4ULWA

Crystal structure of the roq-domain of human roquin1
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
150
structure length
150
Chain Sequence
LSSNLWAAVRARGCQFLGPAMQEEALKLVLLALEDGSALSRKVLVLFVVQRLEPRFPQASKTSIGHVVQLLYRASCFKVTKRDEDSSLMQLKEEFRTYEALRREHDSQIVQIAMEAGLRIAPDQWSSLLYGDQSHKSHMQSIIDKLQTPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein
molecule keywords ROQUIN-1
publication title Roquin Binding to Target Mrnas Involves a Winged Helix-Turn- Helix Motif.
pubmed doi rcsb
source organism Homo sapiens
total genus 51
structure length 150
sequence length 150
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2014-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18386 ROQ_II Roquin II domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1790 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4ulwA00
3X1OA 4ZLDA 4ZLCA 5F5FA 4QI2A 4QI0A 5F5HA 4YWQA 4ULWA
chains in the Genus database with same CATH superfamily
3RKOF 4JCZA 3GWLA 3Q6MA 1U6HA 2IXNA 3U2MA 3EGDA 4U5HA 1HW1A 2X0CA 4XEVA 3BEHA 4G78A 2YL1A 3TOMA 2Q3TA 3WG7C 3NYJA 2W4MA 1TWHA 2KW3C 3T9OA 1YJGA 1HY5A 4AE4B 4PACA 1XZPA 5E3CA 5BUOA 3AQCA 3NYMA 1VYIA 2AWYA 1QPUA 3DE9A 3C8GD 5GPGB 4MNDA 4OIRF 1VTMP 3CSKA 1TR2A 2R25A 4K1OA 1J8MF 4G7OF 3HNIA 5AGFA 3K1IC 4MS2A 3C7JA 2WZLA 1DOWA 3UNGC 5BQIA 5L3VA 4G7HF 4DVYP 4E0HA 2CYDA 4CS7A 4OD5A 1V55C 3IQTA 1T6IA 1I5NA 3FAJA 4DBRA 1ORJA 1FFHA 1JOGA 1LKXA 2EINC 2GA0A 4CX9A 1MNEA 3M79A 4PR9A 2Q9BA 1K05A 3ITFA 4PJLA 1QKRA 4XQ1A 4CDAA 5KYWB 1EQ1A 3NMIA 4R32A 2UUHA 2R7VA 1SZIA 2NSFA 3A11A 3QW0A 4IB4A 1Z5ZA 1XWJA 2P6VA 4MVQA 2PNOA 1NFNA 5L0HA 3JCUQ 1Z23A 4KBLA 1TFOB 3ZIBA 3VRCA 5B3SC 2Q4FA 1E83A 2ETSA 3ASNC 3GM2A 5DVWA 1SR2A 5L0GA 3B0UX 1D0ZA 2Y69C 3RF3A 3C8ZA 1ORSC 1OXBA 1TQGA 2QTVA 3GEHA 2WVQA 1H7IA 1E86A 4ZLCA 5F5FA 4DOZA 3IEEA 5KYNA 3LESA 3C18A 4D4XA 3HNLA 4X0RA 3RW0A 3VYWA 5JUAA 2R7UA 4CIPA 1YAUO 1CPQA 1VMAA 1LE4A 2MWQA 2Q9CA 3HTKC 4JTCB 4RD9A 1PD1A 2YEVA 4EBJA 2HKVA 2HMZA 3GWNA 2BL2A 2WVOA 3TK0A 3KYJA 1ZW3A 1FNTc 1KTMA 1ZHZA 4PJJA 4AL0A 2D4UA 3LS0A 2NSGA 1A0BA 2PBEA 3ABMC 2BC5A 2Y3GA 4MVRA 1EI7A 3EH1A 2P1AA 4BJ5A 4YT8A 3E9VA 2XLHA 2IXOA 2EILC 4E7ZA 5B3IA 1YLMA 4LDKA 3JRMO 4CSAC 2PX3A 1L7CA 2EPLX 3SXYA 4PFOA 3E70C 1KNYA 4CS9C 1A7DA 2PP4A 2LFDA 3H65A 1OR2A 2Q00A 1WASA 1ZHYA 2J46A 4YL3A 3TJ6A 1WTYA 2NG1A 5CI9A 3V7OA 1RXQA 2OQMA 1VOMA 2L6HA 3EHNA 3ZWIA 3G4ZA 2OKUA 1TKNA 2HSQA 4ZLDA 2J8WA 4LACB 2H8AA 3W8HA 4OD4A 2AWCA 1DOVA 4MVSA 2HMQA 3ZSUA 2B0JA 2OG2A 1G4WR 5JVEA 1J8YF 4YL0A 2OJED 2ZD9A 4JTDB 3FOOA 2R02A 1A7EA 1QSPA 1UG7A 4NY3A 2L6GA 1UFBA 4LLEA 2A6HF 1WATA 1SYQA 1Y6DA 4U5FE 4JJGA 2XL6A 3RVYA 2YLIA 3DJUB 4JEBA 3X1OA 1MMDA 1Q0MA 1R4TA 2XLDA 4LDQA 3TQOA 5L0CA 2YHSA 4J7YA 4QI0A 3NKEA 4EWCA 2HSBA 4N6CA 4H4KC 5L0FA 1ZU4A 2Y3BA 2X51A 2FAPB 1JMWA 2KSFA 1GS9A 3DMDA 4QDLA 4CBEA 1H9TA 2R7OA 4EKWA 4XTKA 4J30B 1YZAA 2R7QA 3SP1A 3NKDA 4ULWA 4HFFB 3B71A 3EH2A 1OKKD 4Q7CA 1WWPA 2G3VA 1WOLA 4CS9A 1TWGA 1NZEA 3JZ0A 3UGPA 2J9VA 2WB7A 1LPEA 3QZCA 1SF8A 1Q0FA 1ZYRF 2YL0A 3O39A 2XS1A 3QW1A 5KYYB 3W2WA 3FHDA 4C3BA 3UMIA 1RKEB 1ZW2A 3HNJA 2ASRA 5A6BA 2XRHA 4GEHA 1HMOA 1K40A 4O6YA 3RFYA 1ZZPA 4KI2A 3LJBA 5E2QA 1EKYA 3EPVA 3RIPA 3EZIA 1RKEA 2QUPA 3DI5A 1OQCA 5JP7A 2CCYA 5BQHA 4BJ1A 4FX5A 3L8IA 2QNLA 2CNWA 3NMJA 2AU5A 1K04A 1ST6A 4EUKB 2J45A 2XL4A 4I1OB 1FMWA 5A6KA 4JTAB 1O5HA 1NU7D 3T6JA 1C17M 4EHPA 1D1AA 3K1IA 1OR3A 3S29A 2A69F 2PFDA 2VCCA 3FMSA 3QMKA 3U8VA 3B0PA 1HMDA 3IQ5A 4MQ9F 2HUJA 2D5RB 2L6FA 3S9OA 4P6IC 