4DJ9A

Human vinculin head domain vh1 (residues 1-258) in complex with the talin vinculin binding site 50 (vbs50, residues 2078-2099)
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
251
structure length
242
Chain Sequence
VFHTRTIESILEPVAQQISHLVIMHEEGKAIPDLTAPVAAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTQGIEEALKNRNFTVEKMSAEINEIIRVLQLTSW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Vinculin
publication title Crystal structure of vinculin in complex with vinculin binding site 50 (VBS50), the integrin binding site 2 (IBS2) of talin.
pubmed doi rcsb
source organism Homo sapiens
total genus 103
structure length 242
sequence length 251
ec nomenclature
pdb deposition date 2012-02-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 4dj9A02
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 4dj9A01
1RKCA 1SYQA 5L0GA 5L0DA 1T01A 1QKRA 4E18A 3S90A 3RF3A 3VF0A 5L0HA 1DOWA 1L7CA 4IGGA 3T6GB 2IBFA 5L0IA 1U6HA 5L0CA 4W8PA 1ST6A 1ZW3A 2GDCA 1H6GA 1TR2A 1XWJA 3H2UA 4E17A 1U89A 5L0JA 2LQGA 3TJ6A 3MYIA 5L0FA 1DOVA 2HSQA 4P9TA 2L7AA 4K1OA 1RKEA 1YDIA 2B0HA 1ZVZA 3H2VA 5FZTA 2X0CA 3TJ5A 4DJ9A 1RKEB 4ONSA 4EHPA 3ZDLA 2GWWA 1ZW2A 4PR9A
chains in the Genus database with same CATH superfamily
1MMAA 2Q3TA 3I5QA 2IXOA 4JTAB 2DYRC 2XLMA 4OINF 3WODF 2Y39A 1ZHYA 4AE4B 2Q7RA 2EPKX 1BR2A 3DE8A 4XWJA 5KYWB 1Q0FA 4O6NA 1H9TA 1JOGA 2LD6A 1D1CA 4CJGA 2J7PA 1L3PA 3DZAA 3U8VA 4RDAA 1Q0GA 2ZXRA 5JRAA 3LNRA 3VRCA 3RQGA 3M15A 4CIPA 1OR3A 2NG1A 3GEIA 5FCLA 2UUIA 3GM1A 1C17M 1RKEB 5KYNA 4HE8D 5COMA 3UNGC 2Y3HA 3AQCA 3EGXA 3NYLA 4MTGA 3VYWA 3SZRA 3FXHA 4U5GA 3W8HA 3QW0A 4O6YA 2R02A 3ABLC 1T6QA 2A0UA 2J9UA 2QUPA 5AGFA 4IGGA 4N06A 2XS8A 4IARA 2WZGA 1MNEA 2NPUA 3EHNA 2NSFA 4WABA 1YLMA 5AC4A 1YA9A 3PDMP 2DB4A 3KYIA 3CEXA 4H54A 2EIKC 3C8GD 3RVYA 2A69F 4JKVA 2H7VC 1SR2A 2LQGA 4CDVA 4FESA 2PF4E 3IQCA 4EBJA 1O5HA 2A6EF 2HSQA 2L7AA 4LLCA 4OD4A 1HE1A 1SMYF 2P61A 2WVQA 4DJ9A 5DS4A 3DJUB 4OD5A 2F22A 4G7OF 5JSLA 3EJNA 4JEBA 2B0JA 3K6BA 4PJNA 4JJFA 4FAPB 2PBEA 2BL2A 1V54C 3K66A 4O7GA 1TQGA 3RYLA 2CDQA 4BEMJ 2XXAB 3U0CA 1C03A 2CNWD 2XSEA 1VYIA 3A11A 1QKRA 4CS8A 3DD7A 1RJ9B 1G4US 2DYSC 4G78A 4XPYA 2OU6A 5L0HA 3K7DA 3NRHA 2J9BA 4W8KA 5L0IA 1JRAA 3US6A 2LCHA 4DVYP 3IHUA 2HV6A 2R7TA 1OCOC 4MW3A 1FFTC 5D92A 2VC9A 2WB7A 4FX5A 4PJMA 1BZ4A 1TR2A 3SXZA 1LS1A 1YZCA 1Z3IX 1BDJB 1FMVA 4Z9HA 4F4BA 4LLEA 4K1OA 5CIVA 4HFFB 2H7BA 3LS0A 3TJ5A 5HSWA 4XTKA 2W4MA 3S9OA 2AU5A 4C7OA 1VTMP 3UGPA 4MS2A 3QZCA 1A41A 4D4XA 5TJ5E 1HY5A 1LI5A 2RD9A 3T6BA 1WGWA 1V4AA 1AVOB 2I15A 3M1CB 4HFKB 1OW7A 4I1MA 3TULA 