7A A;  1VYI A;  3ZSU A;  4C3D A;  1A7E A;  1YDI A;  4R32 A;  3FDQ A;  4DBR A;  2EPL X;  3W2W A;  4JKV A;  4QDL A;  1E84 A;  1V4A A;  3W8H A;  4J7T A;  1M2O A;  256B A;  2WZF A;  3RKO F;  3TD7 A;  1K05 A;  1O87 A;  2J0X A;  4PJM A;  1L7C A;  5T3T A;  3RFY A;  2YQY A;  2Y39 A;  3DE9 A;  5JUA A;  3DAG A;  2Q00 A;  4M63 A;  3CEX A;  1Y4C A;  2J0W A;  1Z3I X;  3KYI A;  5FZT A;  3T9O A;  3GEH A;  2IYL D;  4XPW A;  3UMH A;  3O10 A;  3KMI A;  4HFF B;  2QNL A;  3FOP A;  1ST6 A;  1OXB A;  1MMA A;  5TJ5 E;  2UUH A;  4JEA A;  5L0C A;  1RKE A;  1RKE B;  2Y3H A;  3ZTZ A;  2B0H A;  3L1M A;  1HMO A;  4BJ6 C;  3C8Z A;  2Y69 C;  4XTK A;  3V5Y A;  4JJF A;  4OIN F;  1CPR A;  3PMR A;  3IQT A;  4PFO A;  2R25 A;  4XPY A;  2J9U A;  1NBB A;  1YVI A;  1U0B B;  1OCC C;  3C8G A;  1ZVZ A;  2OJQ A;  3C8G B;  2WZL A;  1LKX A;  3GM2 A;  2ZD9 A;  1CGN A;  3OWT A;  4N6C A;  3UR3 C;  5L3Q A;  1Q0F A;  4PJJ A;  1IZM A;  5DS5 A;  3HNI A;  3QW1 A;  2XLW A;  3DAF A;  3A11 A;  3G50 A;  4GQH A;  3RQE A;  1HE1 A;  2KNH A;  5KYU A;  3AGU A;  2PF4 E;  5KYU B;  2W4M A;  3DJU B;  2C04 A;  3E9V A;  3UMK A;  3RH3 A;  3EHM A;  4JTC B;  4K0D A;  2FAP B;  3U5S A;  4CX9 A;  3L8J A;  1JOG A;  1XZQ A;  1E83 A;  2HV7 A;  3FXH A;  3X2Q C;  2XLV A;  4ANJ A;  2YLI A;  3VM6 A;  1KU2 A;  1A7V A;  1R4T A;  4WGY A;  4GYT A;  4WJ0 A;  1CGO A;  5A6J A;  1JPJ A;  4HFK B;  4EWC A;  5BQH A;  5F5F A;  4U5E E;  2VC9 A;  1Z7Q c;  3WAQ A;  2KJG A;  3DZA A;  2HFI A;  1FFT C;  3ITF A;  2G3V A;  4CIP A;  1NU9 C;  2R03 A;  4EBK A;  2XS1 A;  3RIP A;  1S7Z A;  1V55 C;  1LPE A;  1ZHZ A;  3GWL A;  2X51 A;  1EI7 A;  3GWN A;  4CDY A;  2UUI A;  1YYX A;  3N24 A;  2MYS A;  1LI5 A;  2XRH A;  1M57 C;  3AGT A;  5GPG B;  4IAQ A;  4OD5 A;  5HV9 A;  2JX0 A;  4XEF A;  4JVS A;  1V74 B;  2XLD A;  4K7B A;  3G4Z A;  1QLE C;  5EK0 A;  3TK0 A;  1WAS A;  4YWQ A;  4Z9J A;  5E33 A;  1AVO B;  1TKN A;  1ZHX A;  2QTV A;  1OCZ C;  2BE5 F;  2IXP A;  2O9X A;  2P61 A;  2P7V A;  2Q9B A;  3GEE A;  3KH2 A;  1ZZP A;  2ICW G;  4J7Y A;  3WOD F;  2TMV P;  4OIQ F;  1FR0 A;  3VRC A;  4K1O A;  4JJG A;  2H7O A;  2LCH A;  3L8I A;  2W4B A;  4DBQ A;  3VAY A;  2KSF A;  2ETS A;  2KGO A;  1RJ9 B;  1RJ9 A;  4U9E A;  2QE9 A;  4ULV A;  2Q3T A;  1V54 C;  2YL0 A;  3K1I A;  4MND A;  2YL3 A;  1TWC A;  1Z23 A;  4MVM A;  5B1A C;  1YAU O;  4I1O B;  5COM