1NFOA

Apolipoprotein e2 (apoe2, d154a mutation)
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
141
structure length
131
Chain Sequence
GQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQRLSKELQAAQARLGADMEDVCGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADALQKCLAVYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Novel mechanism for defective receptor binding of apolipoprotein E2 in type III hyperlipoproteinemia.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lipid transport
molecule keywords APOLIPOPROTEIN E2
total genus 61
structure length 131
sequence length 141
ec nomenclature
pdb deposition date 1996-07-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.20 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Apolipoprotein 1nfoA00
1AEPA 1LE2A 3S84A 1EA8A 3R2PA 1EQ1A 1LE4A 1B68A 1H7IA 1GS9A 1NFOA 1NFNA 1OR2A 1YA9A 1BZ4A 1LS4A 2KC3A 1LPEA 1OR3A
chains in the Genus database with same CATH superfamily
1ZHZA 4MVOA 1HY5A 3JRTA 4E17A 1BR2A 1PD1A 4ZLDA 1NG1A 2BE5F 3Q6NA 4IWBA 3DE8A 3L8IA 4CJGA 2XL8A 3U2MA 1OXBA 3LAYA 3EFOB 4DRIB 3I5QA 2NUTB 2LCHA 3GODA 1SZIA 5COFA 2ZXPA 1OW7A 3SXKA 3U3FA 3PCVA 2EPKX 1Z6AA 2IXNA 2AWCA 3EZHA 3S90A 5B3IA 3AJMA 2YRFA 3FVYA 3QTHA 4MW3A 1TKNA 3EJNA 3EHMA 1ZU5A 1ZYRF 1TFKB 3GM3A 3NYJA 4RBNA 4YL1A 3G4ZA 4MTFA 2GDCA 1A7VA 3C8GA 4PJMA 4Z9JA 5A6JA 1FNTc 2Y3DA 4RDAA 1VTMP 3NMIA 1R4TA 1WOLA 3CZ6A 2YL7A 2QE9A 3SXMA 4BPMA 1OW8A 3PMRA 1KU2A 3ZIBA 3C7JA 4YT4A 4B6IA 4I1MA 3ABMC 2YEVA 1BBHA 5GPGB 3HNIA 3T6JA 4CS9A 3EGDA 1LS4A 1O5HA 2PP4A 5T3WA 1T5OA 4EBBA 1LE2A 2OQMA 4JTDB 5EK0A 3ZC4A 1BR4A 3UMKA 1K05A 5L0FA 4CIHA 2IM8A 5EHHA 1MNDA 5F28E 3W8HA 4BJ5C 1Q0KA 4G7ZF 2DYRC 4W8KA 4C3EA 4O79A 3DAFA 4YL0A 2VH3A 4GEHA 2XL4A 3MX3A 1HE9A 3HJCA 4PJJA 5L3QA 4QI2A 5KYWA 2ZXOA 2P1AA 4NY3A 3TD7A 4LDKA 3DI5A 2OKUA 4K1OA 2L7AA 1N1CA 2QNLA 3Q7LA 2EIKC 2XRHA 2R7VA 4OD4A 4QI0A 3U8VA 2R7XA 3EGXA 3JCUQ 4CS9C 2F22A 4CSAC 3SP1A 1VLSA 2C03A 2KYHA 4CJOA 1H9TA 1M2VA 2CDQA 4JURI 3SXZA 1QPUA 5JT4A 1LE4A 2RD9A 2VC9A 4BJ6A 5KYXB 2A6HF 5DS4A 1D0XA 2NSFA 4DRHB 2R7RA 2PFDA 1D1BA 1JMWA 2KQ9A 1CGNA 1WGWA 2YZSA 1V4AA 4XPWA 5DVWA 5DLJA 4Q7CA 2R02A 1C17M 2WB7A 4EBKA 1LVKA 3NYLA 3U2LA 2UUIA 5BQGA 4XPXA 4CDAA 2OEXA 1V55C 2YKZA 1ZHTA 3VF0A 1TQGA 4DOZA 3AG2C 1WN0A 2FFHA 3EG9B 4GYTA 3B0UX 2OOCA 3DM5A 3L8JA 5DS6A 2EPLX 1A0BA 3ZTMA 4BEMJ 4ANJA 2WZFA 2XLHA 2YHSA 3K6BA 3H2UA 3NRHA 4H54A 2L81A 3TJ6A 1T6QA 2Q9AA 3ATPA 