4DJ9A

Human vinculin head domain vh1 (residues 1-258) in complex with the talin vinculin binding site 50 (vbs50, residues 2078-2099)
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
251
structure length
242
Chain Sequence
VFHTRTIESILEPVAQQISHLVIMHEEGKAIPDLTAPVAAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTQGIEEALKNRNFTVEKMSAEINEIIRVLQLTSW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vinculin
publication title Crystal structure of vinculin in complex with vinculin binding site 50 (VBS50), the integrin binding site 2 (IBS2) of talin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 103
structure length 242
sequence length 251
ec nomenclature
pdb deposition date 2012-02-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 4dj9A02
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 4dj9A01
2L7AA 3RF3A 1TR2A 3VF0A 5L0DA 1SYQA 2IBFA 1RKEB 1XWJA 4K1OA 3TJ6A 1H6GA 4PR9A 3S90A 4EHPA 4W8PA 3H2VA 3T6GB 4P9TA 2LQGA 3H2UA 1RKCA 1RKEA 5L0IA 1ST6A 1T01A 1QKRA 5L0HA 1ZW3A 1U89A 1YDIA 2B0HA 4IGGA 5L0CA 3ZDLA 1DOVA 1L7CA 1U6HA 1ZVZA 2X0CA 3MYIA 2HSQA 4DJ9A 5FZTA 4E18A 3TJ5A 1DOWA 1ZW2A 5L0GA 5L0JA 4E17A 4ONSA 2GDCA 5L0FA 2GWWA
chains in the Genus database with same CATH superfamily
3C62A 3NYLA 5E33A 3IQ6A 2EPNA 1FR0A 3X2QC 4G78A 3IQCA 4HEAJ 2NSGA 5DQZA 3U2MA 4EUKB 2J8WA 2WVQA 1Z5ZA 2IXMA 3FHDA 3K1HA 3NMKA 4MQ9F 4MW3A 4YL3A 2PF4E 1Q0DA 3DM5A 2Q3TA 4R32A 4K0DA 3US6A 4C7OB 3AQCA 3QMKA 4AL1A 3FOOA 1C17M 4PFOA 5A6KA 4JZAA 4YT5A 4OIRF 2XRHA 3EZIA 3A9CA 3S9OA 3AOUA 3EGXA 2BL2A 2GA0A 4J32B 3UNGC 2OG2A 2H7BA 1BDJB 3ECSA 1NBBA 4DJ9A 4OIOF 1ZW2A 4LLCA 2HZ8A 1S05A 4N06A 3NKEA 4LDQA 1QVXA 3UR3C 2ZD9A 4GYTA 3DI5A 3M15A 3EG9A 3TULA 1D0YA 3O6XA 2YVKA 2OJQA 5IY5C 1NSGB 2EPKX 5DS6A 2IBFA 3AGTA 3K6BA 1QQ3A 4QDLA 5A6BD 2XLVA 3M4BA 3BRJA 4YN0B 3ZG1A 4C3BA 1L3PA 2J7PD 3ASOC 3UMHA 4Q7CA 4AX2A 1VB5A 5DVWA 4AE4B 5L3QA 2NUPB 3M79A 3PHF2 2OKUA 1VYKA 5AGFA 1T01A 4JJGA 3OWTA 1OXBA 3IQTA 5A6BA 3HNLA 5CI8A 3RW0A 2Y39A 3DD7A 2NUTA 4LDRA 2OEVA 4O6YA 2J7PA 2RD9A 4XPYA 3FAPB 3B29A 4NY3A 4A2NB 2IXOA 3NYMA 3U9JA 1O87A 1Y4CA 5DS4A 1TFKB 4JEBA 2ZXRA 1KNYA 4HE8D 4DRJB 1APCA 2PX3A 3B0PA 3JSEO 4NTFA 3Q6MA 4JEAA 1PV3A 3RVYA 3ZWIA 2J9UA 4XLNF 2A69F 2B0JA 2PX0A 2VCCA 3JRTA 3NG1A 4ULWA 1WTYA 3O55A 2XS8A 5TJ5E 2V3CC 3DWWA 3GM2A 1D1CA 3S29A 1LIHA 4ZLCA 3AG4C 3DZAA 1R5ID 3SYNA 4DRIB 4DBQA 2O9XA 2IXPA 1PD0A 1SF8A 4U5HA 2PBEA 1ORJA 3LEVA 1B68A 3C8ZA 2X0CA 1QZXA 3MYIA 2VB6A 4XWJA 3ZQYA 2KSFA 2AWYA 5L0GA 4U5CE 4JTAB 4I1MA 3WHNA 3NMIA 4CDAA 4UDVA 3B9QA 1TKNA 3DJNB 3LNRA 4BPMA 3G4XA 1CGME 2HUJA 