1NFOA

Apolipoprotein e2 (apoe2, d154a mutation)
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
141
structure length
131
Chain Sequence
GQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQRLSKELQAAQARLGADMEDVCGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADALQKCLAVYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Novel mechanism for defective receptor binding of apolipoprotein E2 in type III hyperlipoproteinemia.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lipid transport
molecule keywords APOLIPOPROTEIN E2
total genus 61
structure length 131
sequence length 141
ec nomenclature
pdb deposition date 1996-07-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.20 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Apolipoprotein 1nfoA00
1LE4A 1AEPA 1GS9A 1NFOA 1OR3A 1YA9A 1BZ4A 1B68A 2KC3A 3S84A 1EA8A 1LS4A 3R2PA 1EQ1A 1H7IA 1LPEA 1LE2A 1OR2A 1NFNA
chains in the Genus database with same CATH superfamily
1VYIA 3T9OA 2PX0A 3UR3C 1MNDA 2VH3A 2V26A 4QDLA 5KYNA 1J8MF 1FAPB 2PNOA 4NTBA 4WJ0A 3AOUA 3PHF2 3L1MA 4ANJA 4K7BA 1GS9A 2YKZA 3ZDLA 3OA1A 4KBLA 1PCXA 2LFDA 1VB5A 1C02A 3QW0A 1R5ID 5JSLA 2XL4A 2R03A 4EIYA 1CGME 4KI2A 2P1AA 3AG4C 4H54A 4C3BA 2EIMC 1NU9C 1ORJA 1YZCA 1KNYA 3S29A 3L8JA 3V5XA 3LS0A 1BDJB 3VM6A 5B3IA 2UUIA 1V74B 4OINF 4CJOA 1TWCA 3SEOA 3SYNA 3K66A 4MS2A 4MQ9F 2KK1A 1BR1A 1FFTC 1ZW2A 2BL2A 2HMQA 2J45A 4ULVA 3WG7C 1WN0A 4U5FE 4WGYA 4GYTA 3EHNA 4G7OF 3QZCA 2R7XA 1G4WR 3I4UA 3VAYA 1RKCA 3JCUQ 4J7TA 2GA0A 4CDAA 1N1CA 4JTDB 2H7OA 1M2OA 1QPUA 1W2WA 3L34A 5E3CA 2MWQA 4U5BE 1U6HA 1WWPA 5E2QA 3RVYA 3NMIA 3TJ6A 5KYYB 3GEEA 1G4US 2R25A 3UMIA 3C8GA 3ZQYA 1YVIA 2YRFA 3DM9B 4JZAA 3NYJA 4MNDA 1APCA 1XZQA 3M15A 1Q0DA 1Z63A 1OCZC 4E0HA 3AQBA 1OCRC 4KNVA 1CGOA 4O6MA 1OCCC 2GWWA 3O6XA 2OG2A 3B9QA 1E2XA 3B0PA 3C8GD 3JRMO 1Q0KA 4O6NA 4A2NB 1M6TA 3E70C 1FTSA 2EPNA 1T01A 2IYLD 4XEVA 4BEJA 1RMVA 2J9WA 1M2VB 2HS5A 3I5PA 4NQFA 2EPOA 1QLEC 1OKKA 1NFNA 3GWLA 5JT4A 1SF8A 1AUEA 3GORA 3K1HA 3M4BA 2X0CA 3AJMA 3SZRA 1YLMA 4DXWA 3EFOA 5L0GA 3UNGC 1K40A 2E87A 2LFFA 2YL0A 3LS1A 3DXJF 4LACB 2WB7A 1QVXA 3TK0A 1LS4A 2XXAA 2JD3A 2M4EA 2VB6A 1ZHYA 4YL0A 3HJCA 3VF0A 2XXAB 4ZLCA 1F1MA 1I4ZA 2CNWD 1LVKA 3KMIA 2EPLX 3HNJA 1CPQA 3LJBA 3N2ZB 1TQGA 1V55C 1JMWA 2YL7A 2I15A 3B0VC 2CNWA 2XRHA 1NG1A 3HTKC 4LLEA 4OIPF 4JCZA 1OXBA 1RJ9A 3QVZA 3R2PA 2CW0F 4BJ5A 1TWAA 3FDQA 5A6KA 2CDQA 1C17M 5AC5A 2HJMA 2XSEA 1C03A 3UMHA 5IY5C 