4ULWA

Crystal structure of the roq-domain of human roquin1
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
150
structure length
150
Chain Sequence
b'LSSNLWAAVRARGCQFLGPAMQEEALKLVLLALEDGSALSRKVLVLFVVQRLEPRFPQASKTSIGHVVQLLYRASCFKVTKRDEDSSLMQLKEEFRTYEALRREHDSQIVQIAMEAGLRIAPDQWSSLLYGDQSHKSHMQSIIDKLQTPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ROQUIN-1
publication title Roquin Binding to Target Mrnas Involves a Winged Helix-Turn- Helix Motif.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 51
structure length 150
sequence length 150
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2014-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18386 ROQ_II Roquin II domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1790 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4ulwA00
4QI2A 4ZLCA 5F5HA 4ZLDA 4YWQA 5F5FA 3X1OA 4QI0A 4ULWA
chains in the Genus database with same CATH superfamily
4C3DA 3UNGC 1VLSA 1LIHA 2UUHA 1OCCC 2J0WA 3RIPA 1WTYA 2HZ8A 4MTGA 1AUEA 2VH3A 3AQCA 1GS9A 1H9GA 5KYUA 3X2QC 5D91A 3ASOC 1Z23A 4O6NA 3T6JA 1J8YF 4LDRA 2OEVA 3V5ZA 3VYWA 4D4XA 1MMGA 2XLVA 3IQ5A 5DQZA 4E0IA 2YLDA 3DAFA 3NYMA 2KSFA 1T01A 4XWJA 2LFDA 4WJ0A 1G8XA 5KYWA 5T3TA 2KK1A 1FNTc 1JPJA 1W2WA 4WGZA 2WVNA 2YWAA 3ABLC 3SXZA 3QVYA 3ABKC 3ECSA 5A6KA 5E33A 3K1IA 4XLPF 4YL1A 5JVEA 2HKVA 5TJ5E 4ER9A 1E83A 1H9TA 2GWWA 2HSQA 4MVSA 4N4WA 3WODF 3JRTA 4JCZA 3SYNA 2HMQA 3O39A 4FESA 3UGOA 4K1OA 1IW7F 3K1IC 4IB4A 3H2UA 4DVYP 1OW7A 1LI7A 2I15A 1FAPB 3EZIA 3GM2A 2IXNA 2NPUA 1O5HA 5A6BA 2R7XA 3AOUA 1FR0A 1PCXA 1G4US 1WGWA 3DJUB 4EKWA 3S9OA 2MYSA 3DJNB 3B0PA 1ZHXA 2FAPB 1RCPA 1ORJA 2PP4A 3C62A 3EHNA 3K6BA 4KNWA 4AL1A 1Z3IX 4PJLA 5AC4A 4YN0B 4CIHA 3US6A 2YRFA 3FAJA 5BUOA 2CGEA 4P9TA 1FTSA 3A11A 4U5GA 3U8PA 2IM8A 2YL0A 1ZHWA 5L0JA 1XZQA 2WZFA 4ONSA 4OINF 2P6VA 2XLOA 4N6CA 3BRJA 4MVZA 3CQZA 4AE4B 1E85A 3V5YA 2LK4A 3DXJF 2RSEB 1MMNA 2AWCA 4A4AA 2CW0F 1V74B 5HV9A 4UDVA 1VB5A 2P7VA 3AG2C 4YK5A 3MYFA 1TWHA 3PHF2 4IWBA 2L6HA 1F1MA 1TWGA 3KKBA 1TFOB 2KC3A 1OXBA 1QSPA 1ZVZA 4XQ1A 3PMRA 2PX3A 4KC9A 5B3IA 2R7TA 1MMDA 3GEHA 5A6BD 2A1DD 1D1BA 3C7JA 4GYTA 4IRUA 4KBLA 1H7IA 5BQHA 2EINC 4J7TA 2HMZA 1KNYA 5BQGA 2A6HF 2QNLA 1WASA 1CGOA 2ZPAA 1M2VA 3EZHA 4AK9A 3HKKA 3FVYA 3LESA 1R4TA 2LIGA 3FXHA 3LS1A 3N24A 2J9UA 2MHRA 2QTVA 2RD9A 5JS5A 5L3QA 2HV7A 4NQFA 3FOOA 3A9CA 3W2VA 4CJGA 5KYXA 1KU2A 4LLEA 4CJOA 1LM3B 2V26A 3IPMO 1VOMA 3AGTA 4H54A 2A0BA 3EGDB 3S28A 3UMIA 2JX0A 4ULVA 2GAQA 1YDIA 2OG2A 3JTLO 3W2WA 1SMYF 2OQMA 2YL1A 4NTAA 4RDAA 4U5FE 2XL6A 5L0DA 4YT4A 4E17A 3VAYA 3SEOA 4EHPA 1WWPA 2J9BA 1QZXA 3TK0A 2J0XA 1YZCA 3NMKA 1YJGA 1YYJA 2D5RB 2HS5A 2YLGA 2UUIA 3SP1A 4I1OB 1HMDA 3AG1C 1NG1A 3FAPB 3EGDA 3MLGA 3SXMA 3ASNC 5L3VA 5JP7A 1RKEB 3GWNA 3LUTB 1BR4A 3EFOB 3K7DA 2EIKC 2R7OA 2R03A 2DYRC 1PD1A 2F22A 2QUPA 2Y3GA 4OIOF 2XXAA 3B9QA 3L0IA 4G7OF 4LDKA 2EPLX 2KGOA 3BEHA 4Q4ZF 1BBHA 3EH2A 2YL3A 1OKKD 3C8ZA 4QI0A 2OU6A 4O6MA 4J7YA 2XLDA 3I4UA 1ZU4A 2O9XA 3HNIA 3B71A 3JRMO 3KYJA 1LPEA 2Q9BA 2PF4E 4XEFA 2D4UA 2HUJA 4JRZA 4MVOA 4YT2A 4BJ6A 2VCAA 1YA9A 3LLIA 1DOVA 1ZW3A 4I1MA 4MVUA 1V4AA 2XLEA 4OD5A 4CDAA 3DM9B 2B0HA 3RQFA 3PDMP 2EIJC 1GQAA 2J8WA 3LAYA 2IYLD 4MNDA 1SF8A 1GGQA 3OWTA 3CZ6A 4CS9A 3K66A 1Z5ZA 4U9EA 1AEPA 3PCVA 3LLKA 3QVZA 1A41A 4JJGA 4DRIB 2IBFA 1HW1A 1ZW2A 4U9DA 3O10A 1RXQA 3TULA 5DS4A 1TR2A 1FFHA 1VK5A 3QW0A 4AL0A 4ANJA 1BZ4A 3GANA 4JE9A 3UMHA 4D4NA 1E84A 2TMVP 1QKRA 2ZXWC 4GEHA 3EPVA 3LNMB 4P6IC 4PJJA 4U5HA 4YT8A 3V5XA 3S0XA 