1NFOA

Apolipoprotein e2 (apoe2, d154a mutation)
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
141
structure length
131
Chain Sequence
GQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQRLSKELQAAQARLGADMEDVCGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADALQKCLAVYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords APOLIPOPROTEIN E2
publication title Novel mechanism for defective receptor binding of apolipoprotein E2 in type III hyperlipoproteinemia.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lipid transport
total genus 61
structure length 131
sequence length 141
ec nomenclature
pdb deposition date 1996-07-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.20 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Apolipoprotein 1nfoA00
1AEPA 1H7IA 2KC3A 1NFOA 1EQ1A 3S84A 1OR2A 1LPEA 1LE2A 1B68A 1LE4A 1YA9A 3R2PA 1NFNA 1GS9A 1BZ4A 1LS4A 1OR3A 1EA8A
chains in the Genus database with same CATH superfamily
1OW6A 5HSWA 5KYUA 3OEOA 4LLCA 5KYUB 4EIYA 4OIPF 1QZXA 2CW0F 1ZHWA 3NMIA 5AC5A 3RQEA 2WZFA 1OXKA 2QTVA 2YWAA 3JCUQ 1HMOA 2A6HF 3DAGA 1R5ID 1VLSA 3E9VA 3FHDA 2CNWA 1YLMA 5AC4A 1FNTc 1QLEC 4HEAJ 4CS9A 3DJUB 2O9XA 1OCRC 4PACA 5L3QA 1YZCA 2AU5A 1NLXA 4JIOA 1J8YF 2WVOA 1VMAA 4E0HA 4U5GA 2YL0A 3Q7GA 1M2OA 1K05A 3C8GB 3HKKA 4LLEA 4IWBA 3U5SA 2BC5A 1OR3A 2LD6A 2W4MA 2XS1A 4LDQA 1TFKB 3RVZA 1YDIA 2HV7A 3KMIA 4MVZA 4C3EA 2R03A 3GODA 3SXZA 3AG4C 3ZIBA 4W8PA 4XPWA 1U0BB 1LKXA 1HW2A 3OA1A 3U9JA 3QW1A 4AL1A 3LJBA 5E3AA 3EGDA 2YL3A 4R32A 3DD7A 3EGDB 4YL3A 3S28A 2HV6A 1ZHXA 3MLGA 1E84A 3FOPA 3RF3A 4CSAA 5BQHA 4DBRA 1RJ9B 2XLVA 3RIPA 4KNWA 2L6HA 4WGZA 4IB4A 2NSGA 3U8VA 4YT5A 4CS9C 4PJJA 4L6RA 2M64A 4KBLA 4BG0A 4E0IA 4E7ZA 1RKEA 3LLKA 4NY3A 4EBBA 4ZLCA 1RKEB 3FAJA 1WN0A 3EH2A 3FVYA 5COFA 2R02A 2LIGA 1TWHA 1D1AA 3BEHA 3DZAA 2UUIA 4JTCB 4NC3A 1D0YA 4K0DA 4CDYA 1ST6A 4JW1A 1LI5A 3JTLO 3LESA 3O10A 4MVMA 3U9MA 1DOVA 1V55C 1Y6DA 3I5PA 2R7XA 3LEOA 3NRHA 5DQZA 4G0HA 2A0UA 1ZW2A 2NUTA 3FMSA 1CGME 2NUTB 3MFNA 3T6GB 3EZHA 3EGXA 3I5QA 4JVSA 1M2VA 2J45A 1UFBA 3EGXB 5L0GA 2GFHA 1M2VB 4K1OA 3NYMA 4E18A 5DQTA 2EPOA 4CSAC 2XLHA 1BR4A 2B0HA 1D0XA 5EK0A 3V7OA 3G4XA 2J9VA 2EPKX 2J9BA 2YKZA 2RD9A 3M1CB 4MS2A 3BRJA 3PMRA 2XXAA 1Q0FA 1T6UA 3AQCA 3U3BA 4Z9JA 3V5XA 2XXAB 4XLPF 2Q9CA 2Z15A 4LDRA 2VB6A 1QKRA 2L7AA 2Y3BA 2R25A 1H9GA 3IEEA 1U89A 1M57C 4NTBA 3RFYA 3SNHA 4BJTA 1ORYA 3IHUA 4FWVA 1MMNA 5DS5A 2P6VA 1OKKA 5A6BA 3JT1A 