4K1OA 3K1IA 5F5FA 4IAOA 3Q6NA 4O7GA 4IAQA 2DGJA 2W4BA 2Y3BA 3C18A 2R7UA 5JUAA 4N6CA 3FOPA 4EUKB 1YA9A 4IB4A 5KYXA 1H6GA 1JAFA 2PBEA 2AU5A 4G0HA 4JC7A 5L0FA 4ER9A 4PK4A 2G62A 3L8IA 2QLAA 4XTKA 3Q7LA 1HE9A 3K1IC 2HKVA 1D0YA 2ASRA 1OR3A 4AE4B 4E17A 5BQHA 3NRHA 2NUTA 3DWWA 4DBRA 2DI3A 3EPVA 2P0NA 3G50A 1I4YA 2I8BA 4MW3A 1ORSC 3CZ6A 2JX0A 4MVQA 2J0XA 4JTCB 5JLIA 2EPKX 1NZEA 3FXHA 3M4CA 3EGDA 5EK0A 5KYUA 1CGNA 5BQGA 2V3CC 4E0IA 2YHSA 4DVYP 1PD0A 3KH2A 3JZ0A 1D1AA 3KKBA 1QZXA 1OW8A 3NMKA 3LNRA 2AWCA 3CAXA 1LE2A 2PX3A 5B1BC 4CX9A 1RKEB 2ZXRA 4GQHA 3T4RA 5COFA 1BZ4A 5KYWB 2Y69C 4ULWA 1D1BA 2IXPA 3LLKA 3TD7A 1UFBA 2B0JA 3GANA 4YL3A 3EQLF 1SR2A 4J32B 5HV9A 1B68A 2NUPA 1OQCA 3AGTA 3LUTB 2VC9A 1U89A 3EGXA 2LSEA 4N4WA 1O5HA 2MHRA 3ASOC 5T1DB 1VLTA 2GFHA 3A9CA 3J06A 5L0CA 1EKYA 4YWQA 2YQYA 2BC5A 4M63A 1XZPA 3WHNA 3ZVRA 4L6RA 1ST6A 1K04A 1QKRA 3U8PA 4JW1A 4I1MA 2HSQA 3K6BA 5GPGB 4XQ1A 5FCLA 3O55A 3GM1A 2AP3A 5DVWA 4U9EA 3RIPA 1RXQA 5B3SC 2LIGA 3EG9B 5L0JA 1GQAA 3ZIBA 3SXZA 3HLZA 1VMAA 2ICWG 4XLPF 1U0BB 2G3VA 4BJTA 2X51A 1ZHTA 2KSFA 4PJLA 3PMRA 4XPWA 256BA 2CYDA 4H4KC 4ONSA 2AWYA 1ZU4A 3IHUA 3S0XA 2J8WA 5AC4A 5F28E 4PJJA 4BJ5C 3K7DA 2KGOA 2D4UA 2FFHA 3JTLO 2Q00A 4XEFA 3UMKA 1E83A 4JTAB 1Q0MA 2KJGA 3FHDA 3MLGA 5L0IA 3S28A 2OOCA 3RFYA 1MQVA 2YEVA 3O39A 2PFDA 4LLCA 5DS6A 1KTMA 1VLSA 4JE9A 1PD1A 2WL8A 3NYMA 3LESA 1M56C 5A69A 1A7VA 3GM3A 1Z7Qc 4U5EE 5COGA 3ZG1A 4WGZA 5JS5A 2R7TA 2WZFA 5A6JA 4LDKA 3W4YA 3FAPB 1VOMA 4FAPB 4CBEA 1YARO 3W8IA 3ZC4A 4YK5A 3OWTA 3RQFA 4R32A 1I5NA 4YL1A 3V5ZA 4YT8A 4PFOA 2LD6A 3IQTA 1A0BA 4C3DA 4NCQA 3PCVA 2VCBA 3BRJA 4IJJA 3WAQA 3KYIA 3EG9A 2W9YA 4IARA 3QVYA 5DLJA 4DRJB 1Y6DA 4W8PA 1WASA 5E33A 4B6IA 2J46A 4E18A 3AG1C 2C04A 1O87A 3C7JA 4PJNA 3X1OA 1GGQA 2KNHA 3IQCA 3EGXB 3X2QC 1HW2A 4XEKA 2H7VC 3SXKA 4G7HF 1OW6A 3NYLA 4MVSA 1T9KA 2IBFA 3U9MA 2C03A 1AEPA 3ABLC 4BEMJ 3JT1A 4RBNA 4XWJA 2Z15A 2P6VA 3HNKA 4CDVA 5HSWA 1VYKA 1LPEA 5COMA 4D4NA 1Q0GA 2XLEA 1BBHA 3DMDA 4NY3A 2ZXPA 4D4XA 5A6BD 3U9JA 3CSKA 3PDMP 2W45A 1UG7A 2ZXWC 4YN0B 2XLMA 2R7RA 1HMOA 2KW3C 2A68F 3SP1A 3TJ5A 3AG3C 3JSEO 3EGDB 1ZHZA 5DQZA 3M1CB 1T6QA 5BQIA 3RW0A 2XM4A 2WVOA 2Y3HA 1MMGA 1H7IA 3U3BA 1FFHA 4U9DA 5L3VA 2OKUA 2XM0A 1G5ZA 2EINC 3JRTA 3B0UX 5L0DA 4ZLDA 4CS8C 3C62A 4BG0A 1WGWA 3W2WA 5L0HA 1Y4CA 3GODA 2HJ3A 4MVUA 1LS1A 2YWAA 4WABA 2WZLA 2RSEB 3TOLA 5T3TA 2YZSA 1WTYA 2PF4E 4JURI 4CS8A 2P7VA 4AK9A 1PV3A 2H8AA 2Y39A 3G4XA 3NMJA 4OIRF 1GM5A 3LEOA 3U5SA 