3BRJA 1WATA 4CS8C 4I1OB 5FZTA 3HNLA 3V5ZA 2EINC 1EI7A 2XS8A 3FXHA 5COGA 3T6GB 1RCPA 2LSEA 3BEHA 1HMDA 3NKDA 2HSQA 3JSEO 3OWTA 1SR2A 1RKEB 1HMOA 3B29A 1FAPB 2VCAA 3FAPB 3FAJA 1H9GA 2HKVA 2MYSA 1BR1A 2Y3HA 2V3CC 3S27A 2H8AA 2J9UA 3IQ6A 5L0CA 4C7OB 3MYIA 3N2ZB 3EHNA 3LLKA 5B1AC 3U9MA 4LDQA 3V5YA 1V54C 4J7TA 2OEVA 3SXYA 2J7PD 1S7ZA 4O6MA 2Q3TA 2JX0A 2L9JA 3C62A 3O39A 1CGOA 3SZRA 4CS8A 1IW7F 3RVZA 1TFOB 3U8PA 2J0WA 4XTKA 3FDQA 3DE9A 1CPQA 2J45A 1K40A 4U5HA 1FFHA 3RVYA 4MVMA 5K0IA 1QLEC 3HKKA 4EHPA 4CIPA 4I3MA 1YZCA 2MHRA 4JW1A 2YLGA 3GEIA 3ZQVA 4JKVA 3QZCA 4JVSA 1YA9A 2P61A 1V74B 2VASA 4D4NA 3GWLA 3PDMP 1O3UA 1I4YA 2XLDA 3M79A 3DD7A 4AL1A 5BUOA 1GM5A 3JZ0A 1D0YA 1VYIA 2NPUA 4LDRA 5CI8A 2D5RB 1BZ4A 2IYLD 3LEVA 3A9CA 1C03A 3RYLA 2R7TA 2J9BA 1DOVA 2X51A 5KYXA 3DM9B 1WASA 2Q00A 2R05A 4BJTA 5E3AA 1NU7D 4OIPF 2ZXWC 3A11A 3L34A 1CGME 3LUTB 2AU5A 2GAQA 5DS5A 3E70C 3S84A 2YQYA 3ZQYA 4EBJA 4Q4ZF 3EZIA 4JE9A 4P9FA 2HUJA 4MVZA 4R32A 3I4UA 1HE1A 2KJGA 1M2OA 4EUKB 2WZLA 3AGTA 4BEJA 1ZZPA 1KTMA 3HNJA 1M2VB 1T6UA 2W45A 3UGOA 4XEVA 1E84A 3JTLO 4JEAA 2TMVP 1OCRC 3V7OA 5L0DA 1JPNA 3NKEA 2W4BA 4O7GA 4JRZA 3W2VA 4O6YA 3ZSUA 5DQTA 1RMVA 4HFKB 4RD9A 3UMHA 3KL4A 2HFIA 2J9WA 3W8IA 2QLAA 3K66A 1ZHYA 4FESA 2KSFA 5E3CA 2L6FA 1NZEA 2A1DD 3KKBA 4CDVA 4LLEA 2ETSA 3M4BA 1O87A 4ONSA 4ZLCA 1NBBA 1I4ZA 1YJGA 2HV7A 4KC9A 4QDLA 3I5PA 1JAFA 3AGUA 2LK4A 1SMYF 1Z63A 4KNVA 1D0ZA 1B68A 4YN0B 4OINF 3M15A 2YLIA 2UUHA 3JYYA 3NYMA 2A69F 1W2WA 5E2QA 5JS5A 3LS0A 1YDIA 2QTVA 5B1BC 1S05A 3QW0A 2XM4A 4JZAA 3R7CA 5KYYB 1BDJB 3V5XA 1QZXA 1ZHXA 2JPUA 2H7VC 3N0TA 5L0JA 3U5SA 1J8MF 3NG1A 4X0RA 1T9KA 2YWAA 2ZXRA 4IJJA 4U9EA 1YYXA 1ZW3A 2A6EF 2A0BA 1Y4CA 2DB4A 2W4MA 3EFOA 3NMKA 4Z9HA 4OIRF 5AC4A 2A68F 2FAPB 1SYQA 4KBLA 3TOMA 3AG3C 4XPYA 4E7SA 5D91A 3KPHA 4N4WA 1YZAA 3EH2A 4U5CE 3F47A 1A41A 3JYHA 2WL8A 2Q4FA 1LS1A 2DI3A 1ST6A 3RQGA 2NUPA 5DQZA 1M6TA 4MTOA 2Q9CA 3K1IA 4KI2A 5TJ5E 1MNEA 3ZG1A 3KYJA 4JTCB 1L7CA 5D92A 5JUAA 1TWAA 2VCCA 2XL6A 3X1OA 3IPMO 5JVEA 5F5FA 2M4EA 1JR8A 2EPNA 1DOWA 3FOPA 3LS1A 3X2QC 2P6VA 3J06A 1JOGA 2CGEA 3C8GD 1WWPA 3FOOA 1QSPA 1RJ9A 4GQHA 5A6AA 1VLTA 2LD6A 4WGZA 3SEOA 3IHUA 2M64A 2R7SA 4O6NA 2MWQA 4MTGA 5T1DB 1VMAA 3S0XA 5EGYA 2IOQA 1Q0FA 1OQCA 4PK4A 1LI5A 1WTYA 1TWHA 1VB5A 2VB6A 5BQHA 2C04A 1MMDA 3EGXB 1ORYA 1MQVA 4JJGA 4CX9A 3AG4C 1G8XA 1JPJA 1UFBA 3MYFA 3EQLF 3S9OA 2CCYA 2Y39A 4F4BA 4YT2A 1OW6A 1MMGA 2KGOA 5KYUB 4U5FE 1APCA 2R7OA 1LKXA 5JRAA 2ASRA 1Y6DA 