4ULWA

Crystal structure of the roq-domain of human roquin1
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
150
structure length
150
Chain Sequence
LSSNLWAAVRARGCQFLGPAMQEEALKLVLLALEDGSALSRKVLVLFVVQRLEPRFPQASKTSIGHVVQLLYRASCFKVTKRDEDSSLMQLKEEFRTYEALRREHDSQIVQIAMEAGLRIAPDQWSSLLYGDQSHKSHMQSIIDKLQTPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ROQUIN-1
publication title Roquin Binding to Target Mrnas Involves a Winged Helix-Turn- Helix Motif.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 51
structure length 150
sequence length 150
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2014-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18386 ROQ_II Roquin II domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1790 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4ulwA00
4YWQA 5F5HA 4ULWA 5F5FA 3X1OA 4QI0A 4QI2A 4ZLDA 4ZLCA
chains in the Genus database with same CATH superfamily
2LFFA 1NZEA 2D4UA 3U3BA 1OCRC 1M57C 1GM5A 3SP1A 3R7CA 1VLTA 2ZXPA 4KNWA 3U3FA 4C7OB 2F22A 1VK5A 4ZLDA 1Z3IX 1E2XA 3JCUQ 3EGDB 1HW1A 1TWCA 1YYJA 1H7IA 2LCHA 3V5YA 3H2UA 2HV6A 5EHHA 2A68F 3LEVA 1NLXA 4MVQA 2YVKA 4O6NA 1OKKA 4P6IC 4U5HA 3LAYA 1OR2A 1V55C 2CDQA 4YK5A 1M2OA 1GS9A 4IRUA 1RJ9B 3N24A 4YT5A 3TJ5A 3B0PA 1J8MF 3KKBA 2WZGA 3RKOF 2Q4FA 3E9VA 4E7SA 5KYXB 3AGUA 2GA0A 1LIHA 2YRFA 4A4AA 1F1MA 5CI8A 1M2VA 1ORSC 1KU2A 3C8GB 4YL3A 3ZSUA 4JC7A 2L6FA 1QZXA 5E2QA 4DRHB 5KYUA 5JT4A 1VMAA 3CQZA 4BJ6C 1HMDA 1CGOA 3QZCA 3IPMO 3H65A 2Q9AA 3KPHA 2J9VA 4KBLA 1GQAA 3L1MA 1SYQA 5FZTA 3EH2A 3JYHA 3HJCA 2Q9BA 3GM3A 3OA1A 4BJ5A 2H7BA 2LFDA 5KYWB 3JZ0A 4G7ZF 3GM1A 2YWAA 2Y3GA 1LE2A 4AE4A 1ZYRF 5FCLA 5HV9A 1E84A 1KTMA 2GDCA 3GEHA 4EBKA 4A2NB 1Y4CA 2HJMA 3DAFA 3NYLA 2V26A 1WATA 1TWHA 4FX5A 4R32A 3ASNC 5JLIA 2L7AA 2J9WA 3LESA 1YDIA 3NDBB 5DS5A 4FWVA 4P9TA 4IWBA 5BQHA 1ZHXA 5T3WA 3ZWIA 1L7CA 2MYSA 3WAQA 5JSLA 2XLVA 1CGME 1WOLA 2YL7A 3RF3A 1YLMA 3QVYA 2W4BA 4J32B 2R25A 2RSEB 2G3KA 4D4XA 4DOZA 2VASA 1Z23A 1T6IA 3ZQVA 4YWQA 4G7HF 5JVEA 3IQTA 3MFNA 2KSFA 3RH3A 3L0IA 4N4WA 3T9OA 3EGXA 3LEOA 4CIPA 3J06A 1MMNA 2WVQA 3DZAA 3U9JA 4CS9C 1I5NA 2R7SA 1XWJA 2WVOA 5DS6A 1LKXA 2IXNA 1K05A 1AVOB 4IGGA 4QI0A 4OIPF 2NSFA 4PJNA 5L0DA 3K1HA 1WTYA 3EG9A 3NMIA 2ZD9A 4XWJA 4FAPB 4OIOF 2WZFA 2AU5A 2FAPB 4MVUA 3G50A 1DOWA 3FDQA 2JD3A 3G4XA 4IARA 1S05A 4C3DA 4XEFA 1Z7Qc 4Q4ZF 2H7OA 2P61A 1TWGA 4MVSA 2XM0A 2MHRA 3N0TA 2IXMA 4JJFA 2J9BA 3W8IA 2BC5A 2NUPA 2EILC 4CS9A 1MNDA 2LP4A 2E87A 4JIOA 2XLMA 1CPQA 3GWLA 4KNVA 1R5ID 2KC3A 5A6BA 2Y3BA 3GODA 5AC5A 3QVZA 2HMQA 2VCBA 4C3BA 3TULA 2B0HA 4PR9A 5L3QA 5D92A 2XS1A 3RIPA 4YL0A 3K6BA 1BZ4A 3VAYA 2A6EF 4CS7A 1BBHA 2R9RB 2W9YA 3SYNA 1TWAA 3T6BA 1SMYF 1MNEA 1ZW3A 4JVSA 4Z9JA 3UGPA 5T1DB 2J7PD 1V74B 3K33A 4JEBA 4P9FA 3DAGA 3MYIA 2EPMX 4U5BE 4BG0A 1YZAA 3EQLF 1H9TA 3O39A 3ZC4A 2KYHA 4WGZA 2IBFA 3IQ5A 1YYXA 2B0JA 4O6YA 1Q0KA 2J9UA 2Q7RA 2M4EA 4JCZA 5BUOA 4HFKB 1NFNA 3M4BA 1QSPA 1G4US 4NTFA 1C02A 3TK0A 5A6BD 3S29A 2YL3A 3IQCA 1R4TA 3UMKA 2JPUA 3DE9A 4H4KC 3U8PA 5BQIA 2I8BA 3AOUA 1ZVZA 4RBNA 2MWQA 4E7ZA 1DOVA 1UFBA 4EBBA 3DKAA 3VRCA 1C17M 1XZPA 4O6MA 3ZDLA 3RW0A 3EHNA 2R7TA 2Y3HA 2LSEA 3WHNA 2NPUA 4OD4A 1NU9C 3V5ZA 5CIVA 1RKEA 3AG4C 2EINC 2UUIA 3LLKA 4JTCB 2PBEA 3JSZA 4JRZA 2LD6A 2WZLA 4HEAJ 2XLDA 2ZXWC 3T6GB 3LUTB 1TKNA 3FMSA 3K1IC 2XLEA 2R7QA 3T6JA 4H54A 2CNWD 2OEVA 3RVZA 4C3EA 3JSEO 1M2VB 4XPYA 3ABLC 4EKWA 3EHMA 3L8JA 4AK9A 5DS4A 1OQCA 1RCPA 2OJQA 4BJ5C 1I4ZA 1BR2A 5E33A 2YL1A 1QQ3A 4MNDA 1UG7A 2W4MA 