1K05A 4AE4A 4MVZA 1KNYA 3ASOC 1YA7O 3VF0A 2DI3A 2QY9A 5A6BD 1ZU5A 3B71A 4ER9A 5JUAA 2JD3A 2L6FA 2Y3GA 3IEEA 4KI2A 1V55C 3V5YA 1D0XA 2J8WA 1FFHA 3MX3A 1LI7A 2BC5A 3BRJA 3JSZA 1YZAA 3C8ZA 4DRHB 3HLZA 3S84A 4XEVA 1ST6A 4E0IA 3QW1A 1RMVA 2VH3A 4JTDB 5E2QA 3DI5A 5L0JA 4E17A 2Z15A 2FFHA 1K04A 5L0FA 4JCHA 2NUPB 5A6BA 1RKEA 1YDIA 2XL8A 1Q0KA 3H2VA 4AX2A 2JX0A 4KNWA 4PK4A 1A0BA 1LKXA 3T6JA 4UDVA 4IJJA 2Y3DA 1ZHWA 4NY3A 2P1AA 4YN0B 3EFOB 1QVXA 1MMDA 3LJBA 3ITFA 4IRUA 3C63A 3V7OA 4YT8A 2KC3A 2LFFA 4JVSA 1BR4A 4XEKA 2ETSA 3OEOA 4YL0A 2IM8A 4PACA 4L6RA 3WHNA 3DM5A 5A69A 4QI0A 5BQHA 4E18A 4MVQA 1I4ZA 3L8JA 3V5ZA 5B1BC 5CI9A 1ZZPA 1ZHXA 3FAPB 4U5EE 2P0NA 4NC3A 3Q6NA 2XL4A 1I4YA 2YRFA 4YJWA 1LM3B 4XEFA 3RH3A 2KK1A 1ZYRF 4DBQA 3C62A 3O39A 2LFDA 3AG1C 2IYLD 1CPQA 1U89A 1RCPA 3MLGA 4ULVA 2HKVA 2J45A 3S0XA 2R7SA 3DMDA 3IQTA 1CPRA 1A7EA 1CGOA 4XLNF 3OA1A 3ZDLA 2HS5A 4CX9A 4RBNA 1GQAA 2HMQA 4PR9A 2XXAA 3ZTMA 2VB6A 1HW2A 2Q9CA 1LVKA 3DAFA 3AG2C 4DXWA 3IQ6A 3O10A 1RJ9A 2J7PD 1Q0DA 5L0DA 3CZ6A 2WVOA 2YEVA 5JP7A 2A0BA 2GFHA 1LE2A 4PJLA 4ANJA 3EPVA 4G0HA 5T1DB 2Q9AA 5B3SC 3R7CA 3ABMC 4XLPF 2LP4A 3JT1A 4MVOA 3POVA 1D0ZA 5COGA 3U3FA 1E2XA 5B1AC 2A6HF 4CS9A 2EPLX 1YJGA 2AVKA 2XLEA 4JEAA 4J7YA 5F28E 5DQTA 4EUKB 2XLDA 4I44A 4N4WA 3NMKA 2OEXA 4B6IA 2A68F 2L81A 3N24A 2EIMC 2ZXWC 3HTKC 4DBRA 4Q5SF 2P6VA 1IW7F 3DE9A 4E7SA 1SZIA 3EGDB 4N6HA 3K1IC 2V3CC 2GWWA 2YWAA 4U9DA 4X0RA 3DKAA 1H9GA 3CQZA 5JVEA 2QNLA 2R7OA 3LEVA 2ZXOA 3DWWA 4I3MA 4WJ0A 3ZVRA 2AWYA 3EZHA 4JZAA 1D0YA 2QTVA 3KPHA 3O6XA 3KYJA 1XZPA 2R9RB 4Z9IA 2HFIA 2VCBA 2ICWG 4AL1A 4U5HA 4MVUA 5A6AA 4N6CA 3W8IA 5F5FA 2ZPAA 1G5ZA 3AQBA 3E9VA 2QE9A 3JRMO 2OKUA 4I1OB 4PFPA 1MMGA 4WGYA 3FOOA 5E33A 5L3QA 5IY5C 2R05A 2MWQA 2YL3A 2YLGA 5GPGB 4QDLA 3UR3C 1RXQA 1G8XA 3OWTA 4YWQA 3NDBB 2KJGA 2NUPA 3K1HA 2J0WA 3ZG1A 3L8IA 3C7JA 1M6TA 1TFKB 2R25A 3Q7LA 1JPNA 3JCUQ 3J06A 1D1AA 4NCQA 3G4ZA 5DQZA 4EBKA 1TWAA 3RVZA 1QQ3A 3E70C 3EFOA 4MNDA 4YK5A 2EPNA 4EBBA 3W4YA 3HNKA 3NMIA 3KKBA 3O55A 4BPMA 1E85A 2YQYA 1OKKD 256BA 1EI7A 4G7ZF 2VCCA 3GORA 1H7IA 2KW3C 3M4BA 4R32A 3TOMA 4EWCA 3IPMO 3B29A 1OW8A 3HKKA 4LERA 1L7CA 3LNMB 3T6GB 5KYXB 2VASA 1HMOA 1O3UA 3U5SA 3F47A 4DRIB 4M63A 3K33A 4CSAC 1NBBA 5T3WA 4YT5A 5L0CA 1VOMA 3ZIBA 2R7RA 1Z23A 1OKKA 2PFDA 4ZLCA 1XWJA 2J9VA 4HEAJ 4KC9A 1HE9A 5BUOA 3MYIA 4GQHA 1NSGB 2CW0F 1J8YF 4K7BA 4MTFA 2J46A 1B68A 4RD9A 4NTAA 2YL1A 2V26A 4ONSA 1OQCA 2BE5F 3JSEO 1NZEA 2LIGA 2NUTB 2PX0A 4H4KC 2YVKA 3B0PA 3ZSUA 2KNHA 3A9CA 2CYDA 3HJCA 3X1OA 1BBHA 1G4WR 2C04A 2OJQA 3FMSA 3RQFA 3VM6A 3ZC4A 1E83A 2WVNA 2M64A 3NKEA 1LS4A 2HMZA 4JJGA 3W2WA 