3CSKA 2ZXRA 5DQTA 5COMA 1VMAA 1BR2A 4XTKA 3HTKC 3M4CA 1YLMA 3HNKA 2X0CA 1WN0A 2L81A 3N2ZB 3QZCA 3TOLA 3TJ5A 3U2MA 3B0VC 2EPNA 2KYHA 1R5ID 4NC3A 1JR8A 1H6GA 4QDLA 1BR1A 2OCCC 4IARA 1Z63A 4AX2A 2M64A 4ULWA 4Z9JA 4YL3A 3EHMA 3IQTA 3FDQA 3GM1A 2W45A 2A68F 4MW3A 2AVKA 3IQCA 3WHNA 3ITFA 4FWVA 5BQIA 1CPRA 3DKAA 3J06A 3SZRA 4JURI 2LCHA 4IAQA 4XPYA 3IEEA 1JMWA 1OQCA 3JYYA 2KQ9A 5D92A 2LP4A 4XLNF 3RW0A 3LJBA 4BPMA 4JEBA 1JPNA 3DWWA 1O3UA 4LDQA 3W8HA 4CDVA 3LNRA 2H7BA 4DOZA 3C8GB 1FMVA 1OR2A 5B3SC 1Y6DA 4JVSA 2Q3TA 2QE9A 4DBQA 4JTDB 5JRAA 3G50A 2ZXPA 2Z15A 3FMSA 1XZPA 1YAUO 4MQ9F 2YKZA 3AQBA 4BG0A 1HE1A 5IY5C 1MMAA 2J9VA 4EUKB 2DI3A 1A7VA 4P9FA 3ZQVA 4C3EA 2IXOA 4JKVA 2H7OA 1TKNA 2R7WA 4I44A 2I8BA 4BJTA 1RMVA 1QLEC 1LS4A 2EPMX 2OJED 4IJJA 5GPGB 3ZSUA 5COGA 3L8JA 1MNDA 4N06A 3X1OA 2LFFA 2LSEA 1OR3A 3O55A 2R7RA 1JAFA 1U89A 4DRHB 4LLCA 2BE5F 1YZAA 3KMIA 3NRHA 3SXYA 2GFHA 2YZSA 1NFNA 1ZZPA 2IOQA 2IXMA 2QY9A 2G62A 1MNEA 3DD7A 2R7UA 2VC9A 1AVOB 4XEVA 4AE4A 1ORYA 2H8AA 3JCUQ 4JJFA 1NFOA 5F28E 1VYIA 4DXWA 5A6AA 4EBBA 4PK4A 3VRCA 1G5ZA 2ETSA 3Q7LA 5KYNA 5K0IA 5DVWA 3Q6NA 3EG9B 4A2NB 2AWYA 2NSFA 3S27A 2W4MA 1K05A 1D0YA 3AGUA 1U6HA 4PJNA 4X0RA 1YA7O 2A0UA 3I5QA 3G4XA 4JTCB 4OIRF 2OKUA 3DAGA 4Z9HA 1MQVA 4BEMJ 1LE2A 4DJ9A 2GDCA 4E18A 4MW8A 5B1BC 5L0IA 3KPHA 1HE9A 3SXKA 2KW3C 2IXPA 4U5DE 2EILC 2JD3A 4M63A 1OCOC 1BDJB 5E3AA 5DS5A 1UFBA 2Q00A 1NBBA 2YEVA 1ZU5A 3NG1A 3R2PA 4MVQA 4W8KA 2NSGA 3NKEA 1NU7D 4XEKA 3RQGA 4DRJB 4O79A 5HSWA 2EIMC 3H65A 1M2OA 2ZD9A 2Q9AA 4NTBA 3ZDLA 1ZHZA 2VCBA 1Q0KA 2G3KA 1TWCA 4BJ5A 3ZWIA 3LS0A 1Z6AA 3KH2A 2G3VA 2P0NA 2A69F 2NG1A 2M4EA 5FCLA 2EPOA 5F5FA 3S90A 3ZG1A 1G4WR 3CAXA 3T6BA 4KNVA 4U5CE 4YT5A 3U3FA 2CNWA 1RKCA 3ABMC 4MS2A 5L0FA 2L9JA 1LKXA 5EHHA 1CGNA 1E86A 2XLMA 1A7DA 1KTMA 4E7ZA 1RKEA 1S05A 4ZLCA 3DE9A 3EFOA 3GWLA 4JTAB 3T4RA 4KI2A 1WOLA 1YARO 3F47A 3GM3A 2NUTB 3QW1A 2EPKX 4LERA 2OEXA 4WABA 4PFOA 1TQGA 2PFDA 4DVZA 3DZAA 1CGME 2R02A 2P1AA 5FZTA 4E0HA 3CEXA 3T6GB 2KNHA 2W4BA 1EKYA 2YVKA 2PNOA 4JIOA 4BJ6C 2CDQA 2WVOA 2YLIA 3RVZA 1VTMP 4CS8A 4JEAA 1D0XA 4RD9A 2NUTA 2L6GA 3K33A 3AG4C 4B6IA 4DBRA 1CPQA 5KYYA 2Q4FA 2GA0A 3Q6MA 2W9YA 3NMIA 2LQGA 1SZIA 5EK0A 1L7CA 3FOPA 3RVYA 3QMKA 4EBKA 2AU5A 4FX5A 3ZVRA 5DS6A 5L0HA 4CS9C 4H4KC 1N1CA 5L0GA 1A0BA 3JZ0A 2HFIA 1K04A 3DI5A 2CCYA 4C3BA 2HJ3A 4OIQF 3RYLA 2WVQA 1OW6A 4I3MA 1JRAA 4F4BA 2L6FA 4JC7A 3JSEO 5KYUB 3NYJA 3QTHA 5T3WA 4CX9A 5CIVA 2CNWD 1EI7A 2R9RB 4N6HA 1OXKA 3AJMA 3M4BA 2XSEA 4K7BA 4GQHA 3IQ6A 3H2VA 2WZLA 2WB7A 4EIYA 3LEVA 1ST6A 4CS7A 1IZMA 1I4YA 1APCA 1PD0A 3M15A 5JSLA 1M6TA 5T1DB 5KYWB 2LD6A 3POVA 1QPUA 1D1CA 2FGYA 3MX3A 5CI9A 3U0CA 1DOWA 1ZHTA 1FFTC 2B0JA 4O7GA 3TD7A 2Y3BA 3DE8A 2PBEA 2QLAA 2JPUA 4NY3A 3U8VA 3TQOA 3L8IA 2J45A 1O87A 2Y3HA 2PX0A 3LEOA 4IAOA 1HW2A 1E2XA 4PR9A 2C04A 4OIPF 3RFYA 2WL8A 2R7QA 2CYDA 2XRHA 4XPXA 1V55C 2XS8A 3F46A 2XLWA 3NYLA 4XPWA 1LI5A 2P61A 2XL4A 4O6YA 4HE8D 3OEOA 2XLHA 1FMWA 1SYQA 2J7PA 2Y39A 3C8GA 3NMJA 4Q7CA 4BJ1A 1C02A 2ASRA 3VF0A 3U9JA 3ATPA 2FFHA 3S84A 2L7AA 5JLIA 3EQLF 1K40A 3SNHA 4CBEA 4PJMA 2NUPB 1Q0MA 3ZC4A 3GEIA 1C03A 1VYKA 2OOCA 2XL8A 2DGJA 1HY5A 3HNLA 1M57C 3RH3A 3S29A 5F5HA 3ZIBA 1D1AA 4C7OB 4ZLDA 3RKOF 1C17M 5COFA 4E7SA 4G78A 1Y4CA 2C03A 4J32B 3OA1A 1NLXA 3HLZA 1L3PA 3ZTMA 1B68A 1OCRC 2NUPA 4CSAA 256BA 2Q9CA 4WGYA 3R7CA 4Z9IA 1NSGB 4JZAA 3GORA 1XWJA 3E70C 4MTOA 4C7OA 2R7VA 4Q5SF 4R32A 3ZQYA 4CSAC 1ZYRF 5L0CA 4G7HF 4JW1A 3MFNA 2Y69C 4HEAJ 4QI2A 1S7ZA 1ORSC 3NDBB 4NTFA 1TWAA 1JOGA 2X51A 2J9WA 4G0HA 