3I4UA 1U89A 1O87A 1QPUA 3HNLA 2NUTA 3X1OA 5KYUB 4N6CA 3K7DA 2G62A 1Q0GA 3TOLA 2P6VA 2HKVA 3K1IA 1N1CA 1V4AA 1A7VA 2PX0A 3LJBA 1YA9A 4Q7CA 4W8PA 3V7OA 3WODF 5JRAA 1RKCA 4LDKA 1ZZPA 2QLAA 3GORA 3S28A 2IXOA 1K04A 4EHPA 4YT8A 3TD7A 1OW8A 3UR3C 2YKZA 4BJTA 4XPWA 1FFTC 2UUHA 3S27A 2EPNA 1XZQA 2AWYA 3KH2A 3U2LA 5KYXA 3OEOA 2XRHA 3VYWA 5E3AA 3JT1A 1LS1A 4IB4A 2EIMC 4EUKB 4OIQF 3SXYA 1FNTc 1ZHWA 3AJMA 4HFFB 1EA8A 4PFPA 3POVA 4W8KA 5L0JA 4PACA 2OQMA 2YQYA 4GYTA 2AWCA 2R7OA 4ONSA 1K40A 3FAPB 1D0YA 4ULVA 1JPNA 1BR1A 1ZU5A 4CS8A 3AGTA 4WABA 2XLWA 1VB5A 3LNRA 1LM3B 4JJGA 4CDVA 4E0HA 1LPEA 3DJNB 4DVYP 1JRAA 3FOPA 3TQOA 4JE9A 3US6A 5L0FA 1GGQA 2R7VA 3AQCA 2O9XA 3ASOC 4NY3A 3RVYA 5KYWA 4MVZA 2GFHA 1G8XA 2H8AA 3BRJA 3ZQYA 5F5HA 2XL4A 2J46A 3EPVA 3T4RA 1MMGA 3JTLO 1FAPB 2R02A 3B0VC 2CCYA 1H6GA 2V3CC 4G7OF 1QKRA 2Q9CA 3C18A 3M4CA 2Y69C 2KW3C 3ITFA 2DYSC 1YA7O 3O10A 4J7YA 4JZAA 2PP4A 4AX2A 1T6UA 2BE5F 2Y3DA 3C8GD 4U5FE 2C04A 3C7JA 1D0XA 1YVIA 3EG9B 4LDRA 3O6XA 5L0IA 1ORYA 1YARO 2ICWG 2J7PA 2LIGA 4UDVA 2KJGA 5F5FA 1WGWA 1RXQA 5DQTA 3Q7GA 1EKYA 4EIYA 3AG1C 1Q0MA 2X0CA 1I4YA 4MQ9F 2I15A 4YJWA 4MVOA 2CW0F 4Z9HA 3SZRA 5JUAA 1VLSA 2XLHA 2EPOA 3EFOA 3QTHA 5KYYA 2XXAA 2CGEA 2Q3TA 4IAOA 3ECSA 4N06A 3UMHA 3HTKC 5EK0A 4E17A 2QE9A 1O3UA 3PMRA 4WJ0A 4CIHA 2DYRC 2R7WA 4U5DE 1T6QA 2HV7A 2KNHA 3I5PA 4K1OA 4KC9A 3ZVRA 1LE4A 5IY5C 1BR4A 1T01A 2P7VA 3O55A 2XXAB 3CSKA 2A1DD 1SR2A 4QDLA 4PK4A 4CDAA 2XS8A 5A69A 1KNYA 2XSEA 3KYIA 3C8ZA 2QTVA 1NU7D 1C03A 2L6HA 2PF4E 3DM9B 2J0WA 3NRHA 4PJJA 2DGJA 3NMKA 1OXBA 2XL8A 3SXZA 2HMZA 4X0RA 4WGYA 4CJGA 3IQ6A 3H2VA 1PD1A 4MVMA 2YL0A 3M15A 5B3SC 2A0UA 2R7RA 1SZIA 5B1AC 2D5RB 2CNWA 5GPGB 1E86A 1VYIA 4O79A 2ZXOA 2GWWA 4DRIB 4JW1A 3QW0A 1FMVA 3CEXA 3U0CA 3SXKA 1ZW2A 1PV3A 2R7UA 3DMDA 3U8VA 2EIKC 5DVWA 1S7ZA 3RYLA 3W2WA 3B0UX 2OOCA 1V54C 3DI5A 2J8WA 1ZU4A 3CAXA 3M79A 4G78A 1WN0A 4MTOA 4NC3A 4DBRA 4CX9A 3X2QC 3DE8A 5DLJA 2IYLD 2VCAA 4F4BA 3ATPA 1NG1A 4MVRA 3GM2A 1D1CA 3KL4A 4K7BA 2R03A 4U5EE 3F46A 4G0HA 5BQGA 2PFDA 3IHUA 4BJ1A 2LK4A 2HSQA 1RKEB 3DM5A 1AUEA 1A0BA 3JRTA 2OEXA 4CDYA 5KYNA 2KGOA 2XLOA 1U6HA 5E3CA 3AG2C 4O7GA 1WASA 5COMA 1YZCA 1YJGA 4NQFA 1EI7A 2ASRA 4JTAB 1G4WR 4GQHA 1J8YF 1O5HA 3F47A 3L8IA 1PD0A 4EBJA 3NMJA 2R7XA 1L3PA 2QUPA 4IAQA 2YLDA 2W45A 1OR3A 3IEEA 1T9KA 2HJ3A 3PCVA 3MYFA 2YLGA 4C7OA 3QW1A 1AEPA 3C62A 4JEAA 5AC4A 2Z15A 3EGDA 4RD9A 4CSAC 1OXKA 2Q00A 1FFHA 2NUTB 5AGFA 1ZHZA 2XM4A 3AG3C 1U0BB 4J30B 5B1BC 1MMDA 2JX0A 4CJOA 1VOMA 5F28E 2YHSA 2L6GA 4N6HA 1A7EA 3LS0A 4ULWA 4BEJA 2NG1A 2M64A 3V5XA 4DXWA 3EZIA 1RJ9A 3HKKA 4DBQA 3E70C 2NSGA 4DVZA 4U9DA 1QLEC 2DB4A 1HY5A 4LERA 1E83A 4CS8C 2A0BA 1PCXA 4DRJB 3QMKA 4I3MA 4AE4B 5JP7A 4CSAA 3C63A 3DXJF 4XQ1A 2OKUA 3PHF2 1OW7A 4AL1A 4K0DA 1CGNA 3HNIA 1JR8A 3ABKC 3C8GA 3ZG1A 5HSWA 2AVKA 3ZTZA 3FVYA 1FMWA 5D91A 3VF0A 2RD9A 4NTAA 2LQGA 3GWNA 4MTFA 4DJ9A 2IOQA 4E0IA 1LVKA 2HUJA 4E18A 5TJ5E 3NYJA 3RQEA 1VTMP 4U5CE 2HSBA 3ZTMA 3FAJA 4XTKA 3HNJA 2XL6A 3DWWA 3KYJA 3U5SA 5A6AA 1JPJA 1TFKB 1LI7A 2FGYA 2G3VA 1ST6A 3A9CA 4NTBA 4XPXA 2VB6A 4ER9A 5L0HA 1FR0A 1OKKD 2A6HF 1MMAA 1IZMA 3RQGA 4XLPF 1ORJA 3I5QA 4QI2A 2HZ8A 3U2MA 1Q0DA 4D4NA 1LS4A 1QVXA 1M56C 1WWPA 3HLZA 3AQBA 3L34A 2YEVA 2WB7A 4MW3A 1OCZC 2ETSA 4YN0B 1A41A 4HE8D 1ZHYA 2KK1A 2VH3A 2P1AA 2WVNA 1Y6DA 1FTSA 3W4YA 5JS5A 1NFOA 3SXMA 4BJ6A 5EGYA 3EGXB 4BEMJ 3OWTA 4KI2A 3WG7C 1M6TA 3EZHA 1MQVA 2L81A 3NKEA 1D0ZA 2R05A 2C03A 1W2WA 4M63A 1E85A 4MW8A 2KQ9A 5CI9A 4JCHA 3K66A 3S90A 3SEOA 4XEKA 4BPMA 4OIRF 1JOGA 1JMWA 