4OIQF 5BUOA 3NDBB 4XLNF 1NU7D 4JKVA 4IGGA 3ZWIA 4XPXA 1TFKB 4RD9A 1BR4A 2XS1A 1A41A 1ZU5A 3QMKA 4FWVA 4JEAA 5JP7A 3RF3A 1RKEA 4CSAC 3ABMC 1WOLA 1K05A 2L6FA 2LP4A 4CIPA 4EBJA 4I44A 1JPJA 2YLGA 3AQCA 4U5GA 2L9JA 3S90A 3TQOA 3EZHA 3T6GB 2GDCA 2L6HA 2ZXOA 2R9RB 3DAGA 3IPMO 2UUHA 3U2LA 1XWJA 2BE5F 2A0BA 3FMSA 3W8HA 3ZQVA 5KYXB 2G3KA 4MW8A 1D0ZA 4AX2A 4NTAA 3QW1A 3S9OA 4GEHA 2ZPAA 4QI0A 1NBBA 4UDVA 4O79A 3FVYA 3ZTZA 4I3MA 4EHPA 2YL3A 3DJNB 1TWHA 4Q5SF 2Q3TA 4LDRA 1YZAA 3G4ZA 2H7BA 1FMWA 1LM3B 5FZTA 4DRIB 3JYYA 4P6IC 5A6BA 3AGUA 1D1CA 1Z23A 2XS8A 3N0TA 4O6YA 4Z9HA 5L3QA 1QQ3A 3Q6MA 1TR2A 3A11A 3KL4A 3FAJA 2NG1A 3EFOB 3NKDA 4JRZA 2MYSA 2DYSC 3RH3A 2Y3DA 1L7CA 3MFNA 3K33A 2L7AA 1RJ9B 1MMAA 3JSZA 3LLIA 4E7SA 3UGPA 4J30B 2IM8A 4RDAA 2A0UA 3ASNC 3DI5A 1J8YF 2HV7A 4C7OB 1V4AA 5JRAA 2IXMA 1JPNA 1O3UA 5K0IA 1EI7A 3M79A 4DBQA 3TULA 1ZVZA 4IWBA 4OIOF 3CEXA 2XLDA 2Y3GA 3TOMA 2JPUA 2O9XA 1HY5A 4FX5A 3MBGA 3ABKC 3F47A 1Q0FA 3IQ5A 2L6GA 3F46A 4HFFB 3RKOF 2J7PA 2AVKA 2TMVP 2KQ9A 2R7SA 3IEEA 1FR0A 1LI5A 4MVZA 4DRHB 4CDYA 1EQ1A 5CI9A 3WODF 2B0HA 1YAUO 1V54C 2PP4A 2R7VA 2IXOA 1TKNA 3U0CA 2R05A 1M2VA 3VRCA 3EH1A 1JRAA 1IZMA 1IW7F 3H65A 3HNLA 5CIVA 2D5RB 1S05A 3GM2A 1HMDA 4DJ9A 2OEXA 3S27A 2LCHA 4U5HA 5KYYA 3POVA 5AGFA 4U5DE 3FOOA 4Z9IA 5DS4A 1JR8A 2A69F 2A1DD 1CPRA 5DS5A 3EJNA 2OQMA 3EZIA 2LQGA 3DZAA 4PR9A 3MYIA 4A4AA 3SXMA 2FGYA 3Q7GA 1EA8A 4OD4A 1AVOB 1MMNA 1LKXA 4Z9JA 1T5OA 2NSGA 3I5QA 4BJ6C 1VTMP 2J9UA 5KYWA 3AG2C 3DM5A 2IOQA 4HE8D 1HW1A 4G78A 2OCCC 1MNEA 1VK5A 3BEHA 2EPMX 1SMYF 1KU2A 2F22A 3C8GB 4JJGA 4W8KA 1LE4A 3HKKA 3SNHA 3MYFA 4EKWA 2RD9A 3ITFA 1RCPA 4AL1A 3GWNA 3C8ZA 1WATA 4I1OB 2Q9CA 1ORYA 1A7EA 4NC3A 2WZGA 2CGEA 1YYXA 4DVZA 4CSAA 1DOWA 1FNTc 3RYLA 1TWGA 2LK4A 2M64A 3V5YA 1ZYRF 2GAQA 5D92A 1LIHA 2P61A 1ZW3A 3DJUB 4N6HA 1FMVA 1ZZPA 2QY9A 4N06A 2DB4A 2W4MA 3HNIA 2A6HF 2Q4FA 1E84A 3NKEA 5F5HA 1D0XA 4E7ZA 1S7ZA 4LDQA 4BJ6A 2KYHA 4F4BA 4CJGA 5EGYA 3T6JA 1ZHWA 4BPMA 4Q7CA 4FESA 4YT4A 2XLOA 2NUPB 4PACA 5D91A 2XLHA 5DQTA 1YA7O 4EWCA 1NLXA 3EH2A 3B71A 3EHMA 1YDIA 3DKAA 1L3PA 4P9FA 1SZIA 4JCHA 5EHHA 3NG1A 5JVEA 3LNMB 4AE4A 2WVQA 1QSPA 3LAYA 5CI8A 3JYHA 3U3FA 2KC3A 2FAPB 2QTVA 3H2VA 4OD5A 3ZTMA 1T6UA 3DE8A 2WVNA 2HSBA 1Z3IX 2XL8A 4MTGA 1T6IA 2NUTB 3T6BA 2DYRC 1BR2A 4YJWA 1NFOA 4PFPA 3VYWA 2QE9A 1G8XA 4DOZA 5KYUB 2J9BA 4CS7A 2A6EF 2OEVA 4X0RA 4JVSA 4CS9A 3UGOA 4MVOA 3L0IA 3S84A 1DOVA 2Q7RA 4Q4ZF 4NTFA 4PJMA 3RVZA 1E86A 4U5CE 2Q9AA 3O10A 