2ZXOA 1LE4A 2J7PD 3C8GD 3ZTZA 5A6JA 3O6XA 1M2VB 1LVKA 1Q0GA 3EG9A 3IHUA 1ZHYA 2YHSA 4MTFA 4NCQA 3WG7C 4MVRA 4EBJA 4CIPA 3TOMA 5E3CA 2VASA 1T9KA 1Q0DA 2HV6A 3B29A 3M1CB 5AGFA 3GEEA 3W4YA 5KYXB 2DB4A 3U2LA 3MYIA 4FAPB 2H7VC 3G4ZA 1OKKA 1I4ZA 1U0BB 3W8IA 1OCZC 1QQ3A 3HJCA 1J8MF 4YL0A 1Q0FA 3UGPA 4J30B 2E87A 3TJ6A 3V7OA 1YYXA 1YVIA 5A69A 2YL7A 5JUAA 4BJ5C 1T6UA 3JSZA 3M79A 4CDYA 1T5OA 3AG3C 1LS1A 1T6QA 2AP3A 2KJGA 3FHDA 2HJMA 1I5NA 1VLTA 1PV3A 2WZGA 4HFFB 4PFPA 5CI8A 3VM6A 5DLJA 1M56C 3K1HA 2OJQA 3T9OA 3GODA 1V54C 2XM4A 1UG7A 3NKDA 1TFKB 1WATA 2BL2A 1GM5A 3C18A 4JCHA 1D0ZA 2XM0A 2XXAB 1A7EA 1HMOA 1SR2A 4LACB 3JYHA 3KL4A 1NU9C 3EH1A 1OW8A 5E2QA 3C63A 4U5EE 4U5BE 2Q7RA 4EWCA 3MBGA 3DM5A 2BC5A 4YJWA 3U3BA 1Z7Qc 3UR3C 4IGGA 2R05A 3E9VA 2DYSC 2J46A 3HNJA 1EA8A 3EGXB 3KYIA 4L6RA 3L1MA 3RQEA 5KYYB 5EGYA 2VB6A 3EJNA 5B1AC 1T6IA 2Y3DA 5AC5A 2R25A 4PACA 3UMKA 3B0UX 1RJ9B 4OD4A 2R7SA 2XS1A 4W8PA 3RF3A 1QVXA 2ICWG 2HSBA 4HFKB 3N0TA 3U5SA 4CS8C 4YWQA 2YQYA 2A6EF 4K0DA 4BEJA 2V3CC 3EGXA 2VCCA 3L34A 3WAQA 3Q7GA 4RBNA 3JT1A 3DMDA 2MWQA 1NZEA 3I5PA 1EQ1A 5JT4A 1RJ9A 3U9MA 4G7ZF 4MVMA
chains in the Genus database with same CATH topology
4C3DA 3UNGC 1OCCC 2J0WA 3RIPA 2VH3A 3AQCA 5KYUA 3X2QC 5D91A 3ASOC 1Z23A 4O6NA 3T6JA 1J8YF 3VYWA 1MMGA 5DQZA 3NYMA 3DAFA 4XWJA 4WJ0A 1G8XA 5KYWA 5T3TA 1JPJA 1W2WA 2WVNA 3ABLC 3ABKC 3ECSA 5E33A 4XLPF 3WODF 3JRTA 3SYNA 3O39A 4FESA 3UGOA 1IW7F 3K1IC 4DVYP 3EZIA 2IXNA 1O5HA 2R7XA 1PCXA 1WGWA 3DJUB 2MYSA 3DJNB 3B0PA 1ZHXA 2PP4A 3EHNA 3K6BA 4KNWA 1Z3IX 4PJLA 4YN0B 4CIHA 3FAJA 5BUOA 2CGEA 1FTSA 4U5GA 1ZHWA 2WZFA 4OINF 2P6VA 3CQZA 4AE4B 3DXJF 1MMNA 2CW0F 2P7VA 3AG2C 1TWHA 3PHF2 4IWBA 1TWGA 3KKBA 3PMRA 2PX3A 4KC9A 2R7TA 1MMDA 2A1DD 1D1BA 4GYTA 4IRUA 4KBLA 2EINC 2A6HF 2ZPAA 1M2VA 3EZHA 4AK9A 3FVYA 3LESA 3LS1A 3N24A 2J9UA 2QTVA 5L3QA 2HV7A 3W2VA 5KYXA 1KU2A 4LLEA 2V26A 3UMIA 1VOMA 3EGDB 3S28A 2OG2A 3W2WA 1SMYF 4RDAA 4U5FE 4YT4A 3VAYA 3SEOA 1QZXA 2J0XA 2D5RB 3SP1A 4I1OB 3AG1C 3MLGA 1NG1A 3NDBB 3EGDA 5L3VA 3ASNC 1BR4A 3EFOB 3K7DA 2EIKC 2R7OA 2DYRC 1PD1A 2Y3GA 4OIOF 2XXAA 3B9QA 3L0IA 4G7OF 2KGOA 4Q4ZF 3EH2A 4QI0A 1OKKD 4O6MA 3I4UA 1ZU4A 2O9XA 2Q9BA 2PF4E 4YT2A 4BJ6A 5KYYA 3LLIA 4I1MA 4OD5A 3DM9B 2EIJC 3LAYA 2IYLD 4MNDA 1SF8A 3OWTA 4CS9A 3CZ6A 3K66A 1Z5ZA 3LLKA 4JJGA 5DS4A 1TR2A 1FFHA 1VK5A 4ANJA 3GANA 3UMHA 4GEHA 2ZXWC 4P6IC 3EPVA 4PJJA 4U5HA 4YT8A 3S0XA 3CSKA 2ZXRA 5DQTA 1VMAA 1BR2A 4XTKA 3HTKC 3B0VC 2L81A 3QZCA 3N2ZB 4QDLA 1BR1A 2OCCC 1Z63A 4AX2A 4ULWA 3EHMA 3FDQA 2W45A 2A68F 3ITFA 4FWVA 3SZRA 4JURI 5D92A 3IEEA 4XLNF 2KQ9A 3LJBA 3W8HA 1JPNA 4DOZA 3LNRA 2H7BA 1FMVA 5B3SC 4JVSA 2Q3TA 4DBQA 2ZXPA 2Z15A 4MQ9F 3AQBA 4BG0A 5IY5C 1MMAA 2J9VA 4C3EA 2IXOA 2H7OA 1TKNA 4I44A 2I8BA 4BJTA 1QLEC 4IJJA 3ZSUA 1MNDA 4N06A 3X1OA 2LSEA 2R7RA 4LLCA 2BE5F 3KMIA 3NRHA 2GFHA 2YZSA 2IOQA 2IXMA 2QY9A 2G62A 1MNEA 3DD7A 4AE4A 4JJFA 3JCUQ 1VYIA 4EBBA 4PK4A 3Q7LA 5KYNA 5DVWA 3Q6NA 3EG9B 4A2NB 3S27A 2W4MA 1D0YA 4X0RA 4PJNA 3I5QA 4OIRF 3DAGA 5B1BC 2KW3C 2IXPA 4U5DE 2EILC 2JD3A 4M63A 1OCOC 5E3AA 5DS5A 2YEVA 1ZU5A 3NG1A 4W8KA 3NKEA 1NU7D 5HSWA 4O79A 2EIMC 3H65A 1M2OA 2Q9AA 1ZHZA 2G3KA 1TWCA 4BJ5A 3LS0A 1Z6AA 3KH2A 2G3VA 2A69F 2NG1A 2M4EA 5FCLA 5F5FA 3ZG1A 3T6BA 4KNVA 4U5CE 4YT5A 2CNWA 3ABMC 2L9JA 1LKXA 5EHHA 4E7ZA 4ZLCA 3T4RA 3EFOA 4KI2A 3F47A 2NUTB 4LERA 4DVZA 4PFOA 2PFDA 3DZAA 2KNHA 2W4BA 4BJ6C 2CDQA 2WVOA 4CS8A 1D0XA 4RD9A 2NUTA 3K33A 4B6IA 3AG4C 4DBRA 3Q6MA 2W9YA 1SZIA 2R7UA 5DS6A 3QMKA 3ZVRA 4FX5A 4CS9C 4H4KC 1N1CA 