1HMOA 256BA 1Z63A 1OCOC 3B71A 4LACB 4MTGA 5K0IA 4Q5SF 3CZ6A 3RQFA 2NUPB 1G5ZA 5A6KA 3EFOB 5KYYB 2OG2A 4IJJA 4L6RA 2DI3A 2L9JA 1BDJB 4NCQA 3JRMO 1Q0FA 2GAQA 3G4ZA 3LS1A 4ANJA 3RFYA 3ABMC 2Y39A 2YZSA 5DQZA 5T3TA 3MLGA 4OINF 3GANA 4PJMA 5B3IA 1TQGA 3ZIBA 4EWCA 4LLCA 4GEHA 4JURI 2VCCA 3UGOA 3DJUB 1TFOB 4B6IA 1A7DA 2P0NA 2QY9A 3S84A 5L0CA 4MS2A 2CYDA 1TR2A 1T5OA 2J45A 2WL8A 4Z9IA 1D1BA 2ZXRA 3U9MA 1B68A 2HS5A 2OU6A 2PX3A 3NYMA 3B29A 3A11A 3BEHA 3B9QA 3MBGA 4U5GA 1HW2A 1YAUO 1Z5ZA 3UNGC 4ZLCA 3PDMP 3EJNA 2IM8A 4I44A 4JKVA 5A6JA 3EH1A 3LLIA 2QNLA 1D1AA 5COGA 2AP3A 3SNHA 1APCA 5L0GA 1NSGB 3M1CB 2BL2A 3FOOA 3HNKA 2EPLX 1OCCC 1CPRA 3GEEA 4I1MA 1IW7F 1H9GA 1OW6A 2OCCC 3R2PA 3S9OA 3W2VA 2A69F 2EIJC 4JTDB 1NBBA 4FESA 1Z6AA 1VYKA 3NG1A 2HFIA 4LLEA 3TOMA 4CBEA 2IXPA 3W8HA 3KMIA 2EPKX 4LDQA 4RDAA 1JAFA 4YL1A 4XLNF 1RMVA 1HE1A 2J0XA 1ZHTA 3NKDA 4AL0A 3Q6MA 2VC9A 3N2ZB 4XEVA 4I1OB 2H7VC 3UMIA 3JYYA 3LNMB 4YT4A 3Q6NA 1EQ1A 2FFHA 2YLIA 4YT2A 5L3VA 3VM6A 4OD5A 3S0XA 2PNOA 2X51A 2TMVP 4J7TA 3Q7LA 4PFOA 4PJLA 4U9EA 3TJ6A 5COFA 3MX3A 1HE9A 1LI5A 3DD7A 1SF8A 2OJED 2ZPAA 3GEIA 3FHDA 3FXHA
chains in the Genus database with same CATH topology
1NZEA 1OCRC 1M57C 3SP1A 2ZXPA 4KNWA 4C7OB 1VK5A 4ZLDA 1Z3IX 3JCUQ 3EGDB 1TWCA 2HV6A 5EHHA 2A68F 3LEVA 4O6NA 4P6IC 1OKKA 4U5HA 3LAYA 1V55C 2CDQA 1M2OA 4IRUA 1RJ9B 3N24A 4YT5A 3B0PA 3KKBA 1J8MF 2WZGA 3RKOF 3E9VA 4E7SA 5KYXB 5CI8A 1M2VA 1KU2A 3ZSUA 1QZXA 5E2QA 5KYUA 1VMAA 3CQZA 4BJ6C 3QZCA 3H65A 2Q9AA 2J9VA 4KBLA 3EH2A 3JYHA 3HJCA 2Q9BA 3OA1A 4BJ5A 2H7BA 5KYWB 4G7ZF 2Y3GA 4AE4A 1ZYRF 5FCLA 4A2NB 3B0UX 3DAFA 3NYLA 2V26A 1TWHA 4FX5A 3ASNC 2J9WA 3LESA 3NDBB 5DS5A 4FWVA 4IWBA 1ZHXA 5T3WA 2MYSA 2W4BA 4J32B 2G3KA 4DOZA 2VASA 1Z23A 4YWQA 4G7HF 3RH3A 3L0IA 3EGXA 1MMNA 2WVQA 3DZAA 4CS9C 2R7SA 2WVOA 1LKXA 2IXNA 4QI0A 4OIPF 4PJNA 3K1HA 3EG9A 4XWJA 4OIOF 2WZFA 3FDQA 2JD3A 4C3DA 4Q4ZF 2H7OA 1TWGA 3N0TA 4JJFA 2IXMA 3W8IA 2NUPA 2EILC 4CS9A 1MNDA 2E87A 4KNVA 2Y3BA 3GODA 4C3BA 5L3QA 5D92A 3RIPA 3K6BA 3VAYA 2A6EF 4CS7A 2W9YA 3SYNA 1TWAA 3T6BA 1SMYF 1MNEA 4JVSA 3UGPA 5T1DB 2J7PD 3K33A 3DAGA 4U5BE 4BG0A 3EQLF 3O39A 3ZC4A 2B0JA 4O6YA 2J9UA 2M4EA 5BUOA 4HFKB 3S29A 3UMKA 4H4KC 2I8BA 4RBNA 2MWQA 4E7ZA 4EBBA 4O6MA 2R7TA 3EHNA 2Y3HA 2LSEA 4OD4A 1NU9C 3AG4C 2EINC 3LLKA 3JSZA 4HEAJ 2WZLA 2ZXWC 1TKNA 3K1IC 2R7QA 3T6JA 2CNWD 4C3EA 1M2VB 3ABLC 3EHMA 4AK9A 5DS4A 4BJ5C 5E33A 1BR2A 4MNDA 2W4MA 3I4UA 1O87A 2NUTA 3X1OA 5KYUB 3K7DA 2G62A 2P6VA 3LJBA 1N1CA 2PX0A 4Q7CA 3WODF 3V7OA 3S28A 4YT8A 2IXOA 3TD7A 3UR3C 4BJTA 5KYXA 1FFTC 3S27A 3KH2A 3OEOA 2XRHA 3VYWA 5E3AA 3JT1A 1LS1A 2EIMC 4OIQF 1ZHWA 4HFFB 4PFPA 3POVA 4W8KA 4GYTA 2R7OA 1D0YA 1JPNA 1BR1A 1ZU5A 4CS8A 3LNRA 4JJGA 3DJNB 4DVYP 2R7VA 3AQCA 2O9XA 3ASOC 4NY3A 5KYWA 2GFHA 1G8XA 5F5HA 2XL4A 2J46A 3EPVA 3T4RA 1MMGA 2V3CC 3B0VC 4G7OF 2Q9CA 2Y69C 2KW3C 3ITFA 2DYSC 4JZAA 4AX2A 2PP4A 2BE5F 2Y3DA 4U5FE 2C04A 1D0XA 3EG9B 3O6XA 2J7PA 5F5FA 2KJGA 1WGWA 5DQTA 3Q7GA 3AG1C 4MQ9F 4YJWA 3SZRA 2CW0F 3EFOA 5KYYA 2CGEA 2Q3TA 4IAOA 3ECSA 4N06A 3UMHA 3HTKC 3PMRA 4WJ0A 4CIHA 2DYRC 2R7WA 4U5DE 2HV7A 2KNHA 3I5PA 4KC9A 3ZVRA 5IY5C 1BR4A 2P7VA 2XXAB 3CSKA 2A1DD 4QDLA 4PK4A 2XSEA 2QTVA 1NU7D 2PF4E 3DM9B 2J0WA 3NRHA 4PJJA 2DGJA 4X0RA 1PD1A 5B3SC 2R7RA 1SZIA 5B1AC 2D5RB 2CNWA 1VYIA 4O79A 2ZXOA 4JW1A 1FMVA 2R7UA 3DMDA 3W2WA 2EIKC 5DVWA 1S7ZA 3RYLA 1V54C 1ZU4A 4DBRA 3X2QC 5DLJA 2IYLD 4F4BA 1NG1A 4U5EE 1D1CA 3KL4A 4K7BA 3F46A 4G0HA 2PFDA 4BJ1A 3DM5A 3JRTA 5KYNA 2KGOA 5E3CA 3AG2C 4O7GA 1J8YF 1O5HA 