2KQ9A 2LIGA 3RF3A 1TR2A 3JYYA 2ZXPA 3K1IA 1MNDA 1SYQA 2J45A 3TJ6A 3S28A 3EQLF 4LDKA 3S90A 4Q4ZF 4MVRA 1OW7A 3E9VA 1V55C 4JW1A 3EFOA 5JRAA 1LS4A 3H2VA 3FVYA 1QPUA 1HMDA 4P9TA 5JSLA 3NKDA 1Z7Qc 2AP3A 2DYSC 5F28E 2R7SA 5A6JA 2AU5A 2R7RA 5KYXA 2CDQA 2L6GA 5DLJA 5B3SC 3W8IA 4DOZA 3GM3A 2M4EA 1EKYA 3NYJA 1H9TA 2XXAB 4XLPF 2J9BA 2YLGA 2UUHA 3SXMA 3V7OA 1OR2A 1Q0MA 1G8XA 2ICWG 3UGPA 2PFDA 2KNHA 1LS1A 4CSAC 4MVUA 2OCCC 1OKKA 4MTOA 5F5FA 1H9GA 3AG2C 2R7WA 3K7DA 2EILC 3K1IC 3UMKA 5JLIA 2IM8A 3JYHA 1EA8A 2A0BA 3H2UA 5T3TA 2EPMX 1RKEA 2R25A 3EGDB 4U5GA 2OOCA 2QUPA 1FMVA 2FFHA 3FXHA 1ORSC 3RQEA 3IPMO 4G7ZF 2YL1A 4D4NA 1YJGA 2HJMA 3C18A 1ZHZA 4K7BA 1AVOB 3IEEA 1IZMA 3CZ6A 4DVYP 2H7OA 2KK1A 5DQTA 4EWCA 2J9WA 1FFHA 2XS1A 2WL8A 4BJ5C 1YVIA 1T6UA 2EINC 3EZHA 4PJLA 3MLGA 3POVA 3ZSUA 4U5DE 3HNJA 3ZTMA 2Y3GA 1GM5A 2G3KA 4ZLDA 2RSEB 1PCXA 4NQFA 1NZEA 4C3DA 1FTSA 2EPLX 1VLTA 1VK5A 2F22A 3EGXB 4MNDA 1LE2A 4EHPA 3W4YA 1TWHA 3F46A 2XM0A 4WJ0A 1Q0KA 3LLIA 3U3BA 4O6NA 2P7VA 1U89A 2R7XA 2J46A 3FAJA 1ORYA 2JD3A 3KYJA 4CS8A 3V5ZA 3HJCA 3KYIA 2VCAA 4BJ6A 1G4US 2UUIA 4EBBA 2IOQA 3TQOA 1A7VA 2DB4A 2D5RB 1YYXA 2CGEA 2Y69C 3GWNA 2DI3A 1CPRA 2C04A 1JOGA 5JP7A 1T6IA 1M56C 4ANJA 4KI2A 1TWAA 2LCHA 2Y3DA 2XM4A 4PK4A 2HV7A 1OCZC 1XWJA 4E0HA 1BBHA 3L34A 2AVKA 1JMWA 3SP1A 2BE5F 2Q9AA 4MTGA 4CDYA 4GEHA 1RJ9A 1WGWA 3QW1A 1XZQA 5HSWA 2NUTB 3ZTZA 1AEPA 1K05A 2DGJA 2KC3A 4JCHA 4KBLA 5B1AC 1YYJA 5BQIA 2W4MA 1ST6A 3U3FA 3Q7GA 2ASRA 3X1OA 1MNEA 1WOLA 3CQZA 1E84A 3DMDA 2A6HF 4E7ZA 3EPVA 4C7OA 2KYHA 4XPXA 1Z6AA 3K33A 3DE9A 1FAPB 1VOMA 3QVZA 4IB4A 3DE8A 3E70C 4RD9A 4YL0A 3LEOA 5D92A 4EBKA 3NMJA 3L0IA 4CS8C 1A7EA 1RMVA 3RFYA 4BJ6C 3ITFA 5A6AA 4BJTA 3HLZA 4AL0A 4ONSA 1Q0GA 2GDCA 2HFIA 2IYLD 3EH2A 2YWAA 2L7AA 4JJFA 4P6IC 4PFPA 4BEJA 1HE1A 2HMZA 1IW7F 2WB7A 1G5ZA 1SR2A 3G4ZA 4O7GA 4U5EE 2P0NA 5AC5A 4IWBA 3V5YA 1UFBA 3PCVA 4O79A 4CBEA 3EHMA 5KYYA 1JR8A 4MVZA 2W45A 3WG7C 1U0BB 3S84A 3GEEA 1JAFA 3A11A 4JCZA 5DS5A 4X0RA 1I4ZA 1T6QA 5T1DB 1J8YF 1YZCA 2NG1A 3HNIA 3DAGA 3EJNA 2GAQA 3ZDLA 3O39A 4AE4A 4C3EA 1KU2A 2NUPA 3L1MA 3AG1C 2R05A 4YT8A 2HSQA 1FFTC 1KTMA 2WZLA 1I5NA 1DOWA 4YK5A 3T6BA 4G7OF 2VC9A 4JIOA 1OR3A 1O5HA 3T4RA 1PD1A 4Z9HA 4EBJA 4CSAA 4Q5SF 1OCRC 3LLKA 1YA7O 2V26A 3DAFA 4MTFA 3TOLA 5B3IA 1Z63A 1NLXA 2YL3A 4W8KA 1LE4A 5GPGB 3S0XA 5EGYA 4A4AA 256BA 4PJMA 3IHUA 1Q0FA 1ZHWA 3FOPA 3N2ZB 4CDVA 3T6GB 3I5PA 3MYFA 1Z3IX 2HV6A 4IAOA 3DKAA 1QKRA 4XEFA 3ABMC 3DJUB 3KKBA 2ZXOA 1OCCC 1OW6A 1TFOB 4LLEA 3C8GD 3JT1A 5KYWB 4OD4A 5A69A 2LSEA 2VCBA 2FGYA 4H54A 3JZ0A 4NTBA 4H4KC 4ULVA 3VAYA 1LPEA 1A41A 3NRHA 2R02A 5BQGA 1EI7A 