1MMDA 2HV6A 4MVMA 4G7ZF 1OCOC 3ZSUA 1H9GA 2VCAA 1TFOB 3H2UA 3DD7A 1LI7A 3R7CA 2Q9BA 2J0WA 1Z5ZA 2J7PD 2CCYA 3W2VA 3DE9A 2NPUA 4KNWA 1YJGA 4MTOA 4YT5A 3QTHA 1H9TA 4MTFA 2XLWA 5B1AC 2OU6A 2YLDA 2HMZA 2R7QA 4P9TA 2OJED 3E9VA 3RQEA 4IRUA 3B29A 4C7OA 4EBKA 2R7OA 3KYJA 3MX3A 1R4TA 2NSFA 1OXKA 2YL1A 1OW7A 2OJQA 1SYQA 4JEBA 4MVRA 2YLIA 5E3AA 1NSGB 1OR2A 2HFIA 2QUPA 2R02A 4HFKB 4J7YA 5T3WA 4KC9A 3C63A 3RQGA 3U2MA 3U8VA 4CS9C 1Z6AA 1M57C 4HEAJ 1ZHXA 2VCCA 3US6A 2XL6A 3LEVA 4XPYA 2L81A 4JIOA 2EIKC 2YVKA 4QI2A 4YT2A 3N24A 3GEHA 2ZD9A 2HZ8A 2J9VA 1HE1A 3OEOA 3CQZA 4K0DA 5TJ5E 4C3EA 3KPHA 3ECSA 3IQ6A 3V7OA 4JJFA 2VASA 4EBBA 1A7DA 1E85A 1YYJA 2IXNA 2ETSA 4LERA 4AL0A 2HUJA 3SXYA 1OKKD 1JOGA 4BJ1A 4CIHA 5A6AA 2EILC 3ATPA 2EIJC 2QNLA 3DAFA 2XLVA 3GEIA 2R7WA
chains in the Genus database with same CATH topology
1LE4A 1AEPA 1GS9A 1NFOA 1OR3A 1YA9A 1BZ4A 1B68A 2KC3A 3S84A 1EA8A 1LS4A 3R2PA 1EQ1A 1H7IA 1LPEA 1LE2A 1OR2A 1NFNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LE4 A;  1AEP A;  1GS9 A;  1NFO A;  1OR3 A;  1YA9 A;  1BZ4 A;  1B68 A;  2KC3 A;  3S84 A;  1EA8 A;  1LS4 A;  3R2P A;  1EQ1 A;  1H7I A;  1LPE A;  1LE2 A;  1OR2 A;  1NFN A; 
#chains in the Genus database with same CATH topology
 1VYI A;  3T9O A;  2PX0 A;  3UR3 C;  1MND A;  2VH3 A;  2V26 A;  4QDL A;  5KYN A;  1J8M F;  1FAP B;  2PNO A;  4NTB A;  4WJ0 A;  3AOU A;  3PHF 2;  3L1M A;  4ANJ A;  4K7B A;  1GS9 A;  2YKZ A;  3ZDL A;  3OA1 A;  4KBL A;  1PCX A;  2LFD A;  1VB5 A;  1C02 A;  3QW0 A;  1R5I D;  5JSL A;  2XL4 A;  2R03 A;  4EIY A;  1CGM E;  4KI2 A;  2P1A A;  3AG4 C;  4H54 A;  4C3B A;  2EIM C;  1NU9 C;  1ORJ A;  1YZC A;  1KNY A;  3S29 A;  3L8J A;  3V5X A;  3LS0 A;  1BDJ B;  3VM6 A;  5B3I A;  2UUI A;  1V74 B;  4OIN F;  4CJO A;  1TWC A;  3SEO A;  3SYN A;  3K66 A;  4MS2 A;  4MQ9 F;  2KK1 A;  1BR1 A;  1FFT C;  1ZW2 A;  2BL2 A;  2HMQ A;  2J45 A;  4ULV A;  3WG7 C;  1WN0 A;  4U5F E;  4WGY A;  4GYT A;  3EHN A;  4G7O F;  3QZC A;  2R7X A;  1G4W R;  3I4U A;  3VAY A;  1RKC A;  3JCU Q;  4J7T A;  2GA0 A;  4CDA A;  1N1C A;  4JTD B;  2H7O A;  1M2O A;  1QPU A;  1W2W A;  3L34 A;  5E3C A;  2MWQ A;  4U5B E;  1U6H A;  1WWP A;  5E2Q A;  3RVY A;  3NMI A;  3TJ6 A;  5KYY B;  3GEE A;  1G4U S;  2R25 A;  3UMI A;  3C8G A;  3ZQY A;  1YVI A;  2YRF A;  3DM9 B;  4JZA A;  3NYJ A;  4MND A;  1APC A;  1XZQ A;  3M15 A;  1Q0D A;  1Z63 A;  1OCZ C;  4E0H A;  3AQB A;  1OCR C;  4KNV A;  1CGO A;  4O6M A;  1OCC C;  