4CBEA 2OQMA 4YL3A 5KYYB 4BJ5C 3X2QC 1YYJA 4JURI 1U6HA 2G3KA 3DXJF 1WWPA 2R7QA 4C7OB 2Y3BA 5JLIA 4Q7CA 1NFNA 4CDAA 2XLOA 5CI8A 1FAPB 1SF8A 5JT4A 3F46A 1T6IA 2C03A 1S7ZA 2XLWA 1QSPA 4YT4A 2LK4A 1E84A 1YYXA 3EGDA 2XS1A 2XLHA 2YL0A 1WATA 2AWCA 3TD7A 4JW1A 2IXMA 5KYWA 2EIJC 1BR1A 4EIYA 4CJOA 3FDQA 5L0GA 3B0UX 1N1CA 3ASNC 1WASA 3HNLA 1EA8A 5DS5A 3G4XA 1C02A 3GM3A 4QI2A 1Z7Qc 1MNDA 5DLJA 3IQ5A 4XQ1A 3QVZA 1DOWA 4AL0A 2G3VA 3S90A 3ZQYA 2OOCA 2XL6A 3Q7GA 4NTBA 4D4NA 4Q4ZF 1O87A 1JPJA 1M57C 2WZFA 3AGTA 3M4CA 3NMJA 4JCZA 3TK0A 1OCZC 1ZW3A 1V74B 2H8AA 2GDCA 4GYTA 4IAOA 3S27A 3N2ZB 3FHDA 3ECSA 3PHF2 4EKWA 3JZ0A 2R7UA 3WG7C 1Q0MA 2HZ8A 5KYUB 4BJ1A 3UGOA 4XPWA 2ZXPA 4C3DA 1ORSC 4IAQA 4U5DE 2Q9BA 4CS7A 2TMVP 3RQEA 1LPEA 2XM4A 4CDYA 1UFBA 3C8GB 3EH2A 4OIPF 5EHHA 1PD0A 4G7HF 1KU2A 1TWGA 4LDQA 5JS5A 1NFOA 4LACB 5KYXA 1T6UA 2R7WA 2L6HA 3BEHA 3GM2A 4MVSA 1APCA 2IBFA 4WGZA 1JAFA 2HUJA 2W4BA 2OJED 1R5ID 5E3AA 3L34A 4ULWA 2GA0A 1S05A 2EPOA 3DAGA 3N0TA 1NU9C 4YL1A 4K0DA 4E0HA 1H6GA 1KTMA 2GAQA 5T3TA 2JPUA 4ZLDA 3FOPA 3SEOA 4OIQF 2O9XA 4E7ZA 3PCVA 2ZD9A 4CSAA 2Q4FA 5FZTA 3GEEA 2NUTA 3T4RA 3MBGA 3T9OA 1D1BA 4PJJA 3NYMA 1SYQA 2WL8A 3R2PA 5E3CA 5KYYA 3EZIA 3GODA 4DOZA 4J32B 5F5HA 3H65A 3B0VC 2OCCC 2AP3A 3GWLA 1MMNA 2M4EA 1VB5A 1VMAA 1WN0A 4YT2A 4FWVA 3RIPA 1M2VB 3JTLO 5EGYA 2FAPB 4OIRF 3FVYA 3AGUA 5DVWA 1FMWA 2CGEA 5AC5A 3LUTB 1JR8A 1PD1A 3GWNA 1U0BB 2DGJA 2YLDA 2PP4A 3LLIA 2KQ9A 4JRZA 3HNIA 4BJ6C 1YAUO 1I5NA 4J30B 1OXKA 3LAYA 3U9JA 4BJ5A 4CIHA 5K0IA 2D4UA 3GEHA 1GGQA 3MFNA 2FGYA 2XRHA 2PNOA 1VLSA 2B0HA 4LDRA 1QPUA 3AG3C 2R7XA 1K40A 1OR2A 5BQGA 3SXKA 3EG9B 3UMIA 1JMWA 3LLKA 3U2LA 4JE9A 3RKOF 4KNVA 1QZXA 1OCCC 1Y4CA 2A1DD 5D91A 2NSGA 3G50A 1ZU4A 4NQFA 1AUEA 3HNJA 4OIOF 4A4AA 1AEPA 4C3BA 2EINC 1PCXA 1WOLA 2IOQA 1TWHA 1GS9A 3LEOA 4Z9JA 2MHRA 2HJMA 3RFYA 3LESA 5KYUA 1T5OA 3JRTA 1WTYA 2X51A 2ASRA 4BEJA 1Y6DA 1XZQA 3CAXA 2WZLA 4MTOA 1NLXA 1VK5A 4GEHA 5EK0A 3C8GA 3KH2A 2YLIA 3AJMA 3DM9B 4U9EA 3ZWIA 1ZHZA 4MQ9F 1M56C 4CS9C 3WAQA 2Y69C 1J8MF 2R7VA 3SYNA 1HW1A 4BJTA 4IWBA 1GM5A 1FTSA 3AG4C 1UG7A 4MVRA 3NG1A 3SXMA 1HMDA 5HV9A 2KYHA 3ABKC 1VYKA 2L9JA 3CSKA 5BQIA 1MQVA 1QLEC 1TKNA 2CNWA 5DS6A 4JIOA 4AK9A 1A7DA 1A7VA 3M79A 1DOVA 2VCAA 2X0CA 1ZVZA 2J0XA 1OXBA 1YVIA 1ORJA 1T9KA 2G62A 2HSBA 2W45A 3EH1A 3NYJA 1ORYA 1IZMA 1T01A 1ZW2A 2W9YA 3FAJA 1Z5ZA 1CGME 1R4TA 1OCRC 3EGXB 1W2WA 2QLAA 3B9QA 1TFOB 1OW6A 2HJ3A 2UUHA 2PX3A 5COFA 4P9FA 1M2VA 2LSEA 1NU7D 3EQLF 1EQ1A 1FNTc 3K1IA 1EKYA 1E86A 4O6MA 4MVMA 2MYSA 2H7OA 3QTHA 1TWCA 4XPXA 3GANA 2OG2A 3MYFA 3KL4A 5L3VA 4JC7A 4W8PA 4IB4A 4U5CE 2EPMX 3VAYA 2XLVA 