1NFOA

Apolipoprotein e2 (apoe2, d154a mutation)
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
141
structure length
131
Chain Sequence
GQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQRLSKELQAAQARLGADMEDVCGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADALQKCLAVYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords APOLIPOPROTEIN E2
publication title Novel mechanism for defective receptor binding of apolipoprotein E2 in type III hyperlipoproteinemia.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lipid transport
total genus 61
structure length 131
sequence length 141
ec nomenclature
pdb deposition date 1996-07-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.20 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Apolipoprotein 1nfoA00
1B68A 1LE4A 2KC3A 1EA8A 3R2PA 3S84A 1YA9A 1NFOA 1OR3A 1LS4A 1EQ1A 1LPEA 1LE2A 1NFNA 1OR2A 1H7IA 1AEPA 1BZ4A 1GS9A
chains in the Genus database with same CATH superfamily
1A7VA 1Q0MA 4J7TA 5KYWB 3L34A 2EPKX 4IRUA 3O55A 4MVZA 5E33A 1Z7Qc 4UDVA 4AE4A 2HJMA 2IOQA 3MLGA 4EIYA 4K1OA 3DM5A 4JTCB 2YL0A 3NMKA 4OINF 4D4NA 5AC5A 4G7ZF 2YKZA 5F28E 1G4WR 4NTAA 3I5PA 4W8KA 4I3MA 1GQAA 3C18A 3HNKA 1OR3A 4XEVA 4Z9HA 1VOMA 3DJNB 4ULWA 1W2WA 4DRJB 3RKOF 4ZLCA 2UUIA 5JVEA 1EI7A 2R25A 1RMVA 2XLOA 2R7XA 1S05A 2NSFA 3MFNA 4BJ5A 2ETSA 3EHNA 2J9VA 4JEAA 3T4RA 3LUTB 4JZAA 4JC7A 4ONSA 3DXJF 5DQZA 5JUAA 5B3IA 1HE9A 1Q0KA 4J32B 1CGOA 4AL1A 2HZ8A 1PCXA 1KU2A 2D5RB 2HJ3A 2WVQA 3O10A 2YZSA 4I44A 4PJNA 3VM6A 2LSEA 1HE1A 1D1CA 5GPGB 5BQGA 2IXPA 5E3AA 2XLVA 5L0IA 3U9MA 4FAPB 2PBEA 3RVYA 3LLKA 4K7BA 3JTLO 2A69F 4P9TA 4PJLA 3TOMA 1TR2A 3O39A 3H65A 4AE4B 2EIKC 2YL1A 4WGZA 5L0HA 2XLMA 5DQTA 3NRHA 1G8XA 1WOLA 4U5EE 3UGOA 2W45A 3EGDA 3OWTA 3T9OA 3LNMB 2XM4A 2FAPB 4NCQA 5JP7A 1JPJA 3VAYA 1VTMP 1PD1A 3HNIA 1RKEA 2A0UA 1WASA 2EILC 3ABLC 4JCZA 1V74B 2E87A 4GEHA 4DOZA 4EWCA 2Y69C 1SZIA 3NMIA 2WZGA 2Y3HA 1LI5A 4CIPA 2IXMA 2J7PD 3C7JA 3K1IA 4FWVA 5DLJA 1ORSC 1ZHXA 4CS8C 2CYDA 1LI7A 5B1AC 2XM0A 5BQHA 1MNEA 2C03A 5CIVA 1SMYF 2AWCA 4E17A 2JD3A 2VCCA 4YL1A 1DOWA 3M4BA 3AG1C 2WL8A 4J30B 2LFDA 4R32A 5E3CA 1ZU4A 2GDCA 3C62A 3EG9A 1E2XA 2ZXRA 3DM9B 4ANJA 4IB4A 3N0TA 1LS1A 2OOCA 2XLWA 4WJ0A 5B1BC 3HLZA 1TWHA 1SYQA 3B71A 5COMA 3DWWA 3TOLA 5KYXB 1VYIA 4A4AA 2EINC 1OQCA 2ZXOA 4MTGA 3RVZA 3L8IA 5KYXA 2NUPB 2L6HA 3V7OA 1ST6A 4C3DA 3ZC4A 4AK9A 2KW3C 4MVOA 1GS9A 1M57C 2A6HF 4DXWA 3ABKC 5E2QA 1NG1A 1QQ3A 4LACB 