3F47A 2R7XA 1PD0A 2W45A 3IEEA 4C7OA 2Z15A 3EGDA 4RD9A 4CSAC 1FFHA 2NUTB 1ZHZA 3AG3C 4J30B 5B1BC 1MMDA 1VOMA 2YHSA 3LS0A 4ULWA 4BEJA 2NG1A 3EZIA 1RJ9A 4DBQA 3E70C 4DVZA 1QLEC 4LERA 4CS8C 1PCXA 3QMKA 4I3MA 4AE4B 4CSAA 3DXJF 3PHF2 4K0DA 5HSWA 3ZG1A 3ABKC 3FVYA 1FMWA 5D91A 2IOQA 1LVKA 3NYJA 4U5CE 3FAJA 4XTKA 1JPJA 2FGYA 2G3VA 1ST6A 2VB6A 1OKKD 2A6HF 1MMAA 1IZMA 4XLPF 3I5QA 4QI2A 3L34A 3HLZA 1M56C 3AQBA 2YEVA 2WB7A 1OCZC 4YN0B 4HE8D 1ZHYA 2VH3A 2WVNA 1FTSA 5EGYA 4BJ6A 3EGXB 3OWTA 4KI2A 3WG7C 3EZHA 2L81A 3NKEA 1D0ZA 2C03A 1W2WA 4M63A 2KQ9A 5CI9A 4JCHA 3K66A 3SEOA 4OIRF 1Z63A 1OCOC 4LACB 4Q5SF 3CZ6A 2NUPB 3EFOB 5KYYB 2OG2A 4IJJA 2L9JA 3LS1A 4ANJA 3RFYA 3ABMC 2Y39A 2YZSA 5DQZA 5T3TA 3MLGA 4OINF 3GANA 4PJMA 3ZIBA 4EWCA 4LLCA 4GEHA 4JURI 3UGOA 3DJUB 4B6IA 2QY9A 1TR2A 2J45A 2WL8A 1D1BA 2ZXRA 3NYMA 2PX3A 4U5GA 3B9QA 1Z5ZA 3UNGC 4ZLCA 3EJNA 4I44A 3EH1A 3LLIA 1D1AA 3SNHA 3M1CB 1OCCC 4I1MA 1IW7F 5DS6A 2OCCC 3W2VA 2A69F 2EIJC 2XXAA 4FESA 1Z6AA 1VYKA 3NG1A 4LLEA 4CBEA 2IXPA 3W8HA 3KMIA 4RDAA 4XLNF 2J0XA 1ZHTA 3NKDA 3Q6MA 3N2ZB 4I1OB 2H7VC 3UMIA 4YT4A 3Q6NA 2FFHA 4YT2A 5L3VA 4OD5A 3S0XA 2X51A 3Q7LA 4PFOA 4PJLA 3MX3A 3DD7A 1SF8A 2ZPAA 3FHDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YWQ A;  5F5H A;  4ULW A;  5F5F A;  3X1O A;  4QI0 A;  4QI2 A;  4ZLD A;  4ZLC A; 
#chains in the Genus database with same CATH topology
 2LFF A;  1NZE A;  2D4U A;  3U3B A;  1OCR C;  1M57 C;  1GM5 A;  3SP1 A;  3R7C A;  1VLT A;  2ZXP A;  4KNW A;  3U3F A;  4C7O B;  2F22 A;  1VK5 A;  4ZLD A;  1Z3I X;  1E2X A;  3JCU Q;  3EGD B;  1HW1 A;  1TWC A;  1YYJ A;  1H7I A;  2LCH A;  3V5Y A;  3H2U A;  2HV6 A;  5EHH A;  2A68 F;  3LEV A;  1NLX A;  4MVQ A;  2YVK A;  4O6N A;  1OKK A;  4P6I C;  4U5H A;  3LAY A;  1OR2 A;  1V55 C;  2CDQ A;  4YK5 A;  1M2O A;  1GS9 A;  4IRU A;  1RJ9 B;  3N24 A;  4YT5 A;  3TJ5 A;  3B0P A;  1J8M F;  3KKB A;  2WZG A;  3RKO F;  2Q4F A;  3E9V A;  4E7S A;  5KYX B;  3AGU A;  2GA0 A;  1LIH A;  2YRF A;  4A4A A;  1F1M A;  5CI8 A;  1M2V A;  1ORS C;  1KU2 A;  3C8G B;  4YL3 A;  3ZSU A;  4JC7 A;  2L6F A;  1QZX A;  5E2Q A;  4DRH B;  5KYU A;  5JT4 A;  1VMA A;  3CQZ A;  4BJ6 C;  1HMD A;  1CGO A;  3QZC A;  3IPM O;  3H65 A;  2Q9A A;  3KPH A;  2J9V A;  4KBL A;  1GQA A;  3L1M A;  1SYQ A;  5FZT A;  3EH2 A;  3JYH A;  3HJC A;  2Q9B A;  3GM3 A;  3OA1 A;  4BJ5 A;  2H7B A;  2LFD A;  5KYW B;  3JZ0 A;  4G7Z F;  3GM1 A;  2YWA A;  2Y3G A;  1LE2 A;  4AE4 A;  1ZYR F;  5FCL A;  5HV9 A;  1E84 A;  1KTM A;  2GDC A;  3GEH A;  4EBK A;  4A2N B;  1Y4C A;  2HJM A;  3DAF A;  3NYL A;  2V26 A;  1WAT A;  1TWH A;  4FX5 A;  4R32 A;  3ASN C;  5JLI A;  2L7A A;  2J9W A;  3LES A;  1YDI A;  3NDB B;  5DS5 A;  4FWV A;  4P9T A;  4IWB A;  5BQH A;  1ZHX A;  5T3W A;  3ZWI A;  1L7C A;  2MYS A;  3WAQ A;  5JSL A;  2XLV A;  1CGM E;  1WOL A;  2YL7 A;  3RF3 A;  1YLM A;  3QVY A;  2W4B A;  4J32 B;  2R25 A;  2RSE B;  2G3K A;  4D4X A;  4DOZ A;  2VAS A;  1Z23 A;  1T6I A;  3ZQV A;  4YWQ A;  4G7H F;  5JVE A;  3IQT A;  3MFN A;  2KSF A;  3RH3 A;  3L0I A;  4N4W A;  3T9O A;  3EGX A;  3LEO A;  4CIP A;  3J06 A;  1MMN A;  2WVQ A;  3DZA A;  3U9J A;  4CS9 C;  1I5N A;  2R7S A;  1XWJ A;  2WVO A;  5DS6 A;  1LKX A;  2IXN A;  1K05 A;  1AVO B;  4IGG A;  4QI0 A;  4OIP F;  2NSF A;  4PJN A;  5L0D A;  3K1H A;  1WTY A;  3EG9 A;  3NMI A;  2ZD9 A;  4XWJ A;  4FAP B;  4OIO F;  2WZF A;  2AU5 A;  2FAP B;  4MVU A;  3G50 A;  1DOW A;  3FDQ A;  2JD3 A;  3G4X A;  4IAR A;  1S05 A;  4C3D A;  4XEF A;  1Z7Q c;  4Q4Z F;  2H7O