4DJ9A

Human vinculin head domain vh1 (residues 1-258) in complex with the talin vinculin binding site 50 (vbs50, residues 2078-2099)
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
251
structure length
242
Chain Sequence
VFHTRTIESILEPVAQQISHLVIMHEEGKAIPDLTAPVAAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTQGIEEALKNRNFTVEKMSAEINEIIRVLQLTSW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of vinculin in complex with vinculin binding site 50 (VBS50), the integrin binding site 2 (IBS2) of talin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Vinculin
total genus 103
structure length 242
sequence length 251
ec nomenclature
pdb deposition date 2012-02-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 4dj9A02
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 4dj9A01
1H6GA 1XWJA 1ZW3A 4P9TA 5FZTA 5L0HA 4K1OA 1DOVA 2LQGA 4EHPA 2L7AA 5L0GA 4PR9A 5L0FA 3RF3A 3VF0A 1DOWA 1RKEA 3T6GB 1QKRA 1T01A 1RKEB 2GWWA 1YDIA 1SYQA 2HSQA 4E17A 4W8PA 1ZW2A 1L7CA 3ZDLA 3TJ5A 4DJ9A 1ST6A 5L0JA 3H2UA 1TR2A 3H2VA 1U6HA 2IBFA 4IGGA 4E18A 3MYIA 5L0CA 5L0IA 2X0CA 5L0DA 1RKCA 1ZVZA 2GDCA 3S90A 3TJ6A 2B0HA 4ONSA 1U89A
chains in the Genus database with same CATH superfamily
4CDAA 1ZHTA 3FMSA 3ZWIA 1CGME 1EQ1A 1G4US 3AQCA 3OEOA 2YLIA 2A6HF 4MVSA 3T6GB 1WASA 1MMDA 2PX0A 3ATPA 4W8KA 3EJNA 3I4UA 4BJ6C 1JPNA 3G50A 1NZEA 4ZLCA 4HEAJ 2Q9AA 2HV6A 4EBKA 1K40A 4J7TA 3J06A 4IAOA 5A6KA 1TWGA 2VCCA 3MFNA 4C3DA 1Y4CA 5L0DA 3ABLC 2QNLA 4KI2A 4XPWA 4MNDA 3AG2C 2YLGA 3S9OA 4CSAA 4F4BA 4XPXA 2B0HA 5A6AA 3NYMA 2NSFA 4CS7A 2VH3A 4UDVA 2QLAA 1RJ9B 4PACA 4WGYA 5E3AA 2G3VA 2HS5A 4IB4A 2KNHA 3A11A 3LLIA 5FZTA 1BBHA 1I4ZA 3IQCA 1WATA 3TD7A 3NKEA 4PK4A 3POVA 2M64A 2YL3A 5AGFA 3JCUQ 3CQZA 4U9DA 2EIJC 5KYYA 3EZIA 1OCCC 4JCZA 2WB7A 5F5HA 2GAQA 1VOMA 4JURI 2OJQA 2XLOA 4KNWA 1HW1A 5AC4A 1D0YA 2CGEA 4I1MA 2A69F 2CNWD 2G3KA 2W4BA 3QW1A 1WN0A 4PFOA 4BEJA 4XWJA 4JTAB 1BR1A 2A0UA 3IEEA 1YZCA 4NQFA 2JPUA 2YZSA 1A41A 1CGNA 1KNYA 1NSGB 2R7UA 3K1IA 1EI7A 2F22A 4Z9IA 3U9MA 4AL0A 2HUJA 5KYXB 4C7OA 4RDAA 1R5ID 5D92A 3X2QC 4EIYA 2P61A 5T3WA 3EHMA 3O10A 1VLSA 2Y3BA 4U5FE 4OD5A 1OCOC 4A4AA 1C17M 3GWNA 4CDVA 1G5ZA 3HNJA 4IJJA 1YJGA 2NSGA 3ZDLA 2R7OA 5KYWB 2PBEA 3H2VA 4JIOA 2I15A 2C03A 1T6UA 2XLHA 4FESA 3RKOF 3C62A 3RVZA 1AEPA 4CDYA 2V26A 1ZU4A 3SNHA 3ZIBA 2HKVA 4J32B 2PF4E 2KW3C 4ONSA 5L0IA 3KYJA 1FNTc 1ZU5A 1QQ3A 1U0BB 3JSEO 3VM6A 4ULWA 4HE8D 3EFOA 5E3CA 4O7GA 3DM5A 3G4ZA 3LS1A 4D4NA 3B0VC 4JEBA 1M2VB 1GQAA 3FOPA 1H7IA 1NG1A 3F46A 2DYRC 2HZ8A 2GWWA 3AGUA 1SYQA 4KC9A 1R4TA 3JZ0A 1C03A 4NTBA 3ZQYA 2XLMA 