A;  1A41 A;  2FFH A;  3JSZ A;  4JTA B;  4O79 A;  4Z9H A;  4BEM J;  4YT4 A;  3DM5 A;  3DWW A;  1SZI A;  1D1B A;  4W8K A;  4CIH A;  3ZG1 A;  4E17 A;  3GM1 A;  1IW7 F;  2Y3D A;  4RD9 A;  4CBE A;  4NTB A;  1U89 A;  3S90 A;  1W2W A;  1YZC A;  1XZP A;  1H7I A;  4YN0 B;  1ZW2 A;  1TFK B;  3C8G D;  1SF8 A;  3IEE A;  3LNR A;  4B6I A;  2XXA B;  4NCQ A;  1PV3 A;  4NY3 A;  2R02 A;  3ASO C;  4DRI B;  4CJG A;  2VH3 A;  4BPM A;  1JMW A;  4IAO A;  3ZIB A;  4PAC A;  2OU6 A;  1Q0K A;  3HNK A;  2V26 A;  4QI2 A;  2EPK X;  3M4C A;  1J8Y F;  2B0J A;  2PP4 A;  2XLM A;  3AQB A;  1SMY F;  2LFD A;  1QQ3 A;  3EPV A;  1N1C A;  1D0Z A;  3EJN A;  3NYJ A;  3TOM A;  1SR2 A;  4D4X A;  4G7H F;  1LM3 B;  2OJE D;  1ORY A;  1MND A;  2LK4 A;  1QPU A;  3M15 A;  2W9Y A;  3ZWI A;  4N4W A;  4A4A A;  1JPN A;  4NTA A;  1BDJ B;  4AL0 A;  3IPM O;  4IJJ A;  3RVZ A;  3VF0 A;  3BEH A;  2R7O A;  1QSP A;  4LLC A;  5JT4 A;  1OKK D;  1T6I A;  1WOL A;  3Q7L A;  2H7V C;  2L6H A;  3IQ5 A;  1TWG A;  4X0R A;  2YZS A;  4Q4Z F;  3MYF A;  1Z5Z A;  2A0B A;  2DB4 A;  2NUP B;  2NUP A;  3EHN A;  3CZ6 A;  2OQM A;  3ZC4 A;  3GM3 A;  1E85 A;  1YZA A;  3KKB A;  4L6R A;  3SYN A;  2EPN A;  4U9D A;  3H2V A;  1DOV A;  1H9G A;  2J9B A;  4YT8 A;  3JSE O;  4CDA A;  1HE9 A;  4BJ5 A;  4C3E A;  3RVY A;  2C03 A;  4XEK A;  3DMD A;  3O39 A;  5E3C A;  4O6Y A;  3SZR A;  5L3V A;  2EIN C;  1OQC A;  1D1A A;  2OG2 A;  3I5P A;  3GEI A;  2V3C C;  2OKU A;  3KPH A;  2Q4F A;  4H4K C;  1G4U S;  2WVN A;  4DXW A;  3LJB A;  2LP4 A;  2XLH A;  4G0H A;  2JPU A;  4CDV A;  1H6G A;  3I5Q A;  3B0V C;  3WHN A;  3T6B A;  4IWB A;  3U2M A;  3QVY A;  2GA0 A;  1GM5 A;  4FAP B;  3FAJ A;  1G4W R;  2J45 A;  4U5H A;  4W8P A;  2IBF A;  3SP1 A;  4P6I C;  2Y3B A;  2EPO A;  4I44 A;  2HUJ A;  1KNY A;  1EA8 A;  4CS7 A;  1HW1 A;  4LAC B;  1MMG A;  1OXK A;  2IXN A;  2D4U A;  2R7T A;  2YVK A;  3JTL O;  5KYW A;  5KYW B;  5DS4 A;  4FES A;  5BUO A;  2VCB A;  4DRJ B;  2J7P A;  4E7S A;  1ZU4 A;  1ORS C;  4YL1 A;  3R2P A;  4YL3 A;  2AWY A;  4Z9I A;  3CAX A;  2CGE A;  2DYR C;  4OIO F;  4ZLD A;  2XL4 A;  3ZVR A;  3FAP B;  3AG2 C;  3K1I C;  4MS2 A;  3NKE A;  1Z6A A;  2AWC A;  4CS8 A;  5JVE A;  3DD7 A;  1EKY A;  3W2V A;  2I8B A;  3L34 A;  4PK4 A;  2XL6 A;  4CS9 A;  2PX0 A;  3QMK A;  1T9K A;  2IXO A;  1BR1 A;  2BL2 A;  3DM9 B;  3LES A;  4EIY A;  4C7O A;  