4ULWA

Crystal structure of the roq-domain of human roquin1
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
150
structure length
150
Chain Sequence
LSSNLWAAVRARGCQFLGPAMQEEALKLVLLALEDGSALSRKVLVLFVVQRLEPRFPQASKTSIGHVVQLLYRASCFKVTKRDEDSSLMQLKEEFRTYEALRREHDSQIVQIAMEAGLRIAPDQWSSLLYGDQSHKSHMQSIIDKLQTPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ROQUIN-1
publication title Roquin Binding to Target Mrnas Involves a Winged Helix-Turn- Helix Motif.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 51
structure length 150
sequence length 150
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2014-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18386 ROQ_II Roquin II domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1790 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4ulwA00
4YWQA 4QI0A 3X1OA 4ZLCA 5F5FA 5F5HA 4ZLDA 4QI2A 4ULWA
chains in the Genus database with same CATH superfamily
1AUEA 3ZQYA 2A6EF 3B0UX 4EBKA 4MS2A 3TK0A 3GODA 2H8AA 2WZGA 1V74B 3VYWA 3TQOA 3W2VA 5KYYA 1TR2A 2X0CA 2Y3BA 1RJ9A 3TD7A 2M64A 2LQGA 2EPNA 4AK9A 1QKRA 4I3MA 2GDCA 3C8ZA 1GS9A 1ZHWA 2QNLA 3EH1A 3EZHA 3NKEA 4NTAA 1SMYF 4DXWA 4QDLA 4YWQA 2L81A 2R9RB 1KNYA 1ZZPA 3F46A 3UGPA 2CNWD 1LE4A 2HFIA 3M4CA 3C7JA 4A4AA 1ZYRF 2YL1A 2XLEA 2CW0F 2AVKA 4XPWA 1Q0KA 2DB4A 5AGFA 4CS8A 3ABMC 2GAQA 4JIOA 2LSEA 3DI5A 4N6HA 3W8HA 3DM5A 3FHDA 4ULWA 4ER9A 3EGXB 1QSPA 2HV6A 1V4AA 4JRZA 4YT5A 4HE8D 2LFDA 4LACB 3O10A 3TOLA 3T4RA 2VC9A 3WODF 3X2QC 2XS8A 1MNEA 4CS8C 4LLEA 2Q4FA 1M2OA 5JRAA 3U9MA 1ZHTA 1BR2A 3B0PA 3DD7A 3GEEA 4U5EE 3EJNA 3IHUA 3NRHA 3B29A 2DGJA 1Z6AA 1M57C 4N6CA 3S27A 3RQFA 3IQTA 1WWPA 4RD9A 5KYYB 2OJED 3ABLC 5AC5A 3HNKA 1FMVA 2VASA 4CS9C 5E2QA 3U5SA 3MLGA 1APCA 2OEVA 4PJLA 2RD9A 3GM2A 5COMA 4E18A 3LAYA 1HMOA 2OEXA 4BPMA 4XLPF 1C02A 1JPNA 1ST6A 1OXKA 3T6JA 2VCAA 4XQ1A 5GPGB 1LE2A 2KQ9A 3FOOA 4CJOA 2HJMA 3FXHA 1LKXA 2I8BA 2Q9CA 1MMAA 2J9VA 1Y4CA 1YYJA 4U5FE 1DOWA 4NTFA 5L0FA 3MBGA 2QTVA 3TJ5A 2AWYA 3EZIA 4LDKA 256BA 4LLCA 3L1MA 1OW7A 3N0TA 2IBFA 3M4BA 3RYLA 2B0JA 1YA9A 3AGUA 2HS5A 5KYWB 4XEVA 3KPHA 1LS1A 4C3DA 1NG1A 1IW7F 4YJWA 1JOGA 4N06A 3HJCA 4JVSA 4XPXA 4BJTA 5JUAA 3V7OA 1O3UA 3S9OA 4Z9HA 3MFNA 4OD5A 2A68F 1AVOB 3LS0A 1FFHA 3G50A 2ASRA 2P1AA 5IY5C 1V55C 5E3AA 4MVUA 1JPJA 4R32A 4EHPA 1PV3A 5JS5A 1LPEA 1QLEC 3G4XA 1ZU4A 5E3CA 2R7WA 4LDRA 4MVSA 3NDBB 4Q5SF 2A0BA 1CGME 2I15A 3JSEO 2YL7A 1W2WA 2NUPA 3LNMB 2XXAB 2Q9BA 3EGDA 5CIVA 2M4EA 1JR8A 3VAYA 2NG1A 4OD4A 1OR3A 2Y3DA 4ONSA 3VF0A 1Q0MA 2AP3A 2G3VA 3AG4C 4AX2A 5KYNA 3HLZA 1U0BB 3DJNB 4J30B 3JRMO 1LS4A 2BC5A 2Q3TA 5L0IA 4U5CE 1WATA 3MYIA 3JSZA 1CPQA 4AL0A 4D4NA 1IZMA 3NMJA 4CS7A 3JYYA 4LERA 1D1CA 1GQAA 2WZFA 4I1MA 4A2NB 4QI0A 3UMKA 1Q0GA 1YLMA 4W8PA 3U9JA 3KH2A 3EHMA 3C8GD 1C17M 5L0HA 1RKEA 1YZCA 4E7SA 5A6KA 3K1HA 4MQ9F 3ZC4A 3L8IA 4EBBA 1L3PA 1VK5A 2NPUA 2JPUA 2RSEB 4P6IC 5KYUA 4AE4A 4C7OB 2R7SA 4JC7A 5COGA 4MVZA 4MVOA 2XL8A 4MVMA 2MWQA 3NYJA 4P9TA 1S05A 4OIQF 3IEEA 3CZ6A 3NKDA 2W4BA 1QVXA 3GM1A 1XZPA 3SYNA 1YJGA 2NUPB 3S84A 3HTKC 1VTMP 1OR2A 2WVNA 1JAFA 2CGEA 2LFFA 2XS1A 3O6XA 1GGQA 3H65A 4Z9IA 5A6BD 2XRHA 1S7ZA 2W9YA 3RFYA 1EI7A 1MMDA 2LCHA 3SP1A 2GWWA 1QQ3A 4G7ZF 2IYLD 3GORA 1XZQA 2KJGA 1EKYA 2NSFA 3AQBA 2TMVP 3CAXA 1T9KA 2X51A 1TFOB 2YKZA 3BRJA 3H2UA 1OKKA 2XLVA 3EHNA 4EBJA 4PACA 2C03A 5L0CA 2J45A 3C62A 2CNWA 1D0ZA 1OQCA 5JSLA 2XM4A 4K7BA 1DOVA 1M56C 1NU9C 2YLDA 3JYHA 3EFOB 2IXPA 2PFDA 2NUTA 4BJ1A 5A6JA 2AU5A 1TWHA 3ZG1A 1OKKD 4ANJA 3G4ZA 3F47A 4EWCA 