2Y3DA 2DB4A 2IM8A 3IQ5A 2AU5A 2B0HA 1D0ZA 3LAYA 2I8BA 3QW0A 5CI9A 1M6TA 3G4ZA 5T3TA 2Y3BA 3WODF 3X1OA 1NLXA 3V5XA 1Z3IX 4BJ5C 2P61A 4Z9JA 4JE9A 5KYNA 4M63A 4MVQA 2A0BA 1LS4A 3K6BA 4NTFA 3CSKA 2QLAA 3L8JA 4GQHA 3KMIA 3BEHA 1J8MF 1SF8A 2Y3GA 1FTSA 1OXBA 1JRAA 3SYNA 1IW7F 1FNTc 3JT1A 4OD4A 4XWJA 5JLIA 5A6KA 2DI3A 1YZCA 3W8HA 2R7WA 1PV3A 1T5OA 1QZXA 1XZPA 4O6MA 4IJJA 3SXKA 3S90A 1HW2A 1MMAA 3C8GB 3FMSA 4H4KC 4BPMA 3J06A 2ICWG 2P1AA 1C02A 5HV9A 4OIQF 1U89A 3C8GA 3KKBA 4CDAA 4MW8A 2OJED 4ER9A 1OKKD 4O6YA 3FOOA 2EPOA 2L9JA 4EUKB 1YLMA 1VMAA 3EH1A 1XWJA 2ZPAA 3UR3C 4U9EA 3SXZA 3LEVA 3AJMA 4XLPF 3ZQYA 1EQ1A 3K1IC 2LQGA 4XEFA 4PK4A 1NSGB 2ZD9A 1F1MA 2G3KA 1C17M 2P7VA 1HMOA 4JKVA 3U3BA 4AL0A 3DE9A 1E84A 3SXMA 4CS9A 3K33A 4I1MA 2J9BA 3UGPA 3ABMC 3M1CB 1A7DA 2VCBA 5A6BD 3PMRA 2L7AA 4E18A 1D0XA 3ZG1A 4MTOA 1D1BA 1FAPB 2XL4A 1ZHTA 2J0WA 4FESA 4JCHA 3B0UX 3L0IA 3RH3A 3FAPB 4LLEA 3U2MA 1ZYRF 5COFA 1MMGA 1WN0A 1T01A 3CAXA 1YA9A 3POVA 1CGME 1L7CA 4Q4ZF 2WVOA 2PF4E 3JYYA 3RF3A 4U5HA 5A6JA 1A41A 3FHDA 1OCOC 4J7YA 2NPUA 3KYIA 3LS1A 4BJTA 3M15A 1WTYA 1YJGA 1D1AA 2OU6A 3MYIA 2BL2A 2YEVA 2GAQA 4CS9C 4CIHA 2YHSA 2XS1A 1NBBA 3JSZA 4PFPA 3DMDA 3JRTA 4JVSA 1RCPA 3VRCA 1TWAA 3DKAA 3GM3A 1YYXA 3FVYA 2R02A 4JIOA 4Q7CA 2B0JA 5L0FA 4E0HA 3US6A 1K04A 4C7OA 1IZMA 2KC3A 3S28A 2DGJA 4JRZA 3GEEA 3R2PA 3C8ZA 4G0HA 2PX0A 4G78A 1Y4CA 2WZLA 2NSGA 3EGDB 3FXHA 1G5ZA 2WVNA 1WATA 3EZHA 2M64A 4NY3A 1GM5A 2EIJC 4KI2A 1RKEB 3AGTA 2J9WA 3QVYA 4YN0B 2MYSA 4E0IA 2YL7A 2YLDA 4YT5A 5JSLA 4EHPA 3LJBA 3CEXA 3CZ6A 4U5BE 3IEEA 1BR1A 1KNYA 3IHUA 1BR2A 3NYLA 4XPWA 3UMKA 4PJJA 2HUJA 1MQVA 1R4TA 2OJQA 1CPRA 4BJ1A 2H7BA 4OIRF 2PP4A 3EHMA 1N1CA 2OG2A 1JMWA 2OQMA 2OKUA 4U9DA 2FGYA 2GA0A 2J9UA 1YYJA 3NMJA 4EBBA 1M56C 4PJMA 4YWQA 4C3BA 1E86A 4YJWA 3EG9B 4F4BA 2KK1A 1NZEA 2VASA 4RDAA 3QTHA 3DAFA 2LD6A 2Y39A 3Q6NA 2RD9A 3LS0A 3NKDA 5AGFA 1E85A 5A69A 3GEHA 4K0DA 2HSQA 4PFOA 3DZAA 1UG7A 2XLHA 2V26A 3W2VA 1WGWA 3F47A 4JJFA 3U9JA 3G4XA 3ZTZA 3I5QA 2XL8A 3AG3C 4KBLA 4BG0A 3N2ZB 5JS5A 2HMZA 3AG2C 4QDLA 4Z9IA 4LLCA 4XQ1A 3VF0A 2EIMC 1LIHA 1YAUO 2YLGA 3F46A 1MNDA 2CW0F 3NG1A 2R05A 1FFTC 2W9YA 3SXYA 3U8PA 1UFBA 3ZDLA 1BDJB 1OCRC 3MX3A 4NTBA 4IAOA 2A1DD 2FFHA 2P6VA 1PD0A 5B3SC 3CQZA 1ZW3A 3ECSA 1YARO 3G50A 4LDRA 2Q9BA 2ZXWC 4X0RA 4HEAJ 4DBRA 1RJ9A 1TWGA 1ZHYA 2PFDA 3EJNA 3QVZA 4ULVA 3WG7C 1Y6DA 4A2NB 4JURI 3W4YA 3ZWIA 1ORJA 1ZHWA 5FCLA 4H54A 1Z23A 1GGQA 3GODA 1O87A 4NC3A 3K66A 1TKNA 3TJ6A 