3EGXA 4DJ9A 4IARA 1KU2A 4MTFA 3DI5A 4YN0B 1ORSC 1K05A 5F28E 3RFYA 2R7WA 3U9JA 3FXHA 2R25A 1YA9A 1H9GA 1TWAA 2J9UA 3AOUA 3KMIA 4U5DE 4DBQA 2CCYA 4EBJA 3QVZA 3R2PA 4JE9A 3GWLA 2A0BA 3R7CA 5JUAA 3EGDB 2HJMA 3ZVRA 1GS9A 1MMNA 2I8BA 4GEHA 1NLXA 5DLJA 3SP1A 4CJOA 3AG4C 4K1OA 3V5ZA 1PD0A 4DRIB 2IXNA 4N6HA 5KYNA 2VB6A 5L0FA 2ICWG 3KKBA 1HY5A 1SZIA 1T5OA 2XSEA 4O6MA 1TFKB 1T01A 3NMKA 4EBBA 2ZD9A 3JT1A 2EPKX 2DB4A 4OIPF 3DAGA 2P1AA 3QTHA 2L81A 2EPOA 1RCPA 2CW0F 2LIGA 3O39A 4YT5A 2NUTA 2EPNA 1YYXA 4CS9C 5DS4A 2Q00A 2R7VA 3IQTA 3WG7C 2ZXOA 2IBFA 3MYIA 4HFKB 2J46A 2LSEA 3GORA 4AL1A 3JRMO 3BEHA 3NMJA 2R7RA 1LE2A 2NUPB 3DAFA 5DS5A 1OW7A 1ZHXA 3C8GD 4E7ZA 5JT4A 2KQ9A 4K0DA 4L6RA 1XWJA 3VAYA 3U2MA 3V5XA 1PCXA 4PJMA 1JOGA 2XL4A 3L8JA 1OQCA 3MYFA 4PJLA 3VYWA 5L3VA 1FMWA 2W45A 1A7VA 3GEEA 1KTMA 2ETSA 4MVOA 3O55A 2L9JA 2B0JA 5BUOA 1RKEA 2EILC 2YEVA 3QZCA 4B6IA 1E83A 3S0XA 2KJGA 2XM4A 3GANA 4MVRA 5B1AC 3RQFA 3S28A 3HNLA 2ZXRA 4YL0A 3S29A 3ZQVA 2DYSC 4M63A 3UGPA 2OOCA 4ULVA 3TJ5A 2LK4A 2Y69C 3RVYA 2OKUA 3FDQA 2J0WA 5D91A 1HW2A 3DXJF 3M79A 1O5HA 5HSWA 1A0BA 4JRZA 3JYYA 2G62A 4G7OF 4J30B 1M56C 3ZG1A 1FTSA 2ZPAA 2R05A 5EGYA 2C04A 3SEOA 5COMA 2XL8A 1VB5A 1FAPB 3L8IA 5B3SC 3HNIA 3LEVA 3U2LA 2KC3A 4YL3A 4DOZA 1Z63A 1OW6A 4JCHA 3KPHA 4DXWA 2MYSA 1JAFA 1C02A 3B0PA 1Q0GA 1G4WR 3IHUA 4H54A 4U5BE 5COGA 1F1MA 4E7SA 4QI0A 3M1CB 3IQ6A 4MS2A 3TOLA 1Y6DA 2QTVA 3FHDA 1YZAA 3JTLO 1E84A 1YDIA 5KYYB 2HSQA 4E17A 5BQGA 1BR4A 2R02A 1SMYF 2WZGA 2R7XA 1NU7D 3JRTA 4IRUA 2LFFA 1LE4A 1W2WA 3I5PA 5CI8A 3EHNA 5A6JA 4YJWA 1IZMA 3M4CA 2NG1A 1HE9A 3I5QA 4P9FA 1VMAA 2FFHA 2PP4A 3B9QA 3M15A 1ZVZA 2VCBA 4I44A 4LDRA 3UMHA 1JR8A 3VRCA 5DQZA 1EA8A 2KYHA 1T6QA 2O9XA 2IXPA 2UUIA 2WVOA 1ZW3A 1Z7Qc 4I3MA 1LS4A 2UUHA 4ANJA 1WOLA 2E87A 4N6CA 4EUKB 3C8GB 2PFDA 2CYDA 4U9EA 2P7VA 3W2WA 3DM9B 4O6NA 2P6VA 3CZ6A 3V7OA 2XS8A 3H65A 1RKEB 1S05A 3EH1A 2HSBA 2ZXWC 3SXYA 5T1DB 1PV3A 1OW8A 1YA7O 4G7ZF 1LPEA 2OQMA 1TR2A 4K7BA 3CSKA 1JPJA 4BJ5C 1G8XA 2AU5A 3GEIA 3Q6NA 3EH2A 1WWPA 4XQ1A 2V3CC 1MNDA 1Z23A 3B29A 3KH2A 1D0XA 3PDMP 2J0XA 3SXZA 2FAPB 2EIMC 4LLCA 2KSFA 3UNGC 2IYLD 3SZRA 1D1CA 4NC3A 3B0UX 2PX3A 1ZHYA 3KL4A 3NKDA 4FWVA 4CS8A 2J7PA 2Q9BA 3OA1A 3W4YA 2AP3A 4Z9HA 2JD3A 3G4XA 5E33A 2KK1A 2XLVA 2Y3DA 3DKAA 1DOVA 2A1DD 2IXMA 3EG9A 2L7AA 4CJGA 4XLPF 4LDKA 4JVSA 3ZTMA 5B1BC 2BL2A 1DOWA 1QVXA 5DQTA 1OXKA 1TWCA 2OJED 4PFPA 2Y3GA 2VCAA 3F47A 1SR2A 1UG7A 3DE8A 3HKKA 2YWAA 4MTOA 4BJ1A 2CDQA 4CIHA 4KBLA 5AC5A 1ZHWA 1ST6A 1MNEA 3H2UA 3T6JA 4N4WA 3U3BA 4BJTA 3LNRA 1OCZC 2R7QA 4OIOF 3QMKA 1J8MF 3K1IC 3WODF 1FFTC 2XXAA 1RKCA 4GYTA 2XXAB 