4AE4B 1T6QA 2OOCA 4CJGA 5FCLA 2YVKA 3A9CA 3S29A 4FAPB 3QMKA 3DAFA 1YVIA 2H7OA 3LESA 3QZCA 3CSKA 2R7OA 1KU2A 3LLKA 3T9OA 3KYIA 2YLGA 1OW6A 2ETSA 3KL4A 3MX3A 1FFTC 4KI2A 5EK0A 1G8XA 1K05A 2L6HA 1D1AA 3VRCA 1A0BA 1CPRA 1NLXA 2KW3C 2ZXWC 3U8PA 5K0IA 4GYTA 2Y69C 4YT4A 1R5ID 3W8IA 5DQZA 3GEIA 2YL0A 4KNWA 1Z63A 1NU7D 2EIMC 4OIPF 1T01A 2EILC 3M15A 3CQZA 3S0XA 2Y39A 3FMSA 3GANA 3X1OA 1AEPA 5EHHA 1VB5A 1EA8A 1RJ9B 2XLHA 3Q6NA 4L6RA 3V5YA 3EPVA 4JTCB 2J9BA 3U3FA 4DRJB 5AC4A 1G4US 5L0GA 5KYXA 3BEHA 4IAOA 5F28E 4DOZA 3Q7LA 4FESA 4FX5A 3OEOA 1NFNA 2HUJA 4G7HF 1I5NA 1OCCC 4H4KC 3LLIA 3NG1A 4J7TA 1O5HA 3DWWA 4E0HA 5B1BC 3QVZA 3V5XA 1V54C 4G0HA 3HNJA 3DKAA 1RKCA 2MHRA 3QW1A 3R2PA 4Q4ZF 1J8YF 2QLAA 3SEOA 4JEAA 4OINF 1PD1A 1FR0A 5D92A 3S90A 3B0VC 4KBLA 4YK5A 4I44A 3Q7GA 4XEKA 1TWAA 5D91A 2YRFA 3JT1A 2A69F 2IOQA 2OU6A 2UUHA 3JRTA 4E17A 3E9VA 1YARO 1T6IA 2Y3GA 1LIHA 2A0UA 5F5FA 1F1MA 3M1CB 3SXYA 1LI7A 1OW8A 3KYJA 5HSWA 2CYDA 4GQHA 5BUOA 3UR3C 3LEOA 1LM3B 3RQGA 4NY3A 5JVEA 4P9FA 3DE8A 1U6HA 2L6GA 2R05A 3OA1A 2KSFA 1ZHYA 3ASOC 4CIHA 2EPKX 5JLIA 3GM3A 1SZIA 3AOUA 5T3WA 2Q9AA 2XM0A 5DS4A 2HV7A 4XTKA 3R7CA 1LVKA 5JP7A 2E87A 4PFOA 3UGOA 2R7XA 4YT8A 1EQ1A 1ZHZA 1HE9A 3OWTA 3JTLO 4PK4A 1WTYA 2MYSA 2W4MA 3AG1C 5DVWA 4YL3A 1MMGA 1Q0DA 4DRHB 2H7BA 4CX9A 3KKBA 3C18A 3RH3A 3LS1A 5L3VA 1E2XA 3UMIA 1HY5A 2ZPAA 3NYLA 2ZXOA 4O7GA 4DBQA 1CGNA 2YLIA 1BZ4A 4MVRA 2GFHA 2NSGA 1CGOA 2FAPB 1J8MF 1PD0A 3C8GA 3DM9B 4NC3A 4DJ9A 5DLJA 5DS5A 1SYQA 4K1OA 3DE9A 2PBEA 4RDAA 4RBNA 4JCHA 4QI2A 1SR2A 2EPLX 4YT2A 3V5ZA 3DXJF 2XLMA 3FAJA 4PFPA 1FMWA 4KC9A 2J0XA 3LNRA 3SNHA 4CSAA 1VLSA 3H2VA 4IJJA 4KNVA 4ZLCA 2R7UA 4DBRA 1FNTc 3IQ5A 4O6MA 4OIOF 3ZIBA 2A6HF 1H9GA 1VOMA 2OG2A 5A6BA 1HW2A 1D0YA 3I4UA 2J7PD 1NSGB 3SXKA 4CSAC 4G7OF 3JZ0A 2ICWG 3AQCA 5B1AC 2J8WA 4NCQA 1YAUO 1ZW2A 4IRUA 3GWLA 2UUIA 4I1OB 5EGYA 4JZAA 3IPMO 3TULA 3EGDB 3GWNA 1UG7A 3K1IA 4NQFA 2G3KA 1GM5A 4YL1A 1VYIA 3ZWIA 1OCZC 3RF3A 2L6FA 3EG9A 1OCOC 4U9DA 5DS6A 3C8GB 3HNIA 4JTDB 4N4WA 3SXZA 2KGOA 3K1IC 3VM6A 2VB6A 2VH3A 5T1DB 2PP4A 4CDYA 1U89A 2D5RB 3FAPB 3AG2C 1G4WR 4YN0B 1NZEA 2BE5F 3RVYA 4E0IA 1ZW3A 3A11A 4U9EA 1H9TA 1QPUA 2WVQA 1FAPB 4EIYA 3IQ6A 2XL6A 1RKEB 3EGXA 1BBHA 4LDQA 4EKWA 1JRAA 1Q0FA 4JCZA 5KYUB 4D4XA 2WL8A 1E84A 2EIJC 3WAQA 2EPMX 3RQEA 2R7RA 2YZSA 3AGTA 1K40A 3NYMA 2QY9A 2YHSA 3LEVA 2IXNA 4IARA 4JTAB 4U5HA 4Q7CA 3US6A 3ZSUA 1YYXA 2XLOA 4MTGA 3QTHA 4BEJA 1H6GA 4WGYA 4CIPA 3SZRA 2AWCA 4IB4A 1D0XA 5E33A 4BJ5A 4IAQA 3ITFA 3K6BA 3POVA 1JMWA 2HZ8A 2J9WA 3EG9B 5FZTA 3ZVRA 2V26A 3WHNA 5JT4A 5T3TA 1Z7Qc 4JKVA 3RKOF 4Z9JA 4WABA 3SXMA 4PJNA 4CDAA 5F5HA 4BJ5C 1T6UA 2PX0A 1WOLA 1ORYA 1Y6DA 3ZQVA 1Z5ZA 2VCBA 3ATPA 3CEXA 2XLDA 4JURI 4B6IA 2YQYA 5BQHA 1M2VA 2NUTB 3DZAA 2HSQA 3ZTMA 5BQGA 5L3QA 2YWAA 5A69A 1VLTA 1H7IA 4M63A 5CI9A 3DAGA 1Z3IX 1TWGA 2R7TA 3NMKA 1I4YA 2XLWA 2J46A 3B9QA 4G78A 4XWJA 2QUPA 3DJUB 4HEAJ 3N24A 2G62A 4CS9A 5KYWA 1BDJB 2D4UA 2R7QA 1O87A 2L7AA 4MW8A 3WG7C 4BG0A 2W45A 3L8JA 3ECSA 1ZVZA 3HNLA 5A6AA 2WVOA 1E86A 2R03A 4ULVA 2KC3A 3T6BA 3K33A 4J32B 4J7YA 1D1BA 3GEHA 1B68A 3K7DA 4E7ZA 2DYSC 4O6NA 4JW1A 4CBEA 4XPYA 1NBBA 5L0JA 2OQMA 1N1CA 3I5PA 4MVQA 2ZD9A 5COFA 3PCVA 3FVYA 4CDVA 3TOMA 3FDQA 2IXMA 4MW3A 4X0RA 4GEHA 3FOPA 2LP4A 3IQCA 4HFFB 3U2LA 3TJ6A 2LD6A 1MMNA 2XXAA 3L0IA 1VMAA 1ZHXA 2WZLA 5B3SC 5KYXB 5L0DA 1K04A 4PJJA 4C3BA 3S28A 4DRIB 3LJBA 1MNDA 3UNGC 1M2VB 3LUTB 4BEMJ 3HKKA 2A1DD 3Q6MA 4DVYP 1BR1A 4EUKB 1PCXA 1I4ZA 3PHF2 2Q00A 3QW0A 2ZXRA 4NTBA 4U5GA 2P7VA 2PF4E 2DYRC 2H7VC 