1NFOA

Apolipoprotein e2 (apoe2, d154a mutation)
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
141
structure length
131
Chain Sequence
GQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQRLSKELQAAQARLGADMEDVCGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADALQKCLAVYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lipid transport
molecule keywords APOLIPOPROTEIN E2
publication title Novel mechanism for defective receptor binding of apolipoprotein E2 in type III hyperlipoproteinemia.
pubmed doi rcsb
source organism Homo sapiens
total genus 61
structure length 131
sequence length 141
ec nomenclature
pdb deposition date 1996-07-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.20 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Apolipoprotein 1nfoA00
1H7IA 1OR2A 2KC3A 1LPEA 1NFNA 1AEPA 1BZ4A 1GS9A 1EQ1A 1LS4A 1LE2A 1OR3A 1YA9A 1B68A 3R2PA 1EA8A 1LE4A 1NFOA 3S84A
chains in the Genus database with same CATH superfamily
4JZAA 1GGQA 2XRHA 3H2VA 1SYQA 3HNIA 2A6EF 3TJ5A 2XLMA 3U8PA 3T6BA 4BPMA 1ORYA 4JJFA 2XXAA 4MVZA 5BQIA 2R7WA 1PD0A 3AG3C 2Y69C 2YLIA 4MQ9F 4AK9A 4YT4A 2VCCA 5L3VA 2HUJA 3K1IA 3L0IA 4MVRA 3EPVA 1E84A 4CSAA 1YA9A 4O6MA 2HV6A 3QTHA 1EA8A 1Q0MA 3RFYA 1G4US 1HW1A 2L81A 1I5NA 4MVSA 2Y3BA 4YT2A 2DI3A 2QLAA 1A41A 1H9GA 3A11A 2WVNA 3DJNB 2XS1A 1ZYRF 2D4UA 2OJQA 3FVYA 3VM6A 2BL2A 3DE8A 3UR3C 2QNLA 4J7TA 5A6BA 3GM1A 5AGFA 5A69A 2WVOA 3GANA 2D5RB 4N06A 1Y4CA 3L34A 3WAQA 5L3QA 4BJ6A 1RMVA 4QI0A 2P7VA 2QTVA 5K0IA 3GEEA 2AU5A 1YDIA 2KJGA 1OW8A 3EGDB 4PK4A 5KYYB 1OXBA 1V55C 3W8IA 4E0HA 2W45A 2J45A 1OKKA 3QMKA 1HW2A 2Q7RA 2EPNA 4PACA 3VYWA 1Y6DA 4ULWA 3V5YA 2A0BA 3N0TA 2LFFA 2MWQA 1WOLA 1QPUA 3C8ZA 3GORA 2OG2A 4ZLDA 3G4XA 1XZQA 4MW8A 3KKBA 2AP3A 3PMRA 2KYHA 5L0IA 2XL4A 1VMAA 5DQTA 2C03A 4QDLA 3T6JA 4U5GA 3RW0A 1A7VA 1IW7F 1MQVA 1Z3IX 2HSBA 2NUTA 3WODF 1RCPA 3I5QA 4C7OA 1BR2A 1AEPA 2PFDA 2VC9A 4DBQA 1MMGA 3LLIA 1T6UA 1AUEA 4IAOA 4KNWA 2J0WA 4U9EA 3AG2C 3O55A 4ULVA 2KNHA 3SXYA 3VF0A 1EQ1A 3K7DA 3KMIA 4Z9JA 1Q0KA 3HTKC 3NYMA 4PFPA 5DVWA 1MMAA 1OW6A 1V4AA 2Z15A 1B68A 1FTSA 2E87A 3IHUA 3NDBB 2R7UA 4L6RA 5CI8A 1L7CA 4OIOF 4ER9A 3GEIA 5JSLA 2R7SA 1G8XA 2OCCC 3Q6NA 2W4MA 1HE1A 1LKXA 2VASA 4CDYA 3MYFA 1D0ZA 1T6QA 1YYXA 3AQBA 3ASNC 4WGZA 2J9BA 3S0XA 3S90A 2KW3C 3TD7A 2OKUA 1A0BA 2X0CA 1U0BB 5A6BD 3ZTZA 3DJUB 3CEXA 3HNLA 3DKAA 4K0DA 4CS7A 1ZHZA 2KC3A 2UUIA 4G7ZF 2H7OA 2YLDA 1JPJA 2LCHA 2MYSA 5DS5A 4R32A 