5HSWA 1TWCA 2LFDA 2GWWA 5HV9A 3FHDA 1IZMA 1D1CA 3UMIA 4XLNF 4NTBA 3H65A 3W2WA 2AWYA 3B0PA 2WVNA 4BJ6C 4MS2A 2R03A 2R7WA 1LI7A 1YLMA 4WABA 3UR3C 5IY5C 1M57C 3N24A 2HS5A 4IAQA 3NMJA 3M1CB 4P6IC 3F46A 5A6KA 3GEHA 3WG7C 3RQEA 3AG1C 1G4WR 2NSGA 1PD0A 3K1IC 1RJ9B 2YL1A 3LLIA 2EIJC 3SNHA 3TOLA 4BG0A 4JEBA 1NU9C 2I15A 4G7OF 3DAGA 2OCCC 3HTKC 2NUPB 4EKWA 1NSGB 4NTAA 1RXQA 1T01A 2GA0A 2YL0A 1T6IA 3FMSA 1VOMA 2XXAB 4JJFA 1JRAA 3RKOF 3SYNA 4YWQA 2B0HA 2I8BA 4MW8A 3R2PA 4OD5A 4MVSA 3T9OA 2P7VA 1E2XA 2OJQA 2XLOA 5B3SC 1ZHWA 1EQ1A 3O10A 4MVQA 2Y3GA 3KMIA 2R7QA 1AVOB 3IQTA 3QVZA 4IARA 2LFFA 3OA1A 3ITFA 4PJLA 4CSAA 3TQOA 4LERA 3DZAA 3B9QA 3EGDB 2CNWA 1G4US 3C8GB 4J7YA 3S29A 2KW3C 3Q6MA 4IGGA 4DXWA 2A0UA 1NLXA 2W9YA 2PBEA 3ZDLA 1EKYA 1PV3A 4NC3A 2XLVA 1OKKD 3WODF 3EG9A 2HZ8A 4C7OA 2QY9A 2IXMA 4J32B 5T3TA 4P9TA 1MMAA 1Q0GA 3CSKA 2QUPA 1K04A 3U3BA 1FMWA 1D1AA 4G0HA 2PF4E 5A69A 3LESA 4ULVA 1QKRA 2R9RB 3C8ZA 3JT1A 2OG2A 1VK5A 4N6CA 3UNGC 5FCLA 1Q0DA 5L3VA 3EPVA 2R7UA 3C18A 3LEOA 2WVQA 4U5BE 4JIOA 1U0BB 4PFOA 2H7OA 4FWVA 4YT5A 2OU6A 3U9JA 2ICWG 5KYWB 3QW1A 1FR0A 4PFPA 1GS9A 1ZW2A 4AK9A 3ABLC 1QVXA 1MMNA 2BL2A 3DXJF 4JCHA 4K7BA 5A6BA 2WVOA 2YVKA 2ZD9A 3GWNA 3M4CA 3UGPA 3IQCA 4K0DA 4DBRA 3EH1A 3U0CA 3K33A 1Z7Qc 4FX5A 5BQIA 5KYNA 2KC3A 2XS1A 4FAPB 3RW0A 1LPEA 1XZQA 3LJBA 4NTFA 5JSLA 4EIYA 4MQ9F 4E0IA 1OCCC 1OCZC 1TWGA 2GFHA 1Z3IX 2J46A 3VRCA 3DWWA 2Q9BA 3QMKA 2R25A 2HSBA 3LNMB 2L6GA 4LLCA 1AEPA 1Z23A 2Y69C 4XEFA 4EWCA 3KYIA 4Q5SF 4A4AA 4DVYP 4WGYA 256BA 1YARO 3CQZA 5JLIA 2PX0A 5L0GA 2LIGA 3B0VC 4C3DA 1J8YF 2VCBA 2IXOA 1M56C 2P0NA 3VYWA 1PCXA 1E85A 2KNHA 2D4UA 4H4KC 2V26A 1G5ZA 3CEXA 2BC5A 4DRJB 3E9VA 4AE4A 1HW1A 4BJ1A 3C63A 1UG7A 2J0XA 4E18A 2Z15A 4DBQA 3NDBB 2YL3A 1FTSA 2G3VA 2EIMC 2HJMA 2KK1A 2FGYA 1A7DA 3ABKC 4IRUA 5CI9A 5L0IA 4M63A 1EA8A 1U6HA 4YL3A 5CIVA 2XLMA 1QQ3A 3CAXA 4N06A 3TULA 4JTAB 3IQ5A 1F1MA 4PACA 1ZVZA 4U9DA 1E83A 5F5HA 1GGQA 3GM2A 2H7BA 1I5NA 4CDYA 1Q0MA 2YLDA 1YAUO 1OR2A 4N6HA 4XLPF 1OXKA 2J7PA 1SF8A 3GEEA 2CYDA 4U5DE 4IB4A 2HMQA 2PNOA 1ZU4A 3AQBA 3ASNC 3K7DA 5AGFA 1NFOA 3MLGA 3RF3A 4MVUA 3US6A 2Y3BA 4CS7A 3OEOA 3HNKA 3O55A 4MNDA 3TJ5A 3GORA 4U5EE 4XQ1A 2L6HA 4XWJA 3ZWIA 2X0CA 3VM6A 1L3PA 4I44A 2OJED 2NUTA 3RFYA 3GM1A 3IEEA 3H2VA 3K1HA 2DGJA 2LP4A 4XEKA 4HE8D 4YK5A 4DJ9A 4W8PA 3MBGA 5JP7A 1ORJA 1YYJA 2O9XA 4OIOF 4AE4B 4Z9IA 3ZTZA 1A7EA 1GQAA 1YVIA 2XXAA 2IBFA 4PR9A 4PJNA 5COMA 1OCOC 1U89A 3RQFA 2G3KA 4NCQA 4CBEA 4E0HA 