4BJ5A 4D4XA 1V74B 1OCOC 2HS5A 3QVYA 1ZU4A 3EH1A 4N6CA 4E17A 2HSBA 2W4BA 3AG3C 3LS1A 1OXKA 2XLEA 1E2XA 3MX3A 1YARO 4FX5A 4NCQA 1YLMA 4YT4A 5EHHA 2OQMA 3C8GA 2CW0F 3GODA 2J9VA 4W8PA 2EIKC 2ZPAA 5CIVA 2Y3HA 2LP4A 2JPUA 3Q7LA 3SZRA 4L6RA 3R7CA 3ZQVA 2CCYA 3M1CB 2B0HA 3JSZA 2KJGA 3MFNA 4Z9JA 4MVOA 1MMAA 2EIMC 4U5FE 4G7HF 5L3VA 3FDQA 2YL7A 4J30B 2Q4FA 4BJ1A 2J0XA 1K04A 4JTDB 4KNWA 1WASA 3J06A 1MMNA 1UG7A 1VTMP 2YL0A 2YEVA 5L0FA 4P9FA 2Q9CA 3TOMA 1M57C 2XXAA 1ZZPA 2KW3C 3CEXA 1T9KA 4OD5A 1GS9A 4K1OA 4KC9A 4CIHA 3ATPA 1N1CA 4CJOA 1FMWA 4JKVA 5KYUA 1E85A 1O3UA 4HFKB 4LACB 3SEOA 3SXKA 2MYSA 1TWGA 4I44A 1G4WR 4XEKA 2A68F 2MHRA 3EHNA 5L0IA 3B0VC 2R7QA 3RKOF 1ZW3A 2QE9A 5E2QA 3OA1A 2R7OA 1S7ZA 2XLHA 2HJ3A 4MVSA 1DOVA 1L7CA 3ZIBA 3RYLA 3C63A 3EG9B 4WABA 5EK0A 1M2VA 2XL8A 1CGNA 4ER9A 1WWPA 1HMOA 1OQCA 2YLDA 4U9EA 5L0JA 4XEVA 2HKVA 3VYWA 1MMGA 4CJGA 1VMAA 2FAPB 2PP4A 3H65A 3KL4A 4MS2A 1HE9A 1GQAA 2A1DD 4XTKA 2WVNA 3VF0A 5AC4A 3PMRA 1VLSA 2P1AA 5K0IA 3HTKC 2G62A 1C03A 4PJNA 4N6HA 5CI9A 3VM6A 2EIJC 4DVZA 3QZCA 1GGQA 3W2WA 3KPHA 3OEOA 2CYDA 4JTCB 4YT2A 5BQHA 1EQ1A 5E3AA 1RKCA 1LVKA 4HFFB 3AJMA 2Q7RA 1ZHTA 1ZYRF 3S27A 4BG0A 3UGOA 3WAQA 1JPJA 2E87A 4J7YA 4FWVA 1YZAA 1ZHYA 1M6TA 3LESA 4IGGA 4NTAA 4U5BE 4IJJA 3O10A 4WGYA 5HV9A 1BR2A 4U9DA 1NFOA 4IARA 2R7TA 1F1MA 2QTVA 1TWCA 2YHSA 3B0UX 3CAXA 3W2VA 1D1AA 2C03A 4E7SA 5FCLA 2WZFA 5KYYB 3WODF 3V5XA 4F4BA 1R4TA 3DM9B 4FAPB 5E3CA 4EIYA 2GWWA 3ASNC 3T6JA 1RXQA 3MBGA 3JCUQ 3AQBA 3L8IA 3LJBA 2LD6A 1WATA 4PR9A 3U8VA 2YZSA 1HW1A 1BR1A 2ETSA 4MVQA 1TQGA 2L6HA 2YLIA 3ABLC 2D4UA 3LUTB 3QW0A 2OJED 2P61A 2WZGA 3LS0A 3N0TA 1AUEA 4MVMA 2LQGA 2XL4A 1W2WA 4BEMJ 4DXWA 1CPQA 2Q9BA 5BUOA 4QI2A 2H7VC 1YDIA 2XLMA 3ABKC 1H7IA 2A6EF 2A0UA 2L6FA 2WVOA 1NFNA 4JC7A 1D1BA 3C7JA 1ZVZA 4NC3A 3U8PA 3I5QA 4OIQF 4E18A 4JURI 3TJ5A 3HKKA 2VH3A 4G0HA 5COMA 2AWCA 2OEXA 4RBNA 1CGOA 4YL1A 3LNMB 3GANA 1C02A 1SMYF 3EFOB 4XPWA 3GEHA 1D0XA 5T3WA 3U9MA 3K66A 3U0CA 4WGZA 2DYRC 4XQ1A 3KMIA 3ZVRA 2X51A 4FESA 4PJJA 2H8AA 3HNKA 3JTLO 3G50A 4J7TA 5KYXB 4JE9A 1YAUO 1K40A 3W8HA 3Q6NA 5B1BC 1J8MF 3BEHA 1WN0A 5F5HA 1Y6DA 4IAQA 1YA9A 3F47A 2LFDA 5L0HA 3SXYA 4CS7A 1MMDA 2QLAA 5JVEA 3PDMP 3U5SA 4Z9IA 5JUAA 4JRZA 1V54C 3SNHA 2LFFA 1VYIA 3KH2A 4M63A 2OU6A 3C8GB 3DXJF 4OIPF 1E83A 1LM3B 2W9YA 2G3VA 1ZU5A 3RQGA 1RCPA 3L8JA 1HY5A 2HMQA 2NPUA 4YWQA 1QSPA 2Q00A 2KGOA 1JPNA 3N24A 2QNLA 2PNOA 4CS9A 1RKEB 4CX9A 5L0DA 2Y3BA 2YQYA 2TMVP 4PACA 1H6GA 2GFHA 3GM1A 4DBRA 1NU7D 1NU9C 2CNWD 5COFA 2R7VA 1V4AA 2MWQA 2I8BA 1NG1A 4AK9A 4MW8A 5JS5A 3FMSA 1OKKD 3ZC4A 1I4YA 2XSEA 1XZPA 2QY9A 2J0WA 3GWLA 