1T01A 5GPGB 1QZXA 1S7ZA 4BJ5C 5HSWA 1D0YA 4IARA 3NMIA 1SF8A 3SYNA 2YEVA 2YL3A 2IXMA 2HMQA 3PCVA 1OKKD 1RKEA 1YVIA 3U3BA 4YL3A 1ZW3A 2R02A 2XS8A 3EG9B 4CDVA 2XSEA 2EINC 4MVQA 2W4BA 4JCHA 3RYLA 4CIHA 1FR0A 1ZHXA 1FNTc 1T5OA 4WJ0A 3S29A 1TR2A 3MLGA 3TQOA 2B0HA 3FMSA 4D4XA 256BA 5KYNA 3O6XA 1WTYA 2BE5F 4JE9A 4I1MA 1M2VB 3AGTA 4EUKB 2GWWA 4C7OB 5L0FA 3EHMA 4LDQA 3LNRA 3NG1A 1G5ZA 3RIPA 1FFTC 3NMJA 3F46A 2P61A 3CQZA 4D4NA 1AVOB 1CPQA 1QVXA 2XLWA 3RQGA 2AVKA 2H7VC 4EWCA 3EGDA 2HMZA 4XPWA 3M79A 1HMOA 1LE2A 3K66A 5IY5C 2A6HF 3IQ5A 3CZ6A 4Q4ZF 2R05A 2EIKC 4CS8A 3JZ0A 1XWJA 3UGOA 1A7EA 1D1BA 5COFA 3EJNA 4P6IC 2YZSA 3FAJA 3JRMO 4NY3A 2XLVA 3TJ6A 4Z9HA 2XLHA 1TQGA 5L0DA 2WZGA 1E83A 3AQCA 2Q9CA 4WABA 4Z9IA 5JLIA 5KYWB 2QUPA 3DM9B 1E86A 4G7OF 1EKYA 3GEHA 2J0XA 3S27A 3T4RA 4PFOA 4MVOA 3JYHA 3DMDA 1I4ZA 1FAPB 1RKEB 1WWPA 3F47A 3OEOA 3Q7GA 1OR3A 2F22A 3BEHA 3MFNA 4IAQA 4LDKA 2PF4E 2J8WA 1TWCA 3H65A 4DRJB 3LNMB 4O7GA 3S28A 1WASA 4P9FA 1NBBA 2EPOA 4MTOA 5JS5A 2IYLD 4HFKB 1NU9C 3C7JA 1FMWA 2JPUA 3ZDLA 4LDRA 2NSGA 4JURI 3HLZA 4CS8C 3U2LA 1J8MF 1ZZPA 1HE9A 1Q0DA 3X2QC 5L0JA 1JR8A 1YZCA 1VLSA 3DXJF 3ZTMA 1DOWA 3RQFA 3OA1A 4RDAA 2R7TA 1YJGA 2M64A 1T6IA 3X1OA 1GM5A 2L6FA 1YAUO 2KGOA 2LFDA 1IZMA 2Q4FA 2A69F 3EZIA 2M4EA 4YJWA 3RVYA 4H54A 3U9JA 5F28E 2L7AA 2BC5A 3JYYA 2R7XA 3KPHA 1C03A 2HJ3A 3GM3A 3JSEO 3EH2A 2I15A 3AGUA 4EBJA 3T6GB 2Y3DA 3SXKA 1OCOC 2Q3TA 2NG1A 5E33A 1JRAA 1RJ9B 3ITFA 4JTAB 4EHPA 3T9OA 1W2WA 3EG9A 3W8HA 3DE9A 3S84A 1LM3B 3K1IC 4CIPA 4C3BA 1T9KA 1E85A 4CSAC 4OIPF 1WATA 5AC4A 2CCYA 2J7PA 1K05A 1JPNA 2Y3GA 1LI5A 2PX0A 5JP7A 3ZWIA 4J7YA 2DGJA 4X0RA 1GQAA 2LQGA 4MW3A 4PJMA 3IQTA 2JD3A 3GWLA 1M2VA 3MX3A 2J9WA 5BQGA 5B1BC 4EBBA 3PDMP 3LESA 1EI7A 2OEVA 4BJ6C 3K1HA 5AC5A 4QI2A 5KYUA 1D1CA 2LP4A 1FFHA 4DOZA 1VB5A 2UUHA 3B9QA 1PCXA 1CGNA 1APCA 4N6CA 3UMIA 2RD9A 3UMHA 2J9UA 4E18A 3JTLO 2LK4A 4FESA 4Q5SF 3IQCA 5D92A 4DVYP 3KYJA 4RBNA 2Q9BA 3SP1A 3POVA 3AG4C 1Z7Qc 1TWGA 2EPKX 4YK5A 3C62A 1MNEA 4P9TA 1KNYA 1KU2A 2XM0A 3W2WA 3IPMO 5JRAA 3PHF2 1LS1A 4F4BA 2OJED 4GEHA 2IXNA 4LLEA 5KYWA 2CW0F 1R4TA 2A68F 3E9VA 5F5FA 4NTBA 1RKCA 3ATPA 4JC7A 2G3VA 3B71A 2HFIA 4RD9A 4U9DA 4E0IA 3FDQA 3ABMC 3DI5A 2Q9AA 3LS1A 4E7ZA 5T3TA 4IWBA 3ASOC 3I4UA 2KSFA 4CJOA 3R2PA 2C04A 4NTAA 1Q0GA 1TKNA 2ZXPA 3C18A 2YL7A 3HNJA 1ZU5A 3M15A 1DOVA 5E3AA 2YL0A 4DRIB 4KI2A 3LS0A 4JJGA 4U5FE 4LERA 4CDAA 3K33A 3LEVA 5DS6A 5COMA 1M2OA 1ZHYA 2YVKA 3DM5A 2R7OA 4BEJA 1ZU4A 1M56C 