4EBKA 1MMAA 1H9GA 1Z63A 1SMYF 4O7GA 2J7PA 4WGZA 2V3CC 3FOPA 1OCZC 1R5ID 2XLMA 2XLWA 4AE4A 5FZTA 2BE5F 3ZTMA 1A41A 1YDIA 2ICWG 1CPRA 4HEAJ 5B1AC 3EG9B 5JLIA 3EHMA 1LM3B 5DS5A 3US6A 1LS4A 1APCA 2F22A 5L0DA 4K0DA 4N4WA 4OIOF 2VCBA 2YWAA 3LNMB 3WODF 4AL1A 2JD3A 2PF4E 2VCAA 4YT5A 1ORYA 3V5ZA 4HFKB 2Y3HA 2I8BA 3AG1C 1JPNA 1I4ZA 4L6RA 3EGXB 2IYLD 3ZQYA 2JX0A 2M64A 1WGWA 3GEEA 1BDJB 4I1MA 3SEOA 3UR3C 5DQZA 5CIVA 5K0IA 3ATPA 3ZC4A 1LI7A 4JCHA 3LLIA 1ZHTA 2HS5A 3EGXA 4YT2A 1W2WA 2J9WA 2VASA 4ANJA 1LIHA 2MHRA 3S90A 2GAQA 1O87A 4U5CE 2XXAB 1GGQA 1QLEC 2XM4A 4CSAA 1T01A 4YWQA 5E3AA 1M6TA 1C03A 1IZMA 2W4BA 4FWVA 1H6GA 4N6HA 4U5GA 4WJ0A 1JRAA 3TJ5A 3ZQVA 1PD0A 3B29A 3R2PA 3ZG1A 5IY5C 1RMVA 1ZVZA 3DM9B 5A6AA 2IXPA 3TOLA 4RBNA 1OXKA 2YVKA 3C8GB 1LS1A 4XPXA 4B6IA 3JSZA 4BG0A 5EHHA 1G4US 2DB4A 2IXMA 2NPUA 3M4BA 4CDYA 1T6UA 4Z9HA 3QTHA 3ZDLA 4NTAA 4BJ6C 3LAYA 1RJ9B 1VLTA 2LP4A 2YL7A 4MTOA 1U0BB 3C8GA 2NUTB 3OA1A 3IHUA 1D0YA 3VAYA 1U89A 3EZHA 3VM6A 2OEVA 3L8JA 4BEJA 1OCRC 1RJ9A 4OINF 3M4CA 3NMKA 4EIYA 3Q7GA 3EQLF 2NUTA 3I4UA 1BR2A 5COMA 4HE8D 1N1CA 1PV3A 4CS8C 2HV7A 1HW2A 3GANA 4A4AA 2R7XA 3KH2A 3AGTA 2EPOA 2VC9A 2VB6A 1M2VB 3JSEO 4JJFA 3FXHA 3V5XA 3AG3C 3GM1A 3RVZA 1Z6AA 4YN0B 3KPHA 4MVMA 3ABKC 4I3MA 5E33A 3FDQA 4I44A 1IW7F 3HJCA 5DQTA 3DM5A 4KC9A 2YLDA 3RQFA 4CJOA 2H7VC 1KU2A 1V4AA 256BA 2ZXOA 4G0HA 4MVUA 4D4NA 1LE2A 4GQHA 4JC7A 4IGGA 3AG2C 2YQYA 4K7BA 1BR4A 2KGOA 3T6BA 3MYFA 3W4YA 3EFOB 1B68A 5JRAA 3U0CA 3LEOA 4CIHA 5L0IA 4LLCA 1PCXA 3KYIA 2J9UA 4XWJA 4PFPA 3I5PA 3LUTB 1I4YA 2MYSA 3PMRA 4GYTA 4IRUA 3NRHA 4NCQA 3L34A 1YYXA 4F4BA 2EIKC 3K1HA 3U3BA 3J06A 2R03A 2HV6A 2RSEB 5EGYA 3EJNA 2C03A 2O9XA 2C04A 2DGJA 4JVSA 4BPMA 3MBGA 4AX2A 2E87A 4IJJA 5DS4A 4N06A 4FESA 3TD7A 3U5SA 3S0XA 5KYYA 3V5YA 2KYHA 1YARO 5HV9A 3NDBB 1D1CA 4NC3A 4YL1A 1Q0DA 2HFIA 1NU9C 1Y4CA 2YL3A 4BJTA 1Q0KA 2R9RB 1CGME 3IPMO 4CJGA 1NSGB 1ZHXA 3DE8A 4P9FA 2W9YA 3S27A 1MNDA 2IOQA 3LNRA 2NUPB 1ZHWA 3G4XA 4E18A 3PCVA 1E84A 1A7VA 4XEKA 1V54C 4MTGA 2WZGA 4EBBA 1HE9A 1T5OA 2FGYA 2QLAA 1WN0A 3RH3A 2YRFA 1G8XA 1M57C 1ZU5A 2L7AA 2NUPA 1MMGA 2WL8A 2Y3DA 4O6MA 1YZCA 3B0VC 4KNVA 2A0UA 3MLGA 2W45A 2YZSA 1YA9A 3S28A 3JT1A 5KYUB 1QVXA 2ZXWC 3U9MA 4RDAA 3QVZA 3L0IA 3W2VA 1QZXA 2EIMC 3BRJA 3K66A 5JT4A 3CZ6A 3U2LA 3LLKA 4CDVA 2J9BA 3M15A 3OEOA 5KYUA 1VYKA 2QE9A 3K33A 4DRIB 3C63A 1FTSA 3DXJF 4YJWA 3FAPB 3OWTA 4O6NA 5EK0A 2DYSC 1VLSA 4U9EA 3F47A 3Q6NA 5FCLA 2R7WA 1LI5A 1YA7O 4WABA 4IWBA 3RQGA 2DI3A 1F1MA 1OKKA 2J0XA 2L81A 3EG9A 3N2ZB 3FVYA 5F5HA 1NFOA 1T6QA 3VF0A 1MQVA 2A0BA 1FMVA 2L9JA 2OEXA 2EPKX 3G50A 3WAQA 3F46A 4QI2A 4IARA 1BBHA 3C62A 3JYHA 2LIGA 4NQFA 2OOCA 3U8PA 1YVIA 2R05A 1RCPA 3JTLO 4PJMA 2XM0A 1XZQA 4MVOA 4P9TA 3DAFA 4JEAA 4U5DE 5B1BC 3R7CA 2RD9A 4E7SA 4JRZA 1FAPB 3SNHA 3DAGA 2Q7RA 1E2XA 1E85A 2A68F 2EPNA 4BEMJ 4C3EA 2EPMX 2Z15A 3S84A 2R7SA 1L3PA 4OIQF 1Q0GA 2WVNA 3ZTZA 1NLXA 3T6GB 5CI8A 5KYXB 1Z3IX 4J7TA 1AEPA 1TWCA 3ABLC 4AK9A 4FAPB 4BJ6A 4J32B 4JKVA 4DRJB 1VB5A 4WGYA 2XXAA 4H54A 2M4EA 3DWWA 4ER9A 2R7TA 3MFNA 3SXKA 3PHF2 5KYXA 1FR0A 1VK5A 4MW8A 3GODA 5AC5A 2LCHA 5T3TA 1BZ4A 1YYJA 3DJNB 3O55A 2YLGA 2G3KA 1T9KA 2XLOA 3JYYA 1CGOA 1O3UA 3X2QC 5HSWA 4MW3A 4Z9IA 5AC4A 4CS8A 1CGNA 5JSLA 4DXWA 4JE9A 5L0JA 2Y39A 1OCCC 4U5EE 2XSEA 3U3FA 2QY9A 4Q5SF 4C7OB 2J0WA 1OW7A 4ULVA 3CQZA 2FFHA 1G5ZA 2IM8A 5L3QA 4IAQA 3RQEA 4OIPF 4LERA 4XEFA 4O79A 2ZPAA 4W8PA 5D92A 1OW8A 4XLNF 3LS1A 1Z7Qc 4Z9JA 4E17A 3I5QA 1OW6A 4C7OA 4MTFA 2KC3A 3K7DA 4YK5A 1AUEA 2LSEA 2HJMA 3DKAA 4JZAA 2CW0F 