1NZE A;  3T4R A;  4C7O B;  1T01 A;  3RYL A;  4KI2 A;  4IAR A;  4EHP A;  1O3U A;  1C03 A;  1HY5 A;  3HLZ A;  4JRZ A;  3VYW A;  3TJ6 A;  4EKW A;  2H7B A;  2G3K A;  3C62 A;  2WVQ A;  3FOO A;  4MVQ A;  4XEV A;  5B1B C;  1Q0D A;  3GAN A;  5F5H A;  3B9Q A;  1M6T A;  3HJC A;  1I4Z A;  4P9T A;  1QZX A;  2I15 A;  2OOC A;  1LS4 A;  4I1M A;  3TUL A;  2HKV A;  2HMQ A;  2PNO A;  3EGX A;  1T6Q A;  5CI8 A;  2OEV A;  2ZPA A;  4PJN A;  1D1C A;  3KL4 A;  1VYK A;  1OW6 A;  4UDV A;  3EG9 B;  3EG9 A;  2R7U A;  2R9R B;  2NG1 A;  4HE8 D;  1TQG A;  1QVX A;  4ULW A;  3W8I A;  2R7W A;  1NFO A;  3W4Y A;  3ZTM A;  3Q6M A;  2CW0 F;  3MFN A;  3N0T A;  5DS6 A;  2LSE A;  2YHS A;  3K1H A;  1NG1 A;  3JZ0 A;  3B71 A;  4MW8 A;  3S29 A;  1I4Y A;  2A1D D;  2CCY A;  1K40 A;  2M4E A;  4U5C E;  2M64 A;  4DVZ A;  4LDK A;  1F1M A;  4U5F E;  1B68 A;  1L3P A;  3OEO A;  5A69 A;  1YA7 O;  1ZYR F;  2Z15 A;  1KTM A;  4DOZ A;  2YEV A;  1YLM A;  2P1A A;  1C02 A;  4JUR I;  2Y3G A;  3I4U A;  5D92 A;  2R7X A;  3U8V A;  4MVU A;  4ER9 A;  3DXJ F;  3K33 A;  5B3S C;  5F28 E;  2EIM C;  2ZXR A;  5CI9 A;  4YK5 A;  1K04 A;  3RF3 A;  4ZLC A;  1MMN A;  3QW0 A;  3PDM P;  3S84 A;  4MVO A;  1TWA A;  2GDC A;  1VB5 A;  1OCR C;  4JW1 A;  2R7V A;  1E86 A;  2IM8 A;  2J46 A;  4DVY P;  3K66 A;  3ABL C;  4A2N B;  3MBG A;  4FWV A;  4ONS A;  3MX3 A;  1T5O A;  1LIH A;  3ASN C;  2DGJ A;  4LDR A;  4F4B A;  2YL1 A;  2KK1 A;  3U8P A;  4Q5S F;  3JRM O;  2L6G A;  2HSQ A;  1ZHW A;  2MWQ A;  3ZQY A;  2QY9 A;  2WZG A;  3EZH A;  3J06 A;  4U5D E;  4BJT A;  1JRA A;  4G78 A;  2AP3 A;  2J7P D;  4JE9 A;  5COF A;  4MVS A;  5BQI A;  4XLP F;  1H9T A;  4MQ9 F;  5KYN A;  3IQC A;  5A6B A;  1WGW A;  3EQL F;  3B0P A;  2XS8 A;  1XWJ A; 
#chains in the Genus database with same CATH homology
 1RKE A;  1RKE B;  1ZW3 A;  2B0H A;  2X0C A;  4PR9 A;  4DJ9 A;  3RF3 A;  4E17 A;  1H6G A;  1DOW A;  3VF0 A;  5L0H A;  2GDC A;  1T01 A;  2LQG A;  1U89 A;  3S90 A;  2L7A A;  5L0F A;  4W8P A;  4EHP A;  1YDI A;  2IBF A;  1ZW2 A;  1ZVZ A;  1U6H A;  3T6G B;  3ZDL A;  4ONS A;  3TJ6 A;  5L0J A;  3TJ5 A;  5L0C A;  1SYQ A;  1TR2 A;  5L0G A;  1QKR A;  5L0D A;  2GWW A;  1L7C A;  2HSQ A;  3H2U A;  4K1O A;  1RKC A;  3H2V A;  4IGG A;  1DOV A;  5L0I A;  5FZT A;  4P9T A;  3MYI A;  1ST6 A;  4E18 A;  1XWJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...