2CNWD 3VAYA 2XLWA 3RIPA 1H6GA 3DJNB 3O6XA 2AP3A 3ECSA 1NFNA 2HMZA 1Z5ZA 2NG1A 1OKKA 1FMVA 4ULWA 3MFNA 3W4YA 1TR2A 3T6BA 3S28A 2J8WA 5KYYA 4LACB 2RSEB 5E33A 2XM0A 3POVA 1KNYA 1LIHA 1VYKA 2B0JA 3ASOC 3DJUB 1C02A 3Q7GA 3QVYA 4HFFB 4U5GA 4OIQF 3JSZA 1XZPA 1E86A 2EPOA 2Q7RA 3G50A 1ORSC 2LQGA 3KH2A 4AL0A 3DKAA 3JRMO 4KNWA 1CPRA 2HJ3A 3RH3A 3B71A 2WZGA 4D4XA 4NQFA 1HW2A 5KYUA 3WHNA 4HEAJ 4IAOA 3T4RA 1XWJA 2E87A 3DMDA 2XSEA 4AX2A 3G4XA 4MVRA 5A6BD 3HLZA 4C3BA 4J30B 1FFTC 2J9VA 2EPMX 2HV6A 3L1MA 4JCZA 2IXPA 4WJ0A 2CW0F 2DYSC 1YA7O 4BJ5A 4E7ZA 2G62A 5L0HA 1AUEA 3PHF2 1LM3B 2AVKA 4ER9A 4JC7A 3AOUA 3GANA 4A2NB 1RKCA 3LNRA 1H7IA 3TK0A 4G78A 3WAQA 4YT8A 2XLEA 3L0IA 3AQCA 4G7HF 1R5ID 4DVZA 2PX3A 3ZVRA 4L6RA 5AC5A 4YJWA 2ZPAA 1RKEA 2EILC 4UDVA 2JD3A 1OR3A
chains in the Genus database with same CATH topology
1AEPA 1LE2A 3S84A 1EA8A 3R2PA 1EQ1A 1LE4A 1B68A 1H7IA 1GS9A 1NFOA 1NFNA 1OR2A 1YA9A 1BZ4A 1LS4A 2KC3A 1LPEA 1OR3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AEP A;  1LE2 A;  3S84 A;  1EA8 A;  3R2P A;  1EQ1 A;  1LE4 A;  1B68 A;  1H7I A;  1GS9 A;  1NFO A;  1NFN A;  1OR2 A;  1YA9 A;  1BZ4 A;  1LS4 A;  2KC3 A;  1LPE A;  1OR3 A; 
#chains in the Genus database with same CATH topology
 1ZHZ A;  4MVO A;  1HY5 A;  3JRT A;  4E17 A;  1BR2 A;  1PD1 A;  4ZLD A;  1NG1 A;  2BE5 F;  3Q6N A;  4IWB A;  3DE8 A;  3L8I A;  4CJG A;  2XL8 A;  3U2M A;  1OXB A;  3LAY A;  3EFO B;  4DRI B;  3I5Q A;  2NUT B;  2LCH A;  3GOD A;  1SZI A;  5COF A;  2ZXP A;  1OW7 A;  3SXK A;  3U3F A;  3PCV A;  2EPK X;  1Z6A A;  2IXN A;  2AWC A;  3EZH A;  3S90 A;  5B3I A;  3AJM A;  2YRF A;  3FVY A;  3QTH A;  4MW3 A;  1TKN A;  3EJN A;  3EHM A;  1ZU5 A;  1ZYR F;  1TFK B;  3GM3 A;  3NYJ A;  4RBN A;  4YL1 A;  3G4Z A;  4MTF A;  2GDC A;  1A7V A;  3C8G A;  4PJM A;  4Z9J A;  5A6J A;  1FNT c;  2Y3D A;  4RDA A;  1VTM P;  3NMI A;  1R4T A;  1WOL A;  3CZ6 A;  2YL7 A;  2QE9 A;  3SXM A;  4BPM A;  1OW8 A;  3PMR A;  1KU2 A;  3ZIB A;  3C7J A;  4YT4 A;  4B6I A;  4I1M A;  3ABM C;  2YEV A;  1BBH A;  5GPG B;  3HNI A;  3T6J A;  4CS9 A;  3EGD A;  1LS4 A;  1O5H A;  2PP4 A;  5T3W A;  1T5O A;  4EBB A;  1LE2 A;  2OQM A;  4JTD B;  5EK0 A;  3ZC4 A;  1BR4 A;  3UMK A;  1K05 A;  5L0F A;  4CIH A;  2IM8 A;  5EHH A;  1MND A;  5F28 E;  3W8H A;  4BJ5 C;  1Q0K A;  4G7Z F;  2DYR C;  4W8K A;  4C3E A;  4O79 A;  3DAF A;  4YL0 A;  2VH3 A;  4GEH A;  2XL4 A;  3MX3 A;  1HE9 A;  3HJC A;  4PJJ A;  5L3Q A;  4QI2 A;  