2YKZA 2HV7A 4JTCB 3W2VA 2OEVA 2D5RB 4U5FE 3I5PA 2EILC 2P7VA 4U5BE 4KBLA 3AOUA 1Z6AA 2I8BA 4BG0A 3U3BA 4CS8C 3I4UA 2YL7A 4J7TA 4EHPA 1NG1A 4PFOA 1CGNA 3PMRA 2YHSA 1PV3A 1VLTA 2YZSA 2RSEB 3EG9A 3TQOA 4BJ6A 3RW0A 1RKCA 3KMIA 2L6GA 2E87A 5A6KA 2IXNA 1LE4A 4C3EA 1Z63A 2IXPA 3TOLA 3S29A 4DRJB 3RF3A 2XM0A 3JYHA 3S28A 3UMKA 3QVYA 3SP1A 3ZQVA 1ZHTA 3SXYA 3DJNB 3U9MA 1M2OA 1YARO 3C18A 4O79A 3NKDA 1FR0A 2KSFA 3EHMA 3UMHA 5A6JA 4MW8A 1F1MA 3ATPA 3H2UA 2J9WA 3U8PA 3V5XA 3TJ6A 3ZTZA 2R03A 4P9TA 2CCYA 3L1MA 1LIHA 4LDKA 2KGOA 3QMKA 3U2MA 3L0IA 3Q6MA 2Q00A 5B3IA 4A2NB 3JYYA 4DVZA 4NTFA 3SNHA 4P6IC 3LS1A
chains in the Genus database with same CATH topology
1RKCA 1SYQA 5L0GA 5L0DA 1T01A 1QKRA 4E18A 3S90A 3RF3A 3VF0A 5L0HA 1DOWA 1L7CA 4IGGA 3T6GB 2IBFA 5L0IA 1U6HA 5L0CA 4W8PA 1ST6A 1ZW3A 2GDCA 1H6GA 1TR2A 1XWJA 3H2UA 4E17A 1U89A 5L0JA 2LQGA 3TJ6A 3MYIA 5L0FA 1DOVA 2HSQA 4P9TA 2L7AA 4K1OA 1RKEA 1YDIA 2B0HA 1ZVZA 3H2VA 5FZTA 2X0CA 3TJ5A 4DJ9A 1RKEB 4ONSA 4EHPA 3ZDLA 2GWWA 1ZW2A 4PR9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RKC A;  1SYQ A;  5L0G A;  5L0D A;  1T01 A;  1QKR A;  4E18 A;  3S90 A;  3RF3 A;  3VF0 A;  5L0H A;  1DOW A;  1L7C A;  4IGG A;  3T6G B;  2IBF A;  5L0I A;  1U6H A;  5L0C A;  4W8P A;  1ST6 A;  1ZW3 A;  2GDC A;  1H6G A;  1TR2 A;  1XWJ A;  3H2U A;  4E17 A;  1U89 A;  5L0J A;  2LQG A;  3TJ6 A;  3MYI A;  5L0F A;  1DOV A;  2HSQ A;  4P9T A;  2L7A A;  4K1O A;  1RKE A;  1YDI A;  2B0H A;  1ZVZ A;  3H2V A;  5FZT A;  2X0C A;  3TJ5 A;  4DJ9 A;  1RKE B;  4ONS A;  4EHP A;  3ZDL A;  2GWW A;  1ZW2 A;  4PR9 A; 
#chains in the Genus database with same CATH topology
 1MMA A;  2Q3T A;  3I5Q A;  2IXO A;  4JTA B;  2DYR C;  2XLM A;  4OIN F;  3WOD F;  2Y39 A;  1ZHY A;  4AE4 B;  2Q7R A;  2EPK X;  1BR2 A;  3DE8 A;  4XWJ A;  5KYW B;  1Q0F A;  4O6N A;  1H9T A;  1JOG A;  2LD6 A;  1D1C A;  4CJG A;  2J7P A;  1L3P A;  3DZA A;  3U8V A;  4RDA A;  1Q0G A;  2ZXR A;  5JRA A;  3LNR A;  3VRC A;  3RQG A;  3M15 A;  4CIP A;  1OR3 A;  2NG1 A;  3GEI A;  5FCL A;  2UUI A;  3GM1 A;  1C17 M;  1RKE B;  5KYN A;  4HE8 D;  5COM A;  3UNG C;  2Y3H A;  3AQC A;  3EGX A;  3NYL A;  4MTG A;  3VYW A;  3SZR A;  3FXH A;  4U5G A;  3W8H A;  3QW0 A;  4O6Y A;  2R02 A;  3ABL C;  1T6Q A;  2A0U A;  2J9U A;  2QUP A;  5AGF A;  4IGG A;  4N06 A;  2XS8 A;  4IAR A;  2WZG A;  1MNE A;  2NPU A;  3EHN A;  2NSF A;  4WAB A;  1YLM A;  5AC4 A;  1YA9 A;  3PDM P;  2DB4 A;  3KYI A;  3CEX A;  4H54 A;  2EIK C;  3C8G D;  3RVY A;  2A69 F;  4JKV A;  2H7V C;  1SR2 A;  2LQG A;  4CDV A;  4FES A;  2PF4 E;  3IQC A;  4EBJ A;  1O5H A;  2A6E F;  