1JMWA 4I44A 2G3VA 3KYJA 1CPQA 1HW1A 5EGYA 2ETSA 2IOQA 4JTDB 4EKWA 1RKCA 4MVOA 3WG7C 2VC9A 1OCZC 3U3FA 1ZVZA 3EG9A 4D4XA 4JCZA 3EG9B 3Q6MA 4I1MA 3NDBB 5T3TA 2KNHA 3ZC4A 5JP7A 3O39A 2D5RB 3QMKA 4PFPA 2XLDA 3DM5A 1U6HA 4JE9A 5AGFA 3X1OA 3ZQVA 1EKYA 1NZEA 4JKVA 4E17A 3L0IA 5IY5C 2CYDA 4AE4A 2P7VA 2CNWD 4AE4B 1SR2A 2J0XA 2CGEA 1F1MA 2KYHA 1AEPA 3O55A 4JEBA 2MWQA 4JCHA 3TOLA 2YHSA 3ABMC 2EIMC 2YRFA 2JPUA 4PFOA 2KGOA 4Q5SF 1OR2A 1NBBA 4G78A 1Y4CA 2XL8A 4CJOA 3S9OA 4CIHA 4YK5A 2YEVA 2CDQA 2BL2A 2R7VA 3UMKA 1J8MF 4U9EA 3VAYA 4CS7A 3GWLA 4OIOF 3DE8A 2ZXWC 1C03A 3W4YA 3JRMO 4UDVA 1LE4A 1MNEA 3GEHA 4FX5A 1Z63A 3KL4A 3T9OA 2NUPA 3U2LA 2NUPB 3GWNA 5CI8A 1S05A 2JD3A 3U8PA 1SF8A 1M6TA 4H4KC 4K7BA 4QDLA 2OCCC 3K1HA 1G4WR 3C8ZA 3QVZA 4PJLA 2XRHA 1G4US 2R7QA 2P1AA 4NCQA 4ANJA 1TR2A 2WZLA 1YARO 3US6A 4I3MA 3EPVA 4ONSA 3AQBA 3UGPA 3POVA 3EQLF 2IXMA 3FOOA 4XLNF 3UMHA 4WGYA 4YL0A 1JOGA 1HE1A 3ASOC 3SXYA 4U5CE 1A41A 1T6IA 4W8KA 5T1DB 4MQ9F 3SP1A 2DGJA 2HSBA 3AG1C 4IAQA 3T4RA 1EI7A 4ER9A 2R7SA 2Q4FA 2GWWA 4Z9IA 3EFOA 4QI0A 3EHNA 3QZCA 4CDAA 3EFOB 3ZG1A 4DJ9A 3WAQA 5L0FA 3N0TA 5E33A 3B0PA 3GEEA 3ECSA 1T6QA 1KU2A 2HS5A 1VLTA 2XLOA 3JZ0A 4GEHA 4IAOA 2YLDA 4DVZA 2GAQA 4XEKA 3N24A 5B1BC 2IYLD 2R9RB 3W2VA 2KK1A 1ZZPA 5F28E 4EWCA 4U5EE 2WB7A 4P6IC 2VASA 1YAUO 4YWQA 3HNIA 3HNLA 4N6HA 2IXPA 3VM6A 3UR3C 3ITFA 2EINC 2WZGA 5FZTA 2R7OA 4J7TA 2J7PD 5JSLA 2VCBA 4DRJB 5L0CA 2FFHA 3E70C 2AP3A 1C17M 1C02A 1MMDA 1ORSC 3AG3C 3LNMB 3M79A 2AWYA 1L7CA 1S7ZA 4XEVA 2H7BA 2PNOA 3ASNC 2I15A 4GQHA 1H9TA 3EJNA 1TKNA 4DOZA 1Z5ZA 4E7SA 3DMDA 4YT8A 4J32B 3J06A 3K33A 2F22A 3G50A 5EHHA 1NFNA 3KYIA 1ORJA 2C04A 2Q00A 3M4BA 1OKKD 2IXOA 2Q7RA 4BJ1A 5A6BD 2OJED 4G7HF 1JR8A 2VCAA 4XEFA 4U5FE 1K40A 2HUJA 1A7VA 3NYLA 3HJCA 1SZIA 4CBEA 3VF0A 1GQAA 5E2QA 3X2QC 2OEVA 3L8JA 1RCPA 2D4UA 2G3KA 4I1OB 3RH3A 3TK0A 2J0WA 3S84A 4PR9A 4CDVA 2CCYA 3UNGC 1RMVA 1QVXA 2Y3GA 5F5HA 2LP4A 4M63A 4B6IA 5DLJA 1GGQA 1OQCA 2IBFA 4U5DE 1Z6AA 1Q0KA 1PD1A 1ZHTA 1XZPA 3L8IA 1N1CA 2J7PA 3S27A 1K04A 4PJMA 5D92A 4P9TA 2DYRC 4N06A 5KYWA 3RVYA 1BR1A 4MW8A 4FAPB 1AUEA 2XSEA 1A7EA 4CIPA 3ZSUA 4JRZA 1T9KA 4YN0B 3IQTA 5B1AC 5COMA 1SYQA 1KTMA 1QSPA 2W4BA 3GM3A 1L3PA 3NYJA 5CI9A 3KKBA 5GPGB 4CJGA 5JRAA 2Y3DA 3C7JA 5FCLA 1E83A 1GM5A 3GORA 2YLGA 1BR2A 4JTAB 2PP4A 2IM8A 2NSFA 3ATPA 2J8WA 1Q0MA 3MX3A 4Z9HA 5HV9A 2L81A 3CQZA 2Q9BA 3QVYA 2EPLX 2HSQA 5T3WA 2LK4A 1PV3A 4JC7A 1YA9A 2QLAA 2E87A 3B9QA 2HKVA 2W9YA 3NMJA 1ZW3A 