3EQLF 4DRHB 1WWPA 2UUHA 3SEOA 1HMDA 3TK0A 3E9VA 3ZVRA 4CSAA 4LDKA 4MVSA 1J8YF 3EGXB 4FX5A 5A6AA 3AG4C 2QE9A 4PR9A 3MYFA 4JW1A 2IBFA 1L3PA 1V54C 4WGYA 4JTDB 3UNGC 4G7HF 4OD5A 3EGXA 3GORA 4HFFB 4QI2A 5KYUB 2O9XA 1OW7A 5EK0A 2QNLA 3Q6MA 3IQCA 1M2VA 5BQIA 1APCA 5DS6A 4WABA 5KYUA 4NQFA 3UMHA 2MWQA 4AX2A 3OEOA 4IWBA 4YL0A 3Q7GA 1FMWA 1T6QA 1E83A 1VLSA 3O6XA 2EPMX 3ZTMA 2J46A 2HKVA 2GFHA 4E7ZA 2DYSC 1V55C 2XLDA 3LESA 3AQCA 1I4YA 2A6EF 2PX3A 3DAGA 2AWYA 2Q3TA 3ITFA 3NYMA 4L6RA 4MS2A 2NUTA 4GYTA 3C63A 3DE8A 1H7IA 2CNWD 2HFIA 2HV7A 3HNLA 2JX0A 1JAFA 4N06A 2PNOA 2XXAB 4EKWA 1RXQA 4IGGA 1ORYA 5DVWA 1O5HA 2YWAA 1JR8A 3ZIBA 1AVOB 1YA7O 2XXAA 1CPQA 1LM3B 1OXKA 3WAQA 2R7VA 5EGYA 1MMNA 5L0GA 5L3QA 2HSBA 3T6BA 4U5FE 1YZAA 1I4ZA 2R7OA 4O79A 2XLEA 3U3FA 5L3VA 3SP1A 3S27A 2J45A 3JZ0A 2IXOA 1VLTA 1C03A 4U5CE 1BR4A 1VB5A 5L0DA 3M4CA 2GWWA 5DS4A 5IY5C 1Z6AA 5K0IA 1Z63A 1TWCA 2JPUA 1DOVA 2OEXA 4P9FA 2H8AA 1YDIA 1D0YA 3QW1A 3B0PA 3I4UA 3RFYA 1NU7D 2L6GA 2KYHA 5F5HA 3ZSUA 2Q9AA 2D4UA 3LLIA 1U6HA 2VC9A 5HSWA 3Q7LA 1B68A 4C7OB 1LE4A 4E7SA 3GWNA 3RW0A 3QZCA 2XS8A 2VCAA 2LFFA 3UMIA 2TMVP 2AVKA 4CSAC 1HY5A 2V3CC 3B0VC 3M79A 1NFOA 1QPUA 3V5YA 2J0XA 3S29A 2R7QA 2R7TA 1M2OA 4N4WA 4D4XA 1VYKA 2WB7A 4CJGA 4DVYP 2YVKA 2H7VC 1JOGA 2XRHA 4LDQA 1OR2A 2AP3A 4MNDA 4XTKA 2X51A 4YL3A 3HTKC 3TQOA 3VYWA 3JYHA 4O6NA 4DJ9A 3R7CA 4BEMJ 1T9KA 2Z15A 4YT2A 3GWLA 1OW8A 1LKXA 3MBGA 4BJ6A 1T6UA 3GEIA 3E70C 3KH2A 2J7PA 1A7EA 2F22A 4RD9A 2R7RA 4U5GA 4Q5SF 1ZZPA 3JSEO 1I5NA 2KQ9A 3KPHA 2H7OA 4EBKA 2MHRA 3A11A 1Q0FA 2L81A 2W4MA 2YLIA 4JEBA 1CGNA 2KSFA 2OCCC 1OW6A 3T6GB 1Q0GA 1TQGA 4JJGA 3W8IA 1G4US 1T6IA 3TD7A 1U0BB 1S7ZA 5T1DB 2Q7RA 3SNHA 2X0CA 5JRAA 2YL3A 2W4BA 1K40A 1OCCC 3OA1A 3EH2A 1HW1A 5COGA 1AUEA 1Q0DA 5T3WA 3K1HA 2NG1A 3B29A 3NKEA 4W8PA 3L1MA 4CBEA 1AEPA 3HKKA 1Z5ZA 3KL4A 4P6IC 3HNJA 3TJ5A 3TULA 2ZXPA 256BA 2ASRA 3JRMO 4OIOF 4XLNF 1FFHA 2M4EA 3ATPA 5CI8A 3HJCA 3ZQVA 3PHF2 2Q9CA 1ZHZA 5BUOA 3ASOC 2LK4A 3EZIA 1H9GA 1QSPA 1RJ9B 3DD7A 3DI5A 4QI0A 4O7GA 4CDVA 2R7UA 3W2WA 1FR0A 4MW3A 1QVXA 2YRFA 3U5SA 3SZRA 3ASNC 4CDYA 3DJUB 2Q4FA 3PCVA 1H9TA 1K05A 1LE2A 2BC5A 2LCHA 3RQGA 1LVKA 2XSEA 3AGUA 4XPXA 1VK5A 1ZW2A 2KGOA 4JTAB 4CJOA 2IXNA 3H2VA 2NUPA 4IAQA 4ZLDA 3FOPA 3NDBB 1O3UA 5DS5A 2HV6A 4KNWA 4U5DE 1OCZC 1M2VB 2DYRC 3H2UA 3RQFA 5F5FA 3NYJA 3K7DA 5JT4A 2LIGA 2CDQA 3RYLA 2P0NA 1KTMA 2R03A 1EA8A 4KNVA 3WHNA 1A0BA 2LP4A 3RQEA 1FMVA 2KNHA 2VB6A 2I15A 1XZQA 4DBQA 2QTVA 3KYJA 