4G7ZF 4DVZA 2GFHA 2PX0A 1M56C 2A6EF 3CAXA 3NG1A 3HLZA 5A6BD 5T3WA 5D91A 1D1BA 2I15A 2EIJC 2AVKA 1M2VA 4BJ5C 2OU6A 1D0XA 2LK4A 3JRTA 1AVOB 2TMVP 1LVKA 3WHNA 2R7RA 2H7OA 2HJ3A 3O6XA 1NBBA 3AG4C 4XPYA 3AOUA 3UMKA 3RYLA 3PDMP 1M2OA 3KKBA 1V74B 3DZAA 3ASOC 2CGEA 2ZXPA 2CNWD 1HE1A 1JPJA 2XL8A 5COFA 4XPWA 4DJ9A 1BR1A 3IQ6A 2Q9AA 3HNKA 4Q4ZF 3L1MA 2VH3A 4NTBA 3SXZA 4DBQA 1S7ZA 3QVYA 2P0NA 4JW1A 2LD6A 4E0IA 2V26A 4U5BE 2H7BA 2DYRC 2ZXRA 2IBFA 5COGA 2OCCC 4LDRA 4M63A 2OJQA 3EFOA 3U9JA 3N0TA 1NG1A 2LQGA 2GDCA 3H2VA 3AGUA 5A6JA 3N24A 1GQAA 3UMHA 3KMIA 1TWAA 3AJMA 5KYWA 5DLJA 2J7PD 3POVA 3GM3A 2JPUA 3H2UA 3GEIA 3M1CB 3HKKA 2KNHA 4JURI 2LFFA 3DD7A 4PK4A 1JR8A 4MVZA 3MX3A 3B9QA 3GORA 1RKCA 2P7VA 4UDVA 2KQ9A 1C02A 2UUIA 5TJ5E 4A2NB 3UGOA 5JS5A 3TULA 2B0HA 2XS8A 1FFTC 2YKZA 5T1DB 2WZFA 3AQBA 1OCOC 5A69A 4U9DA 3SZRA 3IQCA 3SYNA 4XLPF 3LEVA 2XLEA 4JIOA 4YT4A 2G62A 3Q7LA 1GM5A 4DRHB 4W8KA 4IAOA 1TFKB 4PJNA 1QQ3A 3MYIA 2AP3A 3K6BA 3KL4A 4KNWA 2XLVA 3ZVRA 3CEXA 5BQGA 3A9CA 3T4RA 4C3DA 2A1DD 4ONSA 1JAFA 2KK1A 3O10A 3SXMA 3W8IA 2KJGA 3EGDB 1MMNA 4NTFA 2HZ8A 3NYLA 5DS6A 3ECSA 5F28E 2GWWA 2CDQA 1EA8A 1S05A 2P61A
chains in the Genus database with same CATH topology
3RKOF 3Q6MA 2IXNA 3EGDA 4U5HA 2Q3TA 3WG7C 3NYJA 2W4MA 1TWHA 2KW3C 4AE4B 5BUOA 5E3CA 3AQCA 3NYMA 1VYIA 4MNDA 4OIRF 3CSKA 1TR2A 1J8MF 4G7OF 3K1IC 3UNGC 2WZLA 4G7HF 5L3VA 4DVYP 4CS7A 4OD5A 1V55C 3FAJA 4DBRA 2EINC 1FFHA 1LKXA 1MNEA 4PJLA 2Q9BA 3ITFA 2R7VA 1SZIA 1Z5ZA 2P6VA 3JCUQ 1Z23A 4KBLA 3ZIBA 5B3SC 3ASNC 5DVWA 3B0UX 1D0ZA 2Y69C 2QTVA 2WVQA 4ZLCA 5F5FA 4DOZA 3IEEA 5KYNA 3LESA 4X0RA 3VYWA 2R7UA 3HTKC 2Q9CA 2MWQA 1VMAA 4RD9A 1PD1A 2YEVA 2WVOA 1ZHZA 4PJJA 3LS0A 3ABMC 2Y3GA 4YT8A 3EH1A 4BJ5A 3E9VA 4E7ZA 2IXOA 2EILC 4CSAC 2PX3A 4PFOA 3E70C 4CS9C 2PP4A 3H65A 1ZHYA 2J46A 2NG1A 5CI9A 3V7OA 3EHNA 1VOMA 1TKNA 4ZLDA 4LACB 3W8HA 4OD4A 3ZSUA 2B0JA 2OG2A 1J8YF 4NY3A 4LLEA 2A6HF 4U5FE 4JJGA 3DJUB 3X1OA 1MMDA 2YHSA 4QI0A 4EWCA 3NKEA 4H4KC 1ZU4A 2Y3BA 2X51A 3DMDA 4CBEA 4QDLA 2R7OA 4XTKA 4J30B 2R7QA 3SP1A 3NKDA 4ULWA 4HFFB 3EH2A 1OKKD 4Q7CA 2G3VA 1TWGA 1NZEA 3UGPA 2J9VA 2WB7A 3QZCA 1SF8A 1ZYRF 3O39A 5KYYB 3W2WA 3FHDA 4C3BA 3UMIA 2XRHA 4GEHA 4O6YA 3RFYA 4KI2A 3LJBA 5E2QA 3EPVA 3RIPA 3EZIA 4BJ1A 4FX5A 2CNWA 1ST6A 2J45A 2XL4A 4I1OB 1FMWA 1O5HA 1NU7D 3T6JA 1D1AA 3S29A 2A69F 2PFDA 3QMKA 3B0PA 4MQ9F 2D5RB 4P6IC 1MMAA 1Z63A 1SMYF 4O7GA 2J7PA 2V3CC 1OCZC 4AE4A 2BE5F 4HEAJ 5B1AC 3EG9B 3EHMA 5DS5A 4K0DA 4OIOF 3WODF 2JD3A 2PF4E 4YT5A 4HFKB 2Y3HA 2I8BA 3AG1C 1JPNA 3EGXB 2IYLD 1WGWA 3UR3C 4I1MA 3SEOA 5DQZA 3ZC4A 4JCHA 3LLIA 1ZHTA 3EGXA 4YT2A 1W2WA 2J9WA 2VASA 4ANJA 2XXAB 1O87A 4U5CE 1QLEC 4CSAA 4YWQA 5E3AA 2W4BA 4FWVA 1IZMA 4WJ0A 4U5GA 4CS9A 1PD0A 5IY5C 3ZG1A 3DM9B 2IXPA 4RBNA 1LS1A 4B6IA 4BG0A 3JSZA 5EHHA 2IXMA 4BJ6C 3LAYA 1RJ9B 2NUTB 3OA1A 1D0YA 3VAYA 3EZHA 4BEJA 1OCRC 1RJ9A 4OINF 3Q7GA 3EQLF 2NUTA 3I4UA 1BR2A 4HE8D 1N1CA 4CS8C 2HV7A 3GANA 2R7XA 3KH2A 2VB6A 1M2VB 4JJFA 3AG3C 1Z6AA 4YN0B 3ABKC 4I3MA 5E33A 3FDQA 4I44A 1IW7F 3HJCA 5DQTA 3DM5A 4KC9A 2H7VC 1KU2A 2ZXOA 4G0HA 3AG2C 4K7BA 1BR4A 2KGOA 3T6BA 3EFOB 4CIHA 4LLCA 1PCXA 2J9UA 4XWJA 4PFPA 3I5PA 3PMRA 2MYSA 4GYTA 4IRUA 4F4BA 3NRHA 5KYWB 3L34A 2EIKC 3K1HA 5EGYA 2HV6A 3EJNA 2C03A 2O9XA 2C04A 2DGJA 4JVSA 4AX2A 2E87A 4IJJA 5DS4A 4N06A 4FESA 3TD7A 3S0XA 5KYYA 3NDBB 1D1CA 1NU9C 4BJTA 1ZHXA 3S27A 2W9YA 1MNDA 2IOQA 3LNRA 2NUPB 1ZHWA 1V54C 2WZGA 4EBBA 2FGYA 3RH3A 1G8XA 1M57C 1ZU5A 2NUPA 2WL8A 1MMGA 2Y3DA 4O6MA 3B0VC 4KNVA 3MLGA 2W45A 2YZSA 3S28A 3JT1A 