4HFKB 4J7YA 2YL7A 2LSEA 3RKOF 1A0BA 4MVSA 3RQGA 4C3DA 4PJNA 1R4TA 2OG2A 2KJGA 3RYLA 2H7OA 3DI5A 2EPNA 1HMDA 3TD7A 1TWGA 1D0ZA 2X51A 4MVUA 2QNLA 5D91A 3A11A 2W45A 4PK4A 3ZWIA 1WATA 5E3CA 3LS0A 4MNDA 4D4NA 3RW0A 1VK5A 1FMWA 1SMYF 4JJFA 3TQOA 5DS4A 2LFFA 3JSEO 5COGA 3ABLC 2FAPB 1VYIA 3A9CA 2ASRA 4RDAA 3S0XA 2G62A 2XLEA 3H65A 256BA 3DJNB 1NU9C 1Q0DA 3F46A 1E86A 3HNJA 2LQGA 3VYWA 1O5HA 2M4EA 3ZTMA 1Q0GA 1Z7Qc 2VH3A 1GS9A 2YQYA 1OW8A 2WL8A 1JPNA 4O6YA 4DBQA 2V3CC 1NU7D 1ZU5A 1EA8A 1I4YA 3C63A 4OD4A 1WGWA 1VOMA 1O3UA 3CEXA 1ZHZA 3Q7LA 4H54A 1WASA 4XWJA 2ZPAA 4C7OA 2R7TA 1LI7A 3G4ZA 1H7IA 5BQIA 5BUOA 3DE9A 4C7OB 3TJ6A 4Q4ZF 1QPUA 2ICWG 2EIJC 2OKUA 1V54C 2QY9A 2XS8A 3FXHA 3GM2A 3IQ5A 4O79A 3NKEA 3TOMA 3ZDLA 5L0JA 3LS1A 2IXNA 3T6BA 1ZHYA 2AVKA 3EH1A 4BPMA 4G7ZF 1CGNA 2P0NA 4JEAA 1FFTC 3CAXA 4YJWA 5A69A 5B3SC 3H2VA 5L0DA 1A7DA 1OXBA 2ZD9A 3AG2C 1TWAA 2QE9A 3AGTA 3PCVA 4KNVA 3V5YA 4FESA 4DRIB 2EIKC 1YJGA 2V26A 1IZMA 3SYNA 3B0VC 5A6KA 3N2ZB 2BE5F 4IARA 2EILC 2KW3C 4AX2A 1OCCC 3UGOA 4MVQA 3ZQYA 2RSEB 4BJ5A 1KNYA 3L34A 3TULA 1WWPA 1CPRA 3RQFA 2A0BA 3AJMA 3SXMA 5JT4A 3V5ZA 1LS1A 3M15A 4OD5A 2PX3A 3L1MA 3MYFA 4IJJA 3WODF 4MTGA 1UG7A 2DYSC 4LDKA 2R7WA 2PBEA 2L6GA 1TWCA 1APCA 2NPUA 3R7CA 4ZLDA 1YYJA 3TJ5A 4DXWA 1BDJB 3H2UA 2J46A 2UUHA 1YZAA 1H6GA 3ABKC 4DVYP 1I5NA 3LUTB 1MMGA 3FAPB 2OEXA 3QTHA 3LEVA 4X0RA 1JAFA 4XTKA 1E85A 3R2PA 3EHMA 3C8GA 4NQFA 1I4ZA 2OOCA 3DWWA 1HE9A 2LCHA 2PF4E 3M4CA 4HFFB 4YT2A 2XLMA 2EPMX 3IQ6A 1LS4A 4P9FA 3B29A 5L0IA 3NKDA 2XL4A 4XPYA 4WJ0A 4KI2A 3IPMO 5TJ5E 4U9DA 3NMKA 4Q7CA 1NG1A 4OINF 4BJ5C 4A2NB 2H8AA 4A4AA 1TQGA 5DS6A 4RBNA 1EQ1A 3UMIA 4OIRF 2L9JA 1DOWA 1BBHA 1M56C 3HTKC 2B0JA 5KYXA 1RJ9A 3K66A 2I8BA 4G7OF 3GEIA 5KYXB 3ZVRA 1YYXA 3K1IA 3KH2A 1AVOB 1YVIA 2PFDA 4YL1A 4GYTA 4ULVA 1FFHA 4N4WA 4AL0A 2C03A 2GA0A 3I4UA 2L6FA 3IQCA 1MMAA 1OW7A 1V4AA 2KSFA 4CX9A 2OJQA 1LM3B 4NTAA 4RD9A 3VRCA 3HLZA 4MTOA 1O87A 1FAPB 1ZU4A 2A1DD 4AK9A 5JS5A 5F5FA 1XWJA 4BEJA 1FR0A 2LFDA 1NSGB 3JYYA 2FGYA 3DKAA 1QQ3A 1VTMP 2Q3TA 3W8IA 5A6JA 3HNKA 4YT4A 4JURI 2HJ3A 5KYNA 2HJMA 3MBGA 2DI3A 2VCCA 3T6JA 4EBKA 2OU6A 2J9WA 3C62A 3SXKA 2XL6A 3ZTZA 2A6EF 4IRUA 2ZXRA 2WVQA 3AOUA 3CSKA 3DM9B 5BQGA 3PDMP 3EZIA 3K1IC 5L3VA 4EHPA 4IGGA 2R7RA 3S90A 1Z23A 1RXQA 2YZSA 1V74B 2QUPA 1BZ4A 3LAYA 4EUKB 4DRHB 3MYIA 2Q9AA 2PX0A 4BJ6A 2JX0A 3K6BA 4O6MA 3W8HA 1PCXA 1VYKA 2YL1A 2HFIA 2OQMA 5JLIA 2AWCA 1MQVA 2MHRA 4U5HA 3C18A 3KPHA 3JRTA 4ULWA 2KQ9A 1CGOA 