2HSQ A;  2L7A A;  4LLC A;  4OD4 A;  1HE1 A;  1SMY F;  2P61 A;  2WVQ A;  4DJ9 A;  5DS4 A;  3DJU B;  4OD5 A;  2F22 A;  4G7O F;  5JSL A;  3EJN A;  4JEB A;  2B0J A;  3K6B A;  4PJN A;  4JJF A;  4FAP B;  2PBE A;  2BL2 A;  1V54 C;  3K66 A;  4O7G A;  1TQG A;  3RYL A;  2CDQ A;  4BEM J;  2XXA B;  3U0C A;  1C03 A;  2CNW D;  2XSE A;  1VYI A;  3A11 A;  1QKR A;  4CS8 A;  3DD7 A;  1RJ9 B;  1G4U S;  2DYS C;  4G78 A;  4XPY A;  2OU6 A;  5L0H A;  3K7D A;  3NRH A;  2J9B A;  4W8K A;  5L0I A;  1JRA A;  3US6 A;  2LCH A;  4DVY P;  3IHU A;  2HV6 A;  2R7T A;  1OCO C;  4MW3 A;  1FFT C;  5D92 A;  2VC9 A;  2WB7 A;  4FX5 A;  4PJM A;  1BZ4 A;  1TR2 A;  3SXZ A;  1LS1 A;  1YZC A;  1Z3I X;  1BDJ B;  1FMV A;  4Z9H A;  4F4B A;  4LLE A;  4K1O A;  5CIV A;  4HFF B;  2H7B A;  3LS0 A;  3TJ5 A;  5HSW A;  4XTK A;  2W4M A;  3S9O A;  2AU5 A;  4C7O A;  1VTM P;  3UGP A;  4MS2 A;  3QZC A;  1A41 A;  4D4X A;  5TJ5 E;  1HY5 A;  1LI5 A;  2RD9 A;  3T6B A;  1WGW A;  1V4A A;  1AVO B;  2I15 A;  3M1C B;  4HFK B;  1OW7 A;  4I1M A;  3TUL A;  1K05 A;  4AE4 A;  4MVZ A;  1KNY A;  3ASO C;  1YA7 O;  3VF0 A;  2DI3 A;  2QY9 A;  5A6B D;  1ZU5 A;  3B71 A;  4ER9 A;  5JUA A;  2JD3 A;  2L6F A;  2Y3G A;  3IEE A;  4KI2 A;  1V55 C;  3V5Y A;  1D0X A;  2J8W A;  1FFH A;  3MX3 A;  1LI7 A;  2BC5 A;  3BRJ A;  3JSZ A;  1YZA A;  3C8Z A;  4DRH B;  3HLZ A;  3S84 A;  4XEV A;  1ST6 A;  4E0I A;  3QW1 A;  1RMV A;  2VH3 A;  4JTD B;  5E2Q A;  3DI5 A;  5L0J A;  4E17 A;  2Z15 A;  2FFH A;  1K04 A;  5L0F A;  4JCH A;  2NUP B;  5A6B A;  1RKE A;  1YDI A;  2XL8 A;  1Q0K A;  3H2V A;  4AX2 A;  2JX0 A;  4KNW A;  4PK4 A;  1A0B A;  1LKX A;  3T6J A;  4UDV A;  4IJJ A;  2Y3D A;  1ZHW A;  4NY3 A;  2P1A A;  4YN0 B;  3EFO B;  1QVX A;  1MMD A;  3LJB A;  3ITF A;  4IRU A;  3C63 A;  3V7O A;  4YT8 A;  2KC3 A;  2LFF A;  4JVS A;  1BR4 A;  4XEK A;  2ETS A;  3OEO A;  4YL0 A;  2IM8 A;  4PAC A;  4L6R A;  3WHN A;  3DM5 A;  5A69 A;  4QI0 A;  5BQH A;  4E18 A;  4MVQ A;  1I4Z A;  3L8J A;  3V5Z A;  5B1B C;  5CI9 A;  1ZZP A;  1ZHX A;  3FAP B;  4U5E E;  2P0N A;  4NC3 A;  3Q6N A;  2XL4 A;  1I4Y A;  2YRF A;  4YJW A;  1LM3 B;  4XEF A;  3RH3 A;  2KK1 A;  1ZYR F;  4DBQ A;  3C62 A;  3O39 A;  2LFD A;  3AG1 C;  2IYL D;  1CPQ A;  1U89 A;  1RCP A;  3MLG A;  4ULV A;  2HKV A;  2J45 A;  3S0X A;  2R7S A;  3DMD A;  3IQT A;  1CPR A;  1A7E A;  1CGO A;  4XLN F;  3OA1 A;  3ZDL A;  2HS5 A;  4CX9 A;  4RBN A;  1GQA A;  2HMQ A;  4PR9 A;  2XXA A;  3ZTM A;  2VB6 A;  1HW2 A;  2Q9C A;  1LVK A;  3DAF A;  3AG2 C;  4DXW A;  3IQ6 A;  3O10 A;  1RJ9 A;  2J7P D;  1Q0D A;  5L0D A;  3CZ6 A;  2WVO A;  2YEV A;  