5KYW A;  2ZXO A;  2P1A A;  4NY3 A;  3TD7 A;  4LDK A;  3DI5 A;  2OKU A;  4K1O A;  2L7A A;  1N1C A;  2QNL A;  3Q7L A;  2EIK C;  2XRH A;  2R7V A;  4OD4 A;  4QI0 A;  3U8V A;  2R7X A;  3EGX A;  3JCU Q;  4CS9 C;  2F22 A;  4CSA C;  3SP1 A;  1VLS A;  2C03 A;  2KYH A;  4CJO A;  1H9T A;  1M2V A;  2CDQ A;  4JUR I;  3SXZ A;  1QPU A;  5JT4 A;  1LE4 A;  2RD9 A;  2VC9 A;  4BJ6 A;  5KYX B;  2A6H F;  5DS4 A;  1D0X A;  2NSF A;  4DRH B;  2R7R A;  2PFD A;  1D1B A;  1JMW A;  2KQ9 A;  1CGN A;  1WGW A;  2YZS A;  1V4A A;  4XPW A;  5DVW A;  5DLJ A;  4Q7C A;  2R02 A;  1C17 M;  2WB7 A;  4EBK A;  1LVK A;  3NYL A;  3U2L A;  2UUI A;  5BQG A;  4XPX A;  4CDA A;  2OEX A;  1V55 C;  2YKZ A;  1ZHT A;  3VF0 A;  1TQG A;  4DOZ A;  3AG2 C;  1WN0 A;  2FFH A;  3EG9 B;  4GYT A;  3B0U X;  2OOC A;  3DM5 A;  3L8J A;  5DS6 A;  2EPL X;  1A0B A;  3ZTM A;  4BEM J;  4ANJ A;  2WZF A;  2XLH A;  2YHS A;  3K6B A;  3H2U A;  3NRH A;  4H54 A;  2L81 A;  3TJ6 A;  1T6Q A;  2Q9A A;  3ATP A;  3BRJ A;  1WAT A;  4CS8 C;  4I1O B;  5FZT A;  3HNL A;  3V5Z A;  2EIN C;  1EI7 A;  2XS8 A;  3FXH A;  5COG A;  3T6G B;  1RCP A;  2LSE A;  3BEH A;  1HMD A;  3NKD A;  2HSQ A;  3JSE O;  3OWT A;  1SR2 A;  1RKE B;  1HMO A;  3B29 A;  1FAP B;  2VCA A;  3FAP B;  3FAJ A;  1H9G A;  2HKV A;  2MYS A;  1BR1 A;  2Y3H A;  2V3C C;  3S27 A;  2H8A A;  2J9U A;  3IQ6 A;  5L0C A;  4C7O B;  3MYI A;  3N2Z B;  3EHN A;  3LLK A;  5B1A C;  3U9M A;  4LDQ A;  3V5Y A;  1V54 C;  4J7T A;  2OEV A;  3SXY A;  2J7P D;  1S7Z A;  4O6M A;  2Q3T A;  2JX0 A;  2L9J A;  3C62 A;  3O39 A;  1CGO A;  3SZR A;  4CS8 A;  1IW7 F;  3RVZ A;  1TFO B;  3U8P A;  2J0W A;  4XTK A;  3FDQ A;  3DE9 A;  1CPQ A;  2J45 A;  1K40 A;  4U5H A;  1FFH A;  3RVY A;  4MVM A;  5K0I A;  1QLE C;  3HKK A;  4EHP A;  4CIP A;  4I3M A;  1YZC A;  2MHR A;  4JW1 A;  2YLG A;  3GEI A;  3ZQV A;  4JKV A;  3QZC A;  4JVS A;  1YA9 A;  2P61 A;  1V74 B;  2VAS A;  4D4N A;  3GWL A;  3PDM P;  1O3U A;  1I4Y A;  2XLD A;  3M79 A;  3DD7 A;  4AL1 A;  5BUO A;  1GM5 A;  3JZ0 A;  1D0Y A;  1VYI A;  2NPU A;  4LDR A;  5CI8 A;  2D5R B;  1BZ4 A;  2IYL D;  3LEV A;  3A9C A;  1C03 A;  3RYL A;  2R7T A;  2J9B A;  1DOV A;  2X51 A;  5KYX A;  3DM9 B;  1WAS A;  2Q00 A;  2R05 A;  4BJT A;  5E3A A;  1NU7 D;  4OIP F;  2ZXW C;  3A11 A;  3L34 A;  1CGM E;  3LUT B;  2AU5 A;  2GAQ A;  5DS5 A;  3E70 C;  3S84 A;  2YQY A;  3ZQY A;  4EBJ A;  4Q4Z F;  3EZI A;  4JE9 A;  4P9F A;  2HUJ A;  4MVZ A;  4R32 A;  3I4U A;  1HE1 