2GWW A;  3O6X A;  2OG2 A;  3B9Q A;  1E2X A;  3B0P A;  3C8G D;  3JRM O;  1Q0K A;  4O6N A;  4A2N B;  1M6T A;  3E70 C;  1FTS A;  2EPN A;  1T01 A;  2IYL D;  4XEV A;  4BEJ A;  1RMV A;  2J9W A;  1M2V B;  2HS5 A;  3I5P A;  4NQF A;  2EPO A;  1QLE C;  1OKK A;  1NFN A;  3GWL A;  5JT4 A;  1SF8 A;  1AUE A;  3GOR A;  3K1H A;  3M4B A;  2X0C A;  3AJM A;  3SZR A;  1YLM A;  4DXW A;  3EFO A;  5L0G A;  3UNG C;  1K40 A;  2E87 A;  2LFF A;  2YL0 A;  3LS1 A;  3DXJ F;  4LAC B;  2WB7 A;  1QVX A;  3TK0 A;  1LS4 A;  2XXA A;  2JD3 A;  2M4E A;  2VB6 A;  1ZHY A;  4YL0 A;  3HJC A;  3VF0 A;  2XXA B;  4ZLC A;  1F1M A;  1I4Z A;  2CNW D;  1LVK A;  3KMI A;  2EPL X;  3HNJ A;  1CPQ A;  3LJB A;  3N2Z B;  1TQG A;  1V55 C;  1JMW A;  2YL7 A;  2I15 A;  3B0V C;  2CNW A;  2XRH A;  1NG1 A;  3HTK C;  4LLE A;  4OIP F;  4JCZ A;  1OXB A;  1RJ9 A;  3QVZ A;  3R2P A;  2CW0 F;  4BJ5 A;  1TWA A;  3FDQ A;  5A6K A;  2CDQ A;  1C17 M;  5AC5 A;  2HJM A;  2XSE A;  1C03 A;  3UMH A;  5IY5 C;  4K1O A;  3K1I A;  5F5F A;  4IAO A;  3Q6N A;  4O7G A;  4IAQ A;  2DGJ A;  2W4B A;  2Y3B A;  3C18 A;  2R7U A;  5JUA A;  4N6C A;  3FOP A;  4EUK B;  1YA9 A;  4IB4 A;  5KYX A;  1H6G A;  1JAF A;  2PBE A;  2AU5 A;  4G0H A;  4JC7 A;  5L0F A;  4ER9 A;  4PK4 A;  2G62 A;  3L8I A;  2QLA A;  4XTK A;  3Q7L A;  1HE9 A;  3K1I C;  2HKV A;  1D0Y A;  2ASR A;  1OR3 A;  4AE4 B;  4E17 A;  5BQH A;  3NRH A;  2NUT A;  3DWW A;  4DBR A;  2DI3 A;  3EPV A;  2P0N A;  3G50 A;  1I4Y A;  2I8B A;  4MW3 A;  1ORS C;  3CZ6 A;  2JX0 A;  4MVQ A;  2J0X A;  4JTC B;  5JLI A;  2EPK X;  1NZE A;  3FXH A;  3M4C A;  3EGD A;  5EK0 A;  5KYU A;  1CGN A;  5BQG A;  2V3C C;  4E0I A;  2YHS A;  4DVY P;  1PD0 A;  3KH2 A;  3JZ0 A;  1D1A A;  3KKB A;  1QZX A;  1OW8 A;  3NMK A;  3LNR A;  2AWC A;  3CAX A;  1LE2 A;  2PX3 A;  5B1B C;  4CX9 A;  1RKE B;  2ZXR A;  4GQH A;  3T4R A;  5COF A;  1BZ4 A;  5KYW B;  2Y69 C;  4ULW A;  1D1B A;  2IXP A;  3LLK A;  3TD7 A;  1UFB A;  2B0J A;  3GAN A;  4YL3 A;  3EQL F;  1SR2 A;  4J32 B;  5HV9 A;  1B68 A;  2NUP A;  1OQC A;  3AGT A;  3LUT B;  2VC9 A;  1U89 A;  3EGX A;  2LSE A;  4N4W A;  1O5H A;  2MHR A;  3ASO C;  5T1D B;  1VLT A;  2GFH A;  3A9C A;  3J06 A;  5L0C A;  1EKY A;  4YWQ A;  2YQY A;  2BC5 A;  4M63 A;  1XZP A;  3WHN A;  3ZVR A;  4L6R A;  1ST6 A;  1K04 A;  1QKR A;  3U8P A;  4JW1 A;  4I1M A;  2HSQ A;  3K6B A;  5GPG B;  4XQ1 A;  5FCL A;  3O55 A;  3GM1 A;  2AP3 A;  5DVW A;  4U9E A;  3RIP A;  1RXQ A;  5B3S C;  2LIG