A;  2P61 A;  1TWG A;  4MVS A;  2XM0 A;  2MHR A;  3N0T A;  2IXM A;  4JJF A;  2J9B A;  3W8I A;  2BC5 A;  2NUP A;  2EIL C;  4CS9 A;  1MND A;  2LP4 A;  2E87 A;  4JIO A;  2XLM A;  1CPQ A;  3GWL A;  4KNV A;  1R5I D;  2KC3 A;  5A6B A;  2Y3B A;  3GOD A;  5AC5 A;  3QVZ A;  2HMQ A;  2VCB A;  4C3B A;  3TUL A;  2B0H A;  4PR9 A;  5L3Q A;  5D92 A;  2XS1 A;  3RIP A;  4YL0 A;  3K6B A;  1BZ4 A;  3VAY A;  2A6E F;  4CS7 A;  1BBH A;  2R9R B;  2W9Y A;  3SYN A;  1TWA A;  3T6B A;  1SMY F;  1MNE A;  1ZW3 A;  4JVS A;  4Z9J A;  3UGP A;  5T1D B;  2J7P D;  1V74 B;  3K33 A;  4JEB A;  4P9F A;  3DAG A;  3MYI A;  2EPM X;  4U5B E;  4BG0 A;  1YZA A;  3EQL F;  1H9T A;  3O39 A;  3ZC4 A;  2KYH A;  4WGZ A;  2IBF A;  3IQ5 A;  1YYX A;  2B0J A;  4O6Y A;  1Q0K A;  2J9U A;  2Q7R A;  2M4E A;  4JCZ A;  5BUO A;  4HFK B;  1NFN A;  3M4B A;  1QSP A;  1G4U S;  4NTF A;  1C02 A;  3TK0 A;  5A6B D;  3S29 A;  2YL3 A;  3IQC A;  1R4T A;  3UMK A;  2JPU A;  3DE9 A;  4H4K C;  3U8P A;  5BQI A;  2I8B A;  3AOU A;  1ZVZ A;  4RBN A;  2MWQ A;  4E7Z A;  1DOV A;  1UFB A;  4EBB A;  3DKA A;  3VRC A;  1C17 M;  1XZP A;  4O6M A;  3ZDL A;  3RW0 A;  3EHN A;  2R7T A;  2Y3H A;  2LSE A;  3WHN A;  2NPU A;  4OD4 A;  1NU9 C;  3V5Z A;  5CIV A;  1RKE A;  3AG4 C;  2EIN C;  2UUI A;  3LLK A;  4JTC B;  2PBE A;  3JSZ A;  4JRZ A;  2LD6 A;  2WZL A;  4HEA J;  2XLD A;  2ZXW C;  3T6G B;  3LUT B;  1TKN A;  3FMS A;  3K1I C;  2XLE A;  2R7Q A;  3T6J A;  4H54 A;  2CNW D;  2OEV A;  3RVZ A;  4C3E A;  3JSE O;  1M2V B;  4XPY A;  3ABL C;  4EKW A;  3EHM A;  3L8J A;  4AK9 A;  5DS4 A;  1OQC A;  1RCP A;  2OJQ A;  4BJ5 C;  1I4Z A;  1BR2 A;  5E33 A;  2YL1 A;  1QQ3 A;  4MND A;  1UG7 A;  2W4M A;  3I4U A;  1U89 A;  1O87 A;  1QPU A;  3HNL A;  2NUT A;  3X1O A;  5KYU B;  4N6C A;  3K7D A;  2G62 A;  1Q0G A;  3TOL A;  2P6V A;  2HKV A;  3K1I A;  1N1C A;  1V4A A;  1A7V A;  2PX0 A;  3LJB A;  1YA9 A;  4Q7C A;  4W8P A;  3V7O A;  3WOD F;  5JRA A;  1RKC A;  4LDK A;  1ZZP A;  2QLA A;  3GOR A;  3S28 A;  2IXO A;  1K04 A;  4EHP A;  4YT8 A;  3TD7 A;  1OW8 A;  3UR3 C;  2YKZ A;  4BJT A;  4XPW A;  1FFT C;  2UUH A;  3S27 A;  2EPN A;  1XZQ A;  2AWY A;  3KH2 A;  3U2L A;  5KYX A;  3OEO A;  2XRH A;  3VYW A;  5E3A A;  3JT1 A;  1LS1 A;  4IB4 A;  2EIM C;  4EUK B;  4OIQ F;  3SXY A;  1FNT c;  1ZHW A;  3AJM A;  4HFF B;  1EA8 A;  4PFP A;  3POV A;  4W8K A;  5L0J A;  4PAC A;  2OQM A;  2YQY A;  4GYT A;  2AWC A;  2R7O A;  4ONS A;  1K40 A;  3FAP B;  1D0Y A;  4ULV A;  1JPN A;  1BR1 A;  1ZU5 A;  4CS8 A;  3AGT A;  4WAB A;  2XLW A;  1VB5 A;  3LNR A;  1LM3 B;  4JJG A;  4CDV A;  4E0H A;  1LPE A;  3DJN B;  4DVY P;  1JRA A;  3FOP A;  3TQO A;  4JE9 A;  3US6 A;  5L0F A;  1GGQ A;  2R7V A;  3AQC A;  2O9X A;  3ASO C;  4NY3 A;  3RVY A;  5KYW A;  4MVZ A;  2GFH A;  1G8X A;  2H8A A;  3BRJ A;  3ZQY A;  5F5H A;  2XL4 A;  2J46 A;  3EPV A;  3T4R A;  1MMG A;  3JTL O;  1FAP B;  2R02 A;  3B0V C;  2CCY A;  1H6G A;  2V3C C;  4G7O F;  1QKR A;  2Q9C A;  3C18 A;  3M4C A;  2Y69 C;  2KW3 C;  3ITF A;  2DYS C;  1YA7 O;  3O10 A;  4J7Y A;  4JZA A;  2PP4 A;  4AX2 A;  1T6U A;  2BE5 F;  2Y3D A;  3C8G D;  4U5F E;  2C04 A;  3C7J A;  1D0X A;  1YVI A;  3EG9 B;  4LDR A;  3O6X A;  5L0I A;  1ORY A;  1YAR O;  2ICW G;  2J7P A;  2LIG A;  4UDV A;  2KJG A;  5F5F A;  1WGW A;  1RXQ A;  5DQT A;  3Q7G A;  1EKY A;  4EIY A;  3AG1 C;  1Q0M A;  2X0C A;  1I4Y A;  4MQ9 F;  2I15 A;  4YJW A;  4MVO A;  2CW0 F;  4Z9H A;  3SZR A;  5JUA A;  1VLS A;  2XLH A;  2EPO A;  3EFO A;  3QTH A;  5KYY A;  2XXA