A;  2KJG A;  1M2O A;  4EUK B;  2WZL A;  3AGT A;  4BEJ A;  1ZZP A;  1KTM A;  3HNJ A;  1M2V B;  1T6U A;  2W45 A;  3UGO A;  4XEV A;  1E84 A;  3JTL O;  4JEA A;  2TMV P;  1OCR C;  3V7O A;  5L0D A;  1JPN A;  3NKE A;  2W4B A;  4O7G A;  4JRZ A;  3W2V A;  4O6Y A;  3ZSU A;  5DQT A;  1RMV A;  4HFK B;  4RD9 A;  3UMH A;  3KL4 A;  2HFI A;  2J9W A;  3W8I A;  2QLA A;  3K66 A;  1ZHY A;  4FES A;  2KSF A;  5E3C A;  2L6F A;  1NZE A;  2A1D D;  3KKB A;  4CDV A;  4LLE A;  2ETS A;  3M4B A;  1O87 A;  4ONS A;  4ZLC A;  1NBB A;  1I4Z A;  1YJG A;  2HV7 A;  4KC9 A;  4QDL A;  3I5P A;  1JAF A;  3AGU A;  2LK4 A;  1SMY F;  1Z63 A;  4KNV A;  1D0Z A;  1B68 A;  4YN0 B;  4OIN F;  3M15 A;  2YLI A;  2UUH A;  3JYY A;  3NYM A;  2A69 F;  1W2W A;  5E2Q A;  5JS5 A;  3LS0 A;  1YDI A;  2QTV A;  5B1B C;  1S05 A;  3QW0 A;  2XM4 A;  4JZA A;  3R7C A;  5KYY B;  1BDJ B;  3V5X A;  1QZX A;  1ZHX A;  2JPU A;  2H7V C;  3N0T A;  5L0J A;  3U5S A;  1J8M F;  3NG1 A;  4X0R A;  1T9K A;  2YWA A;  2ZXR A;  4IJJ A;  4U9E A;  1YYX A;  1ZW3 A;  2A6E F;  2A0B A;  1Y4C A;  2DB4 A;  2W4M A;  3EFO A;  3NMK A;  4Z9H A;  4OIR F;  5AC4 A;  2A68 F;  2FAP B;  1SYQ A;  4KBL A;  3TOM A;  3AG3 C;  4XPY A;  4E7S A;  5D91 A;  3KPH A;  4N4W A;  1YZA A;  3EH2 A;  4U5C E;  3F47 A;  1A41 A;  3JYH A;  2WL8 A;  2Q4F A;  1LS1 A;  2DI3 A;  1ST6 A;  3RQG A;  2NUP A;  5DQZ A;  1M6T A;  4MTO A;  2Q9C A;  3K1I A;  4KI2 A;  5TJ5 E;  1MNE A;  3ZG1 A;  3KYJ A;  4JTC B;  1L7C A;  5D92 A;  5JUA A;  1TWA A;  2VCC A;  2XL6 A;  3X1O A;  3IPM O;  5JVE A;  5F5F A;  2M4E A;  1JR8 A;  2EPN A;  1DOW A;  3FOP A;  3LS1 A;  3X2Q C;  2P6V A;  3J06 A;  1JOG A;  2CGE A;  3C8G D;  1WWP A;  3FOO A;  1QSP A;  1RJ9 A;  4GQH A;  5A6A A;  1VLT A;  2LD6 A;  4WGZ A;  3SEO A;  3IHU A;  2M64 A;  2R7S A;  4O6N A;  2MWQ A;  4MTG A;  5T1D B;  1VMA A;  3S0X A;  5EGY A;  2IOQ A;  1Q0F A;  1OQC A;  4PK4 A;  1LI5 A;  1WTY A;  1TWH A;  1VB5 A;  2VB6 A;  5BQH A;  2C04 A;  1MMD A;  3EGX B;  1ORY A;  1MQV A;  4JJG A;  4CX9 A;  3AG4 C;  1G8X A;  1JPJ A;  1UFB A;  3MYF A;  3EQL F;  3S9O A;  2CCY A;  2Y39 A;  4F4B A;  4YT2 A;  1OW6 A;  1MMG A;  2KGO A;  5KYU B;  4U5F E;  1APC A;  2R7O A;  1LKX A;  5JRA A;  2ASR A;  1Y6D A;  5HSW A;  1TWC A;  2LFD A;  2GWW A;  5HV9 A;  3FHD A;  1IZM A;  1D1C A;  3UMI A;  4XLN F;  4NTB A;  3H65 A;  3W2W A;  2AWY A;  3B0P A;  2WVN A;  4BJ6 C;  4MS2 A;  2R03 A;  2R7W A;  1LI7 A;  1YLM A;  4WAB A;  3UR3 C;  5IY5 C;  