1ZVZA 1U6HA 2R25A 2WZLA 3DWWA 4NCQA 4LLCA 3KYIA 2MHRA 1R5ID 2CYDA 2OQMA 4DRHB 2L6HA 1NZEA 1U89A 2J7PD 2Y3HA 3NRHA 1G4WR 4PR9A 4CS9A 5BQHA 3S9OA 1LPEA 2PP4A 1FMVA 2IBFA 2YWAA 4AL0A 1HMDA 1KTMA 3M4BA 5KYUB 1K04A 3ABKC 3QW0A 4IGGA 1XZPA 2LSEA 2CNWD 4GYTA 2GFHA 4N6HA 3B0PA 3QZCA 2P1AA 3DAGA 4ONSA 2QY9A 2WZFA 2ZPAA 4NC3A 4AL1A 4XQ1A 3VRCA 4B6IA 4HFFB 3RQEA 3HJCA 3EFOB 2EPLX 2A1DD 5B1AC 1TFKB 2WVQA 3W4YA 4AE4B 1NFOA 4NQFA 5EK0A 1RJ9A 3KL4A 4DJ9A 4Q7CA 1Z6AA 5EHHA 3WG7C 1CGOA 2CDQA 3AOUA 3LEOA 2KQ9A 2PBEA 2FAPB 3OWTA 4MS2A 2GA0A 4MVMA 3ZQYA 3ZSUA 4A2NB 3C8GB 3N24A 4U5CE 4G0HA 1E2XA 1OCZC 3FAPB 1OR2A 3U3FA 4EIYA 2V3CC 2WL8A 4YL0A 5FZTA 4JCZA 1V54C 1D1AA 2OOCA 4HEAJ 4FAPB 4BJ1A 1SZIA 1JAFA 1VOMA 4G78A 4YN0B 1BZ4A 1LI7A 2XLOA 4OD5A 3U5SA 4CS9C 4U5HA 2YRFA 2I8BA 4IJJA 4LACB 2KK1A 3V5XA 1OW7A 4BEMJ 1VTMP 1VYKA 4XLNF 2VCBA 1NLXA 5HV9A 2O9XA 1ZW2A 2ZXOA 1LE4A 2DYRC 2W9YA 3NMKA 4PJJA 3ZVRA 3FOPA 3JCUQ 3TULA 3UGPA 3M1CB 4XTKA 3EGXB 2A0UA 2L6GA 3CAXA 1SR2A 2DYSC 4OINF 3KH2A 2ETSA 2G62A 3AJMA 5D91A 2YLGA 3HKKA 3Q6MA 3WHNA 4BJTA 3O10A 1H6GA 3RVZA 3W2VA 5L0HA 1K40A 1OCRC 3VAYA 4FWVA 3TK0A 4EBKA 3SXZA 4XPYA 2XLDA 4MNDA 4YL1A 1M6TA 2CGEA 4XEVA 3LUTB 3QVYA 3UNGC 3JSZA 2YQYA 3CSKA 4EKWA 1O5HA 2NUPA 4JEAA 2IXOA 1F1MA 2XL8A 4O6YA 5T1DB 4DXWA 2V26A 4O79A 1BBHA 5COGA 4I44A 4NTFA 1BR1A 2PX3A 3MBGA 4XEFA 2GDCA 3QVZA 3SEOA 4KBLA 4DBRA 1ST6A 5CIVA 4JTDB 4K1OA 4YT8A 4U5BE 4PJNA 3US6A 1LVKA 1ZHWA 4E7SA 3L8JA 4JKVA 4OD4A 3BRJA 4C3EA 2LD6A 1HY5A 3IQ6A 1NSGB 2FGYA 4U5EE 4E17A 1PD1A 3L8IA 5A6JA 2R9RB 3EHNA 4U5DE 2R7RA 2R7VA 3SXMA 1BDJB 4CBEA 2HV7A 1Z63A 2CNWA 4A4AA 1GS9A 3FOOA 3V7OA 3I5PA 1OQCA 4KNVA 5TJ5E 3R7CA 1N1CA 1YARO 3EQLF 3H2UA 2EIJC 1I4YA 2R7QA 4J30B 1OXKA 1D0XA 3EH1A 3RH3A 3UMKA 1RXQA 2OEXA 2R03A 5DS4A 2G3KA 1C02A 2P6VA 3DAFA 2GAQA 1JMWA 5EGYA 4ZLCA 3ZG1A 4I1OB 3B0VC 1ZHTA 2YHSA 3M4CA 3EFOA 4AE4A 1QSPA 1YYJA 3GM2A 4AX2A 2LIGA 1L3PA 5T3WA 3ZQVA 3NKDA 1CPRA 3G4ZA 1ORJA 2HSQA 3AG1C 3LAYA 2Y39A 2J46A 4W8PA 2B0JA 1WGWA 4K7BA 5CI9A 4BJ5A 3NKEA 4JRZA 3U2MA 2Q00A 4C3DA 2XXAB 2FFHA 4W8KA 1UG7A 5B3IA 1V74B 4OIQF 3C8GA 2HS5A 1UFBA 2HZ8A 1NFNA 2ZXRA 2HJMA 2L9JA 3IEEA 2PNOA 1QKRA 3U9MA 3LJBA 3NYLA 4GQHA 2NUPB 4JEBA 4N4WA 4CX9A 2IM8A 4MTFA 5E3CA 1VYIA 4FX5A 2XM4A 1ORSC 1LS4A 4MVUA 5FCLA 1SMYF 4XEKA 3O39A 5KYXA 2J9VA 1LIHA 2WB7A 3HNKA 4JVSA 3B29A 2AWCA 5JT4A 2TMVP 1A7DA 4KC9A 3FHDA 4MTGA 2H8AA 5DQZA 1J8YF 2YKZA 1VK5A 4IRUA 1BR4A 4J32B 1Z5ZA 3FXHA 4I3MA 2P0NA 