4G7OF 3V5ZA 4DRIB 4YT4A 4C3EA 2CGEA 5KYWA 1MMDA 1TFKB 2J8WA 2L6FA 3FAJA 4RBNA 1OKKA 2HS5A 4CX9A 5KYYB 2RSEB 4BJ6C 4YT8A 3QMKA 2IYLD 1SR2A 2NUTB 2XL6A 2G62A 4YK5A 1QLEC 1JPNA 5KYYA 3IQ6A 3GANA 3N24A 5D91A 3JCUQ 4N6HA 4CS7A 4EBJA 4IARA 2BE5F 2KJGA 2VH3A 4DVZA 1QKRA 1EKYA 2G3VA 2HMQA 3C8GD 3U0CA 4HE8D 2CNWA 5TJ5E 3GM2A 3IPMO 3LEOA 3PDMP 1H6GA 1ZVZA 3B9QA 3EPVA 5AC4A 1RKCA 2EPNA 2Q00A 3GM1A 4N6CA 2OEVA 3U8VA 5A6BA 5L0CA 4MVMA 3FDQA 4OIPF 3S9OA 2C04A 1TFOB 1ZU5A 2EPLX 4MVRA 4I1OB 3BRJA 5EHHA 2QY9A 5L0JA 3S84A 2CCYA 4CS8A 1V4AA 3S0XA 2R7SA 2QUPA 1YVIA 1BBHA 1LPEA 3IQTA 5FZTA 3RIPA 1NFNA 1R5ID 2YQYA 2WZFA 3A9CA 4KC9A 3EFOB 4MTFA 2R9RB 3AOUA 3T6JA 3U2LA 4B6IA 3X2QC 2A68F 4MVUA 5D92A 4BEJA 4HFKB 1NU9C 4XPYA 3AQBA 3EFOA 4MQ9F 4XEKA 1BZ4A 4LERA 3LNRA 4PACA
chains in the Genus database with same CATH topology
1B68A 1LE4A 2KC3A 1EA8A 3R2PA 3S84A 1YA9A 1NFOA 1OR3A 1LS4A 1EQ1A 1LPEA 1LE2A 1NFNA 1OR2A 1H7IA 1AEPA 1BZ4A 1GS9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B68 A;  1LE4 A;  2KC3 A;  1EA8 A;  3R2P A;  3S84 A;  1YA9 A;  1NFO A;  1OR3 A;  1LS4 A;  1EQ1 A;  1LPE A;  1LE2 A;  1NFN A;  1OR2 A;  1H7I A;  1AEP A;  1BZ4 A;  1GS9 A; 
#chains in the Genus database with same CATH topology
 1A7V A;  1Q0M A;  4J7T A;  5KYW B;  3L34 A;  2EPK X;  4IRU A;  3O55 A;  4MVZ A;  5E33 A;  1Z7Q c;  4UDV A;  4AE4 A;  2HJM A;  2IOQ A;  3MLG A;  4EIY A;  4K1O A;  3DM5 A;  4JTC B;  2YL0 A;  3NMK A;  4OIN F;  4D4N A;  5AC5 A;  4G7Z F;  2YKZ A;  5F28 E;  1G4W R;  4NTA A;  3I5P A;  4W8K A;  4I3M A;  1GQA A;  3C18 A;  3HNK A;  1OR3 A;  4XEV A;  4Z9H A;  1VOM A;  3DJN B;  4ULW A;  1W2W A;  4DRJ B;  3RKO F;  4ZLC A;  2UUI A;  5JVE A;  1EI7 A;  2R25 A;  1RMV A;  2XLO A;  2R7X A;  1S05 A;  2NSF A;  3MFN A;  4BJ5 A;  2ETS A;  3EHN A;  2J9V A;  4JEA A;  3T4R A;  3LUT B;  4JZA A;  4JC7 A;  4ONS A;  3DXJ F;  5DQZ A;  5JUA A;  5B3I A;  1HE9 A;  1Q0K A;  4J32 B;  1CGO A;  4AL1 A;  2HZ8 A;  1PCX A;  1KU2 A;  2D5R B;  2HJ3 A;  2WVQ A;  3O10 A;  2YZS A;  4I44 A;  4PJN A;  3VM6 A;  2LSE A;  1HE1 A;  1D1C A;  5GPG B;  5BQG A;  2IXP A;  5E3A A;  2XLV A;  5L0I A;  3U9M A;  4FAP B;  2PBE A;  3RVY A;  3LLK A;  4K7B A;  3JTL O;  2A69 F;  4P9T A;  4PJL A;  3TOM A;  1TR2 A;  3O39 A;  3H65 A;  4AE4 B;  2EIK C;  2YL1 A;  4WGZ A;  5L0H A;  2XLM A;  5DQT A;  3NRH A;  1G8X A;  1WOL A;  4U5E E;  3UGO A;  2W45 A;  3EGD A;  3OWT A;  3T9O A;  3LNM B;  2XM4 A;  2FAP B;  4NCQ A;  5JP7 A;  1JPJ A;  3VAY A;  1VTM P;  1PD1 A;  3HNI A;  1RKE A;  2A0U A;  1WAS A;  2EIL C;  3ABL C;  4JCZ A;  1V74 B;  2E87 A;  4GEH A;  4DOZ A;  4EWC A;  2Y69 C;  1SZI A;  3NMI A;  2WZG A;  2Y3H A;  1LI5 A;  4CIP A;  2IXM A;  2J7P D;  3C7J A;  3K1I A;  4FWV A;  5DLJ A;  1ORS C;  1ZHX A;  4CS8 C;  2CYD A;  1LI7 A;  5B1A C;  2XM0 A;  5BQH A;  1MNE A;  2C03 A;  5CIV A;  1SMY F;  2AWC A;  4E17 A;  2JD3 A;  2VCC A;  4YL1 A;  1DOW A;  3M4B A;  3AG1 C;  2WL8 A;  4J30 B;  2LFD A;  4R32 A;  5E3C A;  1ZU4 A;  2GDC A;  3C62 A;  3EG9 A;  1E2X A;  2ZXR A;  3DM9 B;  4ANJ A;  4IB4 A;  3N0T A;  1LS1 A;  2OOC A;  2XLW A;  4WJ0 A;  5B1B C;  3HLZ A;  1TWH A;  1SYQ A;  3B71 A;  5COM A;  3DWW A;  3TOL A;  5KYX B;  1VYI A;  4A4A A;  2EIN C;  1OQC A;  2ZXO A;  4MTG A;  3RVZ A;  3L8I A;  5KYX A;  2NUP B;  2L6H A;  3V7O A;  1ST6 A;  4C3D A;  3ZC4 A;  4AK9 A;  2KW3 C;  4MVO A;  1GS9 A;  1M57 C;  2A6H F;  4DXW A;  3ABK C;  5E2Q A;  1NG1 A;  1QQ3 A;  4LAC B;  2Y3D A;  2DB4 A;  2IM8 A;  3IQ5 A;  2AU5 A;  2B0H A;  1D0Z A;  3LAY A;  2I8B A;  3QW0 A;  5CI9 A;  1M6T A;  3G4Z A;  5T3T A;  2Y3B A;  3WOD F;  3X1O A;  1NLX A;  3V5X A;  1Z3I X;  4BJ5 C;  2P61 A;  4Z9J A;  4JE9 A;  5KYN A;  4M63 A;  4MVQ A;  2A0B A;  1LS4 A;  3K6B A;  4NTF A;  3CSK A;  2QLA A;  3L8J A;  4GQH A;  3KMI A;  3BEH A;  1J8M F;  1SF8 A;  2Y3G A;  1FTS A;  1OXB A;  1JRA A;  3SYN A;  1IW7 F;  1FNT c;  3JT1 A;  4OD4 A;  4XWJ A;  5JLI A;  5A6K A;  2DI3 A;  1YZC A;  3W8H A;  2R7W A;  1PV3 A;  1T5O A;  1QZX A;  1XZP A;  4O6M A;  4IJJ A;  3SXK A;  3S90 A;  1HW2 A;  1MMA A;  3C8G B;  3FMS A;  4H4K C;  4BPM A;  3J06 A;  2ICW G;  2P1A A;  1C02 A;  5HV9 A;  4OIQ F;  1U89 A;  3C8G A;  3KKB A;  4CDA A;  4MW8 A;  2OJE D;  4ER9 A;  1OKK D;  4O6Y A;  3FOO A;  2EPO A;  2L9J A;  4EUK B;  1YLM A;  1VMA A;  3EH1 A;  1XWJ A;  2ZPA A;  3UR3 C;  4U9E A;  3SXZ A;  3LEV A;  3AJM A;  4XLP F;  3ZQY A;  1EQ1 A;  3K1I C;  2LQG A;  4XEF A;  4PK4 A;  1NSG B;  2ZD9 A;  1F1M A;  2G3K A;  1C17 M;  2P7V A;  1HMO A;  4JKV A;  3U3B A;  4AL0 A;  3DE9 A;  1E84 A;  3SXM A;  4CS9 A;  3K33 A;  4I1M A;  2J9B A;  3UGP A;  3ABM C;  3M1C B;  1A7D A;  2VCB A;  5A6B D;  3PMR A;  2L7A A;  4E18 A;  1D0X A;  3ZG1 A;  4MTO A;  1D1B A;  1FAP B;  2XL4 A;  1ZHT A;  2J0W A;  4FES A;  4JCH A;  3B0U X;  3L0I A;  3RH3 A;  3FAP B;  4LLE A;  3U2M A;  1ZYR F;  5COF A;  1MMG A;  1WN0 A;  1T01 A;  3CAX A;  1YA9 A;  3POV A;  1CGM E;  