4C3BA 4OIQF 3RYLA 2WVQA 4I3MA 4F4BA 5KYUB 3NYJA 5T3WA 2CNWD 2XSEA 4K7BA 2WZLA 2WB7A 3LEVA 1ST6A 4CS7A 1IZMA 1PD0A 5T1DB 5KYWB 3POVA 2FGYA 1D1CA 3MX3A 5CI9A 1ZHTA 2B0JA 1FFTC 4O7GA 3TD7A 2Y3BA 4NY3A 2J45A 1O87A 2Y3HA 2PX0A 4IAOA 4OIPF 2C04A 3RFYA 2WL8A 2R7QA 2XRHA 1V55C 3F46A 3NYLA 2XL4A 4O6YA 4HE8D 3OEOA 1FMWA 2J7PA 2Y39A 4BJ1A 4Q7CA 2FFHA 3EQLF 3SNHA 4CBEA 4PJMA 2NUPB 3ZC4A 1VYKA 2DGJA 1M57C 3RH3A 3S29A 5F5HA 3ZIBA 1D1AA 4C7OB 4ZLDA 3RKOF 4E7SA 2C03A 4J32B 3OA1A 3HLZA 4CSAA 1OCRC 2NUPA 2Q9CA 4JZAA 3E70C 4C7OA 2R7VA 4Q5SF 4CSAC 1ZYRF 4G7HF 4JW1A 2Y69C 4HEAJ 4QI2A 1S7ZA 1TWAA 2X51A 2J9WA 4G0HA 2ZXOA 2J7PD 3O6XA 1M2VB 1LVKA 3EG9A 1ZHYA 2YHSA 3WG7C 5E3CA 2VASA 2HV6A 3M1CB 5KYXB 2H7VC 1OKKA 3W8IA 1OCZC 3HJCA 1J8MF 3UGPA 4J30B 2E87A 3V7OA 4BJ5C 3JSZA 3AG3C 1LS1A 2KJGA 3UR3C 3FHDA 2WZGA 4HFFB 4PFPA 5CI8A 5DLJA 2R7WA 1M56C 3K1HA 3GODA 1V54C 3NKDA 4JCHA 1D0ZA 2XXAB 4LACB 3JYHA 3KL4A 1NU9C 3EH1A 5E2QA 4U5EE 4U5BE 4EWCA 3DM5A 4YJWA 3E9VA 2DYSC 2J46A 3EGXB 5KYYB 5EGYA 3EJNA 2VB6A 5B1AC 2Y3DA 3UMKA 3B0UX 1RJ9B 4OD4A 2R7SA 4HFKB 3N0TA 4CS8C 4YWQA 2A6EF 4K0DA 4BEJA 2V3CC 3EGXA 3L34A 3Q7GA 4RBNA 3JT1A 3DMDA 2MWQA 1NZEA 3I5PA 1RJ9A 4G7ZF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QI2 A;  4ZLC A;  5F5H A;  4ZLD A;  4YWQ A;  5F5F A;  3X1O A;  4QI0 A;  4ULW A; 
#chains in the Genus database with same CATH topology
 4C3D A;  3UNG C;  1VLS A;  1LIH A;  2UUH A;  1OCC C;  2J0W A;  3RIP A;  1WTY A;  2HZ8 A;  4MTG A;  1AUE A;  2VH3 A;  3AQC A;  1GS9 A;  1H9G A;  5KYU A;  3X2Q C;  5D91 A;  3ASO C;  1Z23 A;  4O6N A;  3T6J A;  1J8Y F;  4LDR A;  2OEV A;  3V5Z A;  3VYW A;  4D4X A;  1MMG A;  2XLV A;  3IQ5 A;  5DQZ A;  4E0I A;  2YLD A;  3DAF A;  3NYM A;  2KSF A;  1T01 A;  4XWJ A;  2LFD A;  4WJ0 A;  1G8X A;  5KYW A;  5T3T A;  2KK1 A;  1FNT c;  1JPJ A;  1W2W A;  4WGZ A;  2WVN A;  2YWA A;  3ABL C;  3SXZ A;  3QVY A;  3ABK C;  3ECS A;  5A6K A;  5E33 A;  3K1I A;  4XLP F;  4YL1 A;  5JVE A;  2HKV A;  5TJ5 E;  4ER9 A;  1E83 A;  1H9T A;  2GWW A;  2HSQ A;  4MVS A;  4N4W A;  3WOD F;  3JRT A;  4JCZ A;  3SYN A;  2HMQ A;  3O39 A;  4FES A;  3UGO A;  4K1O A;  1IW7 F;  3K1I C;  4IB4 A;  3H2U A;  4DVY P;  1OW7 A;  1LI7 A;  2I15 A;  1FAP B;  3EZI A;  3GM2 A;  2IXN A;  2NPU A;  1O5H A;  5A6B A;  2R7X A;  3AOU A;  1FR0 A;  1PCX A;  1G4U S;  1WGW A;  3DJU B;  4EKW A;  3S9O A;  2MYS A;  3DJN B;  3B0P A;  1ZHX A;  2FAP B;  1RCP A;  1ORJ A;  2PP4 A;  3C62 A;  3EHN A;  3K6B A;  4KNW A;  4AL1 A;  1Z3I X;  4PJL A;  5AC4 A;  4YN0 B;  4CIH A;  3US6 A;  2YRF A;  3FAJ A;  5BUO A;  2CGE A;  4P9T A;  1FTS A;  3A11 A;  4U5G A;  3U8P A;  2IM8 A;  2YL0 A;  1ZHW A;  5L0J A;  1XZQ A;  2WZF A;  4ONS A;  4OIN F;  2P6V A;  2XLO A;  4N6C A;  3BRJ A;  4MVZ A;  3CQZ A;  4AE4 B;  1E85 A;  3V5Y A;  2LK4 A;  3DXJ F;  2RSE B;  1MMN A;  2AWC A;  4A4A A;  2CW0 F;  1V74 B;  5HV9 A;  4UDV A;  1VB5 A;  2P7V A;  3AG2 C;  4YK5 A;  3MYF A;  1TWH A;  3PHF 2;  4IWB A;  2L6H A;  1F1M A;  1TWG A;  3KKB A;  1TFO B;  2KC3 A;  1OXB A;  1QSP A;  1ZVZ A;  4XQ1 A;  3PMR A;  2PX3 A;  4KC9 A;  5B3I A;  2R7T A;  1MMD A;  3GEH A;  5A6B D;  2A1D D;  1D1B A;  3C7J A;  4GYT A;  4IRU A;  4KBL A;  1H7I A;  5BQH A;  2EIN C;  4J7T A;  2HMZ A;  1KNY A;  5BQG A;  2A6H F;  2QNL A;  1WAS A;  1CGO A;  2ZPA A;  1M2V A;  3EZH A;  4AK9 A;  3HKK A;  3FVY A;  3LES A;  1R4T A;  2LIG A;  3FXH A;  3LS1 A;  3N24 A;  2J9U A;  2MHR A;  2QTV A;  2RD9 A;  5JS5 A;  5L3Q A;  2HV7 A;  4NQF A;  3FOO A;  3A9C A;  