5KYUB 2ZXWC 4RDAA 3L0IA 3W2VA 1QZXA 2EIMC 3K66A 3CZ6A 3LLKA 3OEOA 5KYUA 1VYKA 3K33A 3DXJF 1FTSA 4YJWA 3OWTA 4O6NA 2DYSC 3F47A 3Q6NA 5FCLA 2R7WA 4IWBA 1OKKA 2J0XA 2L81A 3EG9A 3N2ZB 3FVYA 5F5HA 1FMVA 2L9JA 4QI2A 3F46A 3JYHA 4PJMA 4U5DE 3DAFA 5B1BC 4E7SA 3SNHA 3DAGA 2A68F 2R7SA 4C3EA 2Z15A 4OIQF 2WVNA 5CI8A 5KYXB 1Z3IX 1TWCA 3ABLC 4AK9A 4BJ6A 4J32B 2XXAA 2R7TA 2M4EA 3PHF2 5KYXA 1VK5A 3GODA 5T3TA 3DJNB 2G3KA 5HSWA 3X2QC 4CS8A 2Y39A 1OCCC 4U5EE 2XSEA 2QY9A 4Q5SF 4C7OB 2J0WA 3CQZA 2FFHA 4OIPF 5L3QA 4LERA 4XLNF 4O79A 2ZPAA 5D92A 3LS1A 3I5QA 4C7OA 3K7DA 2LSEA 4JZAA 2CW0F 4G7ZF 4DVZA 2GFHA 2PX0A 1M56C 2A6EF 3NG1A 3HLZA 5T3WA 5D91A 1D1BA 2EIJC 1M2VA 4BJ5C 1D0XA 3JRTA 1LVKA 2R7RA 2H7OA 3O6XA 3AG4C 3UMKA 3RYLA 1M2OA 3KKBA 3DZAA 3ASOC 2CGEA 2ZXPA 2CNWD 1JPJA 1BR1A 2Q9AA 4Q4ZF 2VH3A 4DBQA 1S7ZA 4JW1A 2V26A 4U5BE 2H7BA 2DYRC 2ZXRA 2OCCC 4M63A 3EFOA 3N0TA 1NG1A 3N24A 3UMHA 3KMIA 1TWAA 5KYWA 5DLJA 2J7PD 3POVA 3M1CB 2KNHA 4JURI 4PK4A 3DD7A 3MX3A 3B9QA 2P7VA 2KQ9A 4A2NB 3UGOA 1FFTC 5T1DB 2WZFA 3AQBA 1OCOC 3SZRA 3SYNA 4XLPF 3LEVA 4YT4A 2G62A 3Q7LA 4W8KA 4IAOA 4PJNA 3K6BA 3KL4A 4KNWA 3ZVRA 3T4RA 4C3DA 2A1DD 3W8IA 2KJGA 3EGDB 1MMNA 3NYLA 5DS6A 3ECSA 2CDQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X1O A;  4ZLD A;  4ZLC A;  5F5F A;  4QI2 A;  4QI0 A;  5F5H A;  4YWQ A;  4ULW A; 
#chains in the Genus database with same CATH topology
 3RKO F;  4JCZ A;  3GWL A;  3Q6M A;  1U6H A;  2IXN A;  3U2M A;  3EGD A;  4U5H A;  1HW1 A;  2X0C A;  4XEV A;  3BEH A;  4G78 A;  2YL1 A;  3TOM A;  2Q3T A;  3WG7 C;  3NYJ A;  2W4M A;  1TWH A;  2KW3 C;  3T9O A;  1YJG A;  1HY5 A;  4AE4 B;  4PAC A;  1XZP A;  5E3C A;  5BUO A;  3AQC A;  3NYM A;  1VYI A;  2AWY A;  1QPU A;  3DE9 A;  3C8G D;  5GPG B;  4MND A;  4OIR F;  1VTM P;  3CSK A;  1TR2 A;  2R25 A;  4K1O A;  1J8M F;  4G7O F;  3HNI A;  5AGF A;  3K1I C;  4MS2 A;  3C7J A;  2WZL A;  1DOW A;  3UNG C;  5BQI A;  5L3V A;  4G7H F;  4DVY P;  4E0H A;  2CYD A;  4CS7 A;  4OD5 A;  1V55 C;  3IQT A;  1T6I A;  1I5N A;  3FAJ A;  4DBR A;  1ORJ A;  1FFH A;  1JOG A;  1LKX A;  2EIN C;  2GA0 A;  4CX9 A;  1MNE A;  3M79 A;  4PR9 A;  2Q9B A;  1K05 A;  3ITF A;  4PJL A;  1QKR A;  4XQ1 A;  4CDA A;  5KYW B;  1EQ1 A;  3NMI A;  4R32 A;  2UUH A;  2R7V A;  1SZI A;  2NSF A;  3A11 A;  3QW0 A;  4IB4 A;  1Z5Z A;  1XWJ A;  2P6V A;  4MVQ A;  2PNO A;  1NFN A;  5L0H A;  3JCU Q;  1Z23 A;  4KBL A;  1TFO B;  3ZIB A;  3VRC A;  5B3S C;  2Q4F A;  1E83 A;  2ETS A;  3ASN C;  3GM2 A;  5DVW A;  1SR2 A;  5L0G A;  3B0U X;  1D0Z A;  2Y69 C;  3RF3 A;  3C8Z A;  1ORS C;  1OXB A;  1TQG A;  2QTV A;  3GEH A;  2WVQ A;  1H7I A;  1E86 A;  4ZLC A;  5F5F A;  4DOZ A;  3IEE A;  5KYN A;  3LES A;  3C18 A;  4D4X A;  3HNL A;  4X0R A;  3RW0 A;  3VYW A;  5JUA A;  2R7U A;  4CIP A;  1YAU O;  1CPQ A;  1VMA A;  1LE4 A;  2MWQ A;  2Q9C A;  3HTK C;  4JTC B;  4RD9 A;  1PD1 A;  2YEV A;  4EBJ A;  2HKV A;  2HMZ A;  3GWN A;  2BL2 A;  2WVO A;  3TK0 A;  3KYJ A;  1ZW3 A;  1FNT c;  1KTM A;  1ZHZ A;  4PJJ A;  4AL0 A;  2D4U A;  3LS0 A;  2NSG A;  1A0B A;  2PBE A;  3ABM C;  2BC5 A;  2Y3G A;  4MVR A;  1EI7 A;  3EH1 A;  2P1A A;  4BJ5 A;  4YT8 A;  3E9V A;  2XLH A;  2IXO A;  2EIL C;  4E7Z A;  5B3I A;  1YLM A;  4LDK A;  3JRM O;  4CSA C;  2PX3 A;  1L7C A;  2EPL X;  3SXY A;  4PFO A;  3E70 C;  1KNY A;  4CS9 C;  1A7D A;  2PP4 A;  2LFD A;  3H65 A;  1OR2 A;  2Q00 A;  1WAS A;  1ZHY A;  2J46 A;  4YL3 A;  3TJ6 A;  1WTY A;  2NG1 A;  5CI9 A;  3V7O A;  1RXQ A;  2OQM A;  1VOM A;  2L6H A;  3EHN A;  3ZWI A;  3G4Z A;  2OKU A;  1TKN A;  2HSQ A;  4ZLD A;  2J8W A;  4LAC B;  2H8A A;  3W8H A;  4OD4 A;  2AWC A;  1DOV A;  4MVS A;  2HMQ A;  3ZSU A;  2B0J A;  2OG2 A;  1G4W R;  5JVE A;  1J8Y F;  4YL0 A;  2OJE D;  2ZD9 A;  4JTD B;  3FOO A;  2R02 A;  1A7E A;  1QSP A;  1UG7 A;  4NY3 A;  2L6G A;  1UFB A;  4LLE A;  2A6H F;  1WAT A;  1SYQ A;  1Y6D A;  4U5F E;  4JJG A;  2XL6 A;  3RVY A;  2YLI A;  3DJU B;  4JEB A;  3X1O A;  1MMD A;  1Q0M A;  1R4T A;  2XLD A;  4LDQ A;  3TQO A;  5L0C A;  2YHS A;  4J7Y A;  4QI0 A;  3NKE A;  4EWC A;  2HSB A;  4N6C A;  4H4K C;  5L0F A;  1ZU4 A;  2Y3B A;  2X51 A;  2FAP B;  1JMW A;  2KSF A;  1GS9 A;  3DMD A;  4QDL A;  4CBE A;  1H9T A;  2R7O A;  4EKW A;  4XTK A;  4J30 B;  1YZA A;  2R7Q A;  3SP1 A;  3NKD A;  4ULW A;  4HFF B;  3B71 A;  3EH2 A;  1OKK D;  4Q7C A;  1WWP A;  2G3V A;  1WOL A;  4CS9 A;  1TWG A;  1NZE A;  3JZ0 A;  3UGP A;  2J9V A;  2WB7 A;  1LPE A;  3QZC A;  1SF8 A;  1Q0F A;  1ZYR F;  2YL0 A;  3O39 A;  2XS1 A;  3QW1 A;  5KYY B;  3W2W A;  3FHD A;  4C3B A;  3UMI A;  1RKE B;  1ZW2 A;  3HNJ A;  2ASR A;  5A6B A;  2XRH A;  4GEH A;  1HMO A;  1K40 A;  4O6Y A;  3RFY A;  1ZZP A;  4KI2 A;  3LJB A;  5E2Q A;  1EKY A;  3EPV A;  3RIP A;  3EZI A;  1RKE A;  2QUP A;  3DI5 A;  1OQC A;  5JP7 A;  2CCY A;  5BQH A;  4BJ1 A;  4FX5 A;  3L8I A;  2QNL A;  2CNW A;  3NMJ A;  2AU5 A;  1K04 A;  1ST6 A;  4EUK B;  2J45 A;  2XL4 A;  4I1O B;  1FMW A;  5A6K A;  4JTA B;  1O5H A;  1NU7 D;  3T6J A;  1C17 M;  4EHP A;  1D1A A;  3K1I A;  1OR3 A;  3S29 A;  2A69 F;  2PFD A;  2VCC A;  3FMS A;  3QMK A;  3U8V A;  3B0P A;  1HMD A;  3IQ5 A;  4MQ9 F;  2HUJ A;  2D5R B;  2L6F A;  3S9O A;  4P6I C;  4EBK A;  1MMA A;  1H9G A;  1Z63 A;  1SMY F;  4O7G A;  2J7P A;  4WGZ A;  2V3C C;  3FOP A;  1OCZ C;  1R5I D;  2XLM A;  2XLW A;  4AE4 A;  5FZT A;  2BE5 F;  3ZTM A;  1A41 A;  1YDI A;  2ICW G;  1CPR A;  4HEA J;  5B1A C;  3EG9 B;  5JLI A;  3EHM A;  1LM3 B;  5DS5 A;  3US6 A;  1LS4 A;  1APC A;  2F22 A;  5L0D A;  4K0D A;  4N4W A;  4OIO F;  2VCB A;  2YWA A;  3LNM B;  3WOD F;  4AL1 A;  2JD3 A;  2PF4 E;  2VCA A;  4YT5 A;  1ORY A;  3V5Z A;  4HFK B;  2Y3H A;  2I8B A;  3AG1 C;  1JPN A;  1I4Z A;  4L6R A;  3EGX B;  2IYL D;  3ZQY A;  2JX0 A;  2M64 A;  1WGW A;  3GEE A;  1BDJ B;  4I1M A;  3SEO A;  3UR3 C;  5DQZ A;  5CIV A;  5K0I A;  3ATP A;  3ZC4 A;  1LI7 A;  4JCH A;  3LLI A;  1ZHT A;  2HS5 A;  3EGX A;  4YT2 A;  1W2W A;  2J9W A;  2VAS A;  4ANJ A;  1LIH A;  2MHR A;  3S90 A;  2GAQ A;  1O87 A;  4U5C E;  2XXA B;  1GGQ A;  1QLE C;  2XM4 A;  4CSA A;  1T01 A;  4YWQ A;  5E3A A;  1M6T A;  1C03 A;  1IZM A;  2W4B A;  4FWV A;  1H6G A;  4N6H A;  4U5G A;  4WJ0 A;  1JRA A;  3TJ5 A;  3ZQV A;  1PD0 A;  3B29 A;  3R2P A;  3ZG1 A;  5IY5 C;  1RMV A;  1ZVZ A;  3DM9 B;  5A6A A;  2IXP A;  3TOL A;  4RBN A;  1OXK A;  2YVK A;  3C8G B;  1LS1 A;  4XPX A;  4B6I A;  3JSZ A;  4BG0 A;  5EHH A;  1G4U S;  2DB4 A;  2IXM A;  2NPU A;  3M4B A;  4CDY A;  1T6U A;  4Z9H A;  3QTH A;  3ZDL A;  4NTA A;  4BJ6 C;  3LAY A;  1RJ9 B;  1VLT A;  2LP4 A;  2YL7 A;  4MTO A;  1U0B B;  3C8G A;  2NUT B;  3OA1 A;  3IHU A;  1D0Y A;  3VAY A;  1U89 A;  3EZH A;  3VM6 A;  2OEV A;  3L8J A;  4BEJ A;  1OCR C;  1RJ9 A;  4OIN F;  3M4C A;  3NMK A;  4EIY A;  3Q7G A;  3EQL F;  2NUT A;  3I4U A;  1BR2 A;  5COM A;  4HE8 D;  1N1C A;  1PV3 A;  4CS8 C;  2HV7 A;  1HW2 A;  3GAN A;  4A4A A;  2R7X A;  3KH2 A;  3AGT A;  2EPO A;  2VC9 A;  2VB6 A;  1M2V B;  3JSE O;  4JJF A;  3FXH A;  3V5X A;  3AG3 C;  3GM1 A;  3RVZ A;  1Z6A A;  4YN0 