1L7C A;  4Q4Z F;  2WVO A;  2PF4 E;  3JYY A;  3RF3 A;  4U5H A;  5A6J A;  1A41 A;  3FHD A;  1OCO C;  4J7Y A;  2NPU A;  3KYI A;  3LS1 A;  4BJT A;  3M15 A;  1WTY A;  1YJG A;  1D1A A;  2OU6 A;  3MYI A;  2BL2 A;  2YEV A;  2GAQ A;  4CS9 C;  4CIH A;  2YHS A;  2XS1 A;  1NBB A;  3JSZ A;  4PFP A;  3DMD A;  3JRT A;  4JVS A;  1RCP A;  3VRC A;  1TWA A;  3DKA A;  3GM3 A;  1YYX A;  3FVY A;  2R02 A;  4JIO A;  4Q7C A;  2B0J A;  5L0F A;  4E0H A;  3US6 A;  1K04 A;  4C7O A;  1IZM A;  2KC3 A;  3S28 A;  2DGJ A;  4JRZ A;  3GEE A;  3R2P A;  3C8Z A;  4G0H A;  2PX0 A;  4G78 A;  1Y4C A;  2WZL A;  2NSG A;  3EGD B;  3FXH A;  1G5Z A;  2WVN A;  1WAT A;  3EZH A;  2M64 A;  4NY3 A;  1GM5 A;  2EIJ C;  4KI2 A;  1RKE B;  3AGT A;  2J9W A;  3QVY A;  4YN0 B;  2MYS A;  4E0I A;  2YL7 A;  2YLD A;  4YT5 A;  5JSL A;  4EHP A;  3LJB A;  3CEX A;  3CZ6 A;  4U5B E;  3IEE A;  1BR1 A;  1KNY A;  3IHU A;  1BR2 A;  3NYL A;  4XPW A;  3UMK A;  4PJJ A;  2HUJ A;  1MQV A;  1R4T A;  2OJQ A;  1CPR A;  4BJ1 A;  2H7B A;  4OIR F;  2PP4 A;  3EHM A;  1N1C A;  2OG2 A;  1JMW A;  2OQM A;  2OKU A;  4U9D A;  2FGY A;  2GA0 A;  2J9U A;  1YYJ A;  3NMJ A;  4EBB A;  1M56 C;  4PJM A;  4YWQ A;  4C3B A;  1E86 A;  4YJW A;  3EG9 B;  4F4B A;  2KK1 A;  1NZE A;  2VAS A;  4RDA A;  3QTH A;  3DAF A;  2LD6 A;  2Y39 A;  3Q6N A;  2RD9 A;  3LS0 A;  3NKD A;  5AGF A;  1E85 A;  5A69 A;  3GEH A;  4K0D A;  2HSQ A;  4PFO A;  3DZA A;  1UG7 A;  2XLH A;  2V26 A;  3W2V A;  1WGW A;  3F47 A;  4JJF A;  3U9J A;  3G4X A;  3ZTZ A;  3I5Q A;  2XL8 A;  3AG3 C;  4KBL A;  4BG0 A;  3N2Z B;  5JS5 A;  2HMZ A;  3AG2 C;  4QDL A;  4Z9I A;  4LLC A;  4XQ1 A;  3VF0 A;  2EIM C;  1LIH A;  1YAU O;  2YLG A;  3F46 A;  1MND A;  2CW0 F;  3NG1 A;  2R05 A;  1FFT C;  2W9Y A;  3SXY A;  3U8P A;  1UFB A;  3ZDL A;  1BDJ B;  1OCR C;  3MX3 A;  4NTB A;  4IAO A;  2A1D D;  2FFH A;  2P6V A;  1PD0 A;  5B3S C;  3CQZ A;  1ZW3 A;  3ECS A;  1YAR O;  3G50 A;  4LDR A;  2Q9B A;  2ZXW C;  4X0R A;  4HEA J;  4DBR A;  1RJ9 A;  1TWG A;  1ZHY A;  2PFD A;  3EJN A;  3QVZ A;  4ULV A;  3WG7 C;  1Y6D A;  4A2N B;  4JUR I;  3W4Y A;  3ZWI A;  1ORJ A;  1ZHW A;  5FCL A;  4H54 A;  1Z23 A;  1GGQ A;  3GOD A;  1O87 A;  4NC3 A;  3K66 A;  1TKN A;  3TJ6 A;  3EQL F;  4DRH B;  1WWP A;  2UUH A;  3SEO A;  1HMD A;  3TK0 A;  3E9V A;  3ZVR A;  4CSA A;  4LDK A;  4MVS A;  1J8Y F;  3EGX B;  4FX5 A;  5A6A A;  3AG4 C;  2QE9 A;  4PR9 A;  3MYF A;  4JW1 A;  2IBF A;  1L3P A;  1V54 C;  4WGY A;  4JTD