3DMDA 2RD9A 4JW1A 3K33A 2Z15A 1Z5ZA 4U5GA 2Q3TA 4YK5A 2OCCC 3M4BA 1B68A 2PNOA 3S90A 1D0ZA 4E0IA 1RXQA 2AWCA 2XM0A 3ECSA 1YLMA 2AWYA 3LEOA 2A68F 4P6IC 5L0GA 2CNWA 5T3TA 4CBEA 2D4UA 1OXBA 2NPUA 3Q7GA 4QI2A 1M2VA 2LCHA 2YL7A 3AJMA 4OINF 3PHF2 4NY3A 4RD9A 3WAQA 1ORYA 1K04A 4ZLDA 2R03A 5L0JA 2MWQA 4FAPB 1HMOA 4U5HA 4CS9A 3HTKC 1JMWA 2X0CA 3FAPB 3LLKA 5KYUB 2TMVP 2JX0A 1NFNA 1Q0KA 3ABKC 3LUTB 4AX2A 3WHNA 3FOOA 3OWTA 2YL0A 4YT2A 4LERA 1UFBA 4JJGA 5K0IA 1LS1A 4HFFB 3RQEA 1FFHA 3SYNA 4JZAA 3U8VA 1HE1A 3TK0A 2WVQA 2AVKA 3UR3C 3PCVA 2GA0A 2EIKC 1OKKA 4J7YA 4PR9A 3UMKA 1A7EA 2J9BA 5JP7A 1YVIA 1NBBA 1FMVA 3NRHA 4XEKA 1QSPA 4U5CE 4XPYA 3V5YA 2HFIA 3RW0A 4JEAA 5IY5C 1GM5A 4WABA 4BJ6A 4Q5SF 5DS6A 1LVKA 2EINC 2YKZA 3IPMO 5JSLA 4AE4A 2XRHA 1O3UA 4EKWA 5L0CA 4WGZA 2R9RB 3ZTZA 5L0HA 2J7PD 3BRJA 3AGTA 2XL6A 2NUPA 4IAQA 3TQOA 1WTYA 3E9VA 1RJ9A 3DZAA 3NG1A 2Y39A 4Q7CA 3TULA 5HV9A 4IWBA 4U5EE 3MX3A 2R7SA 3AG3C 1OR3A 1HMDA 2HMQA 4LLEA 1ZYRF 3C8ZA 3FVYA 3KYIA 4OD4A 4XEFA 3W8HA 4ER9A 5E2QA 3RF3A 2YVKA 1NU9C 2XLWA 2WZLA 3W8IA 4BG0A 1D1BA 4PJJA 1E85A 1QPUA 3US6A 5L3QA 4OIRF 4Z9JA 1AVOB 2Y3HA 2W9YA 1FR0A 2GFHA 4GQHA 3MBGA 3LJBA 2EPMX 2A6EF 3LAYA 4CSAC 4XLNF 1ZHZA 5KYUA 1V55C 4PJNA 1H9TA 1M2OA 2L6FA 2BE5F 3EG9B 1OR2A 3DE9A 4XEVA 2D5RB 5CI9A 4C3BA 1MQVA 2LFDA 4LACB 5A69A 4JTCB 3SXMA 256BA 1I5NA 2XLDA 1M57C 2W4MA 4JKVA 3ZSUA 4E0HA 2VASA 1LIHA 5TJ5E 1APCA 3ASOC 4EHPA 2J9VA 5CIVA 1XZPA 3NYJA 3EGXB 4N06A 3LS0A 4YWQA 3B71A 2Q7RA 3VF0A 3UMIA 4YT8A 3DJNB 3L1MA 3X1OA 3UGOA 3GEHA 4NCQA 3C63A 1IW7F 2J8WA 2Q9CA 1NFOA 4LDQA 4MVQA 4CS8C 1TQGA 2WL8A 4W8PA 1ZW2A 3HNKA 3K66A 5KYWA 1RMVA 1L3PA 1YYJA 2BC5A 3U8PA 4X0RA 4BPMA 2H7BA 4O79A 2J9WA 1Q0DA 5EHHA 1MMAA 2X51A 3L34A 4FX5A 4QDLA 3ASNC 2OU6A 4OIQF 1XZQA 3AQBA 2VC9A 3S27A 4BJ5A 1VYIA 3RH3A 3EZHA 2MHRA 3HLZA 3MLGA 4JJFA 5EK0A 1LM3B 1Z6AA 4YL1A 2J45A 3GM2A 2Q4FA 3T9OA 3U3FA 3EQLF 2IOQA 3Q6MA 2YRFA 4G0HA 3GM3A 4MW8A 3LNMB 1SF8A 1E2XA 2H7OA 3K6BA 1LI7A 1TFOB 2R7TA 2H8AA 3N2ZB 4D4XA 3EPVA 2QY9A 1Z3IX 2XS1A 3HJCA 4A2NB 1ORJA 1CGOA 1V74B 3IQ5A 5COFA 1Q0FA 1VLTA 3EFOB 3NDBB 3C8GA 1V54C 4KNVA 5BQHA 3ITFA 4NTAA 5JVEA 3T6BA 4EWCA 1QLEC 2OEXA 5B3IA 1CPRA 1S7ZA 3EGDA 3DD7A 3NMIA 3TJ6A 3GODA 2ASRA 4E18A 1QZXA 1E86A 1AUEA 2LP4A 4MVZA 3PMRA 1BDJB 2YLDA 3S84A 2ZXPA 1ZZPA 3CAXA 2QE9A 4AE4B 2HMZA 3AG1C 3ABMC 4DVYP 4I1OB 1M6TA 4WJ0A 1T9KA 3ZC4A 4Q4ZF 3U0CA 2LQGA 3RIPA 4JC7A 4R32A 1LI5A 1Q0MA 3DWWA 3LESA 2P0NA 5JS5A 4BEMJ 2OG2A 2YHSA 5A6BD 3QW0A 3RYLA 3N24A 1N1CA 1EKYA 3K1HA 2NUTB 2EPLX 1L7CA 1TKNA 2WZFA 2OEVA 4MVUA 4G7HF 1J8YF 2YQYA 2HV7A 3K7DA 3Q7LA 1OCRC 1A7DA 