B;  3KPH A;  4MVM A;  3ABK C;  4I3M A;  5E33 A;  3FDQ A;  4I44 A;  1IW7 F;  3HJC A;  5DQT A;  3DM5 A;  4KC9 A;  2YLD A;  3RQF A;  4CJO A;  2H7V C;  1KU2 A;  1V4A A;  256B A;  2ZXO A;  4G0H A;  4MVU A;  4D4N A;  1LE2 A;  4GQH A;  4JC7 A;  4IGG A;  3AG2 C;  2YQY A;  4K7B A;  1BR4 A;  2KGO A;  3T6B A;  3MYF A;  3W4Y A;  3EFO B;  1B68 A;  5JRA A;  3U0C A;  3LEO A;  4CIH A;  5L0I A;  4LLC A;  1PCX A;  3KYI A;  2J9U A;  4XWJ A;  4PFP A;  3I5P A;  3LUT B;  1I4Y A;  2MYS A;  3PMR A;  4GYT A;  4IRU A;  3NRH A;  4NCQ A;  3L34 A;  1YYX A;  4F4B A;  2EIK C;  3K1H A;  3U3B A;  3J06 A;  2R03 A;  2HV6 A;  2RSE B;  5EGY A;  3EJN A;  2C03 A;  2O9X A;  2C04 A;  2DGJ A;  4JVS A;  4BPM A;  3MBG A;  4AX2 A;  2E87 A;  4IJJ A;  5DS4 A;  4N06 A;  4FES A;  3TD7 A;  3U5S A;  3S0X A;  5KYY A;  3V5Y A;  2KYH A;  1YAR O;  5HV9 A;  3NDB B;  1D1C A;  4NC3 A;  4YL1 A;  1Q0D A;  2HFI A;  1NU9 C;  1Y4C A;  2YL3 A;  4BJT A;  1Q0K A;  2R9R B;  1CGM E;  3IPM O;  4CJG A;  1NSG B;  1ZHX A;  3DE8 A;  4P9F A;  2W9Y A;  3S27 A;  1MND A;  2IOQ A;  3LNR A;  2NUP B;  1ZHW A;  3G4X A;  4E18 A;  3PCV A;  1E84 A;  1A7V A;  4XEK A;  1V54 C;  4MTG A;  2WZG A;  4EBB A;  1HE9 A;  1T5O A;  2FGY A;  2QLA A;  1WN0 A;  3RH3 A;  2YRF A;  1G8X A;  1M57 C;  1ZU5 A;  2L7A A;  2NUP A;  1MMG A;  2WL8 A;  2Y3D A;  4O6M A;  1YZC A;  3B0V C;  4KNV A;  2A0U A;  3MLG A;  2W45 A;  2YZS A;  1YA9 A;  3S28 A;  3JT1 A;  5KYU B;  1QVX A;  2ZXW C;  3U9M A;  4RDA A;  3QVZ A;  3L0I A;  3W2V A;  1QZX A;  2EIM C;  3BRJ A;  3K66 A;  5JT4 A;  3CZ6 A;  3U2L A;  3LLK A;  4CDV A;  2J9B A;  3M15 A;  3OEO A;  5KYU A;  1VYK A;  2QE9 A;  3K33 A;  4DRI B;  3C63 A;  1FTS A;  3DXJ F;  4YJW A;  3FAP B;  3OWT A;  4O6N A;  5EK0 A;  2DYS C;  1VLS A;  4U9E A;  3F47 A;  3Q6N A;  5FCL A;  2R7W A;  1LI5 A;  1YA7 O;  4WAB A;  4IWB A;  3RQG A;  2DI3 A;  1F1M A;  1OKK A;  2J0X A;  2L81 A;  3EG9 A;  3N2Z B;  3FVY A;  5F5H A;  1NFO A;  1T6Q A;  3VF0 A;  1MQV A;  2A0B A;  1FMV A;  2L9J A;  2OEX A;  2EPK X;  3G50 A;  3WAQ A;  3F46 A;  4QI2 A;  4IAR A;  1BBH A;  3C62 A;  3JYH A;  2LIG A;  4NQF A;  2OOC A;  3U8P A;  1YVI A;  2R05 A;  1RCP A;  3JTL O;  4PJM A;  2XM0 A;  1XZQ A;  4MVO A;  4P9T A;  3DAF A;  4JEA A;  4U5D E;  5B1B C;  3R7C A;  2RD9 A;  4E7S A;  4JRZ A;  1FAP B;  3SNH A;  3DAG A;  2Q7R A;  1E2X A;  1E85 A;  2A68 F;  2EPN A;  4BEM J;  4C3E A;  2EPM X;  2Z15 A;  3S84 A;  2R7S A;  1L3P A;  4OIQ F;  1Q0G A;  2WVN A;  3ZTZ A;  1NLX A;  3T6G B;  5CI8 A;  5KYX B;  1Z3I X;  4J7T A;  1AEP A;  1TWC A;  3ABL C;  4AK9 A;  4FAP B;  4BJ6 A;  4J32 B;  4JKV A;  4DRJ B;  1VB5 A;  4WGY A;  2XXA A;  4H54 A;  2M4E A;  3DWW A;  4ER9 A;  2R7T A;  3MFN A;  3SXK A;  3PHF 2;  5KYX A;  1FR0 A;  1VK5 A;  4MW8 A;  3GOD A;  5AC5 A;  2LCH A;  5T3T A;  1BZ4 A;  1YYJ A;  3DJN B;  3O55 A;  2YLG A;  2G3K A;  1T9K A;  2XLO A;  3JYY A;  1CGO A;  1O3U A;  3X2Q C;  5HSW A;  4MW3 A;  4Z9I A;  5AC4 A;  4CS8 A;  1CGN A;  5JSL A;  4DXW A;  4JE9 A;  5L0J A;  2Y39 A;  1OCC C;  4U5E E;  2XSE A;  3U3F A;  2QY9 A;  4Q5S F;  4C7O B;  2J0W A;  1OW7 A;  4ULV A;  3CQZ A;  2FFH A;  1G5Z A;  2IM8 A;  5L3Q A;  4IAQ A;  3RQE A;  4OIP F;  4LER A;  4XEF A;  4O79 A;  2ZPA A;  4W8P A;  5D92 A;  1OW8 A;  4XLN F;  3LS1 A;  1Z7Q c;  4Z9J A;  4E17 A;  3I5Q A;  1OW6 A;  4C7O A;  4MTF A;  2KC3 A;  3K7D A;  4YK5 A;  1AUE A;  2LSE A;  2HJM A;  3DKA A;  4JZA A;  2CW0 F;  4G7Z F;  4DVZ A;  2GFH A;  2PX0 A;  1M56 C;  2A6E F;  3CAX A;  3NG1 A;  3HLZ A;  5A6B