B;  3UNG C;  4G7H F;  4OD5 A;  3EGX A;  3GOR A;  4HFF B;  4QI2 A;  5KYU B;  2O9X A;  1OW7 A;  5EK0 A;  2QNL A;  3Q6M A;  3IQC A;  1M2V A;  5BQI A;  1APC A;  5DS6 A;  4WAB A;  5KYU A;  4NQF A;  3UMH A;  2MWQ A;  4AX2 A;  3OEO A;  4IWB A;  4YL0 A;  3Q7G A;  1FMW A;  1T6Q A;  1E83 A;  1VLS A;  3O6X A;  2EPM X;  3ZTM A;  2J46 A;  2HKV A;  2GFH A;  4E7Z A;  2DYS C;  1V55 C;  2XLD A;  3LES A;  3AQC A;  1I4Y A;  2A6E F;  2PX3 A;  3DAG A;  2AWY A;  2Q3T A;  3ITF A;  3NYM A;  4L6R A;  4MS2 A;  2NUT A;  4GYT A;  3C63 A;  3DE8 A;  1H7I A;  2CNW D;  2HFI A;  2HV7 A;  3HNL A;  2JX0 A;  1JAF A;  4N06 A;  2PNO A;  2XXA B;  4EKW A;  1RXQ A;  4IGG A;  1ORY A;  5DVW A;  1O5H A;  2YWA A;  1JR8 A;  3ZIB A;  1AVO B;  1YA7 O;  2XXA A;  1CPQ A;  1LM3 B;  1OXK A;  3WAQ A;  2R7V A;  5EGY A;  1MMN A;  5L0G A;  5L3Q A;  2HSB A;  3T6B A;  4U5F E;  1YZA A;  1I4Z A;  2R7O A;  4O79 A;  2XLE A;  3U3F A;  5L3V A;  3SP1 A;  3S27 A;  2J45 A;  3JZ0 A;  2IXO A;  1VLT A;  1C03 A;  4U5C E;  1BR4 A;  1VB5 A;  5L0D A;  3M4C A;  2GWW A;  5DS4 A;  5IY5 C;  1Z6A A;  5K0I A;  1Z63 A;  1TWC A;  2JPU A;  1DOV A;  2OEX A;  4P9F A;  2H8A A;  1YDI A;  1D0Y A;  3QW1 A;  3B0P A;  3I4U A;  3RFY A;  1NU7 D;  2L6G A;  2KYH A;  5F5H A;  3ZSU A;  2Q9A A;  2D4U A;  3LLI A;  1U6H A;  2VC9 A;  5HSW A;  3Q7L A;  1B68 A;  4C7O B;  1LE4 A;  4E7S A;  3GWN A;  3RW0 A;  3QZC A;  2XS8 A;  2VCA A;  2LFF A;  3UMI A;  2TMV P;  2AVK A;  4CSA C;  1HY5 A;  2V3C C;  3B0V C;  3M79 A;  1NFO A;  1QPU A;  3V5Y A;  2J0X A;  3S29 A;  2R7Q A;  2R7T A;  1M2O A;  4N4W A;  4D4X A;  1VYK A;  2WB7 A;  4CJG A;  4DVY P;  2YVK A;  2H7V C;  1JOG A;  2XRH A;  4LDQ A;  1OR2 A;  2AP3 A;  4MND A;  4XTK A;  2X51 A;  4YL3 A;  3HTK C;  3TQO A;  3VYW A;  3JYH A;  4O6N A;  4DJ9 A;  3R7C A;  4BEM J;  1T9K A;  2Z15 A;  4YT2 A;  3GWL A;  1OW8 A;  1LKX A;  3MBG A;  4BJ6 A;  1T6U A;  3GEI A;  3E70 C;  3KH2 A;  2J7P A;  1A7E A;  2F22 A;  4RD9 A;  2R7R A;  4U5G A;  4Q5S F;  1ZZP A;  3JSE O;  1I5N A;  2KQ9 A;  3KPH A;  2H7O A;  4EBK A;  2MHR A;  3A11 A;  1Q0F A;  2L81 A;  2W4M A;  2YLI A;  4JEB A;  1CGN A;  2KSF A;  2OCC C;  1OW6 A;  3T6G B;  1Q0G A;  1TQG A;  4JJG A;  3W8I A;  1G4U S;  1T6I A;  3TD7 A;  1U0B B;  1S7Z A;  5T1D B;  2Q7R A;  3SNH A;  2X0C A;  5JRA A;  2YL3 A;  2W4B A;  1K40 A;  1OCC C;  3OA1 A;  3EH2 A;  1HW1 A;  5COG A;  1AUE A;  1Q0D A;  5T3W A;  3K1H A;  2NG1 A;  3B29 A;  3NKE A;  4W8P A;  3L1M A;  