3SEOA 1E2XA 1PD0A 4J30B 1JPJA 1WTYA 4XQ1A 4HE8D 2ZXOA 2H7VC 4BEMJ 5KYYA 1LPEA 2XM4A 4O6NA 5KYYB 5CIVA 4O7GA 1FTSA 3W2WA 1LVKA 1W2WA 2YLIA 3PHF2 2A69F 1IW7F 3QW0A 1LIHA 1ZYRF 3B71A 4LERA 5DVWA 4U5BE 4C3BA 1YA7O 2NG1A 1G5ZA 2GDCA 1OCOC 2Y3HA 4CS8A 3DAFA 4MW3A 1G8XA 1JRAA 3CZ6A 1T5OA 5K0IA 3NG1A 2TMVP 1VB5A 4WABA 2HMZA 3JSZA 4LACB 2J9UA 2DB4A 3DXJF 2KC3A 1NFOA 2XM0A 2Y39A 4MVRA 2HZ8A 2X0CA 5KYWB 3K7DA 3U2MA 1Z3IX 5JUAA 4EBJA 3C8GD 1D1BA 2WVNA 4F4BA 2P61A 3B0UX 3LNRA 3OWTA 2XLWA 4OIQF 3F47A 3O6XA 1LE2A 1WOLA 4XPXA 3S29A 3Q6NA 1B68A 1MNDA 3U0CA 5B3IA 1D1CA 2MYSA 1XZQA 2R05A 2Y69C 4KC9A 3JYHA 3GANA 3SZRA 3WHNA 3FDQA 2YVKA 3AGUA 4JZAA 1HY5A 4NTFA 4QI2A 2ZXPA 2HMQA 5L0HA 2R7UA 4MTFA 1FMVA 4JJGA 4BJ6C 5A6AA 1T01A 1TFOB 5JVEA 4N6CA 3GM1A 3LLIA 4CS8C 2A68F
chains in the Genus database with same CATH topology
1AEPA 1H7IA 2KC3A 1NFOA 1EQ1A 3S84A 1OR2A 1LPEA 1LE2A 1B68A 1LE4A 1YA9A 3R2PA 1NFNA 1GS9A 1BZ4A 1LS4A 1OR3A 1EA8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AEP A;  1H7I A;  2KC3 A;  1NFO A;  1EQ1 A;  3S84 A;  1OR2 A;  1LPE A;  1LE2 A;  1B68 A;  1LE4 A;  1YA9 A;  3R2P A;  1NFN A;  1GS9 A;  1BZ4 A;  1LS4 A;  1OR3 A;  1EA8 A; 
#chains in the Genus database with same CATH topology
 1OW6 A;  5HSW A;  5KYU A;  3OEO A;  4LLC A;  5KYU B;  4EIY A;  4OIP F;  1QZX A;  2CW0 F;  1ZHW A;  3NMI A;  5AC5 A;  3RQE A;  2WZF A;  1OXK A;  2QTV A;  2YWA A;  3JCU Q;  1HMO A;  2A6H F;  3DAG A;  1R5I D;  1VLS A;  3E9V A;  3FHD A;  2CNW A;  1YLM A;  5AC4 A;  1FNT c;  1QLE C;  4HEA J;  4CS9 A;  3DJU B;  2O9X A;  1OCR C;  4PAC A;  5L3Q A;  1YZC A;  2AU5 A;  1NLX A;  4JIO A;  1J8Y F;  2WVO A;  1VMA A;  4E0H A;  4U5G A;  2YL0 A;  3Q7G A;  1M2O A;  1K05 A;  3C8G B;  3HKK A;  4LLE A;  4IWB A;  3U5S A;  2BC5 A;  1OR3 A;  2LD6 A;  2W4M A;  2XS1 A;  4LDQ A;  1TFK B;  3RVZ A;  1YDI A;  2HV7 A;  3KMI A;  4MVZ A;  4C3E A;  2R03 A;  3GOD A;  3SXZ A;  3AG4 C;  3ZIB A;  4W8P A;  4XPW A;  1U0B B;  1LKX A;  1HW2 A;  3OA1 A;  3U9J A;  3QW1 A;  4AL1 A;  3LJB A;  5E3A A;  3EGD A;  2YL3 A;  4R32 A;  3DD7 A;  3EGD B;  4YL3 A;  3S28 A;  2HV6 A;  1ZHX A;  3MLG A;  1E84 A;  3FOP A;  3RF3 A;  4CSA A;  5BQH A;  4DBR A;  1RJ9 B;  2XLV A;  3RIP A;  4KNW A;  2L6H A;  4WGZ A;  4IB4 A;  2NSG A;  3U8V A;  4YT5 A;  4CS9 C;  4PJJ A;  4L6R A;  2M64 A;  4KBL A;  4BG0 A;  4E0I A;  4E7Z A;  1RKE A;  3LLK A;  4NY3 A;  4EBB A;  4ZLC A;  1RKE B;  3FAJ A;  1WN0 A;  3EH2 A;  3FVY