3L0IA 1U6HA 4IGGA 4MVMA 4O6YA 4RBNA 2LD6A 2KGOA 3DJUB 3N0TA 3NYLA 2WVNA 1VK5A 2GDCA 2IXOA 2H7VC 4C3EA 1TWHA 2RSEB 3A9CA 3T4RA 1U89A 2M4EA 1CPQA 1H6GA 2QUPA 4CIPA 4AK9A 4CX9A 5FCLA 2L6HA 1BR2A 3JSZA 4G78A 1LKXA 5GPGB 1VTMP 3FAJA 1V4AA 4P9TA 3E70C 5DVWA 4JTDB 4C7OB 3JYHA 4DRHB 3U5SA 1T6IA 5F5FA 2HJ3A 2L6GA 4NTFA 3SXKA 2XLEA 5JLIA 4H4KC 2DI3A 1YAUO 1QKRA 1MMGA 1VYKA 2FGYA 4DRJB 4YT4A 5KYXA 4MW3A 1I4YA 5BQIA 1OKKD 1BZ4A 1D1AA 3TOMA 3O6XA 1O87A 3C7JA 5A6BA 3QVYA 1YARO 3RQGA 2YL1A 3W2VA 1WGWA 4MQ9F 3C18A 4DVZA 3GM1A 1JRAA 1PD1A 5JRAA 2IM8A 4MTGA 2DGJA 4DBRA 3CEXA 1GGQA 4XTKA
chains in the Genus database with same CATH topology
1H6GA 1XWJA 1ZW3A 4P9TA 5FZTA 5L0HA 4K1OA 1DOVA 2LQGA 4EHPA 2L7AA 5L0GA 4PR9A 5L0FA 3RF3A 3VF0A 1DOWA 1RKEA 3T6GB 1QKRA 1T01A 1RKEB 2GWWA 1YDIA 1SYQA 2HSQA 4E17A 4W8PA 1ZW2A 1L7CA 3ZDLA 3TJ5A 4DJ9A 1ST6A 5L0JA 3H2UA 1TR2A 3H2VA 1U6HA 2IBFA 4IGGA 4E18A 3MYIA 5L0CA 5L0IA 2X0CA 5L0DA 1RKCA 1ZVZA 2GDCA 3S90A 3TJ6A 2B0HA 4ONSA 1U89A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H6G A;  1XWJ A;  1ZW3 A;  4P9T A;  5FZT A;  5L0H A;  4K1O A;  1DOV A;  2LQG A;  4EHP A;  2L7A A;  5L0G A;  4PR9 A;  5L0F A;  3RF3 A;  3VF0 A;  1DOW A;  1RKE A;  3T6G B;  1QKR A;  1T01 A;  1RKE B;  2GWW A;  1YDI A;  1SYQ A;  2HSQ A;  4E17 A;  4W8P A;  1ZW2 A;  1L7C A;  3ZDL A;  3TJ5 A;  4DJ9 A;  1ST6 A;  5L0J A;  3H2U A;  1TR2 A;  3H2V A;  1U6H A;  2IBF A;  4IGG A;  4E18 A;  3MYI A;  5L0C A;  5L0I A;  2X0C A;  5L0D A;  1RKC A;  1ZVZ A;  2GDC A;  3S90 A;  3TJ6 A;  2B0H A;  4ONS A;  1U89 A; 
#chains in the Genus database with same CATH topology
 4CDA A;  1ZHT A;  3FMS A;  3ZWI A;  1CGM E;  1EQ1 A;  1G4U S;  3AQC A;  3OEO A;  2YLI A;  2A6H F;  4MVS A;  3T6G B;  1WAS A;  1MMD A;  2PX0 A;  3ATP A;  4W8K A;  3EJN A;  3I4U A;  4BJ6 C;  1JPN A;  3G50 A;  1NZE A;  4ZLC A;  4HEA J;  2Q9A A;  2HV6 A;  4EBK A;  1K40 A;  4J7T A;  3J06 A;  4IAO A;  5A6K A;  1TWG A;  2VCC A;  3MFN A;  4C3D A;  1Y4C A;  5L0D A;  3ABL C;  2QNL A;  4KI2 A;  4XPW A;  4MND A;  3AG2 C;  2YLG A;  3S9O A;  4CSA A;  4F4B A;  4XPX A;  2B0H A;  5A6A A;  3NYM A;  2NSF A;  4CS7 A;  2VH3 A;  4UDV A;  2QLA A;  1RJ9 B;  4PAC A;  4WGY A;  5E3A A;  2G3V A;  2HS5 A;  4IB4 A;  2KNH A;  3A11 A;  3LLI A;  5FZT A;  1BBH A;  1I4Z A;  3IQC A;  1WAT A;  3TD7 A;  3NKE A;  4PK4 A;  3POV A;  2M64 A;  2YL3 A;  5AGF A;  3JCU Q;  3CQZ A;  4U9D A;  2EIJ C;  5KYY A;  3EZI A;  1OCC C;  4JCZ A;  2WB7 A;  5F5H A;  2GAQ A;  1VOM A;  4JUR I;  2OJQ A;  2XLO A;  4KNW A;  1HW1 A;  5AC4 A;  1D0Y A;  2CGE A;  4I1M A;  2A69 F;  2CNW