5JP7 A;  2A0B A;  2GFH A;  1LE2 A;  4PJL A;  4ANJ A;  3EPV A;  4G0H A;  5T1D B;  2Q9A A;  5B3S C;  3R7C A;  3ABM C;  4XLP F;  2LP4 A;  3JT1 A;  4MVO A;  3POV A;  1D0Z A;  5COG A;  3U3F A;  1E2X A;  5B1A C;  2A6H F;  4CS9 A;  2EPL X;  1YJG A;  2AVK A;  2XLE A;  4JEA A;  4J7Y A;  5F28 E;  5DQT A;  4EUK B;  2XLD A;  4I44 A;  4N4W A;  3NMK A;  2OEX A;  4B6I A;  2A68 F;  2L81 A;  3N24 A;  2EIM C;  2ZXW C;  3HTK C;  4DBR A;  4Q5S F;  2P6V A;  1IW7 F;  3DE9 A;  4E7S A;  1SZI A;  3EGD B;  4N6H A;  3K1I C;  2V3C C;  2GWW A;  2YWA A;  4U9D A;  4X0R A;  3DKA A;  1H9G A;  3CQZ A;  5JVE A;  2QNL A;  2R7O A;  3LEV A;  2ZXO A;  3DWW A;  4I3M A;  4WJ0 A;  3ZVR A;  2AWY A;  3EZH A;  4JZA A;  1D0Y A;  2QTV A;  3KPH A;  3O6X A;  3KYJ A;  1XZP A;  2R9R B;  4Z9I A;  2HFI A;  2VCB A;  2ICW G;  4AL1 A;  4U5H A;  4MVU A;  5A6A A;  4N6C A;  3W8I A;  5F5F A;  2ZPA A;  1G5Z A;  3AQB A;  3E9V A;  2QE9 A;  3JRM O;  2OKU A;  4I1O B;  4PFP A;  1MMG A;  4WGY A;  3FOO A;  5E33 A;  5L3Q A;  5IY5 C;  2R05 A;  2MWQ A;  2YL3 A;  2YLG A;  5GPG B;  4QDL A;  3UR3 C;  1RXQ A;  1G8X A;  3OWT A;  4YWQ A;  3NDB B;  2KJG A;  2NUP A;  3K1H A;  2J0W A;  3ZG1 A;  3L8I A;  3C7J A;  1M6T A;  1TFK B;  2R25 A;  3Q7L A;  1JPN A;  3JCU Q;  3J06 A;  1D1A A;  4NCQ A;  3G4Z A;  5DQZ A;  4EBK A;  1TWA A;  3RVZ A;  1QQ3 A;  3E70 C;  3EFO A;  4MND A;  4YK5 A;  2EPN A;  4EBB A;  3W4Y A;  3HNK A;  3NMI A;  3KKB A;  3O55 A;  4BPM A;  1E85 A;  2YQY A;  1OKK D;  256B A;  1EI7 A;  4G7Z F;  2VCC A;  3GOR A;  1H7I A;  2KW3 C;  3M4B A;  4R32 A;  3TOM A;  4EWC A;  3IPM O;  3B29 A;  1OW8 A;  3HKK A;  4LER A;  1L7C A;  3LNM B;  3T6G B;  5KYX B;  2VAS A;  1HMO A;  1O3U A;  3U5S A;  3F47 A;  4DRI B;  4M63 A;  3K33 A;  4CSA C;  1NBB A;  5T3W A;  4YT5 A;  5L0C A;  1VOM A;  3ZIB A;  2R7R A;  1Z23 A;  1OKK A;  2PFD A;  4ZLC A;  1XWJ A;  2J9V A;  4HEA J;  4KC9 A;  1HE9 A;  5BUO A;  3MYI A;  4GQH A;  1NSG B;  2CW0 F;  1J8Y F;  4K7B A;  4MTF A;  2J46 A;  1B68 A;  4RD9 A;  4NTA A;  2YL1 A;  2V26 A;  4ONS A;  1OQC A;  2BE5 F;  3JSE O;  1NZE A;  2LIG A;  2NUT B;  2PX0 A;  4H4K C;  2YVK A;  3B0P A;  3ZSU A;  2KNH A;  3A9C A;  2CYD A;  3HJC A;  3X1O A;  1BBH A;  1G4W R;  2C04 A;  2OJQ A;  3FMS A;  3RQF A;  3VM6 A;  3ZC4 A;  1E83 A;  2WVN A;  2M64 A;  3NKE A;  1LS4 A;  2HMZ A;  4JJG A;  3W2W A;  4CBE A;  2OQM A;  4YL3 A;  5KYY B;  4BJ5 C;  3X2Q C;  1YYJ A;  4JUR I;  1U6H A;  2G3K A;  3DXJ F;  1WWP A;  2R7Q A;  4C7O B;  2Y3B A;  5JLI A;  4Q7C A;  1NFN A;  4CDA A;  2XLO A;  5CI8 A;  1FAP B;  1SF8 A;  5JT4 A;  3F46 A;  1T6I A;  2C03 A;  1S7Z