A;  5COF A;  2R02 A;  2LIG A;  1TWH A;  1D1A A;  3BEH A;  3DZA A;  2UUI A;  4JTC B;  4NC3 A;  1D0Y A;  4K0D A;  4CDY A;  1ST6 A;  4JW1 A;  1LI5 A;  3JTL O;  3LES A;  3O10 A;  4MVM A;  3U9M A;  1DOV A;  1V55 C;  1Y6D A;  3I5P A;  2R7X A;  3LEO A;  3NRH A;  5DQZ A;  4G0H A;  2A0U A;  1ZW2 A;  2NUT A;  3FMS A;  1CGM E;  2NUT B;  3MFN A;  3T6G B;  3EZH A;  3EGX A;  3I5Q A;  4JVS A;  1M2V A;  2J45 A;  1UFB A;  3EGX B;  5L0G A;  2GFH A;  1M2V B;  4K1O A;  3NYM A;  4E18 A;  5DQT A;  2EPO A;  4CSA C;  2XLH A;  1BR4 A;  2B0H A;  1D0X A;  5EK0 A;  3V7O A;  3G4X A;  2J9V A;  2EPK X;  2J9B A;  2YKZ A;  2RD9 A;  3M1C B;  4MS2 A;  3BRJ A;  3PMR A;  2XXA A;  1Q0F A;  1T6U A;  3AQC A;  3U3B A;  4Z9J A;  3V5X A;  2XXA B;  4XLP F;  2Q9C A;  2Z15 A;  4LDR A;  2VB6 A;  1QKR A;  2L7A A;  2Y3B A;  2R25 A;  1H9G A;  3IEE A;  1U89 A;  1M57 C;  4NTB A;  3RFY A;  3SNH A;  4BJT A;  1ORY A;  3IHU A;  4FWV A;  1MMN A;  5DS5 A;  2P6V A;  1OKK A;  5A6B A;  3JT1 A;  1JMW A;  4I44 A;  2G3V A;  3KYJ A;  1CPQ A;  1HW1 A;  5EGY A;  2ETS A;  2IOQ A;  4JTD B;  4EKW A;  1RKC A;  4MVO A;  3WG7 C;  2VC9 A;  1OCZ C;  3U3F A;  1ZVZ A;  3EG9 A;  4D4X A;  4JCZ A;  3EG9 B;  3Q6M A;  4I1M A;  3NDB B;  5T3T A;  2KNH A;  3ZC4 A;  5JP7 A;  3O39 A;  2D5R B;  3QMK A;  4PFP A;  2XLD A;  3DM5 A;  1U6H A;  4JE9 A;  5AGF A;  3X1O A;  3ZQV A;  1EKY A;  1NZE A;  4JKV A;  4E17 A;  3L0I A;  5IY5 C;  2CYD A;  4AE4 A;  2P7V A;  2CNW D;  4AE4 B;  1SR2 A;  2J0X A;  2CGE A;  1F1M A;  2KYH A;  1AEP A;  3O55 A;  4JEB A;  2MWQ A;  4JCH A;  3TOL A;  2YHS A;  3ABM C;  2EIM C;  2YRF A;  2JPU A;  4PFO A;  2KGO A;  4Q5S F;  1OR2 A;  1NBB A;  4G78 A;  1Y4C A;  2XL8 A;  4CJO A;  3S9O A;  4CIH A;  4YK5 A;  2YEV A;  2CDQ A;  2BL2 A;  2R7V A;  3UMK A;  1J8M F;  4U9E A;  3VAY A;  4CS7 A;  3GWL A;  4OIO F;  3DE8 A;  2ZXW C;  1C03 A;  3W4Y A;  3JRM O;  4UDV A;  1LE4 A;  1MNE A;  3GEH A;  4FX5 A;  1Z63 A;  3KL4 A;  3T9O A;  2NUP A;  3U2L A;  2NUP B;  3GWN A;  5CI8 A;  1S05 A;  2JD3 A;  3U8P A;  1SF8 A;  1M6T A;  4H4K C;  4K7B A;  4QDL A;  2OCC C;  3K1H A;  1G4W R;  3C8Z A;  3QVZ A;  4PJL A;  2XRH A;  1G4U S;  2R7Q A;  2P1A A;  4NCQ A;  4ANJ A;  1TR2 A;  2WZL A;  1YAR O;  3US6 A;  4I3M A;  3EPV A;  4ONS A;  3AQB A;  3UGP A;  3POV A;  3EQL F;  2IXM A;  3FOO A;  4XLN F;  3UMH A;  4WGY A;  4YL0 A;  1JOG A;  1HE1 A;  3ASO C;  3SXY A;  4U5C E;  1A41 A;  1T6I A;  4W8K A;  5T1D B;  4MQ9 F;  3SP1 A;  