A;  2CGE A;  2Q3T A;  4IAO A;  3ECS A;  4N06 A;  3UMH A;  3HTK C;  5EK0 A;  4E17 A;  2QE9 A;  1O3U A;  3PMR A;  4WJ0 A;  4CIH A;  2DYR C;  2R7W A;  4U5D E;  1T6Q A;  2HV7 A;  2KNH A;  3I5P A;  4K1O A;  4KC9 A;  3ZVR A;  1LE4 A;  5IY5 C;  1BR4 A;  1T01 A;  2P7V A;  3O55 A;  2XXA B;  3CSK A;  2A1D D;  1SR2 A;  4QDL A;  4PK4 A;  4CDA A;  2XS8 A;  5A69 A;  1KNY A;  2XSE A;  3KYI A;  3C8Z A;  2QTV A;  1NU7 D;  1C03 A;  2L6H A;  2PF4 E;  3DM9 B;  2J0W A;  3NRH A;  4PJJ A;  2DGJ A;  3NMK A;  1OXB A;  2XL8 A;  3SXZ A;  2HMZ A;  4X0R A;  4WGY A;  4CJG A;  3IQ6 A;  3H2V A;  1PD1 A;  4MVM A;  2YL0 A;  3M15 A;  5B3S C;  2A0U A;  2R7R A;  1SZI A;  5B1A C;  2D5R B;  2CNW A;  5GPG B;  1E86 A;  1VYI A;  4O79 A;  2ZXO A;  2GWW A;  4DRI B;  4JW1 A;  3QW0 A;  1FMV A;  3CEX A;  3U0C A;  3SXK A;  1ZW2 A;  1PV3 A;  2R7U A;  3DMD A;  3U8V A;  2EIK C;  5DVW A;  1S7Z A;  3RYL A;  3W2W A;  3B0U X;  2OOC A;  1V54 C;  3DI5 A;  2J8W A;  1ZU4 A;  3CAX A;  3M79 A;  4G78 A;  1WN0 A;  4MTO A;  4NC3 A;  4DBR A;  4CX9 A;  3X2Q C;  3DE8 A;  5DLJ A;  2IYL D;  2VCA A;  4F4B A;  3ATP A;  1NG1 A;  4MVR A;  3GM2 A;  1D1C A;  3KL4 A;  4K7B A;  2R03 A;  4U5E E;  3F46 A;  4G0H A;  5BQG A;  2PFD A;  3IHU A;  4BJ1 A;  2LK4 A;  2HSQ A;  1RKE B;  3DM5 A;  1AUE A;  1A0B A;  3JRT A;  2OEX A;  4CDY A;  5KYN A;  2KGO A;  2XLO A;  1U6H A;  5E3C A;  3AG2 C;  4O7G A;  1WAS A;  5COM A;  1YZC A;  1YJG A;  4NQF A;  1EI7 A;  2ASR A;  4JTA B;  1G4W R;  4GQH A;  1J8Y F;  1O5H A;  3F47 A;  3L8I A;  1PD0 A;  4EBJ A;  3NMJ A;  2R7X A;  1L3P A;  2QUP A;  4IAQ A;  2YLD A;  2W45 A;  1OR3 A;  3IEE A;  1T9K A;  2HJ3 A;  3PCV A;  3MYF A;  2YLG A;  4C7O A;  3QW1 A;  1AEP A;  3C62 A;  4JEA A;  5AC4 A;  2Z15 A;  3EGD A;  4RD9 A;  4CSA C;  1OXK A;  2Q00 A;  1FFH A;  2NUT B;  5AGF A;  1ZHZ A;  2XM4 A;  3AG3 C;  1U0B B;  4J30 B;  5B1B C;  1MMD A;  2JX0 A;  4CJO A;  1VOM A;  5F28 E;  2YHS A;  2L6G A;  4N6H A;  1A7E A;  3LS0 A;  4ULW A;  4BEJ A;  2NG1 A;  2M64 A;  3V5X A;  4DXW A;  3EZI A;  1RJ9 A;  3HKK A;  4DBQ A;  3E70 C;  2NSG A;  4DVZ A;  4U9D A;  1QLE C;  2DB4 A;  1HY5 A;  4LER A;  1E83 A;  4CS8 C;  2A0B A;  1PCX A;  4DRJ B;  3QMK A;  4I3M A;  4AE4 B;  5JP7 A;  4CSA A;  3C63 A;  3DXJ F;  4XQ1 A;  2OKU A;  3PHF 2;  1OW7 A;  4AL1 A;  4K0D A;  1CGN A;  3HNI A;  1JR8 A;  3ABK C;  3C8G A;  3ZG1 A;  5HSW A;  2AVK A;  3ZTZ A;  3FVY A;  1FMW A;  5D91 A;  3VF0 A;  2RD9 A;  4NTA A;  2LQG A;  3GWN A;  4MTF A;  4DJ9 A;  2IOQ A;  4E0I A;  1LVK A;  2HUJ A;  4E18 A;  5TJ5 E;  3NYJ A;  3RQE A;  1VTM P;  4U5C E;  2HSB A;  3ZTM A;  3FAJ A;  4XTK A;  3HNJ A;  2XL6 A;  3DWW A;  3KYJ A;  3U5S A;  5A6A A;  1JPJ A;  1TFK B;  1LI7 A;  2FGY A;  2G3V A;  1ST6 A;  3A9C A;  4NTB A;  4XPX A;  2VB6 A;  4ER9 A;  5L0H A;  1FR0 A;  1OKK D;  2A6H F;  1MMA A;  1IZM A;  3RQG A;  4XLP F;  1ORJ A;  3I5Q A;  4QI2 A;  2HZ8 A;  3U2M A;  1Q0D A;  4D4N A;  1LS4 A;  1QVX A;  1M56 C;  1WWP A;  3HLZ A;  3AQB A;  3L34 A;  2YEV A;  2WB7 A;  4MW3 A;  1OCZ C;  2ETS A;  4YN0 B;  1A41 A;  4HE8 D;  1ZHY A;  2KK1 A;  2VH3 A;  2P1A A;  2WVN A;  1Y6D A;  1FTS A;  3W4Y A;  5JS5 A;  1NFO A;  3SXM A;  4BJ6 A;  5EGY A;  3EGX B;  4BEM J;  3OWT A;  4KI2 A;  3WG7 C;  1M6T A;  3EZH A;  1MQV A;  2L81 A;  3NKE A;  1D0Z A;  2R05 A;  2C03 A;  1W2W A;  4M63 A;  1E85 A;  4MW8 A;  2KQ9 A;  5CI9 A;  4JCH A;  3K66 A;  3S90 A;  3SEO A;  4XEK A;  4BPM A;  4OIR F;  1JOG A;  1JMW A;  1HMO A;  256B A;  1Z63 A;  1OCO C;  3B71 A;  4LAC B;  