4JIOA 3ZIBA 1Q0FA 2OU6A 1NG1A 1YLMA 3ZC4A 4UDVA 2DB4A 3EGXA 1H7IA 1TWHA 1MNDA 1WN0A 2RSEB 5A6KA 1TFOB 1TWAA 3GODA 4H4KC 3SZRA 1OCCC 2XL6A 4HE8D 3JRTA 1MMDA 3U8VA 2NPUA 4G7HF 2XLEA 3A9CA 4M63A 2AWYA 3V5ZA 3NYJA 1QQ3A 1O3UA 3DD7A 5L0GA 3L1MA 3TOLA 3TOMA 3GWNA 4BG0A 1Z23A 1C17M 1YA7O 2X51A 4O6NA 2ASRA 3EZHA 5DLJA 4ANJA 5BUOA 1MMNA 3ECSA 3JT1A 3K6BA 3LLKA 5F5HA 4DVZA 4XPXA 3QW1A 3U0CA 2NUTB 4JW1A 1NU7D 4XWJA 2IXPA 4PJLA 4XLPF 3ABLC 4JTCB 3Q7LA 2VCAA 3RKOF 3E70C 5A6AA 2IOQA 3C8GD 4YT5A 5KYYA 1S05A 1YZAA 2JX0A 1QLEC 2H7BA 1PV3A 2NSFA 2ZD9A 4OIRF 5KYXB 2ICWG 4IB4A 5JUAA 3J06A 4WGYA 3B0UX 3SNHA 2EIMC 2VB6A 1M57C 1JOGA 1O87A 2EILC 3DZAA 1H9TA 3G50A 3C63A 3MYIA 2VH3A 4CJGA 2YL1A 5E2QA 1CGME 1VLTA 2EPMX 3N2ZB 4YWQA 5JVEA 2ZXWC 5B3SC 2QE9A 2HKVA 5L0CA 3RF3A
chains in the Genus database with same CATH topology
1H7IA 1OR2A 2KC3A 1LPEA 1NFNA 1AEPA 1BZ4A 1GS9A 1EQ1A 1LS4A 1LE2A 1OR3A 1YA9A 1B68A 3R2PA 1EA8A 1LE4A 1NFOA 3S84A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H7I A;  1OR2 A;  2KC3 A;  1LPE A;  1NFN A;  1AEP A;  1BZ4 A;  1GS9 A;  1EQ1 A;  1LS4 A;  1LE2 A;  1OR3 A;  1YA9 A;  1B68 A;  3R2P A;  1EA8 A;  1LE4 A;  1NFO A;  3S84 A; 
#chains in the Genus database with same CATH topology
 4JZA A;  1GGQ A;  2XRH A;  3H2V A;  1SYQ A;  3HNI A;  2A6E F;  3TJ5 A;  2XLM A;  3U8P A;  3T6B A;  4BPM A;  1ORY A;  4JJF A;  2XXA A;  4MVZ A;  5BQI A;  2R7W A;  1PD0 A;  3AG3 C;  2Y69 C;  2YLI A;  4MQ9 F;  4AK9 A;  4YT4 A;  2VCC A;  5L3V A;  2HUJ A;  3K1I A;  3L0I A;  4MVR A;  3EPV A;  1E84 A;  4CSA A;  1YA9 A;  4O6M A;  2HV6 A;  3QTH A;  1EA8 A;  1Q0M A;  3RFY A;  1G4U S;  1HW1 A;  2L81 A;  1I5N A;  4MVS A;  2Y3B A;  4YT2 A;  2DI3 A;  2QLA A;  1A41 A;  1H9G A;  3A11 A;  2WVN A;  3DJN B;  2XS1 A;  1ZYR F;  2D4U A;  2OJQ A;  3FVY A;  3VM6 A;  2BL2 A;  3DE8 A;  3UR3 C;  2QNL A;  4J7T A;  5A6B A;  3GM1 A;  5AGF A;  5A69 A;  2WVO A;  3GAN A;  2D5R B;  4N06 A;  1Y4C A;  3L34 A;  3WAQ A;  5L3Q A;  4BJ6 A;  1RMV A;  4QI0 A;  2P7V A;  2QTV A;  5K0I A;  3GEE A;  2AU5 A;  1YDI A;  2KJG A;  1OW8 A;  3EGD B;  4PK4 A;  5KYY B;  1OXB A;  1V55 C;  3W8I A;  4E0H A;  2W45 A;  2J45 A;  1OKK A;  3QMK A;  1HW2 A;  2Q7R A;  2EPN A;  4PAC A;  3VYW A;  1Y6D A;  4ULW A;  3V5Y A;  2A0B A;  3N0T A;  2LFF A;  2MWQ A;  1WOL A;  1QPU A;  3C8Z A;  3GOR A;  2OG2 A;  4ZLD A;  3G4X A;  1XZQ A;  4MW8 A;  3KKB A;  2AP3 A;  3PMR A;  2KYH A;  5L0I A;  2XL4 A;  1VMA A;  