2DGJ A;  2HSB A;  3AG1 C;  4IAQ A;  3T4R A;  1EI7 A;  4ER9 A;  2R7S A;  2Q4F A;  2GWW A;  4Z9I A;  3EFO A;  4QI0 A;  3EHN A;  3QZC A;  4CDA A;  3EFO B;  3ZG1 A;  4DJ9 A;  3WAQ A;  5L0F A;  3N0T A;  5E33 A;  3B0P A;  3GEE A;  3ECS A;  1T6Q A;  1KU2 A;  2HS5 A;  1VLT A;  2XLO A;  3JZ0 A;  4GEH A;  4IAO A;  2YLD A;  4DVZ A;  2GAQ A;  4XEK A;  3N24 A;  5B1B C;  2IYL D;  2R9R B;  3W2V A;  2KK1 A;  1ZZP A;  5F28 E;  4EWC A;  4U5E E;  2WB7 A;  4P6I C;  2VAS A;  1YAU O;  4YWQ A;  3HNI A;  3HNL A;  4N6H A;  2IXP A;  3VM6 A;  3UR3 C;  3ITF A;  2EIN C;  2WZG A;  5FZT A;  2R7O A;  4J7T A;  2J7P D;  5JSL A;  2VCB A;  4DRJ B;  5L0C A;  2FFH A;  3E70 C;  2AP3 A;  1C17 M;  1C02 A;  1MMD A;  1ORS C;  3AG3 C;  3LNM B;  3M79 A;  2AWY A;  1L7C A;  1S7Z A;  4XEV A;  2H7B A;  2PNO A;  3ASN C;  2I15 A;  4GQH A;  1H9T A;  3EJN A;  1TKN A;  4DOZ A;  1Z5Z A;  4E7S A;  3DMD A;  4YT8 A;  4J32 B;  3J06 A;  3K33 A;  2F22 A;  3G50 A;  5EHH A;  1NFN A;  3KYI A;  1ORJ A;  2C04 A;  2Q00 A;  3M4B A;  1OKK D;  2IXO A;  2Q7R A;  4BJ1 A;  5A6B D;  2OJE D;  4G7H F;  1JR8 A;  2VCA A;  4XEF A;  4U5F E;  1K40 A;  2HUJ A;  1A7V A;  3NYL A;  3HJC A;  1SZI A;  4CBE A;  3VF0 A;  1GQA A;  5E2Q A;  3X2Q C;  2OEV A;  3L8J A;  1RCP A;  2D4U A;  2G3K A;  4I1O B;  3RH3 A;  3TK0 A;  2J0W A;  3S84 A;  4PR9 A;  4CDV A;  2CCY A;  3UNG C;  1RMV A;  1QVX A;  2Y3G A;  5F5H A;  2LP4 A;  4M63 A;  4B6I A;  5DLJ A;  1GGQ A;  1OQC A;  2IBF A;  4U5D E;  1Z6A A;  1Q0K A;  1PD1 A;  1ZHT A;  1XZP A;  3L8I A;  1N1C A;  2J7P A;  3S27 A;  1K04 A;  4PJM A;  5D92 A;  4P9T A;  2DYR C;  4N06 A;  5KYW A;  3RVY A;  1BR1 A;  4MW8 A;  4FAP B;  1AUE A;  2XSE A;  1A7E A;  4CIP A;  3ZSU A;  4JRZ A;  1T9K A;  4YN0 B;  3IQT A;  5B1A C;  5COM A;  1SYQ A;  1KTM A;  1QSP A;  2W4B A;  3GM3 A;  1L3P A;  3NYJ A;  5CI9 A;  3KKB A;  5GPG B;  4CJG A;  5JRA A;  2Y3D A;  3C7J A;  5FCL A;  1E83 A;  1GM5 A;  3GOR A;  2YLG A;  1BR2 A;  4JTA B;  2PP4 A;  2IM8 A;  2NSF A;  3ATP A;  2J8W A;  1Q0M A;  3MX3 A;  4Z9H A;  5HV9 A;  2L81 A;  3CQZ A;  2Q9B A;  3QVY A;  2EPL X;  2HSQ A;  5T3W A;  2LK4 A;  1PV3 A;  4JC7 A;  1YA9 A;  2QLA A;  2E87 A;  3B9Q A;  2HKV A;  2W9Y A;  3NMJ A;  1ZW3 A;  4HFK B;  4J7Y A;  2YL7 A;  2LSE A;  3RKO F;  1A0B A;  4MVS A;  3RQG A;  4C3D A;  4PJN A;  1R4T A;  2OG2 A;  2KJG A;  3RYL A;  2H7O A;  3DI5 A;  2EPN A;  1HMD A;  3TD7 A;  1TWG A;  1D0Z A;  2X51 A;  4MVU A;  2QNL A;  5D91 A;  3A11 