5JT4A 3T9OA 1HW2A 2BC5A 2IXNA 1A7DA 5COGA 3TK0A 1ZHXA 3RVZA 3RH3A 4OINF 2CNWA 1BZ4A 2LK4A 4JVSA 5FZTA 4RDAA 3UMIA 4I1OB 2ZXWC 2XLWA 1LKXA 2R7UA 4DRHB 5KYUB 3CSKA 5D91A 2YKZA 2R9RB 2EPOA 4O6MA 5KYWA 3NDBB 4N4WA 1JRAA 1D0ZA 2YRFA 2Z15A 1QLEC 4YJWA 2XL6A 4CS9C 3LAYA 3TD7A 2VASA 1M2OA 3VRCA 2I15A 3JRMO 4E0IA 1M2VB 2XLOA 3I4UA 3AGUA 3GEIA 1E86A 4I3MA 4B6IA 4KNVA 2JX0A 4IRUA 4CIPA 1LI5A 1MQVA 3RQFA 5L0CA 4QI0A 3B71A 1A0BA 3QTHA 2L9JA 1LI7A 1BR4A 4GQHA 1U6HA 3SXZA 2M64A 1SZIA 2XLDA 3GORA 4LERA 4EKWA 5KYNA 3M4CA 3IQ5A 3U2LA 3EGDA 2L81A 2R03A 1T5OA 3RIPA 1FNTc 2P6VA 1RJ9B 1Z23A 1OW8A 2NSFA 3R2PA
chains in the Genus database with same CATH topology
2L7AA 3RF3A 1TR2A 3VF0A 5L0DA 1SYQA 2IBFA 1RKEB 1XWJA 4K1OA 3TJ6A 1H6GA 4PR9A 3S90A 4EHPA 4W8PA 3H2VA 3T6GB 4P9TA 2LQGA 3H2UA 1RKCA 1RKEA 5L0IA 1ST6A 1T01A 1QKRA 5L0HA 1ZW3A 1U89A 1YDIA 2B0HA 4IGGA 5L0CA 3ZDLA 1DOVA 1L7CA 1U6HA 1ZVZA 2X0CA 3MYIA 2HSQA 4DJ9A 5FZTA 4E18A 3TJ5A 1DOWA 1ZW2A 5L0GA 5L0JA 4E17A 4ONSA 2GDCA 5L0FA 2GWWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L7A A;  3RF3 A;  1TR2 A;  3VF0 A;  5L0D A;  1SYQ A;  2IBF A;  1RKE B;  1XWJ A;  4K1O A;  3TJ6 A;  1H6G A;  4PR9 A;  3S90 A;  4EHP A;  4W8P A;  3H2V A;  3T6G B;  4P9T A;  2LQG A;  3H2U A;  1RKC A;  1RKE A;  5L0I A;  1ST6 A;  1T01 A;  1QKR A;  5L0H A;  1ZW3 A;  1U89 A;  1YDI A;  2B0H A;  4IGG A;  5L0C A;  3ZDL A;  1DOV A;  1L7C A;  1U6H A;  1ZVZ A;  2X0C A;  3MYI A;  2HSQ A;  4DJ9 A;  5FZT A;  4E18 A;  3TJ5 A;  1DOW A;  1ZW2 A;  5L0G A;  5L0J A;  4E17 A;  4ONS A;  2GDC A;  5L0F A;  2GWW A; 
#chains in the Genus database with same CATH topology
 3C62 A;  3NYL A;  5E33 A;  3IQ6 A;  2EPN A;  1FR0 A;  3X2Q C;  4G78 A;  3IQC A;  4HEA J;  2NSG A;  5DQZ A;  3U2M A;  4EUK B;  2J8W A;  2WVQ A;  1Z5Z A;  2IXM A;  3FHD A;  3K1H A;  3NMK A;  4MQ9 F;  4MW3 A;  4YL3 A;  2PF4 E;  1Q0D A;  3DM5 A;  2Q3T A;  4R32 A;  4K0D A;  3US6 A;  4C7O B;  3AQC A;  3QMK A;  4AL1 A;  3FOO A;  1C17 M;  4PFO A;  5A6K A;  4JZA A;  4YT5 A;  4OIR F;  2XRH A;  3EZI A;  3A9C A;  3S9O A;  3AOU A;  3EGX A;  2BL2 A;  2GA0 A;  4J32 B;  3UNG C;  2OG2 A;  2H7B A;  1BDJ B;  3ECS A;  1NBB A;  4DJ9 A;  4OIO F;  1ZW2 A;  4LLC A;  2HZ8 A;  1S05 A;  4N06 A;  3NKE A;  4LDQ A;  1QVX A;  3UR3 C;  2ZD9 A;  4GYT A;  3DI5 A;  3M15 A;  3EG9 A;  3TUL A;  1D0Y A;  3O6X A;  2YVK A;  2OJQ A;  5IY5 C;  1NSG B;  2EPK X;  5DS6 A;  2IBF A;  3AGT A;  3K6B A;  1QQ3 A;  4QDL A;  5A6B D;  2XLV A;  3M4B A;  3BRJ A;  4YN0 B;  3ZG1 A;  4C3B A;  1L3P A;  2J7P D;  3ASO C;  3UMH A;  4Q7C A;  4AX2 A;  1VB5 A;  5DVW A;  