5DQT A;  2C03 A;  4QDL A;  3T6J A;  4U5G A;  3RW0 A;  1A7V A;  1IW7 F;  1MQV A;  1Z3I X;  2HSB A;  2NUT A;  3WOD F;  1RCP A;  3I5Q A;  4C7O A;  1BR2 A;  1AEP A;  2PFD A;  2VC9 A;  4DBQ A;  1MMG A;  3LLI A;  1T6U A;  1AUE A;  4IAO A;  4KNW A;  2J0W A;  4U9E A;  3AG2 C;  3O55 A;  4ULV A;  2KNH A;  3SXY A;  3VF0 A;  1EQ1 A;  3K7D A;  3KMI A;  4Z9J A;  1Q0K A;  3HTK C;  3NYM A;  4PFP A;  5DVW A;  1MMA A;  1OW6 A;  1V4A A;  2Z15 A;  1B68 A;  1FTS A;  2E87 A;  3IHU A;  3NDB B;  2R7U A;  4L6R A;  5CI8 A;  1L7C A;  4OIO F;  4ER9 A;  3GEI A;  5JSL A;  2R7S A;  1G8X A;  2OCC C;  3Q6N A;  2W4M A;  1HE1 A;  1LKX A;  2VAS A;  4CDY A;  3MYF A;  1D0Z A;  1T6Q A;  1YYX A;  3AQB A;  3ASN C;  4WGZ A;  2J9B A;  3S0X A;  3S90 A;  2KW3 C;  3TD7 A;  2OKU A;  1A0B A;  2X0C A;  1U0B B;  5A6B D;  3ZTZ A;  3DJU B;  3CEX A;  3HNL A;  3DKA A;  4K0D A;  4CS7 A;  1ZHZ A;  2KC3 A;  2UUI A;  4G7Z F;  2H7O A;  2YLD A;  1JPJ A;  2LCH A;  2MYS A;  5DS5 A;  4R32 A;  1T01 A;  5GPG B;  1QZX A;  1S7Z A;  4BJ5 C;  5HSW A;  1D0Y A;  4IAR A;  3NMI A;  1SF8 A;  3SYN A;  2YEV A;  2YL3 A;  2IXM A;  2HMQ A;  3PCV A;  1OKK D;  1RKE A;  1YVI A;  3U3B A;  4YL3 A;  1ZW3 A;  2R02 A;  2XS8 A;  3EG9 B;  4CDV A;  2XSE A;  2EIN C;  4MVQ A;  2W4B A;  4JCH A;  3RYL A;  4CIH A;  1FR0 A;  1ZHX A;  1FNT c;  1T5O A;  4WJ0 A;  3S29 A;  1TR2 A;  3MLG A;  3TQO A;  2B0H A;  3FMS A;  4D4X A;  256B A;  5KYN A;  3O6X A;  1WTY A;  2BE5 F;  4JE9 A;  4I1M A;  1M2V B;  3AGT A;  4EUK B;  2GWW A;  4C7O B;  5L0F A;  3EHM A;  4LDQ A;  3LNR A;  3NG1 A;  1G5Z A;  3RIP A;  1FFT C;  3NMJ A;  3F46 A;  2P61 A;  3CQZ A;  4D4N A;  1AVO B;  1CPQ A;  1QVX A;  2XLW A;  3RQG A;  2AVK A;  2H7V C;  4EWC A;  3EGD A;  2HMZ A;  4XPW A;  3M79 A;  1HMO A;  1LE2 A;  3K66 A;  5IY5 C;  2A6H F;  3IQ5 A;  3CZ6 A;  4Q4Z F;  2R05 A;  2EIK C;  4CS8 A;  3JZ0 A;  1XWJ A;  3UGO A;  1A7E A;  1D1B A;  5COF A;  3EJN A;  4P6I C;  2YZS A;  3FAJ A;  3JRM O;  4NY3 A;  2XLV A;  3TJ6 A;  4Z9H A;  2XLH A;  1TQG A;  5L0D A;  2WZG A;  1E83 A;  3AQC A;  2Q9C A;  4WAB A;  4Z9I A;  5JLI A;  5KYW B;  2QUP A;  3DM9 B;  1E86 A;  4G7O F;  1EKY A;  3GEH A;  2J0X A;  3S27 A;  3T4R A;  4PFO A;  4MVO A;  3JYH A;  3DMD A;  1I4Z A;  1FAP B;  1RKE B;  1WWP A;  3F47 A;  3OEO A;  3Q7G A;  1OR3 A;  2F22 A;  3BEH A;  3MFN A;  4IAQ A;  4LDK A;  2PF4 E;  2J8W A;  1TWC A;  3H65 A;  4DRJ B;  3LNM B;  4O7G A;  3S28 A;  1WAS A;  4P9F A;  1NBB A;  2EPO A;  