3PDMP 2WB7A 1VYKA 2HMQA 2OCCC 3NMIA 3J06A 3MYFA 4MTOA 3W4YA 4DVZA 1BR4A 2JD3A 1LI5A 1A7VA 1ORJA 1WN0A 2XSEA 3AG3C 4PJMA 1KTMA 4C7OA 2KNHA 3T6GB 2PNOA 5B3IA 2VCCA 1E85A 3C63A 2Z15A 4JE9A 4OIRF 3E70C 1HE1A 1ORSC 2BL2A 1YZAA 3ABKC 1RCPA 3N2ZB 1RMVA 2J7PA 1RXQA 2R25A 3JCUQ 4IGGA 4XEFA 3RVZA 2KK1A 4FWVA 4WGZA 3UMHA 2R02A 4AL1A 2CCYA 1E83A 3U0CA 1OCRC 5TJ5E 3U2MA 2YL3A 2J0WA 3ZDLA 1ZU5A 2F22A 1A41A 2OKUA 3EH2A 3RW0A 2Y3HA 2C04A 1HW1A 1NFOA 3AJMA 3W2WA 4UDVA 2HSBA 1T5OA 1G5ZA 2JX0A 3L34A 4H54A 3RIPA 1TKNA 2B0HA 2IXOA 4XLNF 5BQIA 2KYHA 1UFBA 1QZXA 1C03A 1HMDA 4U5BE 4BJ6A 2P0NA 2R7VA 3QVYA 2FFHA 2QE9A 4JJFA 2EIKC 3DMDA 3EQLF 1MQVA 2P6VA 2J9UA 2Q7RA 5HV9A 1WASA 3U3BA 5DQTA 3M79A 2DI3A 2FGYA 4BJ6C 2LIGA 1FTSA 1Z23A 3I5QA 4ZLDA 2P61A 2EINC 3EFOA 3O55A 2LK4A 2CDQA 4JJGA 4O79A 2PX3A 2XL4A 1A7DA 4YL0A 1M6TA 1YA7O 2L9JA 3U8VA 1YDIA 1A7EA 2HKVA 2IM8A 1WGWA 1OXBA 3KMIA 4O6YA 4MTFA 5CI8A 2V3CC 4IWBA 3PMRA 4U5DE 4MNDA 2HJ3A 3K66A 3B71A 2YEVA 4F4BA 2O9XA 1L7CA 1R4TA 3O39A 1SF8A 3ZTZA 1XWJA 4HFKB 4JEBA 4C3EA 1TFKB 2HMZA 2EPOA 2ZXPA 4PR9A 2GA0A 1TQGA 1TWCA 3ASNC 4W8KA 4WJ0A 4K0DA 2OJQA
chains in the Genus database with same CATH topology
3B0UX 2A6EF 3GODA 2WZGA 3VYWA 3W2VA 5KYYA 1TR2A 2Y3BA 1RJ9A 3TD7A 4AK9A 4I3MA 3EH1A 1ZHWA 3EZHA 3NKEA 4YWQA 1SMYF 4QDLA 2L81A 3F46A 3UGPA 2CNWD 1ZYRF 2CW0F 4CS8A 3ABMC 2LSEA 3W8HA 3DM5A 3FHDA 4ULWA 3EGXB 2HV6A 4YT5A 4HE8D 4LACB 3X2QC 3T4RA 3WODF 4CS8C 1MNEA 4LLEA 1M2OA 1ZHTA 1BR2A 3B0PA 3DD7A 4U5EE 5DVWA 3EJNA 3NRHA 2DGJA 1Z6AA 1M57C 3S27A 4RD9A 5KYYB 3ABLC 1FMVA 2VASA 4CS9C 5E2QA 3MLGA 4PJLA 3LAYA 4XLPF 1ST6A 1JPNA 3T6JA 2KQ9A 1LKXA 2I8BA 2Q9CA 1MMAA 2J9VA 4U5FE 2QTVA 3EZIA 4LLCA 3N0TA 3RYLA 2B0JA 5KYWB 4C3DA 1LS1A 1NG1A 1IW7F 4YJWA 4N06A 3HJCA 4JVSA 4BJTA 3V7OA 4OD5A 2A68F 3LS0A 1FFHA 5IY5C 1V55C 5E3AA 1JPJA 5E3CA 1QLEC 2R7WA 1ZU4A 3NDBB 4Q5SF 1W2WA 2NUPA 2XXAB 2Q9BA 3EGDA 2M4EA 3VAYA 2NG1A 4OD4A 2Y3DA 5KYNA 3AG4C 2G3VA 4AX2A 3HLZA 3DJNB 4J30B 2Q3TA 4U5CE 3JSZA 1IZMA 4CS7A 4LERA 1D1CA 2WZFA 4I1MA 4A2NB 4QI0A 3UMKA 3KH2A 3EHMA 4E7SA 3K1HA 4MQ9F 3ZC4A 4EBBA 1VK5A 4AE4A 4P6IC 4C7OB 5KYUA 2R7SA 2MWQA 3NYJA 4OIQF 3IEEA 3CZ6A 3NKDA 2W4BA 3SYNA 2NUPB 3HTKC 2WVNA 2CGEA 3O6XA 3H65A 2XRHA 1S7ZA 2W9YA 3RFYA 1MMDA 3SP1A 4G7ZF 2IYLD 2KJGA 3AQBA 2X51A 1OKKA 3EHNA 2C03A 2J45A 2CNWA 1D0ZA 4K7BA 1M56C 1NU9C 3JYHA 2NUTA 3EFOB 2IXPA 2PFDA 4BJ1A 3UGOA 1TWHA 3ZG1A 1OKKD 4ANJA 4EWCA 3F47A 4AE4B 5FCLA 3S29A 3QMKA 3DAFA 3QZCA 2H7OA 3LESA 3CSKA 2R7OA 1KU2A 3LLKA 3KL4A 3MX3A 1FFTC 4KI2A 1G8XA 1D1AA 2KW3C 2ZXWC 4GYTA 2Y69C 4YT4A 3W8IA 5DQZA 4KNWA 1Z63A 1NU7D 2EIMC 4OIPF 2EILC 3CQZA 2Y39A 3GANA 3X1OA 5EHHA 1RJ9B 3Q6NA 5KYXA 3EPVA 3S0XA 4IAOA 4DOZA 3Q7LA 4FESA 4FX5A 3OEOA 4G7HF 1OCCC 4H4KC 3LLIA 3NG1A 1O5HA 5B1BC 1V54C 4G0HA 4Q4ZF 1J8YF 3SEOA 4OINF 1PD1A 5D92A 3B0VC 4KBLA 4I44A 3Q7GA 1TWAA 5D91A 3JT1A 2A69F 2IOQA 3JRTA 3E9VA 2Y3GA 5F5FA 3M1CB 5HSWA 5BUOA 3UR3C 4NY3A 3OA1A 1ZHYA 3ASOC 4CIHA 1SZIA 5T3WA 2Q9AA 5DS4A 2HV7A 4XTKA 1LVKA 2E87A 4PFOA 2R7XA 4YT8A 1ZHZA 3OWTA 4PK4A 2MYSA 2W4MA 3AG1C 1MMGA 2H7BA 5L3VA 3KKBA 3RH3A 3LS1A 3UMIA 2ZPAA 3NYLA 2ZXOA 4O7GA 4DBQA 2GFHA 3DM9B 1J8MF 1PD0A 5DLJA 5DS5A 4RDAA 4RBNA 4QI2A 4JCHA 4YT2A 3DXJF 4PFPA 3FAJA 1FMWA 4KC9A 2J0XA 3LNRA 3SNHA 4CSAA 4IJJA 4KNVA 4ZLCA 2R7UA 4DBRA 4O6MA 4OIOF 3ZIBA 2A6HF 1VOMA 2OG2A 1D0YA 3I4UA 2J7PD 4CSAC 4G7OF 3AQCA 5B1AC 4IRUA 4I1OB 5EGYA 4JZAA 3EGDB 2G3KA 1VYIA 1OCZC 3EG9A 1OCOC 5DS6A 2KGOA 3K1IC 2VB6A 2VH3A 5T1DB 2PP4A 2D5RB 3AG2C 4YN0B 