A;  3EG9 B;  5L0J A;  1GQA A;  3ZIB A;  3SXZ A;  3HLZ A;  1VMA A;  2ICW G;  4XLP F;  1U0B B;  2G3V A;  4BJT A;  2X51 A;  1ZHT A;  2KSF A;  4PJL A;  3PMR A;  4XPW A;  256B A;  2CYD A;  4H4K C;  4ONS A;  2AWY A;  1ZU4 A;  3IHU A;  3S0X A;  2J8W A;  5AC4 A;  5F28 E;  4PJJ A;  4BJ5 C;  3K7D A;  2KGO A;  2D4U A;  2FFH A;  3JTL O;  2Q00 A;  4XEF A;  3UMK A;  1E83 A;  4JTA B;  1Q0M A;  2KJG A;  3FHD A;  3MLG A;  5L0I A;  3S28 A;  2OOC A;  3RFY A;  1MQV A;  2YEV A;  3O39 A;  2PFD A;  4LLC A;  5DS6 A;  1KTM A;  1VLS A;  4JE9 A;  1PD1 A;  2WL8 A;  3NYM A;  3LES A;  1M56 C;  5A69 A;  1A7V A;  3GM3 A;  1Z7Q c;  4U5E E;  5COG A;  3ZG1 A;  4WGZ A;  5JS5 A;  2R7T A;  2WZF A;  5A6J A;  4LDK A;  3W4Y A;  3FAP B;  1VOM A;  4FAP B;  4CBE A;  1YAR O;  3W8I A;  3ZC4 A;  4YK5 A;  3OWT A;  3RQF A;  4R32 A;  1I5N A;  4YL1 A;  3V5Z A;  4YT8 A;  4PFO A;  2LD6 A;  3IQT A;  1A0B A;  4C3D A;  4NCQ A;  3PCV A;  2VCB A;  3BRJ A;  4IJJ A;  3WAQ A;  3KYI A;  3EG9 A;  2W9Y A;  4IAR A;  3QVY A;  5DLJ A;  4DRJ B;  1Y6D A;  4W8P A;  1WAS A;  5E33 A;  4B6I A;  2J46 A;  4E18 A;  3AG1 C;  2C04 A;  1O87 A;  3C7J A;  4PJN A;  3X1O A;  1GGQ A;  2KNH A;  3IQC A;  3EGX B;  3X2Q C;  1HW2 A;  4XEK A;  2H7V C;  3SXK A;  4G7H F;  1OW6 A;  3NYL A;  4MVS A;  1T9K A;  2IBF A;  3U9M A;  2C03 A;  1AEP A;  3ABL C;  4BEM J;  3JT1 A;  4RBN A;  4XWJ A;  2Z15 A;  2P6V A;  3HNK A;  4CDV A;  5HSW A;  1VYK A;  1LPE A;  5COM A;  4D4N A;  1Q0G A;  2XLE A;  1BBH A;  3DMD A;  4NY3 A;  2ZXP A;  4D4X A;  5A6B D;  3U9J A;  3CSK A;  3PDM P;  2W45 A;  1UG7 A;  2ZXW C;  4YN0 B;  2XLM A;  2R7R A;  1HMO A;  2KW3 C;  2A68 F;  3SP1 A;  3TJ5 A;  3AG3 C;  3JSE O;  3EGD B;  1ZHZ A;  5DQZ A;  3M1C B;  1T6Q A;  5BQI A;  3RW0 A;  2XM4 A;  2WVO A;  2Y3H A;  1MMG A;  1H7I A;  3U3B A;  1FFH A;  4U9D A;  5L3V A;  2OKU A;  2XM0 A;  1G5Z A;  2EIN C;  3JRT A;  3B0U X;  5L0D A;  4ZLD A;  4CS8 C;  3C62 A;  4BG0 A;  1WGW A;  3W2W A;  5L0H A;  1Y4C A;  3GOD A;  2HJ3 A;  4MVU A;  1LS1 A;  2YWA A;  4WAB A;  2WZL A;  2RSE B;  3TOL A;  5T3T A;  2YZS A;  1WTY A;  2PF4 E;  4JUR I;  4CS8 A;  2P7V A;  4AK9 A;  1PV3 A;  2H8A A;  2Y39 A;  3G4X A;  3NMJ A;  4OIR F;  1GM5 A;  3LEO A;  3U5S A;  4OIQ F;  5BUO A;  3NDB B;  4XLN F;  1NU7 D;  4JKV A;  4IGG A;  3ZWI A;  4XPX A;  1TFK B;  4RD9 A;  1BR4 A;  2XS1 A;  1A41 A;  1ZU5 A;  3QMK A;  4FWV A;  4JEA A;  5JP7 A;  3RF3 A;  1RKE A;  4CSA C;  3ABM C;  1WOL A;  1K05 A;  