3W2V A;  4CJG A;  5KYX A;  1KU2 A;  4LLE A;  4CJO A;  1LM3 B;  2V26 A;  3IPM O;  1VOM A;  3AGT A;  4H54 A;  2A0B A;  3EGD B;  3S28 A;  3UMI A;  2JX0 A;  4ULV A;  2GAQ A;  1YDI A;  2OG2 A;  3JTL O;  3W2W A;  1SMY F;  2OQM A;  2YL1 A;  4NTA A;  4RDA A;  4U5F E;  2XL6 A;  5L0D A;  4YT4 A;  4E17 A;  3VAY A;  3SEO A;  4EHP A;  1WWP A;  2J9B A;  1QZX A;  3TK0 A;  2J0X A;  1YZC A;  3NMK A;  1YJG A;  1YYJ A;  2D5R B;  2HS5 A;  2YLG A;  2UUI A;  3SP1 A;  4I1O B;  1HMD A;  3AG1 C;  1NG1 A;  3FAP B;  3EGD A;  3MLG A;  3SXM A;  3ASN C;  5L3V A;  5JP7 A;  1RKE B;  3GWN A;  3LUT B;  1BR4 A;  3EFO B;  3K7D A;  2EIK C;  2R7O A;  2R03 A;  2DYR C;  1PD1 A;  2F22 A;  2QUP A;  2Y3G A;  4OIO F;  2XXA A;  3B9Q A;  3L0I A;  4G7O F;  4LDK A;  2EPL X;  2KGO A;  3BEH A;  4Q4Z F;  1BBH A;  3EH2 A;  2YL3 A;  1OKK D;  3C8Z A;  4QI0 A;  2OU6 A;  4O6M A;  4J7Y A;  2XLD A;  3I4U A;  1ZU4 A;  2O9X A;  3HNI A;  3B71 A;  3JRM O;  3KYJ A;  1LPE A;  2Q9B A;  2PF4 E;  4XEF A;  2D4U A;  2HUJ A;  4JRZ A;  4MVO A;  4YT2 A;  4BJ6 A;  2VCA A;  1YA9 A;  3LLI A;  1DOV A;  1ZW3 A;  4I1M A;  4MVU A;  1V4A A;  2XLE A;  4OD5 A;  4CDA A;  3DM9 B;  2B0H A;  3RQF A;  3PDM P;  2EIJ C;  1GQA A;  2J8W A;  3LAY A;  2IYL D;  4MND A;  1SF8 A;  1GGQ A;  3OWT A;  3CZ6 A;  4CS9 A;  3K66 A;  1Z5Z A;  4U9E A;  1AEP A;  3PCV A;  3LLK A;  3QVZ A;  1A41 A;  4JJG A;  4DRI B;  2IBF A;  1HW1 A;  1ZW2 A;  4U9D A;  3O10 A;  1RXQ A;  3TUL A;  5DS4 A;  1TR2 A;  1FFH A;  1VK5 A;  3QW0 A;  4AL0 A;  4ANJ A;  1BZ4 A;  3GAN A;  4JE9 A;  3UMH A;  4D4N A;  1E84 A;  2TMV P;  1QKR A;  2ZXW C;  4GEH A;  3EPV A;  3LNM B;  4P6I C;  4PJJ A;  4U5H A;  4YT8 A;  3V5X A;  3S0X A;  3CSK A;  2ZXR A;  5DQT A;  5COM A;  1VMA A;  1BR2 A;  4XTK A;  3HTK C;  3M4C A;  1YLM A;  3HNK A;  2X0C A;  1WN0 A;  2L81 A;  3N2Z B;  3QZC A;  3TOL A;  3TJ5 A;  3U2M A;  3B0V C;  2EPN A;  2KYH A;  1R5I D;  4NC3 A;  1JR8 A;  1H6G A;  4QDL A;  1BR1 A;  2OCC C;  4IAR A;  1Z63 A;  4AX2 A;  2M64 A;  4ULW A;  4Z9J A;  4YL3 A;  3EHM A;  3IQT A;  3FDQ A;  3GM1 A;  2W45 A;  2A68 F;  4MW3 A;  2AVK A;  3IQC A;  3WHN A;  3ITF A;  4FWV A;  5BQI A;  1CPR A;  3DKA A;  3J06 A;  3SZR A;  4JUR I;  2LCH A;  4IAQ A;  4XPY A;  3IEE A;  1JMW A;  1OQC A;  3JYY A;  2KQ9 A;  5D92 A;  2LP4 A;  4XLN F;  3RW0 A;  3LJB A;  4BPM A;  4JEB A;  1JPN A;  3DWW A;  1O3U A;  4LDQ A;  3W8H A;  4CDV A;  3LNR A;  2H7B A;  4DOZ A;  3C8G B;  1FMV A;  1OR2 A;  5B3S C;  1Y6D A;  4JVS A;  2Q3T A;  2QE9 A;  4DBQ A;  4JTD B;  5JRA A;  3G50 A;  2ZXP A;  2Z15 A;  3FMS A;  1XZP A;  1YAU O;  4MQ9 F;  2YKZ A;  3AQB A;  4BG0 A;  1HE1 A;  5IY5 C;  1MMA A;  2J9V A;  4EUK B;  2DI3 A;  1A7V A;  4P9F A;  3ZQV A;  4C3E A;  2IXO A;  4JKV A;  2H7O A;  1TKN A;  2R7W A;  4I44 A;  2I8B A;  4BJT A;  1RMV A;  1QLE C;  1LS4 A;  2EPM X;  2OJE D;  4IJJ A;  5GPG B;  3ZSU A;  5COG A;  3L8J A;  1MND A;  4N06 A;  3X1O A;  2LFF A;  2LSE A;  1OR3 A;  3O55 A;  2R7R A;  1JAF A;  1U89 A;  4DRH B;  4LLC A;  2BE5 F;  1YZA A;  3KMI A;  3NRH A;  3SXY A;  2GFH A;  2YZS A;  1NFN A;  1ZZP A;  2IOQ A;  2IXM A;  2QY9 A;  2G62 A;  1MNE A;  3DD7 A;  2R7U A;  2VC9 A;  1AVO B;  4XEV A;  4AE4 A;  1ORY A;  2H8A A;  3JCU Q;  4JJF A;  1NFO A;  5F28 E;  1VYI A;  4DXW A;  5A6A A;  4EBB A;  4PK4 A;  3VRC A;  1G5Z A;  2ETS A;  3Q7L A;  5KYN A;  5K0I A;  5DVW A;  3Q6N A;  3EG9 B;  4A2N B;  2AWY A;  2NSF A;  3S27 A;  2W4M A;  1K05 A;  1D0Y A;  3AGU A;  1U6H A;  4PJN A;  4X0R A;  1YA7 O;  2A0U A;  3I5Q