D;  5T3W A;  5D91 A;  1D1B A;  2I15 A;  2EIJ C;  2AVK A;  1M2V A;  4BJ5 C;  2OU6 A;  1D0X A;  2LK4 A;  3JRT A;  1AVO B;  2TMV P;  1LVK A;  3WHN A;  2R7R A;  2H7O A;  2HJ3 A;  3O6X A;  1NBB A;  3AG4 C;  4XPY A;  3AOU A;  3UMK A;  3RYL A;  3PDM P;  1M2O A;  3KKB A;  1V74 B;  3DZA A;  3ASO C;  2CGE A;  2ZXP A;  2CNW D;  1HE1 A;  1JPJ A;  2XL8 A;  5COF A;  4XPW A;  4DJ9 A;  1BR1 A;  3IQ6 A;  2Q9A A;  3HNK A;  4Q4Z F;  3L1M A;  2VH3 A;  4NTB A;  3SXZ A;  4DBQ A;  1S7Z A;  3QVY A;  2P0N A;  4JW1 A;  2LD6 A;  4E0I A;  2V26 A;  4U5B E;  2H7B A;  2DYR C;  2ZXR A;  2IBF A;  5COG A;  2OCC C;  4LDR A;  4M63 A;  2OJQ A;  3EFO A;  3U9J A;  3N0T A;  1NG1 A;  2LQG A;  2GDC A;  3H2V A;  3AGU A;  5A6J A;  3N24 A;  1GQA A;  3UMH A;  3KMI A;  1TWA A;  3AJM A;  5KYW A;  5DLJ A;  2J7P D;  3POV A;  3GM3 A;  2JPU A;  3H2U A;  3GEI A;  3M1C B;  3HKK A;  2KNH A;  4JUR I;  2LFF A;  3DD7 A;  4PK4 A;  1JR8 A;  4MVZ A;  3MX3 A;  3B9Q A;  3GOR A;  1RKC A;  2P7V A;  4UDV A;  2KQ9 A;  1C02 A;  2UUI A;  5TJ5 E;  4A2N B;  3UGO A;  5JS5 A;  3TUL A;  2B0H A;  2XS8 A;  1FFT C;  2YKZ A;  5T1D B;  2WZF A;  3AQB A;  1OCO C;  5A69 A;  4U9D A;  3SZR A;  3IQC A;  3SYN A;  4XLP F;  3LEV A;  2XLE A;  4JIO A;  4YT4 A;  2G62 A;  3Q7L A;  1GM5 A;  4DRH B;  4W8K A;  4IAO A;  1TFK B;  4PJN A;  1QQ3 A;  3MYI A;  2AP3 A;  3K6B A;  3KL4 A;  4KNW A;  2XLV A;  3ZVR A;  3CEX A;  5BQG A;  3A9C A;  3T4R A;  4C3D A;  2A1D D;  4ONS A;  1JAF A;  2KK1 A;  3O10 A;  3SXM A;  3W8I A;  2KJG A;  3EGD B;  1MMN A;  4NTF A;  2HZ8 A;  3NYL A;  5DS6 A;  3ECS A;  5F28 E;  2GWW A;  2CDQ A;  1EA8 A;  1S05 A;  2P61 A; 
#chains in the Genus database with same CATH homology
 3RKO F;  3Q6M A;  2IXN A;  3EGD A;  4U5H A;  2Q3T A;  3WG7 C;  3NYJ A;  2W4M A;  1TWH A;  2KW3 C;  4AE4 B;  5BUO A;  5E3C A;  3AQC A;  3NYM A;  1VYI A;  4MND A;  4OIR F;  3CSK A;  1TR2 A;  1J8M F;  4G7O F;  3K1I C;  3UNG C;  2WZL A;  4G7H F;  5L3V A;  4DVY P;  4CS7 A;  4OD5 A;  1V55 C;  3FAJ A;  4DBR A;  2EIN C;  1FFH A;  1LKX A;  1MNE A;  4PJL A;  2Q9B A;  3ITF A;  2R7V A;  1SZI A;  1Z5Z A;  2P6V A;  3JCU Q;  1Z23 A;  4KBL A;  3ZIB A;  5B3S C;  3ASN C;  5DVW A;  3B0U X;  1D0Z A;  2Y69 C;  2QTV A;  2WVQ A;  4ZLC A;  5F5F A;  4DOZ A;  3IEE A;  5KYN A;  3LES A;  4X0R A;  3VYW A;  2R7U A;  3HTK C;  2Q9C A;  2MWQ A;  1VMA A;  4RD9 A;  1PD1 A;  2YEV A;  2WVO A;  1ZHZ A;  4PJJ A;  3LS0 A;  3ABM C;  2Y3G A;  4YT8 A;  3EH1 A;  4BJ5 A;  3E9V A;  4E7Z A;  2IXO A;  2EIL C;  4CSA C;  2PX3 A;  4PFO A;  3E70 C;  4CS9 C;  2PP4 A;  3H65 A;  1ZHY A;  2J46 A;  2NG1 A;  5CI9 A;  3V7O A;  3EHN A;  1VOM A;  1TKN A;  4ZLD A;  4LAC B;  3W8H A;  4OD4 A;  3ZSU A;  2B0J A;  2OG2 A;  1J8Y F;  4NY3 A;  4LLE A;  2A6H F;  4U5F E;  4JJG A;  3DJU B;  3X1O A;  1MMD A;  2YHS A;  4QI0 A;  4EWC A;  3NKE A;  4H4K C;  1ZU4 A;  2Y3B A;  2X51 A;  3DMD A;  4CBE A;  4QDL A;  2R7O A;  4XTK A;  4J30 B;  2R7Q A;  3SP1 A;  3NKD A;  4ULW A;  4HFF B;  3EH2 A;  1OKK D;  4Q7C A;  2G3V A;  1TWG A;  1NZE A;  3UGP A;  2J9V A;  2WB7 A;  3QZC A;  1SF8 A;  1ZYR F;  3O39 A;  5KYY B;  3W2W A;  3FHD A;  4C3B A;  3UMI A;  2XRH A;  4GEH A;  4O6Y A;  3RFY A;  4KI2 A;  3LJB A;  5E2Q A;  3EPV A;  3RIP A;  3EZI A;  4BJ1 A;  4FX5 A;  2CNW A;  1ST6 A;  2J45 A;  2XL4 A;  4I1O B;  1FMW A;  1O5H A;  1NU7 D;  3T6J A;  1D1A A;  3S29 A;  2A69 F;  2PFD A;  3QMK A;  3B0P A;  4MQ9 F;  2D5R B;  4P6I C;  1MMA A;  1Z63 A;  1SMY F;  4O7G A;  2J7P A;  2V3C C;  1OCZ C;  4AE4 A;  