1NZEA 2BE5F 2WVQA 3EGXA 5KYUB 2WL8A 2EIJC 2R7RA 2YZSA 3NYMA 2QY9A 2YHSA 3LEVA 2IXNA 4U5HA 4Q7CA 3ZSUA 4BEJA 3SZRA 1D0XA 5E33A 4BJ5A 3ITFA 3K6BA 3POVA 2J9WA 3EG9B 3ZVRA 2V26A 5T3TA 3RKOF 4PJNA 5F5HA 4BJ5C 2PX0A 1Z5ZA 4B6IA 4JURI 2NUTB 1M2VA 3DZAA 5L3QA 4M63A 5CI9A 3DAGA 1Z3IX 1TWGA 2R7TA 2J46A 3B9QA 4XWJA 3DJUB 4HEAJ 3N24A 2G62A 4CS9A 5KYWA 2R7QA 1O87A 3WG7C 4BG0A 2W45A 3ECSA 2WVOA 3T6BA 3K33A 4J32B 1D1BA 3K7DA 4E7ZA 2DYSC 4O6NA 4JW1A 4CBEA 1N1CA 3I5PA 3FDQA 3FVYA 2IXMA 4X0RA 4GEHA 4HFFB 1MMNA 2XXAA 3L0IA 1VMAA 1ZHXA 2WZLA 5B3SC 5KYXB 4PJJA 4C3BA 3S28A 3LJBA 1MNDA 3UNGC 1M2VB 2A1DD 3Q6MA 4DVYP 1BR1A 1PCXA 3PHF2 2ZXRA 4U5GA 2P7VA 2PF4E 2DYRC 2H7VC 2WB7A 1VYKA 2OCCC 4DVZA 1BR4A 2JD3A 3AG3C 4PJMA 2XSEA 4C7OA 2KNHA 2Z15A 4OIRF 3E70C 3ABKC 3N2ZB 2J7PA 3JCUQ 4FWVA 3UMHA 1OCRC 2J0WA 1ZU5A 3EH2A 2Y3HA 2C04A 3W2WA 3L34A 3RIPA 1TKNA 2IXOA 4XLNF 1QZXA 4U5BE 4BJ6A 2R7VA 2FFHA 4JJFA 2EIKC 3DMDA 3EQLF 2P6VA 2J9UA 5DQTA 2FGYA 4BJ6C 1FTSA 1Z23A 3I5QA 4ZLDA 2EINC 3EFOA 2CDQA 4JJGA 4O79A 2PX3A 2XL4A 2L9JA 4O6YA 3KMIA 1WGWA 5CI8A 2V3CC 4IWBA 3PMRA 4U5DE 4MNDA 3K66A 2YEVA 4F4BA 2O9XA 3O39A 1SF8A 4HFKB 4C3EA 2ZXPA 4W8KA 1TWCA 3ASNC 4WJ0A 4K0DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YWQ A;  4QI0 A;  3X1O A;  4ZLC A;  5F5F A;  5F5H A;  4ZLD A;  4QI2 A;  4ULW A; 
#chains in the Genus database with same CATH topology
 1AUE A;  3ZQY A;  2A6E F;  3B0U X;  4EBK A;  4MS2 A;  3TK0 A;  3GOD A;  2H8A A;  2WZG A;  1V74 B;  3VYW A;  3TQO A;  3W2V A;  5KYY A;  1TR2 A;  2X0C A;  2Y3B A;  1RJ9 A;  3TD7 A;  2M64 A;  2LQG A;  2EPN A;  4AK9 A;  1QKR A;  4I3M A;  2GDC A;  3C8Z A;  1GS9 A;  1ZHW A;  2QNL A;  3EH1 A;  3EZH A;  3NKE A;  4NTA A;  1SMY F;  4DXW A;  4QDL A;  4YWQ A;  2L81 A;  2R9R B;  1KNY A;  1ZZP A;  3F46 A;  3UGP A;  2CNW D;  1LE4 A;  2HFI A;  3M4C A;  3C7J A;  4A4A A;  1ZYR F;  2YL1 A;  2XLE A;  2CW0 F;  2AVK A;  4XPW A;  1Q0K A;  2DB4 A;  5AGF A;  4CS8 A;  3ABM C;  2GAQ A;  4JIO A;  2LSE A;  3DI5 A;  4N6H A;  3W8H A;  3DM5 A;  3FHD A;  4ULW A;  4ER9 A;  3EGX B;  1QSP A;  2HV6 A;  1V4A A;  4JRZ A;  4YT5 A;  4HE8 D;  2LFD A;  4LAC B;  3O10 A;  3TOL A;  3T4R A;  2VC9 A;  3WOD F;  3X2Q C;  2XS8 A;  1MNE A;  4CS8 C;  4LLE A;  2Q4F A;  1M2O A;  5JRA A;  3U9M A;  1ZHT A;  1BR2 A;  3B0P A;  3DD7 A;  3GEE A;  4U5E E;  3EJN A;  3IHU A;  3NRH A;  3B29 A;  2DGJ A;  1Z6A A;  1M57 C;  4N6C A;  3S27 A;  3RQF A;  3IQT A;  1WWP A;  4RD9 A;  5KYY B;  2OJE D;  3ABL C;  5AC5 A;  3HNK A;  1FMV A;  2VAS A;  4CS9 C;  5E2Q A;  3U5S A;  3MLG A;  1APC A;  2OEV A;  4PJL A;  2RD9 A;  3GM2 A;  5COM A;  4E18 A;  3LAY A;  1HMO A;  2OEX A;  4BPM A;  4XLP F;  1C02 A;  1JPN A;  1ST6 A;  1OXK A;  3T6J A;  2VCA A;  4XQ1 A;  5GPG B;  1LE2 A;  2KQ9 A;  3FOO A;  4CJO A;  2HJM A;  3FXH A;  1LKX A;  2I8B A;  2Q9C A;  1MMA A;  2J9V A;  1Y4C A;  1YYJ A;  4U5F E;  1DOW A;  4NTF A;  5L0F A;  3MBG A;  2QTV A;  3TJ5 A;  2AWY A;  3EZI A;  4LDK A;  256B A;  4LLC A;  3L1M A;  1OW7 A;  3N0T A;  2IBF A;  3M4B A;  3RYL A;  2B0J A;  1YA9 A;  3AGU A;  2HS5 A;  5KYW B;  4XEV A;  3KPH A;  1LS1 A;  4C3D A;  1NG1 A;  1IW7 F;  4YJW A;  1JOG A;  4N06 A;  3HJC A;  4JVS A;  4XPX A;  4BJT A;  5JUA A;  3V7O A;  1O3U A;  3S9O A;  4Z9H A;  3MFN A;  4OD5 A;  2A68 F;  1AVO B;  3LS0 A;  1FFH A;  3G50 A;  2ASR A;  2P1A A;  5IY5 C;  1V55 C;  5E3A A;  4MVU A;  1JPJ A;  4R32 A;  4EHP A;  1PV3 A;  5JS5 A;  1LPE A;  1QLE C;  3G4X A;  1ZU4 A;  5E3C A;  2R7W A;  4LDR A;  4MVS A;  3NDB