A;  3G4X A;  4JTC B;  4OIR F;  2OKU A;  3DAG A;  4Z9H A;  1MQV A;  4BEM J;  1LE2 A;  4DJ9 A;  2GDC A;  4E18 A;  4MW8 A;  5B1B C;  5L0I A;  3KPH A;  1HE9 A;  3SXK A;  2KW3 C;  2IXP A;  4U5D E;  2EIL C;  2JD3 A;  4M63 A;  1OCO C;  1BDJ B;  5E3A A;  5DS5 A;  1UFB A;  2Q00 A;  1NBB A;  2YEV A;  1ZU5 A;  3NG1 A;  3R2P A;  4MVQ A;  4W8K A;  2NSG A;  3NKE A;  1NU7 D;  4XEK A;  3RQG A;  4DRJ B;  4O79 A;  5HSW A;  2EIM C;  3H65 A;  1M2O A;  2ZD9 A;  2Q9A A;  4NTB A;  3ZDL A;  1ZHZ A;  2VCB A;  1Q0K A;  2G3K A;  1TWC A;  4BJ5 A;  3ZWI A;  3LS0 A;  1Z6A A;  3KH2 A;  2G3V A;  2P0N A;  2A69 F;  2NG1 A;  2M4E A;  5FCL A;  2EPO A;  5F5F A;  3S90 A;  3ZG1 A;  1G4W R;  3CAX A;  3T6B A;  4KNV A;  4U5C E;  4YT5 A;  3U3F A;  2CNW A;  1RKC A;  3ABM C;  4MS2 A;  5L0F A;  2L9J A;  1LKX A;  5EHH A;  1CGN A;  1E86 A;  2XLM A;  1A7D A;  1KTM A;  4E7Z A;  1RKE A;  1S05 A;  4ZLC A;  3DE9 A;  3EFO A;  3GWL A;  4JTA B;  3T4R A;  4KI2 A;  1WOL A;  1YAR O;  3F47 A;  3GM3 A;  2NUT B;  3QW1 A;  2EPK X;  4LER A;  2OEX A;  4WAB A;  4PFO A;  1TQG A;  2PFD A;  4DVZ A;  3DZA A;  1CGM E;  2R02 A;  2P1A A;  5FZT A;  4E0H A;  3CEX A;  3T6G B;  2KNH A;  2W4B A;  1EKY A;  2YVK A;  2PNO A;  4JIO A;  4BJ6 C;  2CDQ A;  2WVO A;  2YLI A;  3RVZ A;  1VTM P;  4CS8 A;  4JEA A;  1D0X A;  4RD9 A;  2NUT A;  2L6G A;  3K33 A;  3AG4 C;  4B6I A;  4DBR A;  1CPQ A;  5KYY A;  2Q4F A;  2GA0 A;  3Q6M A;  2W9Y A;  3NMI A;  2LQG A;  1SZI A;  5EK0 A;  1L7C A;  3FOP A;  3RVY A;  3QMK A;  4EBK A;  2AU5 A;  4FX5 A;  3ZVR A;  5DS6 A;  5L0H A;  4CS9 C;  4H4K C;  1N1C A;  5L0G A;  1A0B A;  3JZ0 A;  2HFI A;  1K04 A;  3DI5 A;  2CCY A;  4C3B A;  2HJ3 A;  4OIQ F;  3RYL A;  2WVQ A;  1OW6 A;  4I3M A;  1JRA A;  4F4B A;  2L6F A;  4JC7 A;  3JSE O;  5KYU B;  3NYJ A;  3QTH A;  5T3W A;  4CX9 A;  5CIV A;  2CNW D;  1EI7 A;  2R9R B;  4N6H A;  1OXK A;  3AJM A;  3M4B A;  2XSE A;  4K7B A;  4GQH A;  3IQ6 A;  3H2V A;  2WZL A;  2WB7 A;  4EIY A;  3LEV A;  1ST6 A;  4CS7 A;  1IZM A;  1I4Y A;  1APC A;  1PD0 A;  3M15 A;  5JSL A;  1M6T A;  5T1D B;  5KYW B;  2LD6 A;  3POV A;  1QPU A;  1D1C A;  2FGY A;  3MX3 A;  5CI9 A;  3U0C A;  1DOW A;  1ZHT A;  1FFT C;  2B0J A;  4O7G A;  3TD7 A;  2Y3B A;  3DE8 A;  2PBE A;  2QLA A;  2JPU A;  4NY3 A;  3U8V A;  3TQO A;  3L8I A;  2J45 A;  1O87 A;  2Y3H A;  2PX0 A;  3LEO A;  4IAO A;  1HW2 A;  1E2X A;  4PR9 A;  2C04 A;  4OIP F;  3RFY A;  2WL8 A;  2R7Q A;  2CYD A;  2XRH A;  4XPX A;  1V55 C;  2XS8 A;  3F46 A;  2XLW A;  3NYL A;  4XPW A;  1LI5 A;  2P61 A;  2XL4 A;  4O6Y A;  4HE8 D;  3OEO A;  2XLH A;  1FMW A;  1SYQ A;  2J7P A;  2Y39 A;  3C8G A;  3NMJ A;  4Q7C A;  4BJ1 A;  1C02 A;  2ASR A;  3VF0 A;  3U9J A;  3ATP A;  2FFH A;  3S84 A;  2L7A A;  5JLI A;  3EQL F;  1K40 A;  3SNH A;  4CBE A;  4PJM A;  2NUP B;  1Q0M A;  3ZC4 A;  3GEI A;  1C03 A;  1VYK A;  2OOC A;  2XL8 A;  2DGJ A;  1HY5 A;  3HNL A;  1M57 C;  3RH3 A;  3S29 A;  5F5H A;  3ZIB A;  1D1A A;  4C7O B;  4ZLD A;  3RKO F;  1C17 M;  5COF A;  4E7S A;  4G78 A;  1Y4C A;  2C03 A;  4J32 B;  3OA1 A;  1NLX A;  3HLZ A;  1L3P A;  3ZTM A;  1B68 A;  1OCR C;  2NUP A;  4CSA A;  256B A;  2Q9C A;  4WGY A;  3R7C A;  4Z9I A;  1NSG B;  4JZA A;  3GOR A;  1XWJ A;  3E70 C;  4MTO A;  4C7O A;  2R7V A;  4Q5S F;  4R32 A;  3ZQY A;  4CSA C;  1ZYR F;  5L0C A;  4G7H F;  4JW1 A;  3MFN A;  2Y69 C;  4HEA J;  4QI2 A;  1S7Z A;  1ORS C;  3NDB B;  4NTF A;  1TWA A;  1JOG A;  2X51 A;  2J9W A;  4G0H A;  2ZXO A;  1LE4 A;  2J7P D;  3C8G D;  3ZTZ A;  5A6J A;  