2BE5 F;  4HEA J;  5B1A C;  3EG9 B;  3EHM A;  5DS5 A;  4K0D A;  4OIO F;  3WOD F;  2JD3 A;  2PF4 E;  4YT5 A;  4HFK B;  2Y3H A;  2I8B A;  3AG1 C;  1JPN A;  3EGX B;  2IYL D;  1WGW A;  3UR3 C;  4I1M A;  3SEO A;  5DQZ A;  3ZC4 A;  4JCH A;  3LLI A;  1ZHT A;  3EGX A;  4YT2 A;  1W2W A;  2J9W A;  2VAS A;  4ANJ A;  2XXA B;  1O87 A;  4U5C E;  1QLE C;  4CSA A;  4YWQ A;  5E3A A;  2W4B A;  4FWV A;  1IZM A;  4WJ0 A;  4U5G A;  4CS9 A;  1PD0 A;  5IY5 C;  3ZG1 A;  3DM9 B;  2IXP A;  4RBN A;  1LS1 A;  4B6I A;  4BG0 A;  3JSZ A;  5EHH A;  2IXM A;  4BJ6 C;  3LAY A;  1RJ9 B;  2NUT B;  3OA1 A;  1D0Y A;  3VAY A;  3EZH A;  4BEJ A;  1OCR C;  1RJ9 A;  4OIN F;  3Q7G A;  3EQL F;  2NUT A;  3I4U A;  1BR2 A;  4HE8 D;  1N1C A;  4CS8 C;  2HV7 A;  3GAN A;  2R7X A;  3KH2 A;  2VB6 A;  1M2V B;  4JJF A;  3AG3 C;  1Z6A A;  4YN0 B;  3ABK C;  4I3M A;  5E33 A;  3FDQ A;  4I44 A;  1IW7 F;  3HJC A;  5DQT A;  3DM5 A;  4KC9 A;  2H7V C;  1KU2 A;  2ZXO A;  4G0H A;  3AG2 C;  4K7B A;  1BR4 A;  2KGO A;  3T6B A;  3EFO B;  4CIH A;  4LLC A;  1PCX A;  2J9U A;  4XWJ A;  4PFP A;  3I5P A;  3PMR A;  2MYS A;  4GYT A;  4IRU A;  4F4B A;  3NRH A;  5KYW B;  3L34 A;  2EIK C;  3K1H A;  5EGY A;  2HV6 A;  3EJN A;  2C03 A;  2O9X A;  2C04 A;  2DGJ A;  4JVS A;  4AX2 A;  2E87 A;  4IJJ A;  5DS4 A;  4N06 A;  4FES A;  3TD7 A;  3S0X A;  5KYY A;  3NDB B;  1D1C A;  1NU9 C;  4BJT A;  1ZHX A;  3S27 A;  2W9Y A;  1MND A;  2IOQ A;  3LNR A;  2NUP B;  1ZHW A;  1V54 C;  2WZG A;  4EBB A;  2FGY A;  3RH3 A;  1G8X A;  1M57 C;  1ZU5 A;  2NUP A;  2WL8 A;  1MMG A;  2Y3D A;  4O6M A;  3B0V C;  4KNV A;  3MLG A;  2W45 A;  2YZS A;  3S28 A;  3JT1 A;  5KYU B;  2ZXW C;  4RDA A;  3L0I A;  3W2V A;  1QZX A;  2EIM C;  3K66 A;  3CZ6 A;  3LLK A;  3OEO A;  5KYU A;  1VYK A;  3K33 A;  3DXJ F;  1FTS A;  4YJW A;  3OWT A;  4O6N A;  2DYS C;  3F47 A;  3Q6N A;  5FCL A;  2R7W A;  4IWB A;  1OKK A;  2J0X A;  2L81 A;  3EG9 A;  3N2Z B;  3FVY A;  5F5H A;  1FMV A;  2L9J A;  4QI2 A;  3F46 A;  3JYH A;  4PJM A;  4U5D E;  3DAF A;  5B1B C;  4E7S A;  3SNH A;  3DAG A;  2A68 F;  2R7S A;  4C3E A;  2Z15 A;  4OIQ F;  2WVN A;  5CI8 A;  5KYX B;  1Z3I X;  1TWC A;  3ABL C;  4AK9 A;  4BJ6 A;  4J32 B;  2XXA A;  2R7T A;  2M4E A;  3PHF 2;  5KYX A;  1VK5 A;  3GOD A;  5T3T A;  3DJN B;  2G3K A;  5HSW A;  3X2Q C;  4CS8 A;  2Y39 A;  1OCC C;  4U5E E;  2XSE A;  2QY9 A;  4Q5S F;  4C7O B;  2J0W A;  3CQZ A;  2FFH A;  4OIP F;  5L3Q A;  4LER A;  4XLN F;  4O79 A;  2ZPA A;  5D92 A;  3LS1 A;  3I5Q A;  4C7O A;  3K7D A;  2LSE A;  4JZA A;  2CW0 F;  4G7Z F;  4DVZ A;  2GFH A;  2PX0 A;  1M56 C;  2A6E F;  3NG1 A;  3HLZ A;  5T3W A;  5D91 A;  1D1B A;  2EIJ C;  1M2V A;  4BJ5 C;  1D0X A;  3JRT A;  1LVK A;  2R7R A;  2H7O A;  3O6X A;  3AG4 C;  3UMK A;  3RYL A;  1M2O A;  3KKB A;  3DZA A;  3ASO C;  2CGE A;  2ZXP A;  2CNW D;  1JPJ A;  1BR1 A;  2Q9A A;  4Q4Z F;  2VH3 A;  4DBQ A;  1S7Z A;  4JW1 A;  2V26 A;  4U5B E;  2H7B A;  2DYR C;  2ZXR A;  2OCC C;  4M63 A;  3EFO A;  3N0T A;  1NG1 A;  3N24 A;  3UMH A;  3KMI A;  1TWA A;  5KYW A;  5DLJ A;  2J7P D;  3POV A;  3M1C B;  2KNH A;  4JUR I;  4PK4 A;  3DD7 A;  3MX3 A;  3B9Q A;  2P7V A;  2KQ9 A;  4A2N B;  3UGO A;  1FFT C;  5T1D B;  2WZF A;  3AQB A;  1OCO C;  3SZR A;  3SYN A;  4XLP F;  3LEV A;  4YT4 A;  2G62 A;  3Q7L A;  4W8K A;  4IAO A;  4PJN A;  3K6B A;  3KL4 A;  4KNW A;  3ZVR A;  3T4R A;  4C3D A;  2A1D D;  3W8I A;  2KJG A;  3EGD B;  1MMN A;  3NYL A;  5DS6 A;  3ECS A;  2CDQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...