B;  4Q5S F;  2A0B A;  1CGM E;  2I15 A;  3JSE O;  2YL7 A;  1W2W A;  2NUP A;  3LNM B;  2XXA B;  2Q9B A;  3EGD A;  5CIV A;  2M4E A;  1JR8 A;  3VAY A;  2NG1 A;  4OD4 A;  1OR3 A;  2Y3D A;  4ONS A;  3VF0 A;  1Q0M A;  2AP3 A;  2G3V A;  3AG4 C;  4AX2 A;  5KYN A;  3HLZ A;  1U0B B;  3DJN B;  4J30 B;  3JRM O;  1LS4 A;  2BC5 A;  2Q3T A;  5L0I A;  4U5C E;  1WAT A;  3MYI A;  3JSZ A;  1CPQ A;  4AL0 A;  4D4N A;  1IZM A;  3NMJ A;  4CS7 A;  3JYY A;  4LER A;  1D1C A;  1GQA A;  2WZF A;  4I1M A;  4A2N B;  4QI0 A;  3UMK A;  1Q0G A;  1YLM A;  4W8P A;  3U9J A;  3KH2 A;  3EHM A;  3C8G D;  1C17 M;  5L0H A;  1RKE A;  1YZC A;  4E7S A;  5A6K A;  3K1H A;  4MQ9 F;  3ZC4 A;  3L8I A;  4EBB A;  1L3P A;  1VK5 A;  2NPU A;  2JPU A;  2RSE B;  4P6I C;  5KYU A;  4AE4 A;  4C7O B;  2R7S A;  4JC7 A;  5COG A;  4MVZ A;  4MVO A;  2XL8 A;  4MVM A;  2MWQ A;  3NYJ A;  4P9T A;  1S05 A;  4OIQ F;  3IEE A;  3CZ6 A;  3NKD A;  2W4B A;  1QVX A;  3GM1 A;  1XZP A;  3SYN A;  1YJG A;  2NUP B;  3S84 A;  3HTK C;  1VTM P;  1OR2 A;  2WVN A;  1JAF A;  2CGE A;  2LFF A;  2XS1 A;  3O6X A;  1GGQ A;  3H65 A;  4Z9I A;  5A6B D;  2XRH A;  1S7Z A;  2W9Y A;  3RFY A;  1EI7 A;  1MMD A;  2LCH A;  3SP1 A;  2GWW A;  1QQ3 A;  4G7Z F;  2IYL D;  3GOR A;  1XZQ A;  2KJG A;  1EKY A;  2NSF A;  3AQB A;  2TMV P;  3CAX A;  1T9K A;  2X51 A;  1TFO B;  2YKZ A;  3BRJ A;  3H2U A;  1OKK A;  2XLV A;  3EHN A;  4EBJ A;  4PAC A;  2C03 A;  5L0C A;  2J45 A;  3C62 A;  2CNW A;  1D0Z A;  1OQC A;  5JSL A;  2XM4 A;  4K7B A;  1DOV A;  1M56 C;  1NU9 C;  2YLD A;  3JYH A;  3EFO B;  2IXP A;  2PFD A;  2NUT A;  4BJ1 A;  5A6J A;  2AU5 A;  1TWH A;  3ZG1 A;  1OKK D;  4ANJ A;  3G4Z A;  3F47 A;  4EWC A;  4AE4 B;  1T6Q A;  2OOC A;  4CJG A;  5FCL A;  2YVK A;  3A9C A;  3S29 A;  4FAP B;  3QMK A;  3DAF A;  1YVI A;  2H7O A;  3LES A;  3QZC A;  3CSK A;  2R7O A;  1KU2 A;  3LLK A;  3T9O A;  3KYI A;  2YLG A;  1OW6 A;  2ETS A;  3KL4 A;  3MX3 A;  1FFT C;  4KI2 A;  5EK0 A;  1G8X A;  1K05 A;  2L6H A;  1D1A A;  3VRC A;  1A0B A;  1CPR A;  1NLX A;  2KW3 C;  2ZXW C;  3U8P A;  5K0I A;  4GYT A;  2Y69 C;  4YT4 A;  1R5I D;  3W8I A;  5DQZ A;  3GEI A;  2YL0 A;  4KNW A;  1Z63 A;  1NU7 D;  2EIM C;  4OIP F;  1T01 A;  2EIL C;  3M15 A;  3CQZ A;  3S0X A;  2Y39 A;  3FMS A;  3GAN A;  3X1O A;  1AEP A;  5EHH A;  1VB5 A;  1EA8 A;  1RJ9 B;  2XLH A;  3Q6N A;  4L6R A;  3V5Y A;  3EPV A;  4JTC B;  2J9B A;  3U3F A;  4DRJ B;  5AC4 A;  1G4U S;  5L0G A;  5KYX A;  3BEH A;  4IAO A;  5F28 E;  4DOZ A;  3Q7L A;  4FES A;  4FX5 A;  3OEO A;  1NFN A;  2HUJ A;  4G7H F;  1I5N A;  1OCC C;  4H4K C;  3LLI A;  3NG1 A;  4J7T A;  1O5H A;  3DWW A;  4E0H A;  5B1B C;  3QVZ A;  3V5X A;  1V54 C;  4G0H A;  3HNJ A;  3DKA A;  1RKC A;  2MHR A;  3QW1 A;  3R2P A;  4Q4Z F;  1J8Y F;  2QLA A;  3SEO A;  4JEA A;  4OIN F;  1PD1 A;  1FR0 A;  5D92 A;  3S90 A;  3B0V C;  4KBL A;  4YK5 A;  4I44 A;  3Q7G A;  4XEK A;  1TWA A;  5D91 A;  2YRF A;  3JT1 A;  2A69 F;  2IOQ A;  2OU6 A;  2UUH A;  3JRT A;  4E17 A;  3E9V A;  1YAR O;  1T6I A;  2Y3G A;  1LIH A;  2A0U A;  5F5F A;  1F1M A;  3M1C B;  3SXY A;  1LI7 A;  1OW8 A;  3KYJ A;  5HSW A;  2CYD A;  4GQH A;  5BUO A;  3UR3 C;  3LEO A;  1LM3 B;  3RQG A;  4NY3 A;  5JVE A;  4P9F A;  3DE8 A;  1U6H A;  2L6G A;  2R05 A;  3OA1 A;  2KSF A;  1ZHY A;  3ASO C;  4CIH A;  2EPK X;  5JLI A;  3GM3 A;  1SZI A;  3AOU A;  5T3W A;  2Q9A A;  2XM0 A;  5DS4 A;  2HV7 A;  4XTK A;  3R7C A;  1LVK A;  5JP7 A;  2E87 A;  4PFO A;  3UGO A;  2R7X A;  4YT8 A;  1EQ1 A;  1ZHZ A;  1HE9 