4MTG A;  5K0I A;  4Q5S F;  3CZ6 A;  3RQF A;  2NUP B;  1G5Z A;  5A6K A;  3EFO B;  5KYY B;  2OG2 A;  4IJJ A;  4L6R A;  2DI3 A;  2L9J A;  1BDJ B;  4NCQ A;  3JRM O;  1Q0F A;  2GAQ A;  3G4Z A;  3LS1 A;  4ANJ A;  3RFY A;  3ABM C;  2Y39 A;  2YZS A;  5DQZ A;  5T3T A;  3MLG A;  4OIN F;  3GAN A;  4PJM A;  5B3I A;  1TQG A;  3ZIB A;  4EWC A;  4LLC A;  4GEH A;  4JUR I;  2VCC A;  3UGO A;  3DJU B;  1TFO B;  4B6I A;  1A7D A;  2P0N A;  2QY9 A;  3S84 A;  5L0C A;  4MS2 A;  2CYD A;  1TR2 A;  1T5O A;  2J45 A;  2WL8 A;  4Z9I A;  1D1B A;  2ZXR A;  3U9M A;  1B68 A;  2HS5 A;  2OU6 A;  2PX3 A;  3NYM A;  3B29 A;  3A11 A;  3BEH A;  3B9Q A;  3MBG A;  4U5G A;  1HW2 A;  1YAU O;  1Z5Z A;  3UNG C;  4ZLC A;  3PDM P;  3EJN A;  2IM8 A;  4I44 A;  4JKV A;  5A6J A;  3EH1 A;  3LLI A;  2QNL A;  1D1A A;  5COG A;  2AP3 A;  3SNH A;  1APC A;  5L0G A;  1NSG B;  3M1C B;  2BL2 A;  3FOO A;  3HNK A;  2EPL X;  1OCC C;  1CPR A;  3GEE A;  4I1M A;  1IW7 F;  1H9G A;  1OW6 A;  2OCC C;  3R2P A;  3S9O A;  3W2V A;  2A69 F;  2EIJ C;  4JTD B;  1NBB A;  4FES A;  1Z6A A;  1VYK A;  3NG1 A;  2HFI A;  4LLE A;  3TOM A;  4CBE A;  2IXP A;  3W8H A;  3KMI A;  2EPK X;  4LDQ A;  4RDA A;  1JAF A;  4YL1 A;  4XLN F;  1RMV A;  1HE1 A;  2J0X A;  1ZHT A;  3NKD A;  4AL0 A;  3Q6M A;  2VC9 A;  3N2Z B;  4XEV A;  4I1O B;  2H7V C;  3UMI A;  3JYY A;  3LNM B;  4YT4 A;  3Q6N A;  1EQ1 A;  2FFH A;  2YLI A;  4YT2 A;  5L3V A;  3VM6 A;  4OD5 A;  3S0X A;  2PNO A;  2X51 A;  2TMV P;  4J7T A;  3Q7L A;  4PFO A;  4PJL A;  4U9E A;  3TJ6 A;  5COF A;  3MX3 A;  1HE9 A;  1LI5 A;  3DD7 A;  1SF8 A;  2OJE D;  2ZPA A;  3GEI A;  3FHD A;  3FXH A; 
#chains in the Genus database with same CATH homology
 1NZE A;  1OCR C;  1M57 C;  3SP1 A;  2ZXP A;  4KNW A;  4C7O B;  1VK5 A;  4ZLD A;  1Z3I X;  3JCU Q;  3EGD B;  1TWC A;  2HV6 A;  5EHH A;  2A68 F;  3LEV A;  4O6N A;  4P6I C;  1OKK A;  4U5H A;  3LAY A;  1V55 C;  2CDQ A;  1M2O A;  4IRU A;  1RJ9 B;  3N24 A;  4YT5 A;  3B0P A;  3KKB A;  1J8M F;  2WZG A;  3RKO F;  3E9V A;  4E7S A;  5KYX B;  5CI8 A;  1M2V A;  1KU2 A;  3ZSU A;  1QZX A;  5E2Q A;  5KYU A;  1VMA A;  3CQZ A;  4BJ6 C;  3QZC A;  3H65 A;  2Q9A A;  2J9V A;  4KBL A;  3EH2 A;  3JYH A;  3HJC A;  2Q9B A;  3OA1 A;  4BJ5 A;  2H7B A;  5KYW B;  4G7Z F;  2Y3G A;  4AE4 A;  1ZYR F;  5FCL A;  4A2N B;  3B0U X;  3DAF A;  3NYL A;  2V26 A;  1TWH A;  4FX5 A;  3ASN C;  2J9W A;  3LES A;  3NDB B;  5DS5 A;  4FWV A;  4IWB A;  1ZHX A;  5T3W A;  2MYS A;  2W4B A;  4J32 B;  2G3K A;  4DOZ A;  2VAS A;  1Z23 A;  4YWQ A;  4G7H F;  3RH3 A;  3L0I A;  3EGX A;  1MMN A;  2WVQ A;  3DZA A;  4CS9 C;  2R7S A;  2WVO A;  1LKX A;  2IXN A;  4QI0 A;  4OIP F;  4PJN A;  3K1H A;  3EG9 A;  4XWJ A;  4OIO F;  2WZF A;  3FDQ A;  2JD3 A;  4C3D A;  4Q4Z F;  2H7O A;  1TWG A;  3N0T A;  4JJF A;  2IXM A;  3W8I A;  2NUP A;  2EIL C;  4CS9 A;  1MND A;  2E87 A;  4KNV A;  2Y3B A;  3GOD A;  4C3B A;  5L3Q A;  5D92 A;  3RIP A;  3K6B A;  3VAY A;  2A6E F;  4CS7 A;  2W9Y A;  3SYN A;  1TWA A;  3T6B A;  1SMY F;  1MNE A;  4JVS A;  3UGP A;  5T1D B;  2J7P D;  3K33 A;  3DAG A;  4U5B E;  4BG0 A;  3EQL F;  3O39 A;  3ZC4 A;  2B0J A;  4O6Y A;  2J9U A;  2M4E A;  5BUO A;  4HFK B;  3S29 A;  3UMK A;  4H4K C;  2I8B A;  4RBN A;  2MWQ A;  4E7Z A;  4EBB A;  4O6M A;  2R7T A;  3EHN A;  2Y3H A;  2LSE A;  4OD4 A;  1NU9 C;  3AG4 C;  2EIN C;  3LLK A;  3JSZ A;  4HEA J;  2WZL A;  2ZXW C;  1TKN A;  3K1I C;  2R7Q A;  3T6J A;  2CNW D;  4C3E A;  1M2V B;  3ABL C;  3EHM A;  4AK9 A;  5DS4 A;  4BJ5 C;  5E33 