A;  2XLW A;  1QSP A;  4YT4 A;  2LK4 A;  1E84 A;  1YYX A;  3EGD A;  2XS1 A;  2XLH A;  2YL0 A;  1WAT A;  2AWC A;  3TD7 A;  4JW1 A;  2IXM A;  5KYW A;  2EIJ C;  1BR1 A;  4EIY A;  4CJO A;  3FDQ A;  5L0G A;  3B0U X;  1N1C A;  3ASN C;  1WAS A;  3HNL A;  1EA8 A;  5DS5 A;  3G4X A;  1C02 A;  3GM3 A;  4QI2 A;  1Z7Q c;  1MND A;  5DLJ A;  3IQ5 A;  4XQ1 A;  3QVZ A;  1DOW A;  4AL0 A;  2G3V A;  3S90 A;  3ZQY A;  2OOC A;  2XL6 A;  3Q7G A;  4NTB A;  4D4N A;  4Q4Z F;  1O87 A;  1JPJ A;  1M57 C;  2WZF A;  3AGT A;  3M4C A;  3NMJ A;  4JCZ A;  3TK0 A;  1OCZ C;  1ZW3 A;  1V74 B;  2H8A A;  2GDC A;  4GYT A;  4IAO A;  3S27 A;  3N2Z B;  3FHD A;  3ECS A;  3PHF 2;  4EKW A;  3JZ0 A;  2R7U A;  3WG7 C;  1Q0M A;  2HZ8 A;  5KYU B;  4BJ1 A;  3UGO A;  4XPW A;  2ZXP A;  4C3D A;  1ORS C;  4IAQ A;  4U5D E;  2Q9B A;  4CS7 A;  2TMV P;  3RQE A;  1LPE A;  2XM4 A;  4CDY A;  1UFB A;  3C8G B;  3EH2 A;  4OIP F;  5EHH A;  1PD0 A;  4G7H F;  1KU2 A;  1TWG A;  4LDQ A;  5JS5 A;  1NFO A;  4LAC B;  5KYX A;  1T6U A;  2R7W A;  2L6H A;  3BEH A;  3GM2 A;  4MVS A;  1APC A;  2IBF A;  4WGZ A;  1JAF A;  2HUJ A;  2W4B A;  2OJE D;  1R5I D;  5E3A A;  3L34 A;  4ULW A;  2GA0 A;  1S05 A;  2EPO A;  3DAG A;  3N0T A;  1NU9 C;  4YL1 A;  4K0D A;  4E0H A;  1H6G A;  1KTM A;  2GAQ A;  5T3T A;  2JPU A;  4ZLD A;  3FOP A;  3SEO A;  4OIQ F;  2O9X A;  4E7Z A;  3PCV A;  2ZD9 A;  4CSA A;  2Q4F A;  5FZT A;  3GEE A;  2NUT A;  3T4R A;  3MBG A;  3T9O A;  1D1B A;  4PJJ A;  3NYM A;  1SYQ A;  2WL8 A;  3R2P A;  5E3C A;  5KYY A;  3EZI A;  3GOD A;  4DOZ A;  4J32 B;  5F5H A;  3H65 A;  3B0V C;  2OCC C;  2AP3 A;  3GWL A;  1MMN A;  2M4E A;  1VB5 A;  1VMA A;  1WN0 A;  4YT2 A;  4FWV A;  3RIP A;  1M2V B;  3JTL O;  5EGY A;  2FAP B;  4OIR F;  3FVY A;  3AGU A;  5DVW A;  1FMW A;  2CGE A;  5AC5 A;  3LUT B;  1JR8 A;  1PD1 A;  3GWN A;  1U0B B;  2DGJ A;  2YLD A;  2PP4 A;  3LLI A;  2KQ9 A;  4JRZ A;  3HNI A;  4BJ6 C;  1YAU O;  1I5N A;  4J30 B;  1OXK A;  3LAY A;  3U9J A;  4BJ5 A;  4CIH A;  5K0I A;  2D4U A;  3GEH A;  1GGQ A;  3MFN A;  2FGY A;  2XRH A;  2PNO A;  1VLS A;  2B0H A;  4LDR A;  1QPU A;  3AG3 C;  2R7X A;  1K40 A;  1OR2 A;  5BQG A;  3SXK A;  3EG9 B;  3UMI A;  1JMW A;  3LLK A;  3U2L A;  4JE9 A;  3RKO F;  4KNV A;  1QZX A;  1OCC C;  1Y4C A;  2A1D D;  5D91 A;  2NSG A;  3G50 A;  1ZU4 A;  4NQF A;  1AUE A;  3HNJ A;  4OIO F;  4A4A A;  1AEP A;  4C3B A;  2EIN C;  1PCX A;  1WOL A;  2IOQ A;  1TWH A;  1GS9 A;  3LEO A;  4Z9J A;  2MHR A;  2HJM A;  3RFY A;  3LES A;  5KYU A;  1T5O A;  3JRT A;  1WTY A;  2X51 A;  2ASR A;  4BEJ A;  1Y6D A;  1XZQ A;  3CAX A;  2WZL A;  4MTO