D;  2G3K A;  2W4B A;  3QW1 A;  1WN0 A;  4PFO A;  4BEJ A;  4XWJ A;  4JTA B;  1BR1 A;  2A0U A;  3IEE A;  1YZC A;  4NQF A;  2JPU A;  2YZS A;  1A41 A;  1CGN A;  1KNY A;  1NSG B;  2R7U A;  3K1I A;  1EI7 A;  2F22 A;  4Z9I A;  3U9M A;  4AL0 A;  2HUJ A;  5KYX B;  4C7O A;  4RDA A;  1R5I D;  5D92 A;  3X2Q C;  4EIY A;  2P61 A;  5T3W A;  3EHM A;  3O10 A;  1VLS A;  2Y3B A;  4U5F E;  4OD5 A;  1OCO C;  4A4A A;  1C17 M;  3GWN A;  4CDV A;  1G5Z A;  3HNJ A;  4IJJ A;  1YJG A;  2NSG A;  3ZDL A;  2R7O A;  5KYW B;  2PBE A;  3H2V A;  4JIO A;  2I15 A;  2C03 A;  1T6U A;  2XLH A;  4FES A;  3RKO F;  3C62 A;  3RVZ A;  1AEP A;  4CDY A;  2V26 A;  1ZU4 A;  3SNH A;  3ZIB A;  2HKV A;  4J32 B;  2PF4 E;  2KW3 C;  4ONS A;  5L0I A;  3KYJ A;  1FNT c;  1ZU5 A;  1QQ3 A;  1U0B B;  3JSE O;  3VM6 A;  4ULW A;  4HE8 D;  3EFO A;  5E3C A;  4O7G A;  3DM5 A;  3G4Z A;  3LS1 A;  4D4N A;  3B0V C;  4JEB A;  1M2V B;  1GQA A;  3FOP A;  1H7I A;  1NG1 A;  3F46 A;  2DYR C;  2HZ8 A;  2GWW A;  3AGU A;  1SYQ A;  4KC9 A;  1R4T A;  3JZ0 A;  1C03 A;  4NTB A;  3ZQY A;  2XLM A;  3EGX A;  4DJ9 A;  4IAR A;  1KU2 A;  4MTF A;  3DI5 A;  4YN0 B;  1ORS C;  1K05 A;  5F28 E;  3RFY A;  2R7W A;  3U9J A;  3FXH A;  2R25 A;  1YA9 A;  1H9G A;  1TWA A;  2J9U A;  3AOU A;  3KMI A;  4U5D E;  4DBQ A;  2CCY A;  4EBJ A;  3QVZ A;  3R2P A;  4JE9 A;  3GWL A;  2A0B A;  3R7C A;  5JUA A;  3EGD B;  2HJM A;  3ZVR A;  1GS9 A;  1MMN A;  2I8B A;  4GEH A;  1NLX A;  5DLJ A;  3SP1 A;  4CJO A;  3AG4 C;  4K1O A;  3V5Z A;  1PD0 A;  4DRI B;  2IXN A;  4N6H A;  5KYN A;  2VB6 A;  5L0F A;  2ICW G;  3KKB A;  1HY5 A;  1SZI A;  1T5O A;  2XSE A;  4O6M A;  1TFK B;  1T01 A;  3NMK A;  4EBB A;  2ZD9 A;  3JT1 A;  2EPK X;  2DB4 A;  4OIP F;  3DAG A;  2P1A A;  3QTH A;  2L81 A;  2EPO A;  1RCP A;  2CW0 F;  2LIG A;  3O39 A;  4YT5 A;  2NUT A;  2EPN A;  1YYX A;  4CS9 C;  5DS4 A;  2Q00 A;  2R7V A;  3IQT A;  3WG7 C;  2ZXO A;  2IBF A;  3MYI A;  4HFK B;  2J46 A;  2LSE A;  3GOR A;  4AL1 A;  3JRM O;  3BEH A;  3NMJ A;  2R7R A;  1LE2 A;  2NUP B;  3DAF A;  5DS5 A;  1OW7 A;  1ZHX A;  3C8G D;  4E7Z A;  5JT4 A;  2KQ9 A;  4K0D A;  4L6R A;  1XWJ A;  3VAY A;  3U2M A;  3V5X A;  1PCX A;  4PJM A;  1JOG A;  2XL4 A;  3L8J A;  1OQC A;  3MYF A;  4PJL A;  3VYW A;  5L3V A;  1FMW A;  2W45 A;  1A7V A;  3GEE A;  1KTM A;  2ETS A;  4MVO A;  3O55 A;  2L9J A;  2B0J A;  5BUO A;  1RKE A;  2EIL C;  2YEV A;  3QZC A;  4B6I A;  1E83 A;  3S0X A;  2KJG A;  2XM4 A;  3GAN A;  4MVR A;  5B1A C;  3RQF A;  3S28 A;  3HNL A;  2ZXR A;  4YL0 A;  3S29 A;  3ZQV A;  2DYS C;  4M63 A;  3UGP A;  2OOC A;  4ULV A;  3TJ5 A;  2LK4 