4AE4 B;  5L3Q A;  2NUP B;  3M79 A;  3PHF 2;  2OKU A;  1VYK A;  5AGF A;  1T01 A;  4JJG A;  3OWT A;  1OXB A;  3IQT A;  5A6B A;  3HNL A;  5CI8 A;  3RW0 A;  2Y39 A;  3DD7 A;  2NUT A;  4LDR A;  2OEV A;  4O6Y A;  2J7P A;  2RD9 A;  4XPY A;  3FAP B;  3B29 A;  4NY3 A;  4A2N B;  2IXO A;  3NYM A;  3U9J A;  1O87 A;  1Y4C A;  5DS4 A;  1TFK B;  4JEB A;  2ZXR A;  1KNY A;  4HE8 D;  4DRJ B;  1APC A;  2PX3 A;  3B0P A;  3JSE O;  4NTF A;  3Q6M A;  4JEA A;  1PV3 A;  3RVY A;  3ZWI A;  2J9U A;  4XLN F;  2A69 F;  2B0J A;  2PX0 A;  2VCC A;  3JRT A;  3NG1 A;  4ULW A;  1WTY A;  3O55 A;  2XS8 A;  5TJ5 E;  2V3C C;  3DWW A;  3GM2 A;  1D1C A;  3S29 A;  1LIH A;  4ZLC A;  3AG4 C;  3DZA A;  1R5I D;  3SYN A;  4DRI B;  4DBQ A;  2O9X A;  2IXP A;  1PD0 A;  1SF8 A;  4U5H A;  2PBE A;  1ORJ A;  3LEV A;  1B68 A;  3C8Z A;  2X0C A;  1QZX A;  3MYI A;  2VB6 A;  4XWJ A;  3ZQY A;  2KSF A;  2AWY A;  5L0G A;  4U5C E;  4JTA B;  4I1M A;  3WHN A;  3NMI A;  4CDA A;  4UDV A;  3B9Q A;  1TKN A;  3DJN B;  3LNR A;  4BPM A;  3G4X A;  1CGM E;  2HUJ A;  2KQ9 A;  2LIG A;  3RF3 A;  1TR2 A;  3JYY A;  2ZXP A;  3K1I A;  1MND A;  1SYQ A;  2J45 A;  3TJ6 A;  3S28 A;  3EQL F;  4LDK A;  3S90 A;  4Q4Z F;  4MVR A;  1OW7 A;  3E9V A;  1V55 C;  4JW1 A;  3EFO A;  5JRA A;  1LS4 A;  3H2V A;  3FVY A;  1QPU A;  1HMD A;  4P9T A;  5JSL A;  3NKD A;  1Z7Q c;  2AP3 A;  2DYS C;  5F28 E;  2R7S A;  5A6J A;  2AU5 A;  2R7R A;  5KYX A;  2CDQ A;  2L6G A;  5DLJ A;  5B3S C;  3W8I A;  4DOZ A;  3GM3 A;  2M4E A;  1EKY A;  3NYJ A;  1H9T A;  2XXA B;  4XLP F;  2J9B A;  2YLG A;  2UUH A;  3SXM A;  3V7O A;  1OR2 A;  1Q0M A;  1G8X A;  2ICW G;  3UGP A;  2PFD A;  2KNH A;  1LS1 A;  4CSA C;  4MVU A;  2OCC C;  1OKK A;  4MTO A;  5F5F A;  1H9G A;  3AG2 C;  2R7W A;  3K7D A;  2EIL C;  3K1I C;  3UMK A;  5JLI A;  2IM8 A;  3JYH A;  1EA8 A;  2A0B A;  3H2U A;  5T3T A;  2EPM X;  1RKE A;  2R25 A;  3EGD B;  4U5G A;  2OOC A;  2QUP A;  1FMV A;  2FFH A;  3FXH A;  1ORS C;  3RQE A;  3IPM O;  4G7Z F;  2YL1 A;  4D4N A;  1YJG A;  2HJM A;  3C18 A;  1ZHZ A;  4K7B A;  1AVO B;  3IEE A;  1IZM A;  3CZ6 A;  4DVY P;  2H7O A;  2KK1 A;  5DQT A;  4EWC A;  2J9W A;  1FFH A;  2XS1 A;  2WL8 A;  4BJ5 C;  1YVI A;  1T6U A;  2EIN C;  3EZH A;  4PJL A;  3MLG A;  3POV A;  3ZSU A;  4U5D E;  3HNJ A;  3ZTM A;  2Y3G A;  1GM5 A;  2G3K A;  4ZLD A;  2RSE B;  1PCX A;  4NQF A;  1NZE A;  4C3D A;  1FTS A;  2EPL X;  1VLT A;  1VK5 A;  2F22 A;  3EGX B;  4MND A;  1LE2 A;  4EHP A;  3W4Y A;  1TWH A;  3F46 A;  2XM0 A;  4WJ0 A;  1Q0K A;  3LLI A;  3U3B A;  4O6N A;  2P7V A;  1U89 A;  2R7X A;  2J46 A;  3FAJ A;  1ORY A;  2JD3 