4MTO A;  5JS5 A;  2IYL D;  4HFK B;  1NU9 C;  3C7J A;  1FMW A;  2JPU A;  3ZDL A;  4LDR A;  2NSG A;  4JUR I;  3HLZ A;  4CS8 C;  3U2L A;  1J8M F;  1ZZP A;  1HE9 A;  1Q0D A;  3X2Q C;  5L0J A;  1JR8 A;  1YZC A;  1VLS A;  3DXJ F;  3ZTM A;  1DOW A;  3RQF A;  3OA1 A;  4RDA A;  2R7T A;  1YJG A;  2M64 A;  1T6I A;  3X1O A;  1GM5 A;  2L6F A;  1YAU O;  2KGO A;  2LFD A;  1IZM A;  2Q4F A;  2A69 F;  3EZI A;  2M4E A;  4YJW A;  3RVY A;  4H54 A;  3U9J A;  5F28 E;  2L7A A;  2BC5 A;  3JYY A;  2R7X A;  3KPH A;  1C03 A;  2HJ3 A;  3GM3 A;  3JSE O;  3EH2 A;  2I15 A;  3AGU A;  4EBJ A;  3T6G B;  2Y3D A;  3SXK A;  1OCO C;  2Q3T A;  2NG1 A;  5E33 A;  1JRA A;  1RJ9 B;  3ITF A;  4JTA B;  4EHP A;  3T9O A;  1W2W A;  3EG9 A;  3W8H A;  3DE9 A;  3S84 A;  1LM3 B;  3K1I C;  4CIP A;  4C3B A;  1T9K A;  1E85 A;  4CSA C;  4OIP F;  1WAT A;  5AC4 A;  2CCY A;  2J7P A;  1K05 A;  1JPN A;  2Y3G A;  1LI5 A;  2PX0 A;  5JP7 A;  3ZWI A;  4J7Y A;  2DGJ A;  4X0R A;  1GQA A;  2LQG A;  4MW3 A;  4PJM A;  3IQT A;  2JD3 A;  3GWL A;  1M2V A;  3MX3 A;  2J9W A;  5BQG A;  5B1B C;  4EBB A;  3PDM P;  3LES A;  1EI7 A;  2OEV A;  4BJ6 C;  3K1H A;  5AC5 A;  4QI2 A;  5KYU A;  1D1C A;  2LP4 A;  1FFH A;  4DOZ A;  1VB5 A;  2UUH A;  3B9Q A;  1PCX A;  1CGN A;  1APC A;  4N6C A;  3UMI A;  2RD9 A;  3UMH A;  2J9U A;  4E18 A;  3JTL O;  2LK4 A;  4FES A;  4Q5S F;  3IQC A;  5D92 A;  4DVY P;  3KYJ A;  4RBN A;  2Q9B A;  3SP1 A;  3POV A;  3AG4 C;  1Z7Q c;  1TWG A;  2EPK X;  4YK5 A;  3C62 A;  1MNE A;  4P9T A;  1KNY A;  1KU2 A;  2XM0 A;  3W2W A;  3IPM O;  5JRA A;  3PHF 2;  1LS1 A;  4F4B A;  2OJE D;  4GEH A;  2IXN A;  4LLE A;  5KYW A;  2CW0 F;  1R4T A;  2A68 F;  3E9V A;  5F5F A;  4NTB A;  1RKC A;  3ATP A;  4JC7 A;  2G3V A;  3B71 A;  2HFI A;  4RD9 A;  4U9D A;  4E0I A;  3FDQ A;  3ABM C;  3DI5 A;  2Q9A A;  3LS1 A;  4E7Z A;  5T3T A;  4IWB A;  3ASO C;  3I4U A;  2KSF A;  4CJO A;  3R2P A;  2C04 A;  4NTA A;  1Q0G A;  1TKN A;  2ZXP A;  3C18 A;  2YL7 A;  3HNJ A;  1ZU5 A;  3M15 A;  1DOV A;  5E3A A;  2YL0 A;  4DRI B;  4KI2 A;  3LS0 A;  4JJG A;  4U5F E;  4LER A;  4CDA A;  3K33 A;  3LEV A;  5DS6 A;  5COM A;  1M2O A;  1ZHY A;  2YVK A;  3DM5 A;  2R7O A;  4BEJ A;  1ZU4 A;  1M56 C;  1ZVZ A;  1U6H A;  2R25 A;  2WZL A;  3DWW A;  4NCQ A;  4LLC A;  3KYI A;  2MHR A;  1R5I D;  2CYD A;  2OQM A;  4DRH B;  2L6H A;  1NZE A;  1U89 A;  2J7P D;  2Y3H A;  3NRH A;  1G4W R;  4PR9 A;  4CS9 A;  5BQH A;  3S9O A;  1LPE A;  2PP4 A;  1FMV