A;  3OWT A;  3JTL O;  4PK4 A;  1WTY A;  2MYS A;  2W4M A;  3AG1 C;  5DVW A;  4YL3 A;  1MMG A;  1Q0D A;  4DRH B;  2H7B A;  4CX9 A;  3KKB A;  3C18 A;  3RH3 A;  3LS1 A;  5L3V A;  1E2X A;  3UMI A;  1HY5 A;  2ZPA A;  3NYL A;  2ZXO A;  4O7G A;  4DBQ A;  1CGN A;  2YLI A;  1BZ4 A;  4MVR A;  2GFH A;  2NSG A;  1CGO A;  2FAP B;  1J8M F;  1PD0 A;  3C8G A;  3DM9 B;  4NC3 A;  4DJ9 A;  5DLJ A;  5DS5 A;  1SYQ A;  4K1O A;  3DE9 A;  2PBE A;  4RDA A;  4RBN A;  4JCH A;  4QI2 A;  1SR2 A;  2EPL X;  4YT2 A;  3V5Z A;  3DXJ F;  2XLM A;  3FAJ A;  4PFP A;  1FMW A;  4KC9 A;  2J0X A;  3LNR A;  3SNH A;  4CSA A;  1VLS A;  3H2V A;  4IJJ A;  4KNV A;  4ZLC A;  2R7U A;  4DBR A;  1FNT c;  3IQ5 A;  4O6M A;  4OIO F;  3ZIB A;  2A6H F;  1H9G A;  1VOM A;  2OG2 A;  5A6B A;  1HW2 A;  1D0Y A;  3I4U A;  2J7P D;  1NSG B;  3SXK A;  4CSA C;  4G7O F;  3JZ0 A;  2ICW G;  3AQC A;  5B1A C;  2J8W A;  4NCQ A;  1YAU O;  1ZW2 A;  4IRU A;  3GWL A;  2UUI A;  4I1O B;  5EGY A;  4JZA A;  3IPM O;  3TUL A;  3EGD B;  3GWN A;  1UG7 A;  3K1I A;  4NQF A;  2G3K A;  1GM5 A;  4YL1 A;  1VYI A;  3ZWI A;  1OCZ C;  3RF3 A;  2L6F A;  3EG9 A;  1OCO C;  4U9D A;  5DS6 A;  3C8G B;  3HNI A;  4JTD B;  4N4W A;  3SXZ A;  2KGO A;  3K1I C;  3VM6 A;  2VB6 A;  2VH3 A;  5T1D B;  2PP4 A;  4CDY A;  1U89 A;  2D5R B;  3FAP B;  3AG2 C;  1G4W R;  4YN0 B;  1NZE A;  2BE5 F;  3RVY A;  4E0I A;  1ZW3 A;  3A11 A;  4U9E A;  1H9T A;  1QPU A;  2WVQ A;  1FAP B;  4EIY A;  3IQ6 A;  2XL6 A;  1RKE B;  3EGX A;  1BBH A;  4LDQ A;  4EKW A;  1JRA A;  1Q0F A;  4JCZ A;  5KYU B;  4D4X A;  2WL8 A;  1E84 A;  2EIJ C;  3WAQ A;  2EPM X;  3RQE A;  2R7R A;  2YZS A;  3AGT A;  1K40 A;  3NYM A;  2QY9 A;  2YHS A;  3LEV A;  2IXN A;  4IAR A;  4JTA B;  4U5H A;  4Q7C A;  3US6 A;  3ZSU A;  1YYX A;  2XLO A;  4MTG A;  3QTH A;  4BEJ A;  1H6G A;  4WGY A;  4CIP A;  3SZR A;  2AWC A;  4IB4 A;  1D0X A;  5E33 A;  4BJ5 A;  4IAQ A;  3ITF A;  3K6B A;  3POV A;  1JMW A;  2HZ8 A;  2J9W A;  3EG9 B;  5FZT A;  3ZVR A;  2V26 A;  3WHN A;  5JT4 A;  5T3T A;  1Z7Q c;  4JKV A;  3RKO F;  4Z9J A;  4WAB A;  3SXM A;  4PJN A;  4CDA A;  5F5H A;  4BJ5 C;  1T6U A;  2PX0 A;  1WOL A;  1ORY A;  1Y6D A;  3ZQV A;  1Z5Z A;  2VCB A;  3ATP A;  3CEX A;  2XLD A;  4JUR I;  4B6I A;  2YQY A;  5BQH A;  1M2V A;  2NUT B;  3DZA A;  2HSQ A;  3ZTM A;  5BQG A;  5L3Q A;  2YWA A;  5A69 A;  1VLT A;  1H7I A;  4M63 A;  5CI9 A;  3DAG A;  1Z3I X;  1TWG A;  2R7T A;  3NMK A;  1I4Y A;  2XLW A;  2J46 A;  3B9Q A;  4G78 A;  4XWJ A;  2QUP A;  3DJU B;  4HEA J;  3N24 A;  2G62 A;  4CS9 A;  5KYW A;  1BDJ B;  2D4U A;  2R7Q A;  1O87 A;  2L7A A;  4MW8 A;  3WG7 C;  4BG0 A;  2W45 A;  3L8J A;  3ECS A;  1ZVZ A;  3HNL A;  5A6A A;  2WVO A;  1E86 A;  2R03 A;  4ULV A;  2KC3 A;  3T6B A;  3K33 A;  4J32 B;  4J7Y A;  1D1B A;  3GEH A;  1B68 A;  3K7D A;  4E7Z A;  2DYS C;  4O6N A;  4JW1 A;  4CBE A;  4XPY A;  1NBB A;  5L0J A;  2OQM A;  1N1C A;  3I5P A;  4MVQ A;  2ZD9 A;  5COF A;  3PCV A;  3FVY A;  4CDV A;  3TOM A;  3FDQ A;  2IXM A;  4MW3 A;  4X0R A;  4GEH A;  3FOP A;  2LP4 A;  3IQC A;  4HFF B;  3U2L A;  3TJ6 A;  2LD6 A;  1MMN A;  2XXA A;  3L0I A;  1VMA A;  1ZHX A;  2WZL A;  5B3S C;  5KYX B;  5L0D A;  1K04 A;  4PJJ A;  4C3B A;  3S28 A;  4DRI B;  3LJB A;  1MND A;  3UNG C;  1M2V B;  3LUT B;  4BEM J;  3HKK A;  2A1D D;  3Q6M A;  4DVY P;  1BR1 A;  4EUK B;  1PCX A;  1I4Z A;  3PHF 2;  2Q00 A;  3QW0 A;  2ZXR A;  4NTB A;  4U5G A;  2P7V A;  2PF4 E;  2DYR C;  2H7V C;  3PDM P;  2WB7 A;  1VYK A;  2HMQ A;  2OCC C;  3NMI A;  