1M57 C;  3N24 A;  2HS5 A;  4IAQ A;  3NMJ A;  3M1C B;  4P6I C;  3F46 A;  5A6K A;  3GEH A;  3WG7 C;  3RQE A;  3AG1 C;  1G4W R;  2NSG A;  1PD0 A;  3K1I C;  1RJ9 B;  2YL1 A;  3LLI A;  2EIJ C;  3SNH A;  3TOL A;  4BG0 A;  4JEB A;  1NU9 C;  2I15 A;  4G7O F;  3DAG A;  2OCC C;  3HTK C;  2NUP B;  4EKW A;  1NSG B;  4NTA A;  1RXQ A;  1T01 A;  2GA0 A;  2YL0 A;  1T6I A;  3FMS A;  1VOM A;  2XXA B;  4JJF A;  1JRA A;  3RKO F;  3SYN A;  4YWQ A;  2B0H A;  2I8B A;  4MW8 A;  3R2P A;  4OD5 A;  4MVS A;  3T9O A;  2P7V A;  1E2X A;  2OJQ A;  2XLO A;  5B3S C;  1ZHW A;  1EQ1 A;  3O10 A;  4MVQ A;  2Y3G A;  3KMI A;  2R7Q A;  1AVO B;  3IQT A;  3QVZ A;  4IAR A;  2LFF A;  3OA1 A;  3ITF A;  4PJL A;  4CSA A;  3TQO A;  4LER A;  3DZA A;  3B9Q A;  3EGD B;  2CNW A;  1G4U S;  3C8G B;  4J7Y A;  3S29 A;  2KW3 C;  3Q6M A;  4IGG A;  4DXW A;  2A0U A;  1NLX A;  2W9Y A;  2PBE A;  3ZDL A;  1EKY A;  1PV3 A;  4NC3 A;  2XLV A;  1OKK D;  3WOD F;  3EG9 A;  2HZ8 A;  4C7O A;  2QY9 A;  2IXM A;  4J32 B;  5T3T A;  4P9T A;  1MMA A;  1Q0G A;  3CSK A;  2QUP A;  1K04 A;  3U3B A;  1FMW A;  1D1A A;  4G0H A;  2PF4 E;  5A69 A;  3LES A;  4ULV A;  1QKR A;  2R9R B;  3C8Z A;  3JT1 A;  2OG2 A;  1VK5 A;  4N6C A;  3UNG C;  5FCL A;  1Q0D A;  5L3V A;  3EPV A;  2R7U A;  3C18 A;  3LEO A;  2WVQ A;  4U5B E;  4JIO A;  1U0B B;  4PFO A;  2H7O A;  4FWV A;  4YT5 A;  2OU6 A;  3U9J A;  2ICW G;  5KYW B;  3QW1 A;  1FR0 A;  4PFP A;  1GS9 A;  1ZW2 A;  4AK9 A;  3ABL C;  1QVX A;  1MMN A;  2BL2 A;  3DXJ F;  4JCH A;  4K7B A;  5A6B A;  2WVO A;  2YVK A;  2ZD9 A;  3GWN A;  3M4C A;  3UGP A;  3IQC A;  4K0D A;  4DBR A;  3EH1 A;  3U0C A;  3K33 A;  1Z7Q c;  4FX5 A;  5BQI A;  5KYN A;  2KC3 A;  2XS1 A;  4FAP B;  3RW0 A;  1LPE A;  1XZQ A;  3LJB A;  4NTF A;  5JSL A;  4EIY A;  4MQ9 F;  4E0I A;  1OCC C;  1OCZ C;  1TWG A;  2GFH A;  1Z3I X;  2J46 A;  3VRC A;  3DWW A;  2Q9B A;  3QMK A;  2R25 A;  2HSB A;  3LNM B;  2L6G A;  4LLC A;  1AEP A;  1Z23 A;  2Y69 C;  4XEF A;  4EWC A;  3KYI A;  4Q5S F;  4A4A A;  4DVY P;  4WGY A;  256B A;  1YAR O;  3CQZ A;  5JLI A;  2PX0 A;  5L0G A;  2LIG A;  3B0V C;  4C3D A;  1J8Y F;  2VCB A;  2IXO A;  1M56 C;  2P0N A;  3VYW A;  1PCX A;  1E85 A;  2KNH A;  2D4U A;  4H4K C;  2V26 A;  1G5Z A;  3CEX A;  2BC5 A;  4DRJ B;  3E9V A;  4AE4 A;  1HW1 A;  4BJ1 A;  3C63 A;  1UG7 A;  2J0X A;  4E18 A;  2Z15 A;  4DBQ A;  3NDB B;  2YL3 A;  1FTS A;  2G3V A;  2EIM C;  2HJM A;  2KK1 A;  2FGY A;  1A7D A;  3ABK C;  4IRU