3O6X A;  1M2V B;  1LVK A;  1Q0G A;  3EG9 A;  3IHU A;  1ZHY A;  2YHS A;  4MTF A;  4NCQ A;  3WG7 C;  4MVR A;  4EBJ A;  4CIP A;  3TOM A;  5E3C A;  2VAS A;  1T9K A;  1Q0D A;  2HV6 A;  3B29 A;  3M1C B;  5AGF A;  3GEE A;  3W4Y A;  5KYX B;  2DB4 A;  3U2L A;  3MYI A;  4FAP B;  2H7V C;  3G4Z A;  1OKK A;  1I4Z A;  1U0B B;  3W8I A;  1OCZ C;  1QQ3 A;  3HJC A;  1J8M F;  4YL0 A;  1Q0F A;  3UGP A;  4J30 B;  2E87 A;  3TJ6 A;  3V7O A;  1YYX A;  1YVI A;  5A69 A;  2YL7 A;  5JUA A;  4BJ5 C;  1T6U A;  3JSZ A;  3M79 A;  4CDY A;  1T5O A;  3AG3 C;  1LS1 A;  1T6Q A;  2AP3 A;  2KJG A;  3FHD A;  2HJM A;  1I5N A;  1VLT A;  1PV3 A;  2WZG A;  4HFF B;  4PFP A;  5CI8 A;  3VM6 A;  5DLJ A;  1M56 C;  3K1H A;  2OJQ A;  3T9O A;  3GOD A;  1V54 C;  2XM4 A;  1UG7 A;  3NKD A;  1TFK B;  1WAT A;  2BL2 A;  1GM5 A;  3C18 A;  4JCH A;  1D0Z A;  2XM0 A;  2XXA B;  1A7E A;  1HMO A;  1SR2 A;  4LAC B;  3JYH A;  3KL4 A;  1NU9 C;  3EH1 A;  1OW8 A;  5E2Q A;  3C63 A;  4U5E E;  4U5B E;  2Q7R A;  4EWC A;  3MBG A;  3DM5 A;  2BC5 A;  4YJW A;  3U3B A;  1Z7Q c;  3UR3 C;  4IGG A;  2R05 A;  3E9V A;  2DYS C;  2J46 A;  3HNJ A;  1EA8 A;  3EGX B;  3KYI A;  4L6R A;  3L1M A;  3RQE A;  5KYY B;  5EGY A;  2VB6 A;  3EJN A;  5B1A C;  1T6I A;  2Y3D A;  5AC5 A;  2R25 A;  4PAC A;  3UMK A;  3B0U X;  1RJ9 B;  4OD4 A;  2R7S A;  2XS1 A;  4W8P A;  3RF3 A;  1QVX A;  2ICW G;  2HSB A;  4HFK B;  3N0T A;  3U5S A;  4CS8 C;  4YWQ A;  2YQY A;  2A6E F;  4K0D A;  4BEJ A;  2V3C C;  3EGX A;  2VCC A;  3L34 A;  3WAQ A;  3Q7G A;  4RBN A;  3JT1 A;  3DMD A;  2MWQ A;  1NZE A;  3I5P A;  1EQ1 A;  5JT4 A;  1RJ9 A;  3U9M A;  4G7Z F;  4MVM A; 
#chains in the Genus database with same CATH homology
 4C3D A;  3UNG C;  1OCC C;  2J0W A;  3RIP A;  2VH3 A;  3AQC A;  5KYU A;  3X2Q C;  5D91 A;  3ASO C;  1Z23 A;  4O6N A;  3T6J A;  1J8Y F;  3VYW A;  1MMG A;  5DQZ A;  3NYM A;  3DAF A;  4XWJ A;  4WJ0 A;  1G8X A;  5KYW A;  5T3T A;  1JPJ A;  1W2W A;  2WVN A;  3ABL C;  3ABK C;  3ECS A;  5E33 A;  4XLP F;  3WOD F;  3JRT A;  3SYN A;  3O39 A;  4FES A;  3UGO A;  1IW7 F;  3K1I C;  4DVY P;  3EZI A;  2IXN A;  1O5H A;  2R7X A;  1PCX A;  1WGW A;  3DJU B;  2MYS A;  3DJN B;  3B0P A;  1ZHX A;  2PP4 A;  3EHN A;  3K6B A;  4KNW A;  1Z3I X;  4PJL A;  4YN0 B;  4CIH A;  3FAJ A;  5BUO A;  2CGE A;  1FTS A;  4U5G A;  1ZHW A;  2WZF A;  4OIN F;  2P6V A;  3CQZ A;  4AE4 B;  3DXJ F;  1MMN A;  2CW0 F;  2P7V A;  3AG2 C;  1TWH A;  3PHF 2;  4IWB A;  1TWG A;  3KKB A;  3PMR A;  2PX3 A;  4KC9 A;  2R7T A;  1MMD A;  2A1D D;  1D1B A;  4GYT A;  4IRU A;  4KBL A;  2EIN C;  2A6H F;  2ZPA A;  1M2V A;  3EZH A;  4AK9 A;  3FVY A;  3LES A;  3LS1 A;  3N24 A;  2J9U A;  2QTV A;  5L3Q A;  2HV7 A;  3W2V A;  5KYX A;  1KU2 A;  4LLE A;  2V26 A;  3UMI A;  1VOM A;  3EGD B;  3S28 A;  2OG2 A;  3W2W A;  1SMY F;  4RDA A;  4U5F E;  4YT4 A;  3VAY A;  3SEO A;  1QZX A;  2J0X A;  2D5R B;  3SP1 A;  4I1O B;  3AG1 C;  3MLG A;  1NG1 A;  3NDB B;  3EGD A;  5L3V A;  3ASN C;  1BR4 A;  3EFO B;  3K7D A;  2EIK C;  2R7O A;  2DYR C;  1PD1 A;  2Y3G A;  4OIO F;  2XXA A;  3B9Q A;  3L0I A;  4G7O F;  2KGO A;  4Q4Z F;  3EH2 A;  4QI0 A;  1OKK D;  4O6M A;  3I4U A;  1ZU4 A;  2O9X A;  2Q9B A;  2PF4 E;  4YT2 A;  4BJ6 A;  5KYY A;  3LLI A;  4I1M A;  4OD5 A;  3DM9 B;  2EIJ C;  3LAY A;  2IYL D;  4MND A;  1SF8 A;  3OWT A;  4CS9 A;  3CZ6 A;  3K66 A;  1Z5Z A;  3LLK A;  4JJG A;  5DS4 A;  1TR2 A;  1FFH A;  1VK5 A;  4ANJ A;  3GAN A;  3UMH A;  4GEH A;  2ZXW C;  4P6I C;  3EPV A;  4PJJ A;  4U5H A;  4YT8 A;  3S0X