A;  3KYJ A;  4CS8 A;  3V5Z A;  3HJC A;  3KYI A;  2VCA A;  4BJ6 A;  1G4U S;  2UUI A;  4EBB A;  2IOQ A;  3TQO A;  1A7V A;  2DB4 A;  2D5R B;  1YYX A;  2CGE A;  2Y69 C;  3GWN A;  2DI3 A;  1CPR A;  2C04 A;  1JOG A;  5JP7 A;  1T6I A;  1M56 C;  4ANJ A;  4KI2 A;  1TWA A;  2LCH A;  2Y3D A;  2XM4 A;  4PK4 A;  2HV7 A;  1OCZ C;  1XWJ A;  4E0H A;  1BBH A;  3L34 A;  2AVK A;  1JMW A;  3SP1 A;  2BE5 F;  2Q9A A;  4MTG A;  4CDY A;  4GEH A;  1RJ9 A;  1WGW A;  3QW1 A;  1XZQ A;  5HSW A;  2NUT B;  3ZTZ A;  1AEP A;  1K05 A;  2DGJ A;  2KC3 A;  4JCH A;  4KBL A;  5B1A C;  1YYJ A;  5BQI A;  2W4M A;  1ST6 A;  3U3F A;  3Q7G A;  2ASR A;  3X1O A;  1MNE A;  1WOL A;  3CQZ A;  1E84 A;  3DMD A;  2A6H F;  4E7Z A;  3EPV A;  4C7O A;  2KYH A;  4XPX A;  1Z6A A;  3K33 A;  3DE9 A;  1FAP B;  1VOM A;  3QVZ A;  4IB4 A;  3DE8 A;  3E70 C;  4RD9 A;  4YL0 A;  3LEO A;  5D92 A;  4EBK A;  3NMJ A;  3L0I A;  4CS8 C;  1A7E A;  1RMV A;  3RFY A;  4BJ6 C;  3ITF A;  5A6A A;  4BJT A;  3HLZ A;  4AL0 A;  4ONS A;  1Q0G A;  2GDC A;  2HFI A;  2IYL D;  3EH2 A;  2YWA A;  2L7A A;  4JJF A;  4P6I C;  4PFP A;  4BEJ A;  1HE1 A;  2HMZ A;  1IW7 F;  2WB7 A;  1G5Z A;  1SR2 A;  3G4Z A;  4O7G A;  4U5E E;  2P0N A;  5AC5 A;  4IWB A;  3V5Y A;  1UFB A;  3PCV A;  4O79 A;  4CBE A;  3EHM A;  5KYY A;  1JR8 A;  4MVZ A;  2W45 A;  3WG7 C;  1U0B B;  3S84 A;  3GEE A;  1JAF A;  3A11 A;  4JCZ A;  5DS5 A;  4X0R A;  1I4Z A;  1T6Q A;  5T1D B;  1J8Y F;  1YZC A;  2NG1 A;  3HNI A;  3DAG A;  3EJN A;  2GAQ A;  3ZDL A;  3O39 A;  4AE4 A;  4C3E A;  1KU2 A;  2NUP A;  3L1M A;  3AG1 C;  2R05 A;  4YT8 A;  2HSQ A;  1FFT C;  1KTM A;  2WZL A;  1I5N A;  1DOW A;  4YK5 A;  3T6B A;  4G7O F;  2VC9 A;  4JIO A;  1OR3 A;  1O5H A;  3T4R A;  1PD1 A;  4Z9H A;  4EBJ A;  4CSA A;  4Q5S F;  1OCR C;  3LLK A;  1YA7 O;  2V26 A;  3DAF A;  4MTF A;  3TOL A;  5B3I A;  1Z63 A;  1NLX A;  2YL3 A;  4W8K A;  1LE4 A;  5GPG B;  3S0X A;  5EGY A;  4A4A A;  256B A;  4PJM A;  3IHU A;  1Q0F A;  1ZHW A;  3FOP A;  3N2Z B;  4CDV A;  3T6G B;  3I5P A;  3MYF A;  1Z3I X;  2HV6 A;  4IAO A;  3DKA A;  1QKR A;  4XEF A;  3ABM C;  3DJU B;  3KKB A;  2ZXO A;  1OCC C;  1OW6 A;  1TFO B;  4LLE A;  3C8G D;  3JT1 A;  5KYW B;  4OD4 A;  5A69 A;  2LSE A;  2VCB A;  2FGY A;  4H54 A;  3JZ0 A;  4NTB A;  4H4K C;  4ULV A;  3VAY A;  1LPE A;  1A41 A;  3NRH A;  2R02 A;  5BQG A;  1EI7 A;  4BJ5 A;  4D4X A;  1V74 B;  1OCO C;  2HS5 A;  3QVY A;  1ZU4 A;  3EH1 A;  4N6C A;  4E17 A;  2HSB A;  2W4B A;  3AG3 C;  3LS1 A;  1OXK A;  2XLE A;  1E2X A;  3MX3 A;  1YAR O;  4FX5 A;  4NCQ A;  1YLM A;  4YT4 A;  5EHH A;  2OQM A;  3C8G A;  2CW0 