2L6F A;  2LP4 A;  4CIP A;  4EBJ A;  4I44 A;  1JPJ A;  2YLG A;  3AQC A;  4U5G A;  2L9J A;  3S90 A;  3TQO A;  3EZH A;  3T6G B;  2GDC A;  2L6H A;  2ZXO A;  2R9R B;  3DAG A;  3IPM O;  2UUH A;  3U2L A;  1XWJ A;  2BE5 F;  2A0B A;  3FMS A;  3W8H A;  3ZQV A;  5KYX B;  2G3K A;  4MW8 A;  1D0Z A;  4AX2 A;  4NTA A;  3QW1 A;  3S9O A;  4GEH A;  2ZPA A;  4QI0 A;  1NBB A;  4UDV A;  4O79 A;  3FVY A;  3ZTZ A;  4I3M A;  4EHP A;  2YL3 A;  3DJN B;  1TWH A;  4Q5S F;  2Q3T A;  4LDR A;  1YZA A;  3G4Z A;  2H7B A;  1FMW A;  1LM3 B;  5FZT A;  4DRI B;  3JYY A;  4P6I C;  5A6B A;  3AGU A;  1D1C A;  1Z23 A;  2XS8 A;  3N0T A;  4O6Y A;  4Z9H A;  5L3Q A;  1QQ3 A;  3Q6M A;  1TR2 A;  3A11 A;  3KL4 A;  3FAJ A;  2NG1 A;  3EFO B;  3NKD A;  4JRZ A;  2MYS A;  2DYS C;  3RH3 A;  2Y3D A;  1L7C A;  3MFN A;  3K33 A;  2L7A A;  1RJ9 B;  1MMA A;  3JSZ A;  3LLI A;  4E7S A;  3UGP A;  4J30 B;  2IM8 A;  4RDA A;  2A0U A;  3ASN C;  3DI5 A;  1J8Y F;  2HV7 A;  4C7O B;  1V4A A;  5JRA A;  2IXM A;  1JPN A;  1O3U A;  5K0I A;  1EI7 A;  3M79 A;  4DBQ A;  3TUL A;  1ZVZ A;  4IWB A;  4OIO F;  3CEX A;  2XLD A;  2Y3G A;  3TOM A;  2JPU A;  2O9X A;  1HY5 A;  4FX5 A;  3MBG A;  3ABK C;  3F47 A;  1Q0F A;  3IQ5 A;  2L6G A;  3F46 A;  4HFF B;  3RKO F;  2J7P A;  2AVK A;  2TMV P;  2KQ9 A;  2R7S A;  3IEE A;  1FR0 A;  1LI5 A;  4MVZ A;  4DRH B;  4CDY A;  1EQ1 A;  5CI9 A;  3WOD F;  2B0H A;  1YAU O;  1V54 C;  2PP4 A;  2R7V A;  2IXO A;  1TKN A;  3U0C A;  2R05 A;  1M2V A;  3VRC A;  3EH1 A;  1JRA A;  1IZM A;  1IW7 F;  3H65 A;  3HNL A;  5CIV A;  2D5R B;  1S05 A;  3GM2 A;  1HMD A;  4DJ9 A;  2OEX A;  3S27 A;  2LCH A;  4U5H A;  5KYY A;  3POV A;  5AGF A;  4U5D E;  3FOO A;  4Z9I A;  5DS4 A;  1JR8 A;  2A69 F;  2A1D D;  1CPR A;  5DS5 A;  3EJN A;  2OQM A;  3EZI A;  2LQG A;  3DZA A;  4PR9 A;  3MYI A;  4A4A A;  3SXM A;  2FGY A;  3Q7G A;  1EA8 A;  4OD4 A;  1AVO B;  1MMN A;  1LKX A;  4Z9J A;  1T5O A;  2NSG A;  3I5Q A;  4BJ6 C;  1VTM P;  2J9U A;  5KYW A;  3AG2 C;  3DM5 A;  2IOQ A;  4HE8 D;  1HW1 A;  4G78 A;  2OCC C;  1MNE A;  1VK5 A;  3BEH A;  2EPM X;  1SMY F;  1KU2 A;  2F22 A;  3C8G B;  4JJG A;  4W8K A;  1LE4 A;  3HKK A;  3SNH A;  3MYF A;  4EKW A;  2RD9 A;  3ITF A;  1RCP A;  4AL1 A;  3GWN A;  3C8Z A;  1WAT A;  4I1O B;  2Q9C A;  1ORY A;  1A7E A;  4NC3 A;  2WZG A;  2CGE A;  1YYX A;  4DVZ A;  4CSA A;  1DOW A;  1FNT c;  3RYL A;  1TWG A;  2LK4 A;  2M64 A;  3V5Y A;  1ZYR F;  2GAQ A;  5D92 A;  1LIH A;  2P61 A;  1ZW3 