A;  2W45 A;  4PK4 A;  3ZWI A;  1WAT A;  5E3C A;  3LS0 A;  4MND A;  4D4N A;  3RW0 A;  1VK5 A;  1FMW A;  1SMY F;  4JJF A;  3TQO A;  5DS4 A;  2LFF A;  3JSE O;  5COG A;  3ABL C;  2FAP B;  1VYI A;  3A9C A;  2ASR A;  4RDA A;  3S0X A;  2G62 A;  2XLE A;  3H65 A;  256B A;  3DJN B;  1NU9 C;  1Q0D A;  3F46 A;  1E86 A;  3HNJ A;  2LQG A;  3VYW A;  1O5H A;  2M4E A;  3ZTM A;  1Q0G A;  1Z7Q c;  2VH3 A;  1GS9 A;  2YQY A;  1OW8 A;  2WL8 A;  1JPN A;  4O6Y A;  4DBQ A;  2V3C C;  1NU7 D;  1ZU5 A;  1EA8 A;  1I4Y A;  3C63 A;  4OD4 A;  1WGW A;  1VOM A;  1O3U A;  3CEX A;  1ZHZ A;  3Q7L A;  4H54 A;  1WAS A;  4XWJ A;  2ZPA A;  4C7O A;  2R7T A;  1LI7 A;  3G4Z A;  1H7I A;  5BQI A;  5BUO A;  3DE9 A;  4C7O B;  3TJ6 A;  4Q4Z F;  1QPU A;  2ICW G;  2EIJ C;  2OKU A;  1V54 C;  2QY9 A;  2XS8 A;  3FXH A;  3GM2 A;  3IQ5 A;  4O79 A;  3NKE A;  3TOM A;  3ZDL A;  5L0J A;  3LS1 A;  2IXN A;  3T6B A;  1ZHY A;  2AVK A;  3EH1 A;  4BPM A;  4G7Z F;  1CGN A;  2P0N A;  4JEA A;  1FFT C;  3CAX A;  4YJW A;  5A69 A;  5B3S C;  3H2V A;  5L0D A;  1A7D A;  1OXB A;  2ZD9 A;  3AG2 C;  1TWA A;  2QE9 A;  3AGT A;  3PCV A;  4KNV A;  3V5Y A;  4FES A;  4DRI B;  2EIK C;  1YJG A;  2V26 A;  1IZM A;  3SYN A;  3B0V C;  5A6K A;  3N2Z B;  2BE5 F;  4IAR A;  2EIL C;  2KW3 C;  4AX2 A;  1OCC C;  3UGO A;  4MVQ A;  3ZQY A;  2RSE B;  4BJ5 A;  1KNY A;  3L34 A;  3TUL A;  1WWP A;  1CPR A;  3RQF A;  2A0B A;  3AJM A;  3SXM A;  5JT4 A;  3V5Z A;  1LS1 A;  3M15 A;  4OD5 A;  2PX3 A;  3L1M A;  3MYF A;  4IJJ A;  3WOD F;  4MTG A;  1UG7 A;  2DYS C;  4LDK A;  2R7W A;  2PBE A;  2L6G A;  1TWC A;  1APC A;  2NPU A;  3R7C A;  4ZLD A;  1YYJ A;  3TJ5 A;  4DXW A;  1BDJ B;  3H2U A;  2J46 A;  2UUH A;  1YZA A;  1H6G A;  3ABK C;  4DVY P;  1I5N A;  3LUT B;  1MMG A;  3FAP B;  2OEX A;  3QTH A;  3LEV A;  4X0R A;  1JAF A;  4XTK A;  1E85 A;  3R2P A;  3EHM A;  3C8G A;  4NQF A;  1I4Z A;  2OOC A;  3DWW A;  1HE9 A;  2LCH A;  2PF4 E;  3M4C A;  4HFF B;  4YT2 A;  2XLM A;  2EPM X;  3IQ6 A;  1LS4 A;  4P9F A;  3B29 A;  5L0I A;  3NKD A;  2XL4 A;  4XPY A;  4WJ0 A;  4KI2 A;  3IPM O;  5TJ5 E;  4U9D A;  3NMK A;  4Q7C A;  1NG1 A;  4OIN F;  4BJ5 C;  4A2N B;  2H8A A;  4A4A A;  1TQG A;  5DS6 A;  4RBN A;  1EQ1 A;  3UMI A;  4OIR F;  2L9J A;  1DOW A;  1BBH A;  1M56 C;  3HTK C;  2B0J A;  5KYX A;  1RJ9 A;  3K66 A;  2I8B A;  4G7O F;  3GEI A;  5KYX B;  3ZVR A;  1YYX A;  3K1I A;  3KH2 A;  1AVO B;  1YVI A;  2PFD A;  4YL1 A;  4GYT A;  4ULV A;  1FFH A;  