A;  2Y69 C;  3RVY A;  2OKU A;  3FDQ A;  2J0W A;  5D91 A;  1HW2 A;  3DXJ F;  3M79 A;  1O5H A;  5HSW A;  1A0B A;  4JRZ A;  3JYY A;  2G62 A;  4G7O F;  4J30 B;  1M56 C;  3ZG1 A;  1FTS A;  2ZPA A;  2R05 A;  5EGY A;  2C04 A;  3SEO A;  5COM A;  2XL8 A;  1VB5 A;  1FAP B;  3L8I A;  5B3S C;  3HNI A;  3LEV A;  3U2L A;  2KC3 A;  4YL3 A;  4DOZ A;  1Z63 A;  1OW6 A;  4JCH A;  3KPH A;  4DXW A;  2MYS A;  1JAF A;  1C02 A;  3B0P A;  1Q0G A;  1G4W R;  3IHU A;  4H54 A;  4U5B E;  5COG A;  1F1M A;  4E7S A;  4QI0 A;  3M1C B;  3IQ6 A;  4MS2 A;  3TOL A;  1Y6D A;  2QTV A;  3FHD A;  1YZA A;  3JTL O;  1E84 A;  1YDI A;  5KYY B;  2HSQ A;  4E17 A;  5BQG A;  1BR4 A;  2R02 A;  1SMY F;  2WZG A;  2R7X A;  1NU7 D;  3JRT A;  4IRU A;  2LFF A;  1LE4 A;  1W2W A;  3I5P A;  5CI8 A;  3EHN A;  5A6J A;  4YJW A;  1IZM A;  3M4C A;  2NG1 A;  1HE9 A;  3I5Q A;  4P9F A;  1VMA A;  2FFH A;  2PP4 A;  3B9Q A;  3M15 A;  1ZVZ A;  2VCB A;  4I44 A;  4LDR A;  3UMH A;  1JR8 A;  3VRC A;  5DQZ A;  1EA8 A;  2KYH A;  1T6Q A;  2O9X A;  2IXP A;  2UUI A;  2WVO A;  1ZW3 A;  1Z7Q c;  4I3M A;  1LS4 A;  2UUH A;  4ANJ A;  1WOL A;  2E87 A;  4N6C A;  4EUK B;  3C8G B;  2PFD A;  2CYD A;  4U9E A;  2P7V A;  3W2W A;  3DM9 B;  4O6N A;  2P6V A;  3CZ6 A;  3V7O A;  2XS8 A;  3H65 A;  1RKE B;  1S05 A;  3EH1 A;  2HSB A;  2ZXW C;  3SXY A;  5T1D B;  1PV3 A;  1OW8 A;  1YA7 O;  4G7Z F;  1LPE A;  2OQM A;  1TR2 A;  4K7B A;  3CSK A;  1JPJ A;  4BJ5 C;  1G8X A;  2AU5 A;  3GEI A;  3Q6N A;  3EH2 A;  1WWP A;  4XQ1 A;  2V3C C;  1MND A;  1Z23 A;  3B29 A;  3KH2 A;  1D0X A;  3PDM P;  2J0X A;  3SXZ A;  2FAP B;  2EIM C;  4LLC A;  2KSF A;  3UNG C;  2IYL D;  3SZR A;  1D1C A;  4NC3 A;  3B0U X;  2PX3 A;  1ZHY A;  3KL4 A;  3NKD A;  4FWV A;  4CS8 A;  2J7P A;  2Q9B A;  3OA1 A;  3W4Y A;  2AP3 A;  4Z9H A;  2JD3 A;  3G4X A;  5E33 A;  2KK1 A;  2XLV A;  2Y3D A;  3DKA A;  1DOV A;  2A1D D;  2IXM A;  3EG9 A;  2L7A A;  4CJG A;  4XLP F;  4LDK A;  4JVS A;  3ZTM A;  5B1B C;  2BL2 A;  1DOW A;  1QVX A;  5DQT A;  1OXK A;  1TWC A;  2OJE D;  4PFP A;  2Y3G A;  2VCA A;  3F47 A;  1SR2 A;  1UG7 A;  3DE8 A;  3HKK A;  2YWA A;  4MTO A;  4BJ1 A;  2CDQ A;  4CIH A;  4KBL A;  5AC5 A;  1ZHW A;  1ST6 A;  1MNE A;  3H2U A;  3T6J A;  4N4W A;  3U3B A;  4BJT A;  3LNR A;  1OCZ C;  2R7Q A;  4OIO F;  3QMK A;  1J8M F;  3K1I C;  3WOD F;  1FFT C;  2XXA A;  1RKC A;  4GYT A;  2XXA B;  3DMD A;  2RD9 A;  4JW1 A;  3K33 A;  2Z15 A;  1Z5Z A;  4U5G A;  2Q3T A;  4YK5 A;  2OCC C;  3M4B A;  1B68 A;  2PNO A;  3S90 A;  1D0Z A;  4E0I A;  1RXQ A;  2AWC A;  2XM0 A;  3ECS A;  1YLM A;  2AWY A;  3LEO A;  2A68 F;  