A;  1BR2 A;  4MND A;  2W4M A;  3I4U A;  1O87 A;  2NUT A;  3X1O A;  5KYU B;  3K7D A;  2G62 A;  2P6V A;  3LJB A;  1N1C A;  2PX0 A;  4Q7C A;  3WOD F;  3V7O A;  3S28 A;  4YT8 A;  2IXO A;  3TD7 A;  3UR3 C;  4BJT A;  5KYX A;  1FFT C;  3S27 A;  3KH2 A;  3OEO A;  2XRH A;  3VYW A;  5E3A A;  3JT1 A;  1LS1 A;  2EIM C;  4OIQ F;  1ZHW A;  4HFF B;  4PFP A;  3POV A;  4W8K A;  4GYT A;  2R7O A;  1D0Y A;  1JPN A;  1BR1 A;  1ZU5 A;  4CS8 A;  3LNR A;  4JJG A;  3DJN B;  4DVY P;  2R7V A;  3AQC A;  2O9X A;  3ASO C;  4NY3 A;  5KYW A;  2GFH A;  1G8X A;  5F5H A;  2XL4 A;  2J46 A;  3EPV A;  3T4R A;  1MMG A;  2V3C C;  3B0V C;  4G7O F;  2Q9C A;  2Y69 C;  2KW3 C;  3ITF A;  2DYS C;  4JZA A;  4AX2 A;  2PP4 A;  2BE5 F;  2Y3D A;  4U5F E;  2C04 A;  1D0X A;  3EG9 B;  3O6X A;  2J7P A;  5F5F A;  2KJG A;  1WGW A;  5DQT A;  3Q7G A;  3AG1 C;  4MQ9 F;  4YJW A;  3SZR A;  2CW0 F;  3EFO A;  5KYY A;  2CGE A;  2Q3T A;  4IAO A;  3ECS A;  4N06 A;  3UMH A;  3HTK C;  3PMR A;  4WJ0 A;  4CIH A;  2DYR C;  2R7W A;  4U5D E;  2HV7 A;  2KNH A;  3I5P A;  4KC9 A;  3ZVR A;  5IY5 C;  1BR4 A;  2P7V A;  2XXA B;  3CSK A;  2A1D D;  4QDL A;  4PK4 A;  2XSE A;  2QTV A;  1NU7 D;  2PF4 E;  3DM9 B;  2J0W A;  3NRH A;  4PJJ A;  2DGJ A;  4X0R A;  1PD1 A;  5B3S C;  2R7R A;  1SZI A;  5B1A C;  2D5R B;  2CNW A;  1VYI A;  4O79 A;  2ZXO A;  4JW1 A;  1FMV A;  2R7U A;  3DMD A;  3W2W A;  2EIK C;  5DVW A;  1S7Z A;  3RYL A;  1V54 C;  1ZU4 A;  4DBR A;  3X2Q C;  5DLJ A;  2IYL D;  4F4B A;  1NG1 A;  4U5E E;  1D1C A;  3KL4 A;  4K7B A;  3F46 A;  4G0H A;  2PFD A;  4BJ1 A;  3DM5 A;  3JRT A;  5KYN A;  2KGO A;  5E3C A;  3AG2 C;  4O7G A;  1J8Y F;  1O5H A;  3F47 A;  2R7X A;  1PD0 A;  2W45 A;  3IEE A;  4C7O A;  2Z15 A;  3EGD A;  4RD9 A;  4CSA C;  1FFH A;  2NUT B;  1ZHZ A;  3AG3 C;  4J30 B;  5B1B C;  1MMD A;  1VOM A;  2YHS A;  3LS0 A;  4ULW A;  4BEJ A;  2NG1 A;  3EZI A;  1RJ9 A;  4DBQ A;  3E70 C;  4DVZ A;  1QLE C;  4LER A;  4CS8 C;  1PCX A;  3QMK A;  4I3M A;  4AE4 B;  4CSA A;  3DXJ F;  3PHF 2;  4K0D A;  5HSW A;  3ZG1 A;  3ABK C;  3FVY A;  1FMW A;  5D91 A;  2IOQ A;  1LVK A;  3NYJ A;  4U5C E;  3FAJ A;  4XTK A;  1JPJ A;  2FGY A;  2G3V A;  1ST6 A;  2VB6 A;  1OKK D;  2A6H F;  1MMA A;  1IZM A;  4XLP F;  3I5Q A;  4QI2 A;  3L34 A;  3HLZ A;  1M56 C;  3AQB A;  2YEV A;  2WB7 A;  1OCZ C;  4YN0 B;  4HE8 D;  1ZHY A;  2VH3 A;  2WVN A;  1FTS A;  5EGY A;  4BJ6 A;  3EGX B;  3OWT A;  4KI2 A;  3WG7 C;  3EZH A;  2L81 A;  3NKE A;  1D0Z A;  2C03 A;  1W2W A;  4M63 A;  2KQ9 A;  5CI9 A;  4JCH A;  3K66 A;  3SEO A;  4OIR F;  1Z63 A;  1OCO C;  4LAC B;  4Q5S F;  3CZ6 A;  2NUP B;  3EFO B;  5KYY B;  2OG2 A;  4IJJ A;  2L9J A;  3LS1 A;  4ANJ A;  3RFY A;  3ABM C;  2Y39 A;  2YZS A;  5DQZ A;  5T3T A;  3MLG A;  4OIN F;  3GAN A;  4PJM A;  3ZIB A;  4EWC A;  4LLC A;  4GEH A;  4JUR I;  3UGO A;  3DJU B;  4B6I A;  2QY9 A;  1TR2 A;  2J45 A;  2WL8 A;  1D1B A;  2ZXR A;  3NYM A;  2PX3 A;  4U5G A;  3B9Q A;  1Z5Z A;  3UNG C;  4ZLC A;  3EJN A;  4I44 A;  3EH1 A;  3LLI A;  1D1A A;  3SNH A;  3M1C B;  1OCC C;  4I1M A;  1IW7 F;  5DS6 A;  2OCC C;  3W2V A;  2A69 F;  2EIJ C;  2XXA A;  4FES A;  1Z6A A;  1VYK A;  3NG1 A;  4LLE A;  4CBE A;  2IXP A;  3W8H A;  3KMI A;  4RDA A;  4XLN F;  2J0X A;  1ZHT A;  3NKD A;  3Q6M A;  3N2Z B;  4I1O B;  2H7V C;  3UMI A;  4YT4 A;  3Q6N A;  2FFH A;  4YT2 A;  5L3V A;  4OD5 A;  3S0X A;  2X51 A;  3Q7L A;  4PFO A;  4PJL A;  3MX3 A;  3DD7 A;  1SF8 A;  2ZPA A;  3FHD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...