4N4W A;  4AL0 A;  2C03 A;  2GA0 A;  3I4U A;  2L6F A;  3IQC A;  1MMA A;  1OW7 A;  1V4A A;  2KSF A;  4CX9 A;  2OJQ A;  1LM3 B;  4NTA A;  4RD9 A;  3VRC A;  3HLZ A;  4MTO A;  1O87 A;  1FAP B;  1ZU4 A;  2A1D D;  4AK9 A;  5JS5 A;  5F5F A;  1XWJ A;  4BEJ A;  1FR0 A;  2LFD A;  1NSG B;  3JYY A;  2FGY A;  3DKA A;  1QQ3 A;  1VTM P;  2Q3T A;  3W8I A;  5A6J A;  3HNK A;  4YT4 A;  4JUR I;  2HJ3 A;  5KYN A;  2HJM A;  3MBG A;  2DI3 A;  2VCC A;  3T6J A;  4EBK A;  2OU6 A;  2J9W A;  3C62 A;  3SXK A;  2XL6 A;  3ZTZ A;  2A6E F;  4IRU A;  2ZXR A;  2WVQ A;  3AOU A;  3CSK A;  3DM9 B;  5BQG A;  3PDM P;  3EZI A;  3K1I C;  5L3V A;  4EHP A;  4IGG A;  2R7R A;  3S90 A;  1Z23 A;  1RXQ A;  2YZS A;  1V74 B;  2QUP A;  1BZ4 A;  3LAY A;  4EUK B;  4DRH B;  3MYI A;  2Q9A A;  2PX0 A;  4BJ6 A;  2JX0 A;  3K6B A;  4O6M A;  3W8H A;  1PCX A;  1VYK A;  2YL1 A;  2HFI A;  2OQM A;  5JLI A;  2AWC A;  1MQV A;  2MHR A;  4U5H A;  3C18 A;  3KPH A;  3JRT A;  4ULW A;  2KQ9 A;  1CGO A;  3SEO A;  1E2X A;  1PD0 A;  4J30 B;  1JPJ A;  1WTY A;  4XQ1 A;  4HE8 D;  2ZXO A;  2H7V C;  4BEM J;  5KYY A;  1LPE A;  2XM4 A;  4O6N A;  5KYY B;  5CIV A;  4O7G A;  1FTS A;  3W2W A;  1LVK A;  1W2W A;  2YLI A;  3PHF 2;  2A69 F;  1IW7 F;  3QW0 A;  1LIH A;  1ZYR F;  3B71 A;  4LER A;  5DVW A;  4U5B E;  4C3B A;  1YA7 O;  2NG1 A;  1G5Z A;  2GDC A;  1OCO C;  2Y3H A;  4CS8 A;  3DAF A;  4MW3 A;  1G8X A;  1JRA A;  3CZ6 A;  1T5O A;  5K0I A;  3NG1 A;  2TMV P;  1VB5 A;  4WAB A;  2HMZ A;  3JSZ A;  4LAC B;  2J9U A;  2DB4 A;  3DXJ F;  2KC3 A;  1NFO A;  2XM0 A;  2Y39 A;  4MVR A;  2HZ8 A;  2X0C A;  5KYW B;  3K7D A;  3U2M A;  1Z3I X;  5JUA A;  4EBJ A;  3C8G D;  1D1B A;  2WVN A;  4F4B A;  2P61 A;  3B0U X;  3LNR A;  3OWT A;  2XLW A;  4OIQ F;  3F47 A;  3O6X A;  1LE2 A;  1WOL A;  4XPX A;  3S29 A;  3Q6N A;  1B68 A;  1MND A;  3U0C A;  5B3I A;  1D1C A;  2MYS A;  1XZQ A;  2R05 A;  2Y69 C;  4KC9 A;  3JYH A;  3GAN A;  3SZR A;  3WHN A;  3FDQ A;  2YVK A;  3AGU A;  4JZA A;  1HY5 A;  4NTF A;  4QI2 A;  2ZXP A;  2HMQ A;  5L0H A;  2R7U A;  4MTF A;  1FMV A;  4JJG A;  4BJ6 C;  5A6A A;  1T01 A;  1TFO B;  5JVE A;  4N6C A;  3GM1 A;  3LLI A;  4CS8 C;  2A68 F; 
#chains in the Genus database with same CATH homology
 1AEP A;  1H7I A;  2KC3 A;  1NFO A;  1EQ1 A;  3S84 A;  1OR2 A;  1LPE A;  1LE2 A;  1B68 A;  1LE4 A;  1YA9 A;  3R2P A;  1NFN A;  1GS9 A;  1BZ4 A;  1LS4 A;  1OR3 A;  1EA8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...