4P6I C;  5L0G A;  2CNW A;  5T3T A;  4CBE A;  2D4U A;  1OXB A;  2NPU A;  3Q7G A;  4QI2 A;  1M2V A;  2LCH A;  2YL7 A;  3AJM A;  4OIN F;  3PHF 2;  4NY3 A;  4RD9 A;  3WAQ A;  1ORY A;  1K04 A;  4ZLD A;  2R03 A;  5L0J A;  2MWQ A;  4FAP B;  1HMO A;  4U5H A;  4CS9 A;  3HTK C;  1JMW A;  2X0C A;  3FAP B;  3LLK A;  5KYU B;  2TMV P;  2JX0 A;  1NFN A;  1Q0K A;  3ABK C;  3LUT B;  4AX2 A;  3WHN A;  3FOO A;  3OWT A;  2YL0 A;  4YT2 A;  4LER A;  1UFB A;  4JJG A;  5K0I A;  1LS1 A;  4HFF B;  3RQE A;  1FFH A;  3SYN A;  4JZA A;  3U8V A;  1HE1 A;  3TK0 A;  2WVQ A;  2AVK A;  3UR3 C;  3PCV A;  2GA0 A;  2EIK C;  1OKK A;  4J7Y A;  4PR9 A;  3UMK A;  1A7E A;  2J9B A;  5JP7 A;  1YVI A;  1NBB A;  1FMV A;  3NRH A;  4XEK A;  1QSP A;  4U5C E;  4XPY A;  3V5Y A;  2HFI A;  3RW0 A;  4JEA A;  5IY5 C;  1GM5 A;  4WAB A;  4BJ6 A;  4Q5S F;  5DS6 A;  1LVK A;  2EIN C;  2YKZ A;  3IPM O;  5JSL A;  4AE4 A;  2XRH A;  1O3U A;  4EKW A;  5L0C A;  4WGZ A;  2R9R B;  3ZTZ A;  5L0H A;  2J7P D;  3BRJ A;  3AGT A;  2XL6 A;  2NUP A;  4IAQ A;  3TQO A;  1WTY A;  3E9V A;  1RJ9 A;  3DZA A;  3NG1 A;  2Y39 A;  4Q7C A;  3TUL A;  5HV9 A;  4IWB A;  4U5E E;  3MX3 A;  2R7S A;  3AG3 C;  1OR3 A;  1HMD A;  2HMQ A;  4LLE A;  1ZYR F;  3C8Z A;  3FVY A;  3KYI A;  4OD4 A;  4XEF A;  3W8H A;  4ER9 A;  5E2Q A;  3RF3 A;  2YVK A;  1NU9 C;  2XLW A;  2WZL A;  3W8I A;  4BG0 A;  1D1B A;  4PJJ A;  1E85 A;  1QPU A;  3US6 A;  5L3Q A;  4OIR F;  4Z9J A;  1AVO B;  2Y3H A;  2W9Y A;  1FR0 A;  2GFH A;  4GQH A;  3MBG A;  3LJB A;  2EPM X;  2A6E F;  3LAY A;  4CSA C;  4XLN F;  1ZHZ A;  5KYU A;  1V55 C;  4PJN A;  1H9T A;  1M2O A;  2L6F A;  2BE5 F;  3EG9 B;  1OR2 A;  3DE9 A;  4XEV A;  2D5R B;  5CI9 A;  4C3B A;  1MQV A;  2LFD A;  4LAC B;  5A69 A;  4JTC B;  3SXM A;  256B A;  1I5N A;  2XLD A;  1M57 C;  2W4M A;  4JKV A;  3ZSU A;  4E0H A;  2VAS A;  1LIH A;  5TJ5 E;  1APC A;  3ASO C;  4EHP A;  2J9V A;  5CIV A;  1XZP A;  3NYJ A;  3EGX B;  4N06 A;  3LS0 A;  4YWQ A;  3B71 A;  2Q7R A;  3VF0 A;  3UMI A;  4YT8 A;  3DJN B;  3L1M A;  3X1O A;  3UGO A;  3GEH A;  4NCQ A;  3C63 A;  1IW7 F;  2J8W A;  2Q9C A;  1NFO A;  4LDQ A;  4MVQ A;  4CS8 C;  1TQG A;  2WL8 A;  4W8P A;  1ZW2 A;  3HNK A;  3K66 A;  5KYW A;  1RMV A;  1L3P A;  1YYJ A;  2BC5 A;  3U8P A;  4X0R A;  4BPM A;  2H7B A;  4O79 A;  2J9W A;  1Q0D A;  5EHH A;  1MMA A;  2X51 A;  3L34 A;  4FX5 A;  4QDL A;  3ASN C;  2OU6 A;  4OIQ F;  1XZQ A;  3AQB A;  2VC9 A;  3S27 A;  4BJ5 A;  1VYI A;  3RH3 A;  3EZH A;  2MHR A;  3HLZ A;  3MLG A;  4JJF A;  5EK0 A;  1LM3 B;  1Z6A A;  4YL1 A;  2J45 A;  3GM2 A;  2Q4F A;  3T9O A;  3U3F A;  