A;  1NLX A;  1VK5 A;  4GEH A;  5EK0 A;  3C8G A;  3KH2 A;  2YLI A;  3AJM A;  3DM9 B;  4U9E A;  3ZWI A;  1ZHZ A;  4MQ9 F;  1M56 C;  4CS9 C;  3WAQ A;  2Y69 C;  1J8M F;  2R7V A;  3SYN A;  1HW1 A;  4BJT A;  4IWB A;  1GM5 A;  1FTS A;  3AG4 C;  1UG7 A;  4MVR A;  3NG1 A;  3SXM A;  1HMD A;  5HV9 A;  2KYH A;  3ABK C;  1VYK A;  2L9J A;  3CSK A;  5BQI A;  1MQV A;  1QLE C;  1TKN A;  2CNW A;  5DS6 A;  4JIO A;  4AK9 A;  1A7D A;  1A7V A;  3M79 A;  1DOV A;  2VCA A;  2X0C A;  1ZVZ A;  2J0X A;  1OXB A;  1YVI A;  1ORJ A;  1T9K A;  2G62 A;  2HSB A;  2W45 A;  3EH1 A;  3NYJ A;  1ORY A;  1IZM A;  1T01 A;  1ZW2 A;  2W9Y A;  3FAJ A;  1Z5Z A;  1CGM E;  1R4T A;  1OCR C;  3EGX B;  1W2W A;  2QLA A;  3B9Q A;  1TFO B;  1OW6 A;  2HJ3 A;  2UUH A;  2PX3 A;  5COF A;  4P9F A;  1M2V A;  2LSE A;  1NU7 D;  3EQL F;  1EQ1 A;  1FNT c;  3K1I A;  1EKY A;  1E86 A;  4O6M A;  4MVM A;  2MYS A;  2H7O A;  3QTH A;  1TWC A;  4XPX A;  3GAN A;  2OG2 A;  3MYF A;  3KL4 A;  5L3V A;  4JC7 A;  4W8P A;  4IB4 A;  4U5C E;  2EPM X;  3VAY A;  2XLV A;  2YKZ A;  2HV7 A;  4JTC B;  3W2V A;  2OEV A;  2D5R B;  4U5F E;  3I5P A;  2EIL C;  2P7V A;  4U5B E;  4KBL A;  3AOU A;  1Z6A A;  2I8B A;  4BG0 A;  3U3B A;  4CS8 C;  3I4U A;  2YL7 A;  4J7T A;  4EHP A;  1NG1 A;  4PFO A;  1CGN A;  3PMR A;  2YHS A;  1PV3 A;  1VLT A;  2YZS A;  2RSE B;  3EG9 A;  3TQO A;  4BJ6 A;  3RW0 A;  1RKC A;  3KMI A;  2L6G A;  2E87 A;  5A6K A;  2IXN A;  1LE4 A;  4C3E A;  1Z63 A;  2IXP A;  3TOL A;  3S29 A;  4DRJ B;  3RF3 A;  2XM0 A;  3JYH A;  3S28 A;  3UMK A;  3QVY A;  3SP1 A;  3ZQV A;  1ZHT A;  3SXY A;  3DJN B;  3U9M A;  1M2O A;  1YAR O;  3C18 A;  4O79 A;  3NKD A;  1FR0 A;  2KSF A;  3EHM A;  3UMH A;  5A6J A;  4MW8 A;  1F1M A;  3ATP A;  3H2U A;  2J9W A;  3U8P A;  3V5X A;  3TJ6 A;  3ZTZ A;  2R03 A;  4P9T A;  2CCY A;  3L1M A;  1LIH A;  4LDK A;  2KGO A;  3QMK A;  3U2M A;  3L0I A;  3Q6M A;  2Q00 A;  5B3I A;  4A2N B;  3JYY A;  4DVZ A;  4NTF A;  3SNH A;  4P6I C;  3LS1 A; 
#chains in the Genus database with same CATH homology
 1RKC A;  1SYQ A;  5L0G A;  5L0D A;  1T01 A;  1QKR A;  4E18 A;  3S90 A;  3RF3 A;  3VF0 A;  5L0H A;  1DOW A;  1L7C A;  4IGG A;  3T6G B;  2IBF A;  5L0I A;  1U6H A;  5L0C A;  4W8P A;  1ST6 A;  1ZW3 A;  2GDC A;  1H6G A;  1TR2 A;  1XWJ A;  3H2U A;  4E17 A;  1U89 A;  5L0J A;  2LQG A;  3TJ6 A;  3MYI A;  5L0F A;  1DOV A;  2HSQ A;  4P9T A;  2L7A A;  4K1O A;  1RKE A;  1YDI A;  2B0H A;  1ZVZ A;  3H2V A;  5FZT A;  2X0C A;  3TJ5 A;  4DJ9 A;  1RKE B;  4ONS A;  4EHP A;  3ZDL A;  2GWW A;  1ZW2 A;  4PR9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...