A;  2IBF A;  2YWA A;  4AL0 A;  1HMD A;  1KTM A;  3M4B A;  5KYU B;  1K04 A;  3ABK C;  3QW0 A;  4IGG A;  1XZP A;  2LSE A;  2CNW D;  4GYT A;  2GFH A;  4N6H A;  3B0P A;  3QZC A;  2P1A A;  3DAG A;  4ONS A;  2QY9 A;  2WZF A;  2ZPA A;  4NC3 A;  4AL1 A;  4XQ1 A;  3VRC A;  4B6I A;  4HFF B;  3RQE A;  3HJC A;  3EFO B;  2EPL X;  2A1D D;  5B1A C;  1TFK B;  2WVQ A;  3W4Y A;  4AE4 B;  1NFO A;  4NQF A;  5EK0 A;  1RJ9 A;  3KL4 A;  4DJ9 A;  4Q7C A;  1Z6A A;  5EHH A;  3WG7 C;  1CGO A;  2CDQ A;  3AOU A;  3LEO A;  2KQ9 A;  2PBE A;  2FAP B;  3OWT A;  4MS2 A;  2GA0 A;  4MVM A;  3ZQY A;  3ZSU A;  4A2N B;  3C8G B;  3N24 A;  4U5C E;  4G0H A;  1E2X A;  1OCZ C;  3FAP B;  1OR2 A;  3U3F A;  4EIY A;  2V3C C;  2WL8 A;  4YL0 A;  5FZT A;  4JCZ A;  1V54 C;  1D1A A;  2OOC A;  4HEA J;  4FAP B;  4BJ1 A;  1SZI A;  1JAF A;  1VOM A;  4G78 A;  4YN0 B;  1BZ4 A;  1LI7 A;  2XLO A;  4OD5 A;  3U5S A;  4CS9 C;  4U5H A;  2YRF A;  2I8B A;  4IJJ A;  4LAC B;  2KK1 A;  3V5X A;  1OW7 A;  4BEM J;  1VTM P;  1VYK A;  4XLN F;  2VCB A;  1NLX A;  5HV9 A;  2O9X A;  1ZW2 A;  2ZXO A;  1LE4 A;  2DYR C;  2W9Y A;  3NMK A;  4PJJ A;  3ZVR A;  3FOP A;  3JCU Q;  3TUL A;  3UGP A;  3M1C B;  4XTK A;  3EGX B;  2A0U A;  2L6G A;  3CAX A;  1SR2 A;  2DYS C;  4OIN F;  3KH2 A;  2ETS A;  2G62 A;  3AJM A;  5D91 A;  2YLG A;  3HKK A;  3Q6M A;  3WHN A;  4BJT A;  3O10 A;  1H6G A;  3RVZ A;  3W2V A;  5L0H A;  1K40 A;  1OCR C;  3VAY A;  4FWV A;  3TK0 A;  4EBK A;  3SXZ A;  4XPY A;  2XLD A;  4MND A;  4YL1 A;  1M6T A;  2CGE A;  4XEV A;  3LUT B;  3QVY A;  3UNG C;  3JSZ A;  2YQY A;  3CSK A;  4EKW A;  1O5H A;  2NUP A;  4JEA A;  2IXO A;  1F1M A;  2XL8 A;  4O6Y A;  5T1D B;  4DXW A;  2V26 A;  4O79 A;  1BBH A;  5COG A;  4I44 A;  4NTF A;  1BR1 A;  2PX3 A;  3MBG A;  4XEF A;  2GDC A;  3QVZ A;  3SEO A;  4KBL A;  4DBR A;  1ST6 A;  5CIV A;  4JTD B;  4K1O A;  4YT8 A;  4U5B E;  4PJN A;  3US6 A;  1LVK A;  1ZHW A;  4E7S A;  3L8J A;  4JKV A;  4OD4 A;  3BRJ A;  4C3E A;  2LD6 A;  1HY5 A;  3IQ6 A;  1NSG B;  2FGY A;  4U5E E;  4E17 A;  1PD1 A;  3L8I A;  5A6J A;  2R9R B;  3EHN A;  4U5D E;  2R7R A;  2R7V A;  3SXM A;  1BDJ B;  4CBE A;  2HV7 A;  1Z63 A;  2CNW A;  4A4A A;  1GS9 A;  3FOO A;  3V7O A;  3I5P A;  1OQC A;  4KNV A;  5TJ5 E;  3R7C A;  1N1C A;  1YAR O;  3EQL F;  3H2U A;  2EIJ C;  1I4Y A;  2R7Q A;  4J30 B;  1OXK A;  1D0X A;  3EH1 A;  3RH3 A;  3UMK A;  1RXQ A;  2OEX A;  2R03 A;  5DS4 A;  2G3K A;  1C02 A;  2P6V A;  3DAF A;  