3EQL F;  2IOQ A;  3Q6M A;  2YRF A;  4G0H A;  3GM3 A;  4MW8 A;  3LNM B;  1SF8 A;  1E2X A;  2H7O A;  3K6B A;  1LI7 A;  1TFO B;  2R7T A;  2H8A A;  3N2Z B;  4D4X A;  3EPV A;  2QY9 A;  1Z3I X;  2XS1 A;  3HJC A;  4A2N B;  1ORJ A;  1CGO A;  1V74 B;  3IQ5 A;  5COF A;  1Q0F A;  1VLT A;  3EFO B;  3NDB B;  3C8G A;  1V54 C;  4KNV A;  5BQH A;  3ITF A;  4NTA A;  5JVE A;  3T6B A;  4EWC A;  1QLE C;  2OEX A;  5B3I A;  1CPR A;  1S7Z A;  3EGD A;  3DD7 A;  3NMI A;  3TJ6 A;  3GOD A;  2ASR A;  4E18 A;  1QZX A;  1E86 A;  1AUE A;  2LP4 A;  4MVZ A;  3PMR A;  1BDJ B;  2YLD A;  3S84 A;  2ZXP A;  1ZZP A;  3CAX A;  2QE9 A;  4AE4 B;  2HMZ A;  3AG1 C;  3ABM C;  4DVY P;  4I1O B;  1M6T A;  4WJ0 A;  1T9K A;  3ZC4 A;  4Q4Z F;  3U0C A;  2LQG A;  3RIP A;  4JC7 A;  4R32 A;  1LI5 A;  1Q0M A;  3DWW A;  3LES A;  2P0N A;  5JS5 A;  4BEM J;  2OG2 A;  2YHS A;  5A6B D;  3QW0 A;  3RYL A;  3N24 A;  1N1C A;  1EKY A;  3K1H A;  2NUT B;  2EPL X;  1L7C A;  1TKN A;  2WZF A;  2OEV A;  4MVU A;  4G7H F;  1J8Y F;  2YQY A;  2HV7 A;  3K7D A;  3Q7L A;  1OCR C;  1A7D A;  3L0I A;  1U6H A;  4IGG A;  4MVM A;  4O6Y A;  4RBN A;  2LD6 A;  2KGO A;  3DJU B;  3N0T A;  3NYL A;  2WVN A;  1VK5 A;  2GDC A;  2IXO A;  2H7V C;  4C3E A;  1TWH A;  2RSE B;  3A9C A;  3T4R A;  1U89 A;  2M4E A;  1CPQ A;  1H6G A;  2QUP A;  4CIP A;  4AK9 A;  4CX9 A;  5FCL A;  2L6H A;  1BR2 A;  3JSZ A;  4G78 A;  1LKX A;  5GPG B;  1VTM P;  3FAJ A;  1V4A A;  4P9T A;  3E70 C;  5DVW A;  4JTD B;  4C7O B;  3JYH A;  4DRH B;  3U5S A;  1T6I A;  5F5F A;  2HJ3 A;  2L6G A;  4NTF A;  3SXK A;  2XLE A;  5JLI A;  4H4K C;  2DI3 A;  1YAU O;  1QKR A;  1MMG A;  1VYK A;  2FGY A;  4DRJ B;  4YT4 A;  5KYX A;  4MW3 A;  1I4Y A;  5BQI A;  1OKK D;  1BZ4 A;  1D1A A;  3TOM A;  3O6X A;  1O87 A;  3C7J A;  5A6B A;  3QVY A;  1YAR O;  3RQG A;  2YL1 A;  3W2V A;  1WGW A;  4MQ9 F;  3C18 A;  4DVZ A;  3GM1 A;  1JRA A;  1PD1 A;  5JRA A;  2IM8 A;  4MTG A;  2DGJ A;  4DBR A;  3CEX A;  1GGQ A;  4XTK A; 
#chains in the Genus database with same CATH homology
 1H6G A;  1XWJ A;  1ZW3 A;  4P9T A;  5FZT A;  5L0H A;  4K1O A;  1DOV A;  2LQG A;  4EHP A;  2L7A A;  5L0G A;  4PR9 A;  5L0F A;  3RF3 A;  3VF0 A;  1DOW A;  1RKE A;  3T6G B;  1QKR A;  1T01 A;  1RKE B;  2GWW A;  1YDI A;  1SYQ A;  2HSQ A;  4E17 A;  4W8P A;  1ZW2 A;  1L7C A;  3ZDL A;  3TJ5 A;  4DJ9 A;  1ST6 A;  5L0J A;  3H2U A;  1TR2 A;  3H2V A;  1U6H A;  2IBF A;  4IGG A;  4E18 A;  3MYI A;  5L0C A;  5L0I A;  2X0C A;  5L0D A;  1RKC A;  1ZVZ A;  2GDC A;  3S90 A;  3TJ6 A;  2B0H A;  4ONS A;  1U89 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...