4CBE A;  1AEP A;  3HKK A;  1Z5Z A;  3KL4 A;  4P6I C;  3HNJ A;  3TJ5 A;  3TUL A;  2ZXP A;  256B A;  2ASR A;  3JRM O;  4OIO F;  4XLN F;  1FFH A;  2M4E A;  3ATP A;  5CI8 A;  3HJC A;  3ZQV A;  3PHF 2;  2Q9C A;  1ZHZ A;  5BUO A;  3ASO C;  2LK4 A;  3EZI A;  1H9G A;  1QSP A;  1RJ9 B;  3DD7 A;  3DI5 A;  4QI0 A;  4O7G A;  4CDV A;  2R7U A;  3W2W A;  1FR0 A;  4MW3 A;  1QVX A;  2YRF A;  3U5S A;  3SZR A;  3ASN C;  4CDY A;  3DJU B;  2Q4F A;  3PCV A;  1H9T A;  1K05 A;  1LE2 A;  2BC5 A;  2LCH A;  3RQG A;  1LVK A;  2XSE A;  3AGU A;  4XPX A;  1VK5 A;  1ZW2 A;  2KGO A;  4JTA B;  4CJO A;  2IXN A;  3H2V A;  2NUP A;  4IAQ A;  4ZLD A;  3FOP A;  3NDB B;  1O3U A;  5DS5 A;  2HV6 A;  4KNW A;  4U5D E;  1OCZ C;  1M2V B;  2DYR C;  3H2U A;  3RQF A;  5F5F A;  3NYJ A;  3K7D A;  5JT4 A;  2LIG A;  2CDQ A;  3RYL A;  2P0N A;  1KTM A;  2R03 A;  1EA8 A;  4KNV A;  3WHN A;  1A0B A;  2LP4 A;  3RQE A;  1FMV A;  2KNH A;  2VB6 A;  2I15 A;  1XZQ A;  4DBQ A;  2QTV A;  3KYJ A;  4G7O F;  3V5Z A;  4DRI B;  4YT4 A;  4C3E A;  2CGE A;  5KYW A;  1MMD A;  1TFK B;  2J8W A;  2L6F A;  3FAJ A;  4RBN A;  1OKK A;  2HS5 A;  4CX9 A;  5KYY B;  2RSE B;  4BJ6 C;  4YT8 A;  3QMK A;  2IYL D;  1SR2 A;  2NUT B;  2XL6 A;  2G62 A;  4YK5 A;  1QLE C;  1JPN A;  5KYY A;  3IQ6 A;  3GAN A;  3N24 A;  5D91 A;  3JCU Q;  4N6H A;  4CS7 A;  4EBJ A;  4IAR A;  2BE5 F;  2KJG A;  2VH3 A;  4DVZ A;  1QKR A;  1EKY A;  2G3V A;  2HMQ A;  3C8G D;  3U0C A;  4HE8 D;  2CNW A;  5TJ5 E;  3GM2 A;  3IPM O;  3LEO A;  3PDM P;  1H6G A;  1ZVZ A;  3B9Q A;  3EPV A;  5AC4 A;  1RKC A;  2EPN A;  2Q00 A;  3GM1 A;  4N6C A;  2OEV A;  3U8V A;  5A6B A;  5L0C A;  4MVM A;  3FDQ A;  4OIP F;  3S9O A;  2C04 A;  1TFO B;  1ZU5 A;  2EPL X;  4MVR A;  4I1O B;  3BRJ A;  5EHH A;  2QY9 A;  5L0J A;  3S84 A;  2CCY A;  4CS8 A;  1V4A A;  3S0X A;  2R7S A;  2QUP A;  1YVI A;  1BBH A;  1LPE A;  3IQT A;  5FZT A;  3RIP A;  1NFN A;  1R5I D;  2YQY A;  2WZF A;  3A9C A;  4KC9 A;  3EFO B;  4MTF A;  2R9R B;  3AOU A;  3T6J A;  3U2L A;  4B6I A;  3X2Q C;  2A68 F;  4MVU A;  5D92 A;  4BEJ A;  4HFK B;  1NU9 C;  4XPY A;  3AQB A;  3EFO A;  4MQ9 F;  4XEK A;  1BZ4 A;  4LER A;  3LNR A;  4PAC A; 
#chains in the Genus database with same CATH homology
 1B68 A;  1LE4 A;  2KC3 A;  1EA8 A;  3R2P A;  3S84 A;  1YA9 A;  1NFO A;  1OR3 A;  1LS4 A;  1EQ1 A;  1LPE A;  1LE2 A;  1NFN A;  1OR2 A;  1H7I A;  1AEP A;  1BZ4 A;  1GS9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...