A;  3CSK A;  2ZXR A;  5DQT A;  1VMA A;  1BR2 A;  4XTK A;  3HTK C;  3B0V C;  2L81 A;  3QZC A;  3N2Z B;  4QDL A;  1BR1 A;  2OCC C;  1Z63 A;  4AX2 A;  4ULW A;  3EHM A;  3FDQ A;  2W45 A;  2A68 F;  3ITF A;  4FWV A;  3SZR A;  4JUR I;  5D92 A;  3IEE A;  4XLN F;  2KQ9 A;  3LJB A;  3W8H A;  1JPN A;  4DOZ A;  3LNR A;  2H7B A;  1FMV A;  5B3S C;  4JVS A;  2Q3T A;  4DBQ A;  2ZXP A;  2Z15 A;  4MQ9 F;  3AQB A;  4BG0 A;  5IY5 C;  1MMA A;  2J9V A;  4C3E A;  2IXO A;  2H7O A;  1TKN A;  4I44 A;  2I8B A;  4BJT A;  1QLE C;  4IJJ A;  3ZSU A;  1MND A;  4N06 A;  3X1O A;  2LSE A;  2R7R A;  4LLC A;  2BE5 F;  3KMI A;  3NRH A;  2GFH A;  2YZS A;  2IOQ A;  2IXM A;  2QY9 A;  2G62 A;  1MNE A;  3DD7 A;  4AE4 A;  4JJF A;  3JCU Q;  1VYI A;  4EBB A;  4PK4 A;  3Q7L A;  5KYN A;  5DVW A;  3Q6N A;  3EG9 B;  4A2N B;  3S27 A;  2W4M A;  1D0Y A;  4X0R A;  4PJN A;  3I5Q A;  4OIR F;  3DAG A;  5B1B C;  2KW3 C;  2IXP A;  4U5D E;  2EIL C;  2JD3 A;  4M63 A;  1OCO C;  5E3A A;  5DS5 A;  2YEV A;  1ZU5 A;  3NG1 A;  4W8K A;  3NKE A;  1NU7 D;  5HSW A;  4O79 A;  2EIM C;  3H65 A;  1M2O A;  2Q9A A;  1ZHZ A;  2G3K A;  1TWC A;  4BJ5 A;  3LS0 A;  1Z6A A;  3KH2 A;  2G3V A;  2A69 F;  2NG1 A;  2M4E A;  5FCL A;  5F5F A;  3ZG1 A;  3T6B A;  4KNV A;  4U5C E;  4YT5 A;  2CNW A;  3ABM C;  2L9J A;  1LKX A;  5EHH A;  4E7Z A;  4ZLC A;  3T4R A;  3EFO A;  4KI2 A;  3F47 A;  2NUT B;  4LER A;  4DVZ A;  4PFO A;  2PFD A;  3DZA A;  2KNH A;  2W4B A;  4BJ6 C;  2CDQ A;  2WVO A;  4CS8 A;  1D0X A;  4RD9 A;  2NUT A;  3K33 A;  4B6I A;  3AG4 C;  4DBR A;  3Q6M A;  2W9Y A;  1SZI A;  2R7U A;  5DS6 A;  3QMK A;  3ZVR A;  4FX5 A;  4CS9 C;  4H4K C;  1N1C A;  4C3B A;  4OIQ F;  3RYL A;  2WVQ A;  4I3M A;  4F4B A;  5KYU B;  3NYJ A;  5T3W A;  2CNW D;  2XSE A;  4K7B A;  2WZL A;  2WB7 A;  3LEV A;  1ST6 A;  4CS7 A;  1IZM A;  1PD0 A;  5T1D B;  5KYW B;  3POV A;  2FGY A;  1D1C A;  3MX3 A;  5CI9 A;  1ZHT A;  2B0J A;  1FFT C;  4O7G A;  3TD7 A;  2Y3B A;  4NY3 A;  2J45 A;  1O87 A;  2Y3H A;  2PX0 A;  4IAO A;  4OIP F;  2C04 A;  3RFY A;  2WL8 A;  2R7Q A;  2XRH A;  1V55 C;  3F46 A;  3NYL A;  2XL4 A;  4O6Y A;  4HE8 D;  3OEO A;  1FMW A;  2J7P A;  2Y39 A;  4BJ1 A;  4Q7C A;  2FFH A;  3EQL F;  3SNH A;  4CBE A;  4PJM A;  2NUP B;  3ZC4 A;  1VYK A;  2DGJ A;  1M57 C;  3RH3 A;  3S29 A;  5F5H A;  3ZIB A;  1D1A A;  4C7O B;  4ZLD A;  3RKO F;  4E7S A;  2C03 A;  4J32 B;  3OA1 A;  3HLZ A;  4CSA A;  1OCR C;  2NUP A;  2Q9C A;  4JZA A;  3E70 C;  4C7O A;  2R7V A;  4Q5S F;  4CSA C;  1ZYR F;  4G7H F;  4JW1 A;  2Y69 C;  4HEA J;  4QI2 A;  1S7Z A;  1TWA A;  2X51 A;  2J9W A;  4G0H A;  2ZXO A;  2J7P D;  3O6X A;  1M2V B;  1LVK A;  3EG9 A;  1ZHY A;  2YHS A;  3WG7 C;  5E3C A;  2VAS A;  2HV6 A;  3M1C B;  5KYX B;  2H7V C;  1OKK A;  3W8I A;  1OCZ C;  3HJC A;  1J8M F;  3UGP A;  4J30 B;  2E87 A;  3V7O A;  4BJ5 C;  3JSZ A;  3AG3 C;  1LS1 A;  2KJG A;  3UR3 C;  3FHD A;  2WZG A;  4HFF B;  4PFP A;  5CI8 A;  5DLJ A;  2R7W A;  1M56 C;  3K1H A;  3GOD A;  1V54 C;  3NKD A;  4JCH A;  1D0Z A;  2XXA B;  4LAC B;  3JYH A;  3KL4 A;  1NU9 C;  3EH1 A;  5E2Q A;  4U5E E;  4U5B E;  4EWC A;  3DM5 A;  4YJW A;  3E9V A;  2DYS C;  2J46 A;  3EGX B;  5KYY B;  5EGY A;  3EJN A;  2VB6 A;  5B1A C;  2Y3D A;  3UMK A;  3B0U X;  1RJ9 B;  4OD4 A;  2R7S A;  4HFK B;  3N0T A;  4CS8 C;  4YWQ A;  2A6E F;  4K0D A;  4BEJ A;  2V3C C;  3EGX A;  3L34 A;  3Q7G A;  4RBN A;  3JT1 A;  3DMD A;  2MWQ A;  1NZE A;  3I5P A;  1RJ9 A;  4G7Z F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...