3J06 A;  3MYF A;  4MTO A;  3W4Y A;  4DVZ A;  1BR4 A;  2JD3 A;  1LI5 A;  1A7V A;  1ORJ A;  1WN0 A;  2XSE A;  3AG3 C;  4PJM A;  1KTM A;  4C7O A;  2KNH A;  3T6G B;  2PNO A;  5B3I A;  2VCC A;  1E85 A;  3C63 A;  2Z15 A;  4JE9 A;  4OIR F;  3E70 C;  1HE1 A;  1ORS C;  2BL2 A;  1YZA A;  3ABK C;  1RCP A;  3N2Z B;  1RMV A;  2J7P A;  1RXQ A;  2R25 A;  3JCU Q;  4IGG A;  4XEF A;  3RVZ A;  2KK1 A;  4FWV A;  4WGZ A;  3UMH A;  2R02 A;  4AL1 A;  2CCY A;  1E83 A;  3U0C A;  1OCR C;  5TJ5 E;  3U2M A;  2YL3 A;  2J0W A;  3ZDL A;  1ZU5 A;  2F22 A;  1A41 A;  2OKU A;  3EH2 A;  3RW0 A;  2Y3H A;  2C04 A;  1HW1 A;  1NFO A;  3AJM A;  3W2W A;  4UDV A;  2HSB A;  1T5O A;  1G5Z A;  2JX0 A;  3L34 A;  4H54 A;  3RIP A;  1TKN A;  2B0H A;  2IXO A;  4XLN F;  5BQI A;  2KYH A;  1UFB A;  1QZX A;  1C03 A;  1HMD A;  4U5B E;  4BJ6 A;  2P0N A;  2R7V A;  3QVY A;  2FFH A;  2QE9 A;  4JJF A;  2EIK C;  3DMD A;  3EQL F;  1MQV A;  2P6V A;  2J9U A;  2Q7R A;  5HV9 A;  1WAS A;  3U3B A;  5DQT A;  3M79 A;  2DI3 A;  2FGY A;  4BJ6 C;  2LIG A;  1FTS A;  1Z23 A;  3I5Q A;  4ZLD A;  2P61 A;  2EIN C;  3EFO A;  3O55 A;  2LK4 A;  2CDQ A;  4JJG A;  4O79 A;  2PX3 A;  2XL4 A;  1A7D A;  4YL0 A;  1M6T A;  1YA7 O;  2L9J A;  3U8V A;  1YDI A;  1A7E A;  2HKV A;  2IM8 A;  1WGW A;  1OXB A;  3KMI A;  4O6Y A;  4MTF A;  5CI8 A;  2V3C C;  4IWB A;  3PMR A;  4U5D E;  4MND A;  2HJ3 A;  3K66 A;  3B71 A;  2YEV A;  4F4B A;  2O9X A;  1L7C A;  1R4T A;  3O39 A;  1SF8 A;  3ZTZ A;  1XWJ A;  4HFK B;  4JEB A;  4C3E A;  1TFK B;  2HMZ A;  2EPO A;  2ZXP A;  4PR9 A;  2GA0 A;  1TQG A;  1TWC A;  3ASN C;  4W8K A;  4WJ0 A;  4K0D A;  2OJQ A; 
#chains in the Genus database with same CATH homology
 3B0U X;  2A6E F;  3GOD A;  2WZG A;  3VYW A;  3W2V A;  5KYY A;  1TR2 A;  2Y3B A;  1RJ9 A;  3TD7 A;  4AK9 A;  4I3M A;  3EH1 A;  1ZHW A;  3EZH A;  3NKE A;  4YWQ A;  1SMY F;  4QDL A;  2L81 A;  3F46 A;  3UGP A;  2CNW D;  1ZYR F;  2CW0 F;  4CS8 A;  3ABM C;  2LSE A;  3W8H A;  3DM5 A;  3FHD A;  4ULW A;  3EGX B;  2HV6 A;  4YT5 A;  4HE8 D;  4LAC B;  3X2Q C;  3T4R A;  3WOD F;  4CS8 C;  1MNE A;  4LLE A;  1M2O A;  1ZHT A;  1BR2 A;  3B0P A;  3DD7 A;  4U5E E;  5DVW A;  3EJN A;  3NRH A;  2DGJ A;  1Z6A A;  1M57 C;  3S27 A;  4RD9 A;  5KYY B;  3ABL C;  1FMV A;  2VAS A;  4CS9 C;  5E2Q A;  3MLG A;  4PJL A;  3LAY A;  4XLP F;  1ST6 A;  1JPN A;  3T6J A;  2KQ9 A;  1LKX A;  2I8B A;  2Q9C A;  1MMA A;  2J9V A;  4U5F E;  2QTV A;  3EZI A;  4LLC A;  3N0T A;  3RYL A;  2B0J A;  5KYW B;  4C3D A;  1LS1 A;  1NG1 A;  1IW7 F;  4YJW A;  4N06 A;  3HJC A;  4JVS A;  4BJT A;  3V7O A;  4OD5 A;  2A68 F;  3LS0 A;  1FFH A;  5IY5 C;  1V55 C;  5E3A A;  1JPJ A;  5E3C A;  1QLE C;  2R7W A;  1ZU4 A;  3NDB B;  4Q5S F;  1W2W A;  2NUP A;  2XXA B;  2Q9B A;  3EGD A;  2M4E A;  3VAY A;  2NG1 A;  4OD4 A;  2Y3D A;  5KYN A;  3AG4 C;  2G3V A;  4AX2 A;  3HLZ A;  3DJN B;  4J30 B;  2Q3T A;  4U5C E;  3JSZ A;  1IZM A;  4CS7 A;  4LER A;  1D1C A;  2WZF A;  4I1M A;  4A2N B;  4QI0 A;  3UMK A;  3KH2 A;  3EHM A;  4E7S A;  3K1H A;  4MQ9 F;  3ZC4 A;  4EBB A;  1VK5 A;  4AE4 A;  4P6I C;  4C7O B;  5KYU A;  2R7S A;  2MWQ A;  3NYJ A;  4OIQ F;  3IEE A;  3CZ6 A;  3NKD A;  2W4B A;  3SYN A;  2NUP B;  3HTK C;  2WVN A;  2CGE A;  3O6X A;  3H65 A;  2XRH A;  1S7Z A;  2W9Y A;  3RFY A;  1MMD A;  3SP1 A;  4G7Z F;  2IYL D;  2KJG A;  3AQB A;  2X51 A;  1OKK A;  3EHN A;  2C03 A;  2J45 A;  2CNW A;  1D0Z A;  4K7B A;  1M56 C;  1NU9 C;  3JYH A;  2NUT A;  3EFO B;  2IXP A;  2PFD A;  4BJ1 A;  3UGO A;  1TWH