A;  3DJU B;  4N6H A;  1FMV A;  1ZZP A;  2QY9 A;  4N06 A;  2DB4 A;  2W4M A;  3HNI A;  2A6H F;  2Q4F A;  1E84 A;  3NKE A;  5F5H A;  1D0X A;  4E7Z A;  1S7Z A;  4LDQ A;  4BJ6 A;  2KYH A;  4F4B A;  4CJG A;  5EGY A;  3T6J A;  1ZHW A;  4BPM A;  4Q7C A;  4FES A;  4YT4 A;  2XLO A;  2NUP B;  4PAC A;  5D91 A;  2XLH A;  5DQT A;  1YA7 O;  4EWC A;  1NLX A;  3EH2 A;  3B71 A;  3EHM A;  1YDI A;  3DKA A;  1L3P A;  4P9F A;  1SZI A;  4JCH A;  5EHH A;  3NG1 A;  5JVE A;  3LNM B;  4AE4 A;  2WVQ A;  1QSP A;  3LAY A;  5CI8 A;  3JYH A;  3U3F A;  2KC3 A;  2FAP B;  2QTV A;  3H2V A;  4OD5 A;  3ZTM A;  1T6U A;  3DE8 A;  2WVN A;  2HSB A;  1Z3I X;  2XL8 A;  4MTG A;  1T6I A;  2NUT B;  3T6B A;  2DYR C;  1BR2 A;  4YJW A;  1NFO A;  4PFP A;  3VYW A;  2QE9 A;  1G8X A;  4DOZ A;  5KYU B;  2J9B A;  4CS7 A;  2A6E F;  2OEV A;  4X0R A;  4JVS A;  4CS9 A;  3UGO A;  4MVO A;  3L0I A;  3S84 A;  1DOV A;  2Q7R A;  4Q4Z F;  4NTF A;  4PJM A;  3RVZ A;  1E86 A;  4U5C E;  2Q9A A;  3O10 A;  1MMD A;  2HV6 A;  4MVM A;  4G7Z F;  1OCO C;  3ZSU A;  1H9G A;  2VCA A;  1TFO B;  3H2U A;  3DD7 A;  1LI7 A;  3R7C A;  2Q9B A;  2J0W A;  1Z5Z A;  2J7P D;  2CCY A;  3W2V A;  3DE9 A;  2NPU A;  4KNW A;  1YJG A;  4MTO A;  4YT5 A;  3QTH A;  1H9T A;  4MTF A;  2XLW A;  5B1A C;  2OU6 A;  2YLD A;  2HMZ A;  2R7Q A;  4P9T A;  2OJE D;  3E9V A;  3RQE A;  4IRU A;  3B29 A;  4C7O A;  4EBK A;  2R7O A;  3KYJ A;  3MX3 A;  1R4T A;  2NSF A;  1OXK A;  2YL1 A;  1OW7 A;  2OJQ A;  1SYQ A;  4JEB A;  4MVR A;  2YLI A;  5E3A A;  1NSG B;  1OR2 A;  2HFI A;  2QUP A;  2R02 A;  4HFK B;  4J7Y A;  5T3W A;  4KC9 A;  3C63 A;  3RQG A;  3U2M A;  3U8V A;  4CS9 C;  1Z6A A;  1M57 C;  4HEA J;  1ZHX A;  2VCC A;  3US6 A;  2XL6 A;  3LEV A;  4XPY A;  2L81 A;  4JIO A;  2EIK C;  2YVK A;  4QI2 A;  4YT2 A;  3N24 A;  3GEH A;  2ZD9 A;  2HZ8 A;  2J9V A;  1HE1 A;  3OEO A;  3CQZ A;  4K0D A;  5TJ5 E;  4C3E A;  3KPH A;  3ECS A;  3IQ6 A;  3V7O A;  4JJF A;  2VAS A;  4EBB A;  1A7D A;  1E85 A;  1YYJ A;  2IXN A;  2ETS A;  4LER A;  4AL0 A;  2HUJ A;  3SXY A;  1OKK D;  1JOG A;  4BJ1 A;  4CIH A;  5A6A A;  2EIL C;  3ATP A;  2EIJ C;  2QNL A;  3DAF A;  2XLV A;  3GEI A;  2R7W A; 
#chains in the Genus database with same CATH homology
 1LE4 A;  1AEP A;  1GS9 A;  1NFO A;  1OR3 A;  1YA9 A;  1BZ4 A;  1B68 A;  2KC3 A;  3S84 A;  1EA8 A;  1LS4 A;  3R2P A;  1EQ1 A;  1H7I A;  1LPE A;  1LE2 A;  1OR2 A;  1NFN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...