2GAQ A;  1JMW A;  5EGY A;  4ZLC A;  3ZG1 A;  4I1O B;  3B0V C;  1ZHT A;  2YHS A;  3M4C A;  3EFO A;  4AE4 A;  1QSP A;  1YYJ A;  3GM2 A;  4AX2 A;  2LIG A;  1L3P A;  5T3W A;  3ZQV A;  3NKD A;  1CPR A;  3G4Z A;  1ORJ A;  2HSQ A;  3AG1 C;  3LAY A;  2Y39 A;  2J46 A;  4W8P A;  2B0J A;  1WGW A;  4K7B A;  5CI9 A;  4BJ5 A;  3NKE A;  4JRZ A;  3U2M A;  2Q00 A;  4C3D A;  2XXA B;  2FFH A;  4W8K A;  1UG7 A;  5B3I A;  1V74 B;  4OIQ F;  3C8G A;  2HS5 A;  1UFB A;  2HZ8 A;  1NFN A;  2ZXR A;  2HJM A;  2L9J A;  3IEE A;  2PNO A;  1QKR A;  3U9M A;  3LJB A;  3NYL A;  4GQH A;  2NUP B;  4JEB A;  4N4W A;  4CX9 A;  2IM8 A;  4MTF A;  5E3C A;  1VYI A;  4FX5 A;  2XM4 A;  1ORS C;  1LS4 A;  4MVU A;  5FCL A;  1SMY F;  4XEK A;  3O39 A;  5KYX A;  2J9V A;  1LIH A;  2WB7 A;  3HNK A;  4JVS A;  3B29 A;  2AWC A;  5JT4 A;  2TMV P;  1A7D A;  4KC9 A;  3FHD A;  4MTG A;  2H8A A;  5DQZ A;  1J8Y F;  2YKZ A;  1VK5 A;  4IRU A;  1BR4 A;  4J32 B;  1Z5Z A;  3FXH A;  4I3M A;  2P0N A;  4JIO A;  3ZIB A;  1Q0F A;  2OU6 A;  1NG1 A;  1YLM A;  3ZC4 A;  4UDV A;  2DB4 A;  3EGX A;  1H7I A;  1TWH A;  1MND A;  1WN0 A;  2RSE B;  5A6K A;  1TFO B;  1TWA A;  3GOD A;  4H4K C;  3SZR A;  1OCC C;  2XL6 A;  4HE8 D;  3JRT A;  1MMD A;  3U8V A;  2NPU A;  4G7H F;  2XLE A;  3A9C A;  4M63 A;  2AWY A;  3V5Z A;  3NYJ A;  1QQ3 A;  1O3U A;  3DD7 A;  5L0G A;  3L1M A;  3TOL A;  3TOM A;  3GWN A;  4BG0 A;  1Z23 A;  1C17 M;  1YA7 O;  2X51 A;  4O6N A;  2ASR A;  3EZH A;  5DLJ A;  4ANJ A;  5BUO A;  1MMN A;  3ECS A;  3JT1 A;  3K6B A;  3LLK A;  5F5H A;  4DVZ A;  4XPX A;  3QW1 A;  3U0C A;  2NUT B;  4JW1 A;  1NU7 D;  4XWJ A;  2IXP A;  4PJL A;  4XLP F;  3ABL C;  4JTC B;  3Q7L A;  2VCA A;  3RKO F;  3E70 C;  5A6A A;  2IOQ A;  3C8G D;  4YT5 A;  5KYY A;  1S05 A;  1YZA A;  2JX0 A;  1QLE C;  2H7B A;  1PV3 A;  2NSF A;  2ZD9 A;  4OIR F;  5KYX B;  2ICW G;  4IB4 A;  5JUA A;  3J06 A;  4WGY A;  3B0U X;  3SNH A;  2EIM C;  2VB6 A;  1M57 C;  1JOG A;  1O87 A;  2EIL C;  3DZA A;  1H9T A;  3G50 A;  3C63 A;  3MYI A;  2VH3 A;  4CJG A;  2YL1 A;  5E2Q A;  1CGM E;  1VLT A;  2EPM X;  3N2Z B;  4YWQ A;  5JVE A;  2ZXW C;  5B3S C;  2QE9 A;  2HKV A;  5L0C A;  3RF3 A; 
#chains in the Genus database with same CATH homology
 1H7I A;  1OR2 A;  2KC3 A;  1LPE A;  1NFN A;  1AEP A;  1BZ4 A;  1GS9 A;  1EQ1 A;  1LS4 A;  1LE2 A;  1OR3 A;  1YA9 A;  1B68 A;  3R2P A;  1EA8 A;  1LE4 A;  1NFO A;  3S84 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...