A;  3ZG1 A;  1OKK D;  4ANJ A;  4EWC A;  3F47 A;  4AE4 B;  5FCL A;  3S29 A;  3QMK A;  3DAF A;  3QZC A;  2H7O A;  3LES A;  3CSK A;  2R7O A;  1KU2 A;  3LLK A;  3KL4 A;  3MX3 A;  1FFT C;  4KI2 A;  1G8X A;  1D1A A;  2KW3 C;  2ZXW C;  4GYT A;  2Y69 C;  4YT4 A;  3W8I A;  5DQZ A;  4KNW A;  1Z63 A;  1NU7 D;  2EIM C;  4OIP F;  2EIL C;  3CQZ A;  2Y39 A;  3GAN A;  3X1O A;  5EHH A;  1RJ9 B;  3Q6N A;  5KYX A;  3EPV A;  3S0X A;  4IAO A;  4DOZ A;  3Q7L A;  4FES A;  4FX5 A;  3OEO A;  4G7H F;  1OCC C;  4H4K C;  3LLI A;  3NG1 A;  1O5H A;  5B1B C;  1V54 C;  4G0H A;  4Q4Z F;  1J8Y F;  3SEO A;  4OIN F;  1PD1 A;  5D92 A;  3B0V C;  4KBL A;  4I44 A;  3Q7G A;  1TWA A;  5D91 A;  3JT1 A;  2A69 F;  2IOQ A;  3JRT A;  3E9V A;  2Y3G A;  5F5F A;  3M1C B;  5HSW A;  5BUO A;  3UR3 C;  4NY3 A;  3OA1 A;  1ZHY A;  3ASO C;  4CIH A;  1SZI A;  5T3W A;  2Q9A A;  5DS4 A;  2HV7 A;  4XTK A;  1LVK A;  2E87 A;  4PFO A;  2R7X A;  4YT8 A;  1ZHZ A;  3OWT A;  4PK4 A;  2MYS A;  2W4M A;  3AG1 C;  1MMG A;  2H7B A;  5L3V A;  3KKB A;  3RH3 A;  3LS1 A;  3UMI A;  2ZPA A;  3NYL A;  2ZXO A;  4O7G A;  4DBQ A;  2GFH A;  3DM9 B;  1J8M F;  1PD0 A;  5DLJ A;  5DS5 A;  4RDA A;  4RBN A;  4QI2 A;  4JCH A;  4YT2 A;  3DXJ F;  4PFP A;  3FAJ A;  1FMW A;  4KC9 A;  2J0X A;  3LNR A;  3SNH A;  4CSA A;  4IJJ A;  4KNV A;  4ZLC A;  2R7U A;  4DBR A;  4O6M A;  4OIO F;  3ZIB A;  2A6H F;  1VOM A;  2OG2 A;  1D0Y A;  3I4U A;  2J7P D;  4CSA C;  4G7O F;  3AQC A;  5B1A C;  4IRU A;  4I1O B;  5EGY A;  4JZA A;  3EGD B;  2G3K A;  1VYI A;  1OCZ C;  3EG9 A;  1OCO C;  5DS6 A;  2KGO A;  3K1I C;  2VB6 A;  2VH3 A;  5T1D B;  2PP4 A;  2D5R B;  3AG2 C;  4YN0 B;  1NZE A;  2BE5 F;  2WVQ A;  3EGX A;  5KYU B;  2WL8 A;  2EIJ C;  2R7R A;  2YZS A;  3NYM A;  2QY9 A;  2YHS A;  3LEV A;  2IXN A;  4U5H A;  4Q7C A;  3ZSU A;  4BEJ A;  3SZR A;  1D0X A;  5E33 A;  4BJ5 A;  3ITF A;  3K6B A;  3POV A;  2J9W A;  3EG9 B;  3ZVR A;  2V26 A;  5T3T A;  3RKO F;  4PJN A;  5F5H A;  4BJ5 C;  2PX0 A;  1Z5Z A;  4B6I A;  4JUR I;  2NUT B;  1M2V A;  3DZA A;  5L3Q A;  4M63 A;  5CI9 A;  3DAG A;  1Z3I X;  1TWG A;  2R7T A;  2J46 A;  3B9Q A;  4XWJ A;  3DJU B;  4HEA J;  3N24 A;  2G62 A;  4CS9 A;  5KYW A;  2R7Q A;  1O87 A;  3WG7 C;  4BG0 A;  2W45 A;  3ECS A;  2WVO A;  3T6B A;  3K33 A;  4J32 B;  1D1B A;  3K7D A;  4E7Z A;  2DYS C;  4O6N A;  4JW1 A;  4CBE A;  1N1C A;  3I5P A;  3FDQ A;  3FVY A;  2IXM A;  4X0R A;  4GEH A;  4HFF B;  1MMN A;  2XXA A;  3L0I A;  1VMA A;  1ZHX A;  2WZL A;  5B3S C;  5KYX B;  4PJJ A;  4C3B A;  3S28 A;  3LJB A;  1MND A;  3UNG C;  1M2V B;  2A1D D;  3Q6M A;  4DVY P;  1BR1 A;  1PCX A;  3PHF 2;  2ZXR A;  4U5G A;  2P7V A;  2PF4 E;  2DYR C;  2H7V C;  2WB7 A;  1VYK A;  2OCC C;  4DVZ A;  1BR4 A;  2JD3 A;  3AG3 C;  4PJM A;  2XSE A;  4C7O A;  2KNH A;  2Z15 A;  4OIR F;  3E70 C;  3ABK C;  3N2Z B;  2J7P A;  3JCU Q;  4FWV A;  3UMH A;  1OCR C;  2J0W A;  1ZU5 A;  3EH2 A;  2Y3H A;  2C04 A;  3W2W A;  3L34 A;  3RIP A;  1TKN A;  2IXO A;  4XLN F;  1QZX A;  4U5B E;  4BJ6 A;  2R7V A;  2FFH A;  4JJF A;  2EIK C;  3DMD A;  3EQL F;  2P6V A;  2J9U A;  5DQT A;  2FGY A;  4BJ6 C;  1FTS A;  1Z23 A;  3I5Q A;  4ZLD A;  2EIN C;  3EFO A;  2CDQ A;  4JJG A;  4O79 A;  2PX3 A;  2XL4 A;  2L9J A;  4O6Y A;  3KMI A;  1WGW A;  5CI8 A;  2V3C C;  4IWB A;  3PMR A;  4U5D E;  4MND A;  3K66 A;  2YEV A;  4F4B A;  2O9X A;  3O39 A;  1SF8 A;  4HFK B;  4C3E A;  2ZXP A;  4W8K A;  1TWC A;  3ASN C;  4WJ0 A;  4K0D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...