A;  5CI9 A;  5L0I A;  4M63 A;  1EA8 A;  1U6H A;  4YL3 A;  5CIV A;  2XLM A;  1QQ3 A;  3CAX A;  4N06 A;  3TUL A;  4JTA B;  3IQ5 A;  1F1M A;  4PAC A;  1ZVZ A;  4U9D A;  1E83 A;  5F5H A;  1GGQ A;  3GM2 A;  2H7B A;  1I5N A;  4CDY A;  1Q0M A;  2YLD A;  1YAU O;  1OR2 A;  4N6H A;  4XLP F;  1OXK A;  2J7P A;  1SF8 A;  3GEE A;  2CYD A;  4U5D E;  4IB4 A;  2HMQ A;  2PNO A;  1ZU4 A;  3AQB A;  3ASN C;  3K7D A;  5AGF A;  1NFO A;  3MLG A;  3RF3 A;  4MVU A;  3US6 A;  2Y3B A;  4CS7 A;  3OEO A;  3HNK A;  3O55 A;  4MND A;  3TJ5 A;  3GOR A;  4U5E E;  4XQ1 A;  2L6H A;  4XWJ A;  3ZWI A;  2X0C A;  3VM6 A;  1L3P A;  4I44 A;  2OJE D;  2NUT A;  3RFY A;  3GM1 A;  3IEE A;  3H2V A;  3K1H A;  2DGJ A;  2LP4 A;  4XEK A;  4HE8 D;  4YK5 A;  4DJ9 A;  4W8P A;  3MBG A;  5JP7 A;  1ORJ A;  1YYJ A;  2O9X A;  4OIO F;  4AE4 B;  4Z9I A;  3ZTZ A;  1A7E A;  1GQA A;  1YVI A;  2XXA A;  2IBF A;  4PR9 A;  4PJN A;  5COM A;  1OCO C;  1U89 A;  3RQF A;  2G3K A;  4NCQ A;  4CBE A;  4E0H A;  2CNW D;  3VAY A;  2XLW A;  3RIP A;  1H6G A;  3DJN B;  3O6X A;  2AP3 A;  3ECS A;  1NFN A;  2HMZ A;  1Z5Z A;  2NG1 A;  1OKK A;  1FMV A;  4ULW A;  3MFN A;  3W4Y A;  1TR2 A;  3T6B A;  3S28 A;  2J8W A;  5KYY A;  4LAC B;  2RSE B;  5E33 A;  2XM0 A;  3POV A;  1KNY A;  1LIH A;  1VYK A;  2B0J A;  3ASO C;  3DJU B;  1C02 A;  3Q7G A;  3QVY A;  4HFF B;  4U5G A;  4OIQ F;  3JSZ A;  1XZP A;  1E86 A;  2EPO A;  2Q7R A;  3G50 A;  1ORS C;  2LQG A;  3KH2 A;  4AL0 A;  3DKA A;  3JRM O;  4KNW A;  1CPR A;  2HJ3 A;  3RH3 A;  3B71 A;  2WZG A;  4D4X A;  4NQF A;  1HW2 A;  5KYU A;  3WHN A;  4HEA J;  4IAO A;  3T4R A;  1XWJ A;  2E87 A;  3DMD A;  2XSE A;  4AX2 A;  3G4X A;  4MVR A;  5A6B D;  3HLZ A;  4C3B A;  4J30 B;  1FFT C;  2J9V A;  2EPM X;  2HV6 A;  3L1M A;  4JCZ A;  2IXP A;  4WJ0 A;  2CW0 F;  2DYS C;  1YA7 O;  4BJ5 A;  4E7Z A;  2G62 A;  5L0H A;  1AUE A;  3PHF 2;  1LM3 B;  2AVK A;  4ER9 A;  4JC7 A;  3AOU A;  3GAN A;  4A2N B;  1RKC A;  3LNR A;  1H7I A;  3TK0 A;  4G78 A;  3WAQ A;  4YT8 A;  2XLE A;  3L0I A;  3AQC A;  4G7H F;  1R5I D;  4DVZ A;  2PX3 A;  3ZVR A;  4L6R A;  5AC5 A;  4YJW A;  2ZPA A;  1RKE A;  2EIL C;  4UDV A;  2JD3 A;  1OR3 A; 
#chains in the Genus database with same CATH homology
 1AEP A;  1LE2 A;  3S84 A;  1EA8 A;  3R2P A;  1EQ1 A;  1LE4 A;  1B68 A;  1H7I A;  1GS9 A;  1NFO A;  1NFN A;  1OR2 A;  1YA9 A;  1BZ4 A;  1LS4 A;  2KC3 A;  1LPE A;  1OR3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...