F;  3GOD A;  2J9V A;  4W8P A;  2EIK C;  2ZPA A;  5CIV A;  2Y3H A;  2LP4 A;  2JPU A;  3Q7L A;  3SZR A;  4L6R A;  3R7C A;  3ZQV A;  2CCY A;  3M1C B;  2B0H A;  3JSZ A;  2KJG A;  3MFN A;  4Z9J A;  4MVO A;  1MMA A;  2EIM C;  4U5F E;  4G7H F;  5L3V A;  3FDQ A;  2YL7 A;  4J30 B;  2Q4F A;  4BJ1 A;  2J0X A;  1K04 A;  4JTD B;  4KNW A;  1WAS A;  3J06 A;  1MMN A;  1UG7 A;  1VTM P;  2YL0 A;  2YEV A;  5L0F A;  4P9F A;  2Q9C A;  3TOM A;  1M57 C;  2XXA A;  1ZZP A;  2KW3 C;  3CEX A;  1T9K A;  4OD5 A;  1GS9 A;  4K1O A;  4KC9 A;  4CIH A;  3ATP A;  1N1C A;  4CJO A;  1FMW A;  4JKV A;  5KYU A;  1E85 A;  1O3U A;  4HFK B;  4LAC B;  3SEO A;  3SXK A;  2MYS A;  1TWG A;  4I44 A;  1G4W R;  4XEK A;  2A68 F;  2MHR A;  3EHN A;  5L0I A;  3B0V C;  2R7Q A;  3RKO F;  1ZW3 A;  2QE9 A;  5E2Q A;  3OA1 A;  2R7O A;  1S7Z A;  2XLH A;  2HJ3 A;  4MVS A;  1DOV A;  1L7C A;  3ZIB A;  3RYL A;  3C63 A;  3EG9 B;  4WAB A;  5EK0 A;  1M2V A;  2XL8 A;  1CGN A;  4ER9 A;  1WWP A;  1HMO A;  1OQC A;  2YLD A;  4U9E A;  5L0J A;  4XEV A;  2HKV A;  3VYW A;  1MMG A;  4CJG A;  1VMA A;  2FAP B;  2PP4 A;  3H65 A;  3KL4 A;  4MS2 A;  1HE9 A;  1GQA A;  2A1D D;  4XTK A;  2WVN A;  3VF0 A;  5AC4 A;  3PMR A;  1VLS A;  2P1A A;  5K0I A;  3HTK C;  2G62 A;  1C03 A;  4PJN A;  4N6H A;  5CI9 A;  3VM6 A;  2EIJ C;  4DVZ A;  3QZC A;  1GGQ A;  3W2W A;  3KPH A;  3OEO A;  2CYD A;  4JTC B;  4YT2 A;  5BQH A;  1EQ1 A;  5E3A A;  1RKC A;  1LVK A;  4HFF B;  3AJM A;  2Q7R A;  1ZHT A;  1ZYR F;  3S27 A;  4BG0 A;  3UGO A;  3WAQ A;  1JPJ A;  2E87 A;  4J7Y A;  4FWV A;  1YZA A;  1ZHY A;  1M6T A;  3LES A;  4IGG A;  4NTA A;  4U5B E;  4IJJ A;  3O10 A;  4WGY A;  5HV9 A;  1BR2 A;  4U9D A;  1NFO A;  4IAR A;  2R7T A;  1F1M A;  2QTV A;  1TWC A;  2YHS A;  3B0U X;  3CAX A;  3W2V A;  1D1A A;  2C03 A;  4E7S A;  5FCL A;  2WZF A;  5KYY B;  3WOD F;  3V5X A;  4F4B A;  1R4T A;  3DM9 B;  4FAP B;  5E3C A;  4EIY A;  2GWW A;  3ASN C;  3T6J A;  1RXQ A;  3MBG A;  3JCU Q;  3AQB A;  3L8I A;  3LJB A;  2LD6 A;  1WAT A;  4PR9 A;  3U8V A;  2YZS A;  1HW1 A;  1BR1 A;  2ETS A;  4MVQ A;  1TQG A;  2L6H A;  2YLI A;  3ABL C;  2D4U A;  3LUT B;  3QW0 A;  2OJE D;  2P61 A;  2WZG A;  3LS0 A;  3N0T A;  1AUE A;  4MVM A;  2LQG A;  2XL4 A;  1W2W A;  4BEM J;  4DXW A;  1CPQ A;  2Q9B A;  5BUO A;  4QI2 A;  2H7V C;  1YDI A;  2XLM A;  3ABK C;  1H7I A;  2A6E F;  2A0U A;  2L6F A;  2WVO A;  1NFN A;  4JC7 A;  1D1B A;  3C7J A;  1ZVZ A;  4NC3 A;  3U8P A;  3I5Q A;  4OIQ F;  4E18 A;  4JUR I;  3TJ5 A;  3HKK A;  2VH3 A;  4G0H A;  5COM A;  2AWC A;  2OEX A;  4RBN A;  1CGO A;  4YL1 A;  3LNM B;  3GAN A;  1C02 A;  1SMY F;  3EFO B;  4XPW A;  3GEH A;  1D0X A;  5T3W A;  3U9M A;  3K66 A;  3U0C A;  4WGZ A;  2DYR C;  4XQ1 A;  3KMI A;  3ZVR A;  2X51 A;  4FES A;  4PJJ A;  2H8A A;  3HNK A;  3JTL O;  3G50 A;  4J7T A;  5KYX B;  4JE9 A;  1YAU O;  1K40 A;  3W8H A;  3Q6N A;  5B1B C;  1J8M F;  3BEH A;  1WN0 A;  5F5H A;  1Y6D A;  4IAQ A;  1YA9 A;  3F47 A;  2LFD A;  5L0H A;  3SXY A;  4CS7 A;  1MMD A;  2QLA A;  5JVE A;  3PDM P;  3U5S A;  4Z9I A;  5JUA A;  4JRZ A;  1V54 C;  3SNH A;  2LFF A;  1VYI A;  3KH2 A;  4M63 A;  2OU6 A;  3C8G B;  3DXJ F;  4OIP F;  1E83 A;  1LM3 B;  2W9Y A;  2G3V A;  1ZU5 A;  3RQG A;  1RCP A;  3L8J A;  1HY5 A;  2HMQ A;  2NPU A;  4YWQ A;  1QSP A;  2Q00 A;  2KGO A;  1JPN A;  3N24 A;  2QNL A;  2PNO A;  4CS9 A;  1RKE B;  4CX9 A;  5L0D A;  2Y3B A;  2YQY A;  2TMV P;  4PAC A;  1H6G A;  2GFH A;  3GM1 A;  4DBR A;  1NU7 D;  1NU9 C;  2CNW D;  5COF A;  2R7V A;  1V4A A;  2MWQ A;  2I8B A;  1NG1 A;  4AK9 A;  4MW8 A;  5JS5 A;  3FMS A;  1OKK D;  3ZC4 A;  1I4Y A;  2XSE A;  1XZP A;  2QY9 A;  2J0W A;  3GWL A;  5JT4 A;  3T9O A;  1HW2 A;  2BC5 A;  2IXN A;  1A7D A;  5COG A;  3TK0 A;  1ZHX A;  3RVZ A;  3RH3 A;  4OIN F;  2CNW A;  1BZ4 A;  2LK4 A;  4JVS A;  5FZT A;  4RDA A;  3UMI A;  4I1O B;  2ZXW C;  2XLW A;  1LKX A;  2R7U A;  4DRH B;  5KYU B;  3CSK A;  5D91 A;  2YKZ A;  2R9R B;  2EPO A;  4O6M A;  5KYW A;  3NDB B;  4N4W A;  1JRA A;  1D0Z A;  2YRF A;  2Z15 A;  1QLE C;  4YJW A;  2XL6 A;  4CS9 C;  3LAY A;  3TD7 A;  2VAS A;  1M2O A;  3VRC A;  2I15 A;  3JRM O;  4E0I A;  1M2V B;  2XLO A;  3I4U A;  3AGU A;  3GEI A;  1E86 A;  4I3M A;  4B6I A;  4KNV A;  2JX0 A;  4IRU A;  4CIP A;  1LI5 A;  1MQV A;  3RQF A;  5L0C A;  4QI0 A;  3B71 A;  1A0B A;  3QTH A;  2L9J A;  1LI7 A;  1BR4 A;  4GQH A;  1U6H A;  3SXZ A;  2M64 A;  1SZI A;  2XLD A;  3GOR A;  4LER A;  4EKW A;  5KYN A;  3M4C A;  3IQ5 A;  3U2L A;  3EGD A;  2L81 A;  2R03 A;  1T5O A;  3RIP A;  1FNT c;  2P6V A;  1RJ9 B;  1Z23 A;  1OW8 A;  2NSF A;  3R2P A; 
#chains in the Genus database with same CATH homology
 2L7A A;  3RF3 A;  1TR2 A;  3VF0 A;  5L0D A;  1SYQ A;  2IBF A;  1RKE B;  1XWJ A;  4K1O A;  3TJ6 A;  1H6G A;  4PR9 A;  3S90 A;  4EHP A;  4W8P A;  3H2V A;  3T6G B;  4P9T A;  2LQG A;  3H2U A;  1RKC A;  1RKE A;  5L0I A;  1ST6 A;  1T01 A;  1QKR A;  5L0H A;  1ZW3 A;  1U89 A;  1YDI A;  2B0H A;  4IGG A;  5L0C A;  3ZDL A;  1DOV A;  1L7C A;  1U6H A;  1ZVZ A;  2X0C A;  3MYI A;  2HSQ A;  4DJ9 A;  5FZT